3LCOA

Inhibitor bound to a dfg-out structure of the kinase domain of csf-1r
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
293
Chain Sequence
KIIEFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVRLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Structure-based drug design enables conversion of a DFG-in binding CSF-1R kinase inhibitor to a DFG-out binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 293
sequence length 319
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lcoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lcoA01
3IW5A 5HVYA 1ZYJA 4LL5A 1JSUA 3MVHA 2XB7A 5E8XA 2YM7A 4GS6A 5GIPE 3LM0A 3E8DA 3MV5A 3MIAA 4ZXTA 4BTMA 3NEWA 2X8DA 4DYMA 1OPKA 2O65A 4O2PA 4TW9A 5ANKA 5IISA 4PL5A 2CNUA 2J2IB 4LOPA 4E1ZA 5I9VA 3L9MA 4Y5HA 4BY9E 3P08A 4U0IA 4P4CA 1GZOA 3P86A 1GAGA 4N6YA 4R78A 3FLSA 3H3CA 3KXZA 2R3MA 3VHKA 3UGCA 3OOGA 4KD1A 4WKQA 1LR4A 3V8TA 4C58A 4EH3A 3QRTA 4XP2A 3QX4A 3NMUF 1BYGA 5FRIA 3ULZA 4DH7A 5HO7A 1YQJA 3HRCA 1PMUA 3RINA 2XS0A 3PJ8A 3TEIA 3VBXA 1W82A 3A62A 4MX9A 3FSKA 2IVVA 5IQEA 5KUPA 5K0XA 4FICA 4UMTA 3NYXA 3DK6A 5CZIA 3UQFA 4U42A 4BN1A 4QMLA 3UG1A 2W7XA 3QRJA 4HVSA 5FTOA 4C34A 5HNBA 2Z2WA 3TV7A 4PMMA 3DBCA 4GG7A 4JAIA 4EONA 3QGYA 3G5DA 3IDPA 4RJ7A 3MY1A 4RQVA 3QQHA 3TT0A 5DEYA 4FTLA 3V5JA 4CSVA 3GFEA 3QHRA 1ZMWA 5K5NA 2R64A 5EOLA 4BTFA 2RF9A 3UG2A 4UMUA 3LM5A 4YHFA 3Q4TA 5L2TA 3F5UA 1SNXA 3IS5A 2Z7LA 2O5KA 3QRIA 3C9WA 3OBGA 1M52A 5CF8A 4RIWA 3BLRA 4M0YA 1NVSA 2XNPA 5DT0A 4KBKA 4QMPA 5HVJA 4IB1A 3PDTA 4IE9A 4TKSA 5D1JA 3S4QA 3HDMA 3N51A 1XH7A 3QCSA 3QD3A 5EQYA 3TV4A 1FMOE 3SAYA 3QL8A 3RPRA 3TV6A 4C61A 4C2WA 2QOFA 4K18A 5E8ZA 2JIIA 3EL8A 4EK6A 3G0EA 1UU7A 4FKOA 3U8WA 4IFCA 4YC8A 4CYIA 3Q3BA 5AX9A 4X2FA 3I60A 3VRYA 4ZSJA 4AQCA 4N6ZA 5DN3A 3Q32A 3BLQA 3ZS5A 4C3PA 3GC0A 1R1WA 4O1PA 4HZRA 4YTHA 4ANOA 3FLNC 3PVWA 5TOZA 5IMEA 4A9TA 1DS5A 2IZUA 2X4ZA 3O96A 1FINA 4E6CA 5EI2A 4DEEA 3CPBA 1IA9A 4CXAA 4LGHA 2WMBA 4QYFA 5IA0A 3CPCA 4YJUA 4YZMA 3FKOA 1JLUE 4H3BA 2DQ7X 2Q83A 2WMRA 5H2UA 2ZB1A 4FKPA 1E9HA 5BX0A 2WOTA 4TY1A 3KA0A 3VQHA 4MQ1A 1MRUA 5KCVA 4GYIA 4WG4A 2ITUA 3R21A 2XP2A 4MAOA 5AP5A 2WQMA 4FNXA 5IA1A 3UOJA 3G51A 1X8BA 2F7XE 4FV7A 3ZUUA 3ID6C 3P0MA 2GTNA 2C5NA 4RVLA 3UNKA 2X6DA 3OFMA 3QQUA 4ANMA 4I22A 4EQMA 4C59A 4W4WA 3II5A 4FT3A 4MYGA 1RQQA 4ID7A 4KKEA 2BVAA 3KULA 4X3FA 4XUFA 5F20A 3P79A 2WTKC 4F6UA 3UBDA 2BZHB 3QLGA 3U4UA 3NNXA 1W8CA 2VTHA 4DC2A 3GU6A 4EUUA 2R5TA 3HRBA 3LMGA 4N70A 2VWWA 2X7FA 3MPMA 3AC5A 3BGPA 5BUEA 3FXWA 4ZS4A 4FV9A 4RQKA 3UMWA 5HX6A 4MF0A 4MBLA 3GB2A 3QQKA 5KZ0A 1V0PA 3E8NA 3ORPA 2GDOA 2UW0A 3FLZA 4NIFB 3EWHA 4YR8A 3CD8A 4TYJA 4Z7HA 3QQJA 4IZAA 4ARKA 5AUZA 4PWNA 4AP7A 2ETRA 3QWKA 5D41A 4E5AX 4IM0A 1MRVA 4IVDA 3U6HA 5AUTA 3FZPA 4R3RA 1M2QA 2UW5A 3FZSA 2IVSA 3I0QA 2NPQA 2VZ6A 3TACA 4MXXA 5B2KA 5CAVA 2Q0NA 3ENHA 4IQ6A 3TUBA 3VUHA 4K77A 1H4LA 5AM7A 4BWPA 4E73A 4JDKA 4F9BA 3GI3A 4EK3A 2G9XA 4CFMA 1YDRE 4TL0A 4HZSA 4Z3VA 5AWMA 4FZFB 2I0EA 3LFFA 4RWKA 3QTUA 4LMUA 5JFSA 2VRXA 1RW8A 3Q96A 4KWPA 1ZWSA 4GJ2A 2G15A 2XNGA 3S00A 3G15A 3RGFA 4XBUA 3KEXA 1LUFA 3MJ1A 4BKZA 4JLCA 1H1PA 4U79A 1Q8TA 4WUNA 3PVUA 4NM7A 2WU7A 5DHJA 4KKHA 3V04A 4BVUA 4EKKA 4LV5A 3QUEA 1KE7A 2C3KA 2A19B 3GC7A 2R3FA 4FNWA 3F7WA 3PVGA 1JOWB 3Q5IA 2R3PA 4UWCA 5AP3A 5EYCA 3ROYA 3OHTA 4XG6A 3U51A 3ZDUA 3SKCA 4DGOA 3KXXA 4DH1A 3Q52A 3TNQB 4YMJA 5DLSA 4WNKA 5M08A 3BKBA 5L2SA 4YP8A 3CGOA 2F49A 4FSWA 3KXHA 2IW9A 1ZYCA 5KNJA 1OBGA 4EHVA 4F6WA 3NWWA 3HMIA 4QP1A 2GNHA 3DBQA 2B54A 5HBEA 2IW8A 4I4EA 2B9FA 3FI3A 4IXPA 3A8WA 3VW6A 3ZH8A 4QTDA 3OW4A 3COMA 3ITZA 1OITA 3R1YA 3OCBA 1FVVA 3ZLWA 3KMUA 4IADA 3TKHA 3PPZA 2A1AB 5C8KA 5HZNA 4OAVB 4G16A 5IQBA 4RGJA 1H07A 3HMOA 4XLVA 3UDBA 2W1FA 4F0FA 4WRSA 2OU7A 4QMUA 5AADA 4MF1A 1YOMA 4FG7A 2Z60A 5E8UA 5I9WA 1J7UA 4B8LA 3AC3A 4PQNA 4X0MA 4HPTE 1OL7A 4KABA 3FC1X 5C01A 3ORMA 3GU4A 2C0TA 3FPMA 3AOXA 4FOBA 4O7LA 2W9ZB 4RFMA 3R8MA 2XK4A 3QRKA 3RK5A 2HELA 1IR3A 5LJJA 3F82A 4I3ZA 4J53A 2V22A 2B0QA 3A8XA 5E8TA 4R5SA 5EW8A 5HCXA 3GQLA 3ZUTA 3NVKI 2VX0A 4R7HA 4FV3A 5EDPA 3R22A 1EH4A 1U4DA 3HMNA 3ZYAA 2Y4IB 5CEKA 4O0SA 1FVTA 4FV1A 4YJSA 3C7QA 3WZEA 4FKQA 3OF0A 5DH3A 4C37A 4A4OA 3P7CA 5ACKA 3DBFA 3DOGA 3LE6A 3P5KA 4LRJA 1PMEA 1M2PA 4NU1A 2XNNA 2PK9A 3A99A 3ZMMA 4FL2A 5AR7A 5A4CA 5ETCA 2J0JA 1XBAA 5GHVA 3T3UA 2ZDTA 2QR8A 2QKWB 2YDIA 3AGLA 4GEOA 4G6LA 4GMYA 4XHKB 2QG7A 1PXMA 3PE1A 3H30A 3LXLA 4FE2A 5JFXA 4ZTLA 4DEIA 5AAEA 4FTUA 5E1EA 4B6LA 3LLTA 3KXNA 4QPSA 3VWAA 2XA4A 3UIMA 4FT5A 1XBBA 3Q4UA 4KIQA 1HCKA 2W05A 3KKVA 2FSTX 3ODYX 4OBOA 3DV3A 2C3IB 4XP0A 1P14A 4EOOA 1LPUA 1PMVA 5AUUA 3JY9A 5AP7A 2XNOA 4O6EA 2R7BA 2VN9A 3FMDA 2FSOX 4WUAA 5FP5A 3MSSA 4JR3A 4M69B 5T6KA 4IX5A 4D28A 2QU6A 4OTDA 4C2VA 1A9UA 3PVBA 5CWZA 1Y91A 3BLHA 1PXIA 2UW6A 2XNBA 4NM5A 5KMMA 2IPXA 3UZRA 1YXTA 2BUJA 3PPJA 4AU8A 1YW2A 3LCDA 4WA9A 5AR4A 3LCKA 5EI8A 3W2QA 4BCMA 4CFVA 5FP6A 3BELA 2WELA 4QTBA 4II5A 4UXLA 5J1WA 5CANA 3MFSA 3DTCA 3EN5A 3HNGA 2YDJA 4FUXA 2W1CA 4E5WA 4EZ5A 4AG8A 4AF3A 5BVFA 2CKOA 1PY5A 3U54A 5CENA 1AQ1A 4CFXA 2GHLA 2AC5A 5KZIA 4AWIA 1M14A 2E9PA 2WQEA 4C3FA 5KMLA 3R8ZA 4CMTA 2QODA 2HWPA 2IZTA 2KTYA 1ZOEA 2C0IA 1Q8YA 4QMSA 5AR2A 4BRXA 4I4FA 4FK6A 1NVRA 2J4ZA 4QPMA 1GZ8A 4J96A 3C0HA 1UV5A 2VX1A 3QXPA 2Z8CA 4RLLA 3EN6A 5EYDA 4HYSA 1YI6A 3R8LA 3FLYA 3PRIA 5J8IA 2W1DA 5JKGA 3PJ2A 2JFLA 3ZLXA 3A7FA 3UPZA 1B38A 2C6TA 2Z7QA 4O6LA 3UC4A 2HK5A 4UB7A 3UE4A 1BI7A 4UX9A 3KRWA 4P90A 2UW8A 3R71A 5AX3A 5AEPA 5JZJA 2BROA 3LW0A 2GS2A 5J9ZA 4ZSLA 4L53A 4BDBA 2PL0A 3Q5ZA 5CI6A 3UNZA 4IX6A 1H8FA 2CLQA 3LPBA 3WF8A 2C6DA 4TZRA 2R3NA 3HA6A 4H1JA 2FB8A 1FVRA 2P55A 4JBQA 4FBXA 5AV4A 3VBTA 1F5QA 3BZ3A 4FC0A 4P7EA 2B55A 3RM6A 1OBDA 4GKIA 1S9IA 3BHHA 3MIYA 4GT4A 4IBMA 4JOAA 4QMVA 5IZFA 4F0IA 5D12A 3ORNA 4NKAA 2QURA 4S32A 1KOAA 1QL6A 1IA8A 4UN0C 4L8MA 4NL0A 3BE9A 4BI1A 1PXOA 4MBJA 4AZEA 3CLYA 2OGVA 4QRCA 5HEZA 5KO1A 3ZZEA 4JG6A 3R28A 4XG7A 5G1XA 5LVMA 4RJ4A 4O7NA 3EZVA 4ERKA 2CN8A 3DKCA 1YHVA 2ZM3A 4ACHA 3GCQA 4I5HA 2NO3A 3TXOA 3SX9A 2P4IA 1P4FA 2VTLA 2NNWB 4V0GA 4ITIA 4OLIA 3EQBA 3AG9A 4X3FC 3C4ZA 3KRXA 1ZXEA 4PUZA 5IEXA 4L43A 1URWA 3RK9A 4YJOA 5CSVA 3CJGA 3WILA 1WBVA 4QMMA 3MH2A 3UVPA 4C4GA 3QQLA 2XKEA 1DI8A 2JD5A 2PMNX 3PXQA 2WPAA 5J7HA 2VD5A 2OXDA 1JSVA 5EDQA 5CNNA 4DFZE 3LQ3A 4EEVA 5GJFA 2VO6A 3RWQA 3QFVA 4U7ZA 4BCOA 3EQPA 4XH6A 2GU8A 4MCVA 4GVJA 4EBVA 4IMYA 2O63A 3MA6A 3QXOA 4ZS0A 3VBVA 4BDGA 2P0CA 4IC8A 4FT9A 4BCPA 5JGAA 2YN8A 4L7SA 4KUJA 3HMMA 4YC3A 2PUIA 1KUTA 4A9YA 2WXVA 1IASA 4ZAUA 4U97A 4AT3A 2VTMA 5EHOA 4AN9A 4F1TA 3AC1A 5IH6A 4IANA 3G9NA 4L3PA 4I6QA 3UO5A 3PG3A 5AR8A 3GU5A 2HYYA 4AA5A 2ZDUA 2ZVAA 3PXYA 3DDPA 4IZYA 3VIDA 2W96B 2REIA 1J91A 3OTUA 5AUYA 4J1RA 3RZBA 1URCA 1OKZA 4GG5A 2QO7A 4GFMA 1A48A 3KFAA 3BQRA 2IJMA 2PE2A 4D0XA 4U45A 4YTFA 4HCVA 4EHGA 5JK3A 2DWBA 3NNWA 3VBYA 4EHEA 1AD5A 2BZJA 2IO6A 4MQ2A 3RKBA 4IAZA 4ZJVA 3P9JA 5AAFA 3THBA 5I9ZA 1OUKA 4WSQA 3D0EA 3NNVA 3UVQA 4L3LA 5CEMA 4Q5EA 4NFNA 5EH0A 4TPTA 5B2MA 2G2IA 3FUPA 4DCEA 4R7IA 3LMHA 5IH4A 2X7OA 3DKOA 5H9BA 4OTFA 5AP4A 2CMWA 3DBDA 3QTZA 4JBPA 5TE0A 3UZPA 5AUXA 2QU5A 4DBXA 5JN2A 3GCSA 2HZIA 2C5YA 3LOKA 1T46A 3ZEPA 5KMNA 4D9UA 1Q61A 5FGKA 3QTXA 2V62A 4OTRA 3KU2A 2WIPA 5CXZA 3AC8A 4QP7A 2VTRA 4JNWA 4AGDA 4JIAA 3QTWA 2CKPA 3F5PA 4ZJJA 2XEYA 4FZAB 2FGIA 2IW6A 4UXQA 5J95A 3VS3A 5AP2A 4ZTMA 1KSWA 3RNYA 4LG4A 2YZAA 1I09A 1XJDA 5EW9A 5IQAA 4HCTA 4CLJA 1J3HA 4FTCA 3V5PA 1J1BA 3EN4A 4R77A 1QPEA 2OXYA 1WBTA 5AMNA 5FDPA 2X2MA 3FQHA 3FSFA 3R00A 5I3RA 4RT7A 3EQFA 4L46A 2GS7A 1U46A 3SHEA 3DAKA 2RIOA 3LFAA 4FYNA 4C3RA 3CY3A 2VWZA 1SVGA 2XJ0A 4DGNA 3D7TA 4DG3E 4L3JA 5IPJA 3V51A 4EQCA 4YJVA 1DAYA 1YXXA 4IFGA 4ALWA 5ETIA 3E63A 3WIKA 4QTEA 2BRHA 4H39A 4Y46A 4S33A 4FIEA 3GCPA 2XYUA 4WG3A 1PKDA 3V5QA 3NYOA 1JNKA 2WTIA 1Q8ZA 3JVRA 4XCUA 5GIOE 3ULIA 3SA0A 1VJYA 2GMXA 3COIA 4L6QA 4LUEA 3DA6A 3HUBA 3EQIA 5T3QA 5LMKC 4QMYA 4ZOGA 3LXNA 4D1XA 5HE2A 4YSJA 4IWDA 5CU6A 5CVFA 4ANSA 2PULA 5B2LA 4FTJA 2VTNA 4F09A 4RX9A 3DU8A 1Q4LA 4YHJA 5CQWA 4YJRA 5DMZA 2F7ZE 2BDWA 5M51A 4O86A 3MESA 2WB8A 4L01A 3W2PA 3HUCA 2JDRA 3FHIA 3UZTA 1PYEA 3HV4A 4FTOA 4FV0A 3TTIA 3OT8A 3VS4A 1PXJA 4L42A 5AR3A 4BTJA 4E6AA 5LVOA 1QPJA 3RZFA 2PUPA 1H1SA 4EYMA 1XH8A 5D9HA 2EXEA 3SD0A 5HIEA 3FHRA 3FQEA 4J95A 4MXCA 4FIJA 3PXFA 4OTPA 1H08A 3PP1A 3I5NA 3D5WA 4FTNA 4GFOA 4IWPA 4W8DA 4QQCA 5HG7A 2GNFA 3JYAA 4R3CA 2PZPA 1BMKA 2PVRA 4D9TA 4JQEA 2PWLA 1M2RA 3NS9A 3O50A 3D14A 3FMMA 2QCSA 4BF2A 2VWYA 3DGKA 3VN9A 3LFCA 2C68A 1NA7A 3RHKA 3H9RA 4QMZA 4I6BA 3PG1A 3CJFA 3BGZA 3M1SA 3W16A 5TO8A 3WOWA 4EZ7A 1L8TA 3ET7A 2EXCX 3IECA 1G8AA 2Y4PA 4PP7A 1W84A 4EBWA 4CQEA 1MQBA 4RJ6A 4I93A 4FKLA 2VO3A 3R1NA 4NIFA 4F1OA 5FTGA 4L52A 3LIJA 5DRBA 2EWAA 2FUMA 3NVMB 4CFWA 2HZ4A 4FIIA 2IVTA 2WOUA 1JKKA 3NYNA 3QUDA 5HX8A 4KIOA 4EOLA 2JKKA 3EFKA 2QOIA 4EORA 3OCTA 5F95A 3MPTA 4FL1A 5L2QA 4EH6A 1TKIA 3OBJA 5A4TA 5KMKA 2QO2A 2J51A 5HG8A 4DBNA 5IMXA 3QA8A 4ZMEA 3UYTA 4O21A 4G5PA 3CXWA 1ZOGA 3DKFA 1SVEA 2QNJA 5HCYA 5DG5A 5HTIA 4TN6A 3Q2MA 4PF4A 5LVLA 1K3AA 1WAKA 2JDSA 1BUHA 2JGZA 1H26A 5HBHA 4UY9A 4FSTA 4LYNA 2BRBA 3CD3A 3EHAA 4ORKA 1YXUA 4DTBA 4X2KA 3R8UA 4HPUE 4KIKB 2JIUA 1REKA 3R7VA 3AD6A 4Q9SA 4XV2A 4QNYA 5DBXA 3CR0A 3OC1A 4A4LA 4CV8A 3BBTB 3N4VA 4NM0A 3R02A 4I0RA 4O0YA 5IQIA 1BKXA 3VBQA 3AGMA 4F4PA 4RWIA 1TVOA 4PTGA 4JDIA 4QP4A 2R3RA 3V6SA 4NTTA 3V6RA 4LOOA 4JG7A 3CS9A 3NUPA 3BU5A 4MH7A 3W18A 3PJ3A 4EC9A 2XCKA 2XIZA 3BPRA 4OT5A 3OP5A 1RJBA 4IM3A 1JSTA 3PFQA 3QTQA 3TZMA 4F70A 3G0FA 3E62A 2C69A 4EOIA 3QRUA 5B7VA 4UZHA 4ZLOA 3VAPA 3DNEA 2J0KA 4OT6A 3MYGA 5IKWA 4QYHA 3Q60A 2BIKB 3JY0A 3SG9A 4G3CA 2PE1A 2JIVA 4RZWA 2IN6A 2X9FA 4I6FA 3COKA 4G31A 2V7OA 4BDJA 1QPCA 2YCSA 3RCDA 1WMKA 5HG5A 3UOLA 3D5VA 3NUNA 4NW6A 2OSCA 1WCCA 4I23A 4LUDA 3TIZA 4FTAA 3EQHA 4F7LA 3K2LA 3NX8A 3HYHA 4YGAA 1JKTA 4ENYA 5FEDA 4AGWA 4BCFA 4DTAA 1Y8YA 2J0LA 2WTWA 3SG8A 4FZ7A 4LRMA 5EFQA 2JKOA 2BAQA 2RFNA 3FMNA 2Z02A 1BLXA 2KULA 4UYNA 1M7QA 2RGPA 1Q3DA 3AC4A 2X4FA 3LKMA 1WFCA 2GCDA 3D7ZA 3FKNA 3EOCA 3PJCA 2QQ7A 4QYGA 5ACBC 3W55A 4X2GA 5K9IA 2UZDA 3D2IA 2YEXA 3QD4A 4F9CA 5J5TA 2EB2A 4ZEGA 2X9EA 3QGWA 4CZYB 4PL4A 1XH9A 5KMJA 4RJ5A 5I3OA 4G3GA 5D10A 1QMZA 3REPA 2X2LA 2EU9A 3ORLA 4GK3A 1GIHA 2ZOQA 3T3VA 1SZMA 2OKRA 5C03A 5L8KA 3ZHPC 3ZLYA 2H8HA 4YO6A 5FTQA 3TKUA 4FV5A 4OR5A 2JFMA 5C8MA 5TR6A 4CEGA 3SC1A 2Y6MA 4ONAA 2PVYA 4O96A 1WVXA 2FO0A 2HXLA 2XIRA 4S2ZA 5HLNA 3K5VA 5DVRA 2OZAB 5L6PA 5AUVA 4J97A 2F2UA 3S95A 4FOCA 3WZDA 1FBNA 3G33A 4FSMA 3WF6A 3QZFA 5ANOA 1OECA 3NRMA 1OKVA 1Q24A 4C0TA 3WARA 2PZYA 4ZSAA 3U6JA 2BIYA 3TM0A 3FLQA 4DEHA 5HIDA 3WYYA 3ROCA 4DT9A 3A7HA 2BZKB 1BL7A 2XM9A 3L8PA 3PY1A 5A46A 2UZLA 4BCGA 2FVDA 2UZWE 2BAJA 2RKUA 3ACJA 3LHJA 4DH5A 3FPQA 3TDVA 4USEA 3FZ1A 3RAWA 5AV0A 3D5XA 2YAAA 3GQIA 4V01A 2PVNA 4X2NA 2Q0BA 4GU9A 3GC8A 1ZYDA 2XJ2A 2W1EA 3F3ZA 3O71A 3M11A 1ATPE 4O2ZA 4U6RA 2CKEA 4GL9A 4FNYA 3T8OA 5HE1A 2WQBA 3BCEA 4JRNA 3ALOA 1R0PA 3SXFA 4BDCA 4KRDA 2E2BA 5AP6A 5HO8A 3PXKA 4GUBA 4GSBA 4DGGA 2WTKB 4DH3A 4XJ0A 4QP9A 3ZUVA 1CKIA 3QLFA 1OL1A 4U80A 3R1QA 5ANEA 3DXPA 5DOSA 2PSQA 2RL5A 4V04A 3FYJX 3IKAA 3VNTA 3I6UA 1OKYA 2NP8A 2RG5A 3K3JA 3LFSA 2UZVA 3KRLA 5B0XA 2ONLC 3FZRA 4HNIA 4M7IA 5CU4A 2R9SA 5JQ5A 4IB0A 4QO9A 4ASZA 5K4IA 4QP2A 3TTJA 2W1IA 1OUYA 3D94A 4R8QA 2WTVA 4BI2A 2XBAA 4AZWA 3BHTA 4AE9A 2XIYA 3BE2A 4DN5A 4NCTA 5IA2A 4C4JA 5F1ZA 5FXSA 3BYVA 3C4EA 3HL7A 4ITJA 1LP4A 3R2YA 5BVDA 3S0OA 2XK9A 4AGUA 4DEAA 3QKLA 2YWPA 3GXLA 2I40A 2ZM1A 4F7NA 3GU8A 2GNGA 4DEDA 4IB5A 5E92A 1OIUA 2X81A 4U5JA 2J50A 3LFQA 3I0OA 5M09A 1FPUA 4L7FA 5E8WA 4DGLC 2X2KA 4MTAA 1KE6A 4B8MA 3DK7A 2OIDA 3PXRA 3TI1A 1GIJA 3LFNA 5JH6A 4NJDA 3O7LD 1REJA 5CSXA 3RJCA 3ZRLA 5E7RA 4D58A 3D4QA 3EIDA 3L8VA 4EH2A 3KC3A 5IQDA 4IVAA 4HNFA 5HICA 3TWJA 4C36A 5LOHA 2WAJA 3HP2A 4CFNA 3W2CA 4JX3A 1IRKA 2UVXA 1W98A 2GHMA 2XCHA 2OZOA 1PXPA 4YZ9A 3MB7A 4CYJA 1OL6A 2IWIA 1NT2A 1YKRA 2ITZA 5KHWA 4XRJA 4GVAA 4MD9E 1BI8A 5CAPA 3I81A 2BRMA 5LMAA 4O81A 4WO5A 4J98A 2RFEA 4FV8A 3RK7A 4BKYA 4I0SA 1Y8GA 2OICA 3ZC6A 4O0WA 3VF8A 3LFBA 1B6CB 3NCZA 3Q4ZA 3KN5A 2O2UA 3W10A 4YTCA 5EG3A 3ORIA 4X21A 3JVSA 3NW5A 3IW8A 4LMNA 4RC3A 2WMQA 5F94A 5HD7A 3VQUA 3HDNA 1TQMA 3DKGA 4KRCA 4C4EA 3BV2A 5CQUA 4BBEA 4QQJA 4W4XA 4I20A 3JXWA 4O22A 4MNEB 4BYIA 4CV9A 4Q2AA 4PMPA 3CKWA 3F3UA 3A4OX 4QMOA 1VR2A 4BHZA 3S2PA 4ENXA 2W4JA 4FZDB 4IVCA 2YM5A 4YLKA 1Q8UA 1YWNA 4AA0A 4CRLA 2H9VA 3ORXA 1H25A 3ALNA 4BR3A 5FQDC 4IJPA 1YOJA 4WHZA 3FI4A 2IG7A 1UNLA 2VGOA 3ZC5A 4N4SA 3L9LA 4GCJA 1IEPA 4GK4A 4TYHA 3V3VA 1OL2A 2BCJA 4M3QA 1O6YA 3FY2A 3LJ2A 4A9RA 2PY3A 2OF2A 4I5PA 3W2SA 4AN2A 4LRKA 4CZUA 4PPBA 4NWMA 4F9YA 4ZLYA 3MWUA 4O83A 3TZ7A 3SXRA 2J6MA 5ANDA 5AIRA 5EK7A 3K54A 2ITQA 2WMUA 5BVEA 4AZSA 2P33A 3QC4A 5LQFA 4C4FA 3MVMA 2QI8A 4FYOA 1ZMUA 2GTMA 4I94A 4IAYA 5KHXA 3O8PA 5DI1A 5BMSA 1U5RA 2X0GA 2BKZA 4LM5A 4FGRA 4UZDA 4R1YA 3RTPA 2J5EA 4F6SA 1XHAA 5EQEA 4KAOA 4YC6A 3C13A 2B9IA 4BIDA 4ZTQA 1PRYA 3E93A 1KOBA 3QUPA 2YAKA 3QZGA 4NYEA 2R3QA 1PKGA 3W32A 1OZ1A 4G9CA 4ZK5A 3FAAA 4Z9LA 2ITNA 4H36A 1UU8A 5JMSA 3Q04A 3SVVA 4Y73A 1PXKA 3DCVA 3VRZA 3EQDA 4CLIA 3AQVA 5DEWA 2BZIB 2HW7A 2HY81 4L9IA 4XOYA 5AV2A 4MWIA 4D1SA 4ZY4A 3MDYA 2ZV7A 1Q62A 4PDYA 3MY0A 4JJRA 3D83A 4UBAA 4D2RA 1U5QA 4AW5A 4DG2E 2C30A 4J8MA 3R9DA 2CJMA 3MVLA 2J9MA 3DXNA 2RSVA 2ITVA 3UJGA 5IEVA 5JFVA 1XWSA 1ERKA 3BHYA 5BYLA 3L9PA 5DRDA 4ANLA 1O6KA 5IQHA 3IONA 4JBVA 4DLJA 3UOKA 3D5UA 4UMRA 5A6OA 3EH9A 3HX4A 2WZJA 1GY3A 4YPSA 3R2BA 2VX3A 3R7IA 4K6ZA 2GNJA 3GC9A 4LI5A 5A4EA 5ETAA 4S31A 4WIHA 4ACMA 4CT1A 4QMQA 3RBWA 3VULA 2B53A 3JR1A 5CF4A 2XM8A 3NCGA 2HCKA 4K8AA 4CT2A 2H96A 4DGMA 3QF9A 5L4QA 2R3OA 3DBEA 5H8GA 4IVBA 4W9XA 3KGAA 2YFXA 4JDJA 4FKWA 4GKHA 3I7BA 3L8SA 3R83A 2R3JA 3G6HA 1G5SA 3UNJA 4B7TA 2PU8A 4XV1A 4K1BA 3E87A 2XK7A 1LEZA 2HENA 4QQ5A 3TUDA 3GFWA 1Q3WA 4A06A 1OB3A 3HMPA 3PIYA 3IW7A 4ZZOA 1YOLA 4YUQA 4CMOA 4WD5A 3EQGA 3FJQE 4JQ8A 1P2AA 5FDXA 3C4CA 2BHEA 5CSPA 3RPVA 4YJPA 5CNOA 2PZ5A 4USFA 3FMKA 5DR2A 2QO9A 3DS6A 4RZVA 4RRVA 4MVFA 2AYPA 2WIHA 3SOCA 5LARA 5M57A 3R1SA 3HRFA 2P2HA 3MA3A 3Q4CA 3UC3A 1UWJA 3H4JA 2CSNA 3NIEA 4G6OA 2WMWA 4F63A 5D7AA 5JT2A 3CBLA 4AA4A 3AD4A 3FL4A 3NUSA 4O7SA 1R3CA 5HNGA 3GEQA 3IDCA 4E6QA 2VUWA 5IA3A 4AFEA 1W83A 5EM5A 1ZYSA 2C6KA 2V7AA 4KS8A 5FM2A 2YLFA 2R3HA 3NZ0A 4FEQA 4LGDA 3CSVA 2ETMA 4D2WA 2C4GA 4TRLA 4AZFA 2ESMA 3P7BA 2GQRA 4JAJA 2IZSA 3KULB 4X3FB 3CC6A 4PY1A 4BWKA 4P5QA 4RIXB 3ATSA 3NUXA 1NXKA 3PY3A 4CMUA 1PJKA 2W5AA 3ZBFA 4D2VA 5DWRA 4CKIA 4YTIA 5LCKA 2WHBA 3W2OA 2GQGA 5J5SA 4IAFA 5IDNA 3FXZA 4BYJA 3H0YA 4EOKA 2YIRA 2JBPA 4AGCA 3NUAA 2BRGA 2WO6A 3TN8A 3BHVA 3V01A 5IUIA 5M44A 4H58A 3I7CA 3KQ7A 1KE8A 5H8BA 5DFPA 4CNHA 2BFYA 3LCOA 2FH9A 4EK5A 2HW6A 5A14A 4EH9A 4FSRA 3UYSA 2F2CB 4NT4A 3RM7A 3KF4A 4HCUA 3FZOA 3F2AA 3CCNA 2I7QA 4EOMA 4F9AA 1OI9A 3VS0A 4Z7GA 2JC6A 3U4WA 5GJGA 3FLWA 5KMIA 4RFZA 2VNWA 4CTBA 3JUHA 1J7IA 4HGLA 3D15A 4CG8A 5JFWA 1G8SA 1MP8A 3DNDA 4A9SA 2FSLX 3FXXA 4BZNA 1OGUA 4UWYA 3VHEA 1NW1A 2QOQA 3HV5A 4OTIA 3IPHA 3FKLA 1WVWA 4E3CA 3OXTA 2BDJA 3RAHA 1GZNA 3LJ0A 4KIPA 4BDAA 3R7YA 4O82A 1YWVA 4BIBA 3QYWA 2I0HA 4DFUA 5KKRC 3KMMA 5EOBA 3QBNA 3ERKA 5L8LA 3K3IA 3P7AA 4I21A 4KBAA 4BDDA 4YJNA 2ZB0A 3B2WA 4IEBA 3IDBA 1MQ4A 5D11A 4MXYA 5HU9A 1JWHA 3VS7A 2V5QA 5E9EA 4M13A 2NRUA 5LMBA 3ZO3A 4D0WA 2O3PA 2J90A 2PE0A 3OVVA 4M84A 5CU3A 3W1FA 4BIEA 4D4VA 3OMVA 2XNEA 1DAWA 3PYYA 4RWJA 5HHWA 3UOHA 4WBBB 3ACKA 3F6XA 1TQIA 3QU0A 3O51A 4I5CA 1P5EA 2IZRA 4D2TA 4YLLA 4RVTA 4XLIA 3DZQA 4FIHA 4L00A 2JAVA 4EKLA 2A4LA 2CNQA 2G2HA 4FSUA 5DNRA 5EHYA 2YACA 1ZAOA 2J5FA 3MFUA 3TNHA 5BUIA 4K0YA 2C5VA 4OTWA 4EJNA 5CAQA 3KVWA 3TJDA 5HTCA 5DR6A 4DEGA 2YHVA 3RPOA 4CZTA 2UVYA 2WMXA 4WNOA 2OJFE 3E7VA 5I4NA 4O7WA 4WNMA 2YIQA 1WZYA 4X2JA 3SQQA 2YIXA 3PRFA 3ZLSA 2ETKA 5CY3A 3OT3A 3Q9ZA 4IW0A 3ATTA 5L2IA 4X7QA 3FL5A 4XRLA 3SRVB 2BHHA 4FKJA 4GRBA 5IA4A 2XRUA 3ZXZA 3OROA 3DJ7A 3WE8A 5IG1A 5BVWA 5K4JA 3R30A 3Q53A 3G9LX 4GT5A 4XBRA 4ZZMA 2YZLA 4JG8A 2SRCA 3LFDA 1M7NA 2OZAA 3MH0A 2JAMA 3MS9A 4LQMA 3PIXA 1MUOA 1T45A 3EFJA 2PVJA 4APCA 5I9YA 1Q5KA 4KB8A 5M55A 1OMWA 3NR9A 3V8SA 2X1NA 2W1ZA 3WZUA 4JI9A 3OCGA 1FGIA 4K2RA 4U43A 3EZRA 3OOMA 4ACCA 4D5HA 2A27A 2I6LA 4FMQA 4EK4A 4IC7A 3CTQA 3MTFA 3C4FA 4FTMA 3DDQA 3RHXA 2XKFA 2B4SB 2R7IA 3COHA 4WT6A 1Q8WA 2JITA 2QHNA 3ZFXA 4D1ZA 4D4SA 5HIBA 1YWRA 2W06A 3I6WA 4KSQA 2YM3A 4PMTA 5FLFA 3I79A 3A61A 4S30A 3CTJA 4JXFA 5I0BA 5CSHA 3B8QA 1VYWA 2EXMA 1GNGA 3GT8A 3OG7A 2OFVA 2W5HA 4EOQA 4UMPA 5GZAA 1YDSE 4RA5A 5GINE 3PIZA 4FV6A 2YITA 3HEGA 1Z5MA 3HGKA 4U3YA 5AV1A 3R7OA 5FXRA 2C1BA 3QZIA 5CEQA 2YM8A 3BWJA 4XYFA 2ZMCA 5IH5A 2XYNA 2A0CX 3FMJA 3VUMA 4UALA 1VYZA 4XS2A 4EH7A 5AA9A 2ERKA 3K5UA 4BDHA 2NRYA 4ASDA 3JS2A 3IGOA 3D9VA 4QQTA 3GCUA 3C4XA 3EQCA 1ZYLA 3N4UA 2O64A 4AZVA 2OWBA 4PRJA 2EB3A 5JRQA 3MH1A 1ZARA 2BKKA 3C1XA 1U54B 3QKKA 1S9JA 4MWHA 5IA5A 3QX2A 3PUPA 4NKSA 4A4XA 2WFYA 5BVKA 4MHAA 4BL1A 1H1RA 4MXOA 3QTRA 3Q2JA 3MI9A 4ZTNA 4I41A 4U9AA 5IQFA 4DTKA 3EFWA 4P2KA 4OTGA 4A9UA 4IH8A 3UIXA 5JQ8A 2DS1A 4RX8A 3E88A 3PTGA 4ZTRA 3ZSGA 4EH4A 5GZ9A 4FL3A 3HV7A 3IO7A 4FG8A 1A06A 4J8NA 5H3QA 4BCJA 3NW6A 2GFCA 4E6DA 4E4XA 1H00A 2OK1A 5FBNC 4HYUA 4EH5A 1O9UA 3ELJA 3F88A 3TIYA 4F65A 5IDPA 4J99A 4NZWB 3C50A 4RPVA 4FKGA 4UV0A 2PVMA 3CY2A 5HO6A 3PWYA 2R3KA 4LV8A 3F7ZA 5AR5A 5E8SA 4ZSGA 1AGWA 5C4LA 5A3XA 2W99B 2FYSA 1IAJA 1SNUA 1ZZLA 4PNIA 5CU2A 4A7CA 4AOIA 3KL8A 3L9NA 4HOKA 4FR4A 3PA4A 3BQCA 1ZRZA 2PHKA 4IDVA 4O7VA 1F0QA 2YCFA 4Z55A 1R0EA 2AUHA 1KWPA 3ORZA 3QTSA 4FIGA 3FC2A 4GK2A 5DT3A 5AP0A 2B52A 3EYGA 4YZBA 5J87A 5LVPA 5HKMA 3LXKA 2OG8A 2YA9A 4H3QA 3KRRA 4P5ZA 5CYIA 4AW2A 3SW4A 2QONA 3ZDIA 3ZO4A 2CLXA 4PDSA 4YJTA 2J0MB 2WTJA 4C35A 5L8JA 4CGAA 2QG5A 4EYJA 4FEVA 3WF5A 3CQUA 3GGFA 4G9RA 4QPAA 2YDKA 4BDFA 1DM2A 4CVAA 1UA2A 4Y83A 5CI7A 3F2NA 3BU6A 1OVEA 1STCE 5EDRA 3LQ5A 3QD2B 1WBWA 3OEFX 3M42A 2WQNA 3A60A 2DUVA 3MPAA 3NDMA 3FE3A 3PWDA 2R4BA 4MNEA 3JPVA 3GUBA 2R0UA 2I0YA 5LCJA 4DFNA 5IUHA 4IZ5A 4OBQA 3RPSA 5L3AA 3U55A 1H1WA 3HAMA 3LCTA 2OJIA 3E8CA 3OTVA 3SV0A 4ACDA 1JAMA 2BRNA 3EL7A 3HZTA 4FIFA 4O0XA 3PY0A 3OCSA 1YXVA 3P78A 3R7UA 5EKNA 3NYVA 1FOTA 4YNOA 4O7YA 4JVGA 1HCLA 4FKUA 5HI2A 4UYAA 3VUKA 4O38A 3RAKA 4I5MA 3WZJA 5HQ0A 1LEWA 2GNIA 4RJ8A 4E93A 5BNJA 1UWHA 4IAKA 4RA4A 4I6HA 3OXZA 4CFUA 4TYIA 5BVNA 1PXNA 4IM2A 5C1QB 3GBZA 5KBRA 1KE5A 3W2RA 3ZFYA 3UPXA 3LXPA 4IX3A 4DF3A 4DT8A 2Z7RA 5C8NA 4NJ3A 4PL3A 5FUTA 1H27A 4RC2A 5EM6A 3UMXA 4F0GA 1PF8A 2UV2A 4L44A 4G6NA 2AC3A 3KF7A 3TCPA 5EW3A 4U8ZA 3MVJA 3R9RA 3R9OA 4F7SA 3RWPA 2C6IA 1XQZA 1XBCA 3ANQA 4C38A 3LVPA 4NEUA 5IQCA 2QR7A 3UODA 1YHSA 2VTOA 2J0IA 1WBPA 4IB3A 2UVZA 5HVKA 4TYGA 4EUTA 3DB6A 4U44A 5JEBA 3E3BX 3T9IA 2ZM4A 3FMHA 3UIBA 3QCQA 5C9CA 2JDOA 3N9XA 5CXHA 3AD5A 3EFLA 4U40A 3TJCA 4E5BA 4CCUA 3FEGA 4DINA 2YWVA 4HVIA 4CD0A 1XH5A 3KCKA 3EB0A 4D55A 4FV4A 3ZFMA 4QT1A 1UKHA 2UZTA 4FEUA 3FV8A 2OLCA 3D2KA 2YM6A 3UO6A 3TL8A 2C6EA 3I4BA 3GNIB 3U87A 2HY0A 3ENMA 3F69A 2QOBA 3OD6X 4TWOA 2LGCA 4BC6A 5AIKA 1R78A 4QYEA 1J7LA 3F3TA 4QMTA 3LCSA 1CKJA 1O6LA 3F3VA 1JPAA 5E8VA 4AS0A 5A6NA 4ZMFA 2UUEA 4PTCA 2X8EA 2E9NA 2GSFA 2OH0E 1NY3A 2WEIA 2PUUA 3LJ1A 5TF9A 4Q5HA 4AACA 2W0JA 4JQ7A 4M69A 4K11A 4Y8DA 4AE6A 5M07A 2A2AA 3HKOA 2WTCA 3EN7A 4FKIA 5CAUA 2GHGA 2ITOA 3KY2A 4A07A 3QCYA 5DPVA 4M12A 2G01A 4NH1A 3ZZWA 4EOSA 4NK9A 3IQ7A 3W8QA 2OBJA 3O7LB 4FT7A 3RP9A 3R7GA 3EKKA 4XMOA 4OGRA 2OIBA 3TUCA 4D2SA 3BI6A 4WRGA 4N57A 2ZJWA 4KKGA 4PPAA 1JBPE 1YHWA 4WG5A 5HU3A 2XK6A 4E20A 5HORA 4BDIA 3QD0A 4G1WA 2X7GA 4DA5A 4OTQA 4RIYB 3D7TB 4XG8A 5CF6A 3A7IA 4HYHA 3LZBA 4YZNA 5C27A 2OH4A 5CAOA 3V8WA 2QOKA 3FY0A 1OPJA 5DIAA 3E64A 4TWCA 4O0RA 4G3DA 2QOCA 3ZBXA 3AT4A 3HECA 5CS6A 4DFYA 1CKPA 3UVRA 1VEBA 1W0XC 5CALA 2WMTA 1YI3A 4FI1A 3KVXA 3P4KA 4XEYA 3QTIA 3AMBA 4M66A 1CDKA 1R39A 2JKMA 4M0ZA 4D4RA 5K3YA 1YVJA 2VWVA 2GQSA 1YXSA 1GOLA 3GOKA 2PVFA 3GU7A 4HGSA 5T68A 4ZZNA 3UIUA 3RVGA 1RDQE 5EHLA 3KK9A 3TZ9A 2BALA 3MW1A 1Y57A 5E8YA 3ZSIA 4YNEA 3G90X 4H3PA 4CTCA 2XH5A 1ZLTA 4EK8A 3RPYA 4YBKA 5CVHA 1FMKA 2CHLA 5J79A 1ND4A 4ZTHA 2ITXA 5FEEA 1Y6BA 3V5TA 4BDEA 2W5BA 2XVDA 3BYOA 3IW4A 4WOVA 3VS6A 3G2FA 1H24A 3B2TA 3OEZA 4OUCA 2C0OA 5DA3A 3W8LA 4E7WA 3DFAA 3ETAA 5HG9A 5FBOA 2R0IA 4YBJA 3EMGA 2C3LA 2QHMA 2OJJA 2Y9QA 3BIZA 3DQWA 4MBIA 4J52A 4U41A 5CEOA 4RIXA 3A7JA 3NNUA 5IUGA 2W4KA 4AZTA 5E4HA 4GIIA 4APPA 4PDPA 3FMEA 4EH8A 3OWLA 1PMNA 2RG6A 1JQHA 4I24A 4ZJIA 5JSMA 4O0TA 5LVNA 5HOAA 3OUKA 2CGVA 3V5LA 2Y8OA 3BRBA 3KXMA 5HTBA 1PXLA 1CMKE 4TWNA 4FK3A 4XG9A 1OIQA 4AAAA 5BYZA 4MXAA 3UQGA 2BFXA 3IK3A 1E1XA 3C0GA 4F9WA 4ZTSA 4MNFA 3ZSHA 3BEGA 4DLIA 4OAUC 3C5IA 2PMIA 2VU3A 4JBOA 3F2RA 4C8BA 1NVQA 4DH8A 4C02A 4WNPA 4G2FA 3DQXA 5I9UA 5TT7A 2XKDA 2CGUA 3BYUA 2PYWA 2VWXA 4M8TA 4KNBA 3Q9WA 4F7JA 4KBCA 5HD4A 2XMYA 4XX9A 4CQGA 3AT2A 2Y6OA 4BKJA 4FSYA 2VTSA 4X6RA 3F66A 4ZLZA 4M67A 5DT4A 4C7TA 3EYHA 4JIKA 4BZOA 3O2MA 5GJDA 4FSZA 5CTPA 1PHKA 2V55A 4USDA 5FM3A 3RNIA 3BEAA 4QTCA 3PZHA 3CQEA 4I0TA 4QMXA 3KREA 4AUAA 1APME 2GFSA 2W9FB 4QMNA 5A54A 5AAGA 3S1HA 5J1VA 1OIRA 3LMIA 4R7BA 2O8YA 1Q97A 3MJ2A 1SYKA 3RI1A 4EJ7A 4IDTA 3UO4A 4IIRA 4EZ3A 4HVHA 2QOLA 3W33A 1K9AA 3VBWA 2B7AA 3BX5A 3BYSA 3FWQA 4FEWA 3MFTA 4CCBA 5E91A 3VUIA 2PZIA 4IAIA 4W4VA 2CNVA 3Q9XA 2CCIA 3R8VA 2P2IA 3DFCB 4AN3A 4TTHB 3VUTA 3ZU7A 4J7BA 5CT7A 4CRSA 2XUUA 5AFVA 4HYIA 4PMSA 1GIIA 2YABA 2WQOA 2JLDA 2FSMX 3G6GA 5LWNA 1PW2A 4X6QC 4HVGA 5AUWA 5D7VA 4ZIMA 3IOPA 3CP9A 4J71A 2UW4A 2UZNA 3PZEA 3SOAA 4IX4A 5CU0A 2JDTA 2VV9A 3HP5A 2IVUA 4F64A 5GNKA 3EN9A 2UW3A 2VTTA 2G1TA 4ASEA 5BYYA 4QNAA 4N0SA 1U59A 4R6VA 3PP0A 3BU3A 1HOWA 3DPKA 3FDNA 4MEDA 3IG7A 2PVHA 4KSPA 5CEPA 5JGBA 5F9EA 4CKRA 5CVGA 3ZONA 4KS7A 3LLAA 1JKLA 1V1KA 4FTIA 3GVUA 3OUNB 4BCQA 2QD9A 3M2WA 4BCKA 5DYJA 4ANBA 3SRVA 2CKQA 2R2PA 2YISA 3CQWA 3O23A 4D4YA 4QD6A 3F5XA 4FODA 4TT7A 2B9HA 3MGYA 4K9YA 4FKRA 3E5AA 2ZV2A 1ZZ2A 3Q6UA 4M14A 3WE4A 4R5YA 4O0VA 2XKCA 3LAUA 1ZMVA 3OWKA 1UU3A 5FEQA 3ZCLA 2C47A 4KINA 4FTTA 4O7TA 4GJ3A 5ICPA 2VWIA 4G34A 3ANRA 3VUGA 4E4LA 2CCHA 2VTIA 1BL6A 3WYXA 3E3PA 5L6OA 4BICA 5M4IA 3C0IA 2BMCA 3ZTXA 3QKMA 5CASA 3A4PA 3RALA 5LMKA 4O27B 1ZY5A 5C4KA 3H0ZA 1FQ1B 3QAME 4LL0A 4MD8E 1QCFA 2QLQA 2R3LA 4QMWA 5EM7A 3PLAE 3LQ8A 4UEUA 4XG4A 2CN5A 5I9XA 2XJ1A 2PUNA 2Y4IC 3GCVA 4EWHA 2QLUA 1MRYA 4AW1A 4RIWB 3RCJA 5H8EA 2PTKA 3I5ZA 1TQPA 3C4WA 4E26A 2WU6A 4HGTA 3UTOA 3BGQA 5AA8A 3WF7A 1YI4A 3SDJA 1UKIA 2UZBA 2YCRA 4RVMA 4DFBA 4EI4A 2OJGA 3Q6WA 4G3FA 2FA2A 4ALVA 3P23A 3CKXA 4JRVA 3TDWA 4IACA 5KE0A 3DK3A 4BCNA 2C1AA 4PNKA 3NW7A 3UP2A 3V5WA 5A4LA 4EOJA 5GZ8A 3GP0A 4V05A 3R9HA 4EL9A 5BVOA 2WMAA 4KA3A 3NAYA 4DG0E 3ZO1A 2W4OA 1L3RE 2XF0A 3O8TA 2UW7A 4GYGA 1ZY4A 2XEZA 2WNTA 3AC2A 2QOOA 4NFMA 1F3MC 3QALE 1Z9XA 3UP7A 1SVHA 3EKNA 4BCIA 1U54A 3SLSA 4PP9A 2WEVA 2Z7SA 3QA0A 1OL5A 3KB7A 3IGGA 3QWJA 2PMLX 5EM8A 5EKOA 2E9OA 3VJOA 4FV2A 4BB4A 3FZTA 1E1VA 1KV2A 2P3GX 5HE3A 4OBPA 4Y5QA 4YLJA 2ACXA 4WSYA 5HNIX 4RX7A 3NPCA 1QPDA 3DTWA 1XH4A 1JVPP 3CIKA 2VTJA 2YIWA 2W17A 3C5UA 4W4YA 5TKDA 5JGDA 4JDHA 3WF9A 3BV3A 5L6WL 2EVAA 4EWQA 2H6DA 2V0DA 4O91A 4Q9ZA 1IAHA 3AMAA 2UZEA 2I1MA 3CE3A 4O1OA 3L1SA 3TNPC 4H1MA 3VS2A 5KMOA 2W1GA 4BFMA 3F9NA 4BGQA 2DYLA 1B39A 5L2WA 4FEXA 2C6OA 2JEDA 2C5XA 4C57A 4LFIA 2I0VA 4MD7E 3OW3A 1WBOA 2OW3A 4QP3A 5EI6A 1OPLA 3HV3A 4TWPA 3VF9A 4ANNA 5AV3A 1SM2A 4FTKA 5EQPA 2HZ0A 3HA8A 4GV1A 4RJ3A 3EJ1A 4E4MA 4EHZA 3DXQA 4EOPA 2RFSA 5ANIA 3E92A 3TKIA 4Z16A 4YU2A 1UU9A 3CEKA 4LGGA 2YERA 1WVYA 4U81A 4AT5A 4EQUA 3HVCA 4O84A 4FF8A 3ZEWA 3ORKA 2X39A 2E9UA 2BDFA 1JKSA 5J9LA 4NCTC 4RIOA 5BMMA 5A9UA 4JS8A 5KKRB 5M53A 4BTKA 1CTPE 3PE2A 1H1QA 2HIWA 3P1AA 4ITHA 4E4NA 4AOJA 4KIKA 4FNZA 5M4CA 3FI2A 4IZ7A 3O0GA 3MH3A 2PMOX 3R6XA 2ITTA 4RMZA 1I44A 3FBVA 4L67A 2HZNA 3H10A 5C26A 2UZUE 1XKKA 3OZ6A 3E8EA 2EUFB 3KMWA 2YIYA 4QTAA 2X8IA 4S34A 3TZ8A 4PV0A 4O7RA 4GUEA 2XRWA 3O17A 4B4LA 3AXWA 4JR7A 5M06A 3ZO2A 3VS5A 1M17A 1PYXA 4RVKA 2CDZA 4FTQA 4C62A 5ETFA 4UMQA 4QP8A 3PLSA 2BPMA 3OY1A 4GFGA 4DE4A 2X6EA 4YJQA 1CM8A 4B99A 2C6LA 4L68A 4RX5A 4OTHA 3FI8A 4YO4A 5JZNA 5J7BA 3ZXTA 5JRSA 4HVDA 5I5ZA 2RFDA 3SXSA 2WGJA 3MTLA 3N4TA 4ZSEA 4XP3A 5KX8A 1KV1A 2VWBA 4TYEA 5HESA 3VVHA 5M56A 2ITYA 2HOGA 2W1HA 3NAXA 3O8UA 2BILB 1YDTE 2OO8X 3ZRMA 3FYKX 1GJOA 1OIYA 5DGZA 3H9OA 4RG0A 2HWOA 3L8XA 2BTRA 5EYMA 2ZV9A 3GOPA 4CFFA 2VTQA 3PSBA 4IWOA 3ORTA 3QZHA 4DFLA 3LFEA 5ITAA 2YJSA 4M97A 4EC8A 1Q41A 2YLEA 4HW7A 2H34A 3RAIA 4NM3A 5BPYA 3Q9YA 3SW7A 4PDOA 4NSTA 2UZOA 4F99A 3DLSA 4FSNA 4TYHB 3ZM9A 3ZOSA 4FVQA 2XIXA 2VTPA 3WI6A 1BX6A 1XO2B 3DJ5A 3TNWA 3R01A 4AFJA 2WTDA 5HLWA 4FGBA 5HGIA 2ZV8A 3A2CA 3B8RA 3R9NA 5FD2A 2B1PA 5IU2A 3VC4A 3MB6A 3MN3A 3R8PA 4FTRA 5IF1A 2QC6A 4TNBA 3R7EA 3OY3A 3NGAA 3PA5A 5HLPA 5F4NA 3VUDA 4R3PA 4DHFA 2C6MA 4RC4A 3QCXA 4M15A 2VWUA 3DAJA 2XBJA 1SMHA 2OF4A 1P4OA 4CG9A 1Z57A 3NLBA 3DB8A 1G3NA 3CTHA 2R3GA 3F3WA 4FSQA 4GIHA 5E1SA 3KCFA 4IAAA 4AOTA 3U6IA 2OI4X 1UNGA 5ANJA 3HLLA 4FVPA 4YZCA 3QQFA 4RLKA 3QQGA 5IQGA 3TNIA 1H0WA 5BQ0A 1OKWA 3MY5A 4GW8A 4AT4A 2O0UA 3H9FA 4YZDA 1GZKA 4FA2A 2PVKA 4ZP5A 2ZYBA 3BWFA 4FKTA 2B9JA 4D5KA 3DJ6A 1J1CA 2C5OA 3PPKA 4XG3A 4XOZA 5CSWA 4DCAA 2CGXA 4FUYA 4RBLA 2VO0A 4BI0A 2VO7A 5A4QA 3OXIA 4XG2A 3ODZX 3OWJA 4ALUA 2OFUA 4U3ZA 5HE0A 2PZRA 4GU6A 3VJNA 1K2PA 3S3IA 4PX6A 4I92A 5EYKA 3SGCA 2ONLA 2XIKA 4YHTA 5FWKK 3VW8A 3WBLA 5LWMA 1WBSA 4XNEA 4FKVA 4NW5A 4G17A 2XNMA 2WMSA 4RIYA 4GT3A 3DAEA 2GPHA 4W8EA 5K5XA 4G3EA 1H28A 2LAVA 2PVLA 2BTSA 2UW9A 4O0UA 4FVRA 4BWXA 4UWBA 1XH6A 3U9NA 4BZDA 2QOHA 5ANGA 2OXXA 2R3IA 3KN6A 4B9DA 2F57A 4C33A 3KRJA 1V0OA 3DLZA 4Y72A 3UQCA 3BBWA 2Y0AA 4CKJA 3NUUA 3DY7A 5CT0A 4C4HA 5K0KA 3AT3A 4DFXE 2Y7JA 5AJQA 1UNHA 2HXQA 3A7GA 3C51A 5E90A 4YSMA 5DE2A 4AX8A 1CSNA 2J7TA 3R73A 4R1VA 4HGEA 4TNDA 3PJ1A 5CX9A 4ANQA 1VZOA 4TXCA 3WIGA 5CLPA 1W7HA 2QKRA 5FXQA 1IG1A 3HV6A 3DZOA 4BCHA 2JBOA 4W9WA 4IJ9A 4ERWA 4DITA 4YPDA 5M4UA 2GS6A 2F4JA 5DR9A 2XK8A 4Y85A 3KXGA 1YRPA 4H05A 3R04A 5CZHA 3I1AA 3POOA 3PSDA 2CGWA 4FZ6A 4JL9A 2WKMA 3QHWA 3EQRA 4GH2A 3R0TA 5IEYA 1XR1A 5HBJA 2G2FA 4XV3A 4AW0A 2OJ9A 3DT1A 4BBMA 4BDKA 4BBFA 4X3JA 2CPKE 4HJOA 3T9TA 3WZKA 2QVSE 2VTAA 3PXZA 3ZM4A 4F1MA 4YURA 3KK8A 1H0VA 4MK0A 3GENA 3MBLA 3NUYA 4FT0A 3BHUA 2ITPA 3MFRA 4OW8A 5G6VA 4AXAA 4MXZA 2E9VA 4FG9A 4QYYA 4ACGA 5J9YA 4L45A 2ZAZA 1H01A 2BAKA 2GNLA 3FQSA 2JDVA 3PSCA 3F61A 4F08A 3TG1A 2ZMDA 4ZY5A 4D2PA 2XK3A 1FGKA 4PTEA 2BR1A 3VO3A 3NSZA 3F5GA 3NIZA 1ZOHA 2F9GA 2HAKA 5HCZA 2ITWA 5CF5A 1DI9A 3IOKA 4JX7A 3AMYA 4ZY6A 2YJRA 4RSSA 4BGHA 4O7ZA 5BUJA 4NTSA 3VS1A 5AM6A 3RMFA 3FMLA 4G5JA 3OWPA 2YM4A 4K33A 2OIQA 4RFYA 3U9CA 4ASXA 3IW6A 4QP6A 3ZRKA 2F7EE 2C3JA 2VNYA 4E8AA 1Y6AA 4LOQA 2JKQA 5M4FA 4FKSA 4IHPA 4BGGA 2WMVA 3QC9A 1WBNA 3PA3A 4V0GB 3CGFA 4JT3A 5LXMA 3OS3A 5CEIA 4B0GA 2VGPA 4PPCA 3HAVA 4DEBA 1RE8A 3BYMA 1OM1A 2YCQA 4XV9A 5FG8A 2XZSA 4FX3A 1KE9A 4WBOA 2WD1A 4RWLA 4MKCA 4DAWA 3E7OA 4BHNA 4NUSA 1UVRA 1Q99A 4M68A 4C4IA 3POZA 5KBQA 2VAGA 5AP1A 3QYZA 2PPQA 4IWQA 4Y95A 3R63A 1V0BA 2ERZE 4QOXA 4I1ZA
chains in the Genus database with same CATH superfamily
3IW5A 5HVYA 1ZYJA 4LL5A 1JSUA 3MVHA 2XB7A 5E8XA 2YM7A 4GS6A 5GIPE 3LM0A 3E8DA 3MV5A 3MIAA 4ZXTA 4BTMA 3NEWA 2X8DA 4DYMA 1OPKA 2O65A 4O2PA 4TW9A 5ANKA 5IISA 4PL5A 2CNUA 2J2IB 4LOPA 4E1ZA 5I9VA 3L9MA 4Y5HA 4BY9E 3P08A 4U0IA 4P4CA 1GZOA 3P86A 1GAGA 4N6YA 4R78A 3FLSA 3H3CA 3KXZA 2R3MA 3VHKA 3UGCA 3OOGA 4KD1A 4WKQA 1LR4A 3V8TA 4C58A 4EH3A 3QRTA 4XP2A 3QX4A 3NMUF 1BYGA 5FRIA 3ULZA 4DH7A 5HO7A 1YQJA 3HRCA 1PMUA 3RINA 2XS0A 3PJ8A 3TEIA 3VBXA 1W82A 3A62A 4MX9A 3FSKA 2IVVA 5IQEA 5KUPA 5K0XA 4FICA 4UMTA 3NYXA 3DK6A 5CZIA 3UQFA 4U42A 4BN1A 4QMLA 3UG1A 2W7XA 3QRJA 4HVSA 5FTOA 4C34A 5HNBA 2Z2WA 3TV7A 4PMMA 3DBCA 4GG7A 4JAIA 4EONA 3QGYA 3G5DA 3IDPA 4RJ7A 3MY1A 4RQVA 3QQHA 3TT0A 5DEYA 3ML1A 4FTLA 3V5JA 4CSVA 3GFEA 3QHRA 1ZMWA 5K5NA 2R64A 5EOLA 4BTFA 2RF9A 3UG2A 4UMUA 1VLRA 3LM5A 4YHFA 3Q4TA 5L2TA 3F5UA 1SNXA 3IS5A 2Z7LA 2O5KA 3QRIA 3C9WA 3OBGA 1M52A 5CF8A 4RIWA 3BLRA 4M0YA 1NVSA 2XNPA 5DT0A 4KBKA 4QMPA 5HVJA 4IB1A 3PDTA 4IE9A 4TKSA 5D1JA 3S4QA 3HDMA 3N51A 3AKKA 1XH7A 3QCSA 3QD3A 5EQYA 3TV4A 1FMOE 3SAYA 4AAYA 3QL8A 3RPRA 3TV6A 4C61A 4C2WA 2QOFA 4K18A 5E8ZA 2JIIA 3EL8A 4EK6A 3G0EA 1UU7A 4FKOA 3U8WA 4IFCA 4YC8A 4CYIA 3Q3BA 5AX9A 4X2FA 3KIOC 3I60A 3VRYA 4ZSJA 3UDZA 4AQCA 4N6ZA 5DN3A 3Q32A 3BLQA 3ZS5A 4C3PA 3GC0A 1R1WA 4O1PA 4HZRA 4YTHA 4ANOA 3FLNC 3PVWA 5TOZA 5IMEA 4A9TA 1DS5A 2IZUA 2X4ZA 3O96A 1FINA 4E6CA 5EI2A 4DEEA 3CPBA 1IA9A 4CXAA 4LGHA 2WMBA 4QYFA 5IA0A 3CPCA 4YJUA 4YZMA 3FKOA 1JLUE 4H3BA 2DQ7X 2Q83A 2WMRA 5H2UA 2ZB1A 4FKPA 1E9HA 5BX0A 2WOTA 4TY1A 3KA0A 3VQHA 4MQ1A 1MRUA 5KCVA 4GYIA 4WG4A 2XAOA 2ITUA 3R21A 2XP2A 4MAOA 5AP5A 2WQMA 4FNXA 5IA1A 3UOJA 3G51A 1X8BA 2F7XE 4FV7A 3ZUUA 3ID6C 3P0MA 2GTNA 2C5NA 4RVLA 3UNKA 2X6DA 3OFMA 3QQUA 4ANMA 4I22A 4EQMA 4C59A 4W4WA 3II5A 4FT3A 4MYGA 1RQQA 4ID7A 4KKEA 2BVAA 3KULA 4X3FA 4XUFA 5F20A 3P79A 2WTKC 4F6UA 3UBDA 2BZHB 3QLGA 3U4UA 3NNXA 1W8CA 2VTHA 4DC2A 3GU6A 4EUUA 2R5TA 3HRBA 3LMGA 4N70A 2VWWA 2X7FA 3MPMA 3AC5A 2A98A 3BGPA 5BUEA 3FXWA 4ZS4A 4FV9A 4RQKA 3UMWA 5HX6A 4MF0A 4MBLA 3GB2A 3QQKA 5KZ0A 1V0PA 3E8NA 3ORPA 2GDOA 2UW0A 3FLZA 4NIFB 3EWHA 4YR8A 3CD8A 4TYJA 4Z7HA 3QQJA 4IZAA 4ARKA 5AUZA 4PWNA 4AP7A 2ETRA 3QWKA 5D41A 4E5AX 4IM0A 1MRVA 4IVDA 3U6HA 5AUTA 3FZPA 4R3RA 1M2QA 2UW5A 3FZSA 2IVSA 3I0QA 2NPQA 2VZ6A 3TACA 4MXXA 5B2KA 5CAVA 2Q0NA 3ENHA 4IQ6A 3TUBA 3VUHA 4K77A 1H4LA 5AM7A 4BWPA 4E73A 4JDKA 4F9BA 3GI3A 4EK3A 2G9XA 4CFMA 1YDRE 4TL0A 4HZSA 4Z3VA 5AWMA 4FZFB 2I0EA 3LFFA 4RWKA 3QTUA 4LMUA 5JFSA 2VRXA 1RW8A 3Q96A 4KWPA 1ZWSA 4GJ2A 2G15A 2XNGA 3S00A 3G15A 3RGFA 4XBUA 4AXEA 3KEXA 1LUFA 3MJ1A 4BKZA 4JLCA 1H1PA 4U79A 1Q8TA 4WUNA 3PVUA 4NM7A 2WU7A 5DHJA 4KKHA 3V04A 4BVUA 4EKKA 4LV5A 3QUEA 1KE7A 2C3KA 2A19B 3GC7A 2R3FA 4FNWA 3F7WA 3PVGA 1JOWB 3Q5IA 2R3PA 4UWCA 5AP3A 5EYCA 3ROYA 3OHTA 4XG6A 3U51A 3ZDUA 3SKCA 4DGOA 3KXXA 4DH1A 3Q52A 3TNQB 4YMJA 5DLSA 4WNKA 5M08A 3BKBA 5L2SA 4YP8A 3CGOA 2F49A 4FSWA 3KXHA 2IW9A 1ZYCA 5KNJA 1OBGA 4EHVA 4F6WA 3NWWA 3HMIA 4QP1A 2GNHA 3DBQA 2B54A 5HBEA 2IW8A 4I4EA 2B9FA 3FI3A 4IXPA 3A8WA 3VW6A 3ZH8A 4QTDA 3OW4A 3COMA 3ITZA 1OITA 3R1YA 3OCBA 1FVVA 3ZLWA 3KMUA 4IADA 3TKHA 3PPZA 2A1AB 5C8KA 5HZNA 4OAVB 4G16A 5IQBA 4RGJA 1H07A 3HMOA 4XLVA 3UDBA 2W1FA 4F0FA 4WRSA 2OU7A 4QMUA 5AADA 4MF1A 1YOMA 4FG7A 2Z60A 5E8UA 5I9WA 1J7UA 4B8LA 3AC3A 4PQNA 4X0MA 4HPTE 1OL7A 4KABA 3FC1X 5C01A 3ORMA 3GU4A 2C0TA 3FPMA 3AOXA 4FOBA 4O7LA 2W9ZB 4RFMA 3R8MA 2XK4A 3QRKA 3RK5A 2HELA 1IR3A 5LJJA 3F82A 4I3ZA 4J53A 2V22A 2B0QA 3A8XA 5E8TA 4R5SA 5EW8A 5HCXA 3GQLA 3ZUTA 3NVKI 2VX0A 4R7HA 4FV3A 5EDPA 3R22A 1EH4A 1U4DA 3HMNA 3ZYAA 2Y4IB 5CEKA 4O0SA 1FVTA 4FV1A 4YJSA 3C7QA 3WZEA 4FKQA 3OF0A 5DH3A 4C37A 4A4OA 3P7CA 5ACKA 3DBFA 3DOGA 3LE6A 3P5KA 4LRJA 1PMEA 1M2PA 4NU1A 2XNNA 2PK9A 3A99A 3ZMMA 4FL2A 5AR7A 5A4CA 5ETCA 2J0JA 1XBAA 5GHVA 3T3UA 2ZDTA 2QR8A 2QKWB 2YDIA 3AGLA 4GEOA 4G6LA 4GMYA 4XHKB 2QG7A 1PXMA 3PE1A 3H30A 3LXLA 4FE2A 5JFXA 4ZTLA 4DEIA 5AAEA 4FTUA 5E1EA 4B6LA 3LLTA 3KXNA 4QPSA 3VWAA 2XA4A 3UIMA 4FT5A 1XBBA 3Q4UA 4KIQA 1HCKA 2NYAA 2W05A 3KKVA 2FSTX 3ODYX 4OBOA 3DV3A 2C3IB 4XP0A 1P14A 4EOOA 1LPUA 1PMVA 5AUUA 3JY9A 5AP7A 2XNOA 4O6EA 2R7BA 2VN9A 3P5JC 3FMDA 2FSOX 4WUAA 5FP5A 3MSSA 4JR3A 4M69B 5T6KA 4IX5A 4D28A 2QU6A 4OTDA 4C2VA 1A9UA 3PVBA 5CWZA 1Y91A 3BLHA 1PXIA 2UW6A 2XNBA 4NM5A 5KMMA 2IPXA 3UZRA 1YXTA 2BUJA 3PPJA 4AU8A 1YW2A 3LCDA 4WA9A 5AR4A 3LCKA 5EI8A 3W2QA 4BCMA 4CFVA 5FP6A 3BELA 2WELA 4QTBA 4II5A 4UXLA 5J1WA 5CANA 3MFSA 3DTCA 3EN5A 3NFFB 3HNGA 2YDJA 4FUXA 2W1CA 4E5WA 4EZ5A 4AG8A 4AF3A 5BVFA 2CKOA 1PY5A 3U54A 5CENA 1AQ1A 4CFXA 2GHLA 2AC5A 5KZIA 4AWIA 1M14A 2E9PA 2WQEA 4C3FA 5KMLA 3R8ZA 4CMTA 2QODA 2HWPA 2IZTA 2KTYA 1ZOEA 2C0IA 1Q8YA 4QMSA 5AR2A 4BRXA 4I4FA 4FK6A 1NVRA 2J4ZA 4QPMA 1GZ8A 4J96A 3C0HA 1UV5A 2VX1A 3QXPA 2Z8CA 4RLLA 3EN6A 5EYDA 4HYSA 1YI6A 3R8LA 3FLYA 3PRIA 5J8IA 2W1DA 5JKGA 3PJ2A 2JFLA 3ZLXA 3A7FA 3UPZA 1B38A 2C6TA 2Z7QA 4O6LA 3UC4A 2HK5A 4UB7A 3UE4A 4LDTA 1BI7A 4UX9A 4DDGA 3KRWA 4P90A 2UW8A 3R71A 5AX3A 5AEPA 5JZJA 2BROA 3LW0A 2GS2A 5J9ZA 4ZSLA 4L53A 4BDBA 2PL0A 3Q5ZA 5CI6A 3UNZA 4IX6A 1H8FA 2CLQA 3LPBA 3WF8A 2C6DA 4TZRA 2R3NA 3HA6A 4H1JA 2FB8A 1FVRA 2P55A 4JBQA 4FBXA 5AV4A 3VBTA 1F5QA 3BZ3A 4FC0A 4P7EA 2B55A 3RM6A 1OBDA 4GKIA 1S9IA 3BHHA 3MIYA 4GT4A 4IBMA 4JOAA 4QMVA 5IZFA 4F0IA 5D12A 3ORNA 4NKAA 2QURA 4S32A 1KOAA 1QL6A 1IA8A 4UN0C 4L8MA 4NL0A 3BE9A 4BI1A 1PXOA 4MBJA 4AZEA 3CLYA 2OGVA 4QRCA 5HEZA 5KO1A 3ZZEA 4JG6A 3R28A 4XG7A 5G1XA 5LVMA 4RJ4A 4O7NA 3EZVA 4ERKA 2CN8A 3DKCA 1YHVA 2ZM3A 4ACHA 3GCQA 4I5HA 2NO3A 3TXOA 3SX9A 2P4IA 1P4FA 2VTLA 2NNWB 2XANA 4V0GA 4ITIA 4OLIA 3EQBA 3AG9A 4X3FC 3C4ZA 3KRXA 1ZXEA 4PUZA 5IEXA 4L43A 1URWA 3RK9A 4YJOA 4DHJA 5CSVA 3CJGA 3WILA 1WBVA 4QMMA 3MH2A 3UVPA 4C4GA 3QQLA 2XKEA 1DI8A 2JD5A 2PMNX 3PXQA 2WPAA 5J7HA 2VD5A 2OXDA 1JSVA 5EDQA 5CNNA 4DFZE 3LQ3A 4EEVA 5GJFA 2VO6A 3RWQA 3QFVA 4U7ZA 4BCOA 3EQPA 4XH6A 2GU8A 4MCVA 4GVJA 4EBVA 4IMYA 2O63A 3MA6A 3QXOA 4ZS0A 3VBVA 4BDGA 2P0CA 4IC8A 4FT9A 4BCPA 5JGAA 2YN8A 4L7SA 4KUJA 3HMMA 4YC3A 2PUIA 3TMOA 1KUTA 4A9YA 2WXVA 1IASA 4ZAUA 4LV7A 4U97A 4AT3A 2VTMA 5EHOA 4AN9A 4F1TA 3AC1A 5IH6A 4IANA 3G9NA 4L3PA 4I6QA 3UO5A 3PG3A 5AR8A 3GU5A 2HYYA 3VONA 4AA5A 2ZDUA 2ZVAA 3PXYA 3W0OA 3DDPA 4IZYA 3VIDA 2W96B 2REIA 1J91A 3OTUA 5AUYA 4J1RA 3RZBA 1URCA 1OKZA 4GG5A 2QO7A 4GFMA 1A48A 3KFAA 3BQRA 2IJMA 2PE2A 4D0XA 4U45A 4YTFA 4HCVA 4EHGA 5JK3A 2DWBA 3NNWA 3VBYA 4EHEA 1AD5A 2BZJA 2IO6A 4MQ2A 3RKBA 4IAZA 4ZJVA 3P9JA 5AAFA 3THBA 5I9ZA 1OUKA 4WSQA 3D0EA 3NNVA 3UVQA 4L3LA 5CEMA 4Q5EA 4NFNA 5EH0A 4TPTA 5B2MA 2G2IA 3FUPA 4DCEA 4R7IA 3LMHA 5IH4A 2X7OA 3DKOA 5H9BA 2XARA 4OTFA 5AP4A 2CMWA 3DBDA 3QTZA 4JBPA 5TE0A 3UZPA 5AUXA 2QU5A 4DBXA 5JN2A 3GCSA 2HZIA 2C5YA 3LOKA 1T46A 3ZEPA 5KMNA 3UDTA 4D9UA 4DDIA 4FJVA 1Q61A 5FGKA 3QTXA 2V62A 4OTRA 3KU2A 2WIPA 5CXZA 3AC8A 4QP7A 2VTRA 4JNWA 4AGDA 4JIAA 3QTWA 2CKPA 3F5PA 4ZJJA 2XEYA 4FZAB 2FGIA 2IW6A 4UXQA 5J95A 3VS3A 5AP2A 4ZTMA 1KSWA 3RNYA 4LG4A 2YZAA 1I09A 1XJDA 5EW9A 5IQAA 4HCTA 4CLJA 1J3HA 4FTCA 3V5PA 1J1BA 3EN4A 4R77A 1QPEA 2OXYA 1WBTA 5AMNA 5FDPA 2X2MA 3FQHA 3FSFA 3R00A 5I3RA 4RT7A 3EQFA 4L46A 2GS7A 1U46A 3SHEA 3DAKA 2RIOA 3LFAA 4FYNA 4C3RA 3CY3A 2VWZA 1SVGA 2XJ0A 4DGNA 3D7TA 4DG3E 4L3JA 5IPJA 3V51A 4EQCA 4YJVA 1DAYA 1YXXA 4IFGA 4ALWA 5ETIA 4DHZA 3E63A 1W2FA 3WIKA 4QTEA 2BRHA 4H39A 4Y46A 4S33A 1TFFA 4FIEA 3GCPA 2XYUA 4WG3A 1PKDA 3V5QA 3NYOA 1JNKA 2WTIA 1Q8ZA 3JVRA 1TZDA 4XCUA 5GIOE 3ULIA 3SA0A 1VJYA 2GMXA 3COIA 4L6QA 4LUEA 3DA6A 3HUBA 3EQIA 5T3QA 5LMKC 4QMYA 4ZOGA 3LXNA 4D1XA 5HE2A 4YSJA 4IWDA 5CU6A 5CVFA 4ANSA 2PULA 5B2LA 4FTJA 2VTNA 4F09A 4RX9A 3DU8A 1Q4LA 4YHJA 5CQWA 4YJRA 5DMZA 2F7ZE 2BDWA 1XMMA 5M51A 4O86A 3MESA 2WB8A 4L01A 3W2PA 3HUCA 2JDRA 3FHIA 3UZTA 1PYEA 3HV4A 4FTOA 4FV0A 3TTIA 3OT8A 4MUQA 3VS4A 1PXJA 4L42A 5AR3A 4BTJA 4E6AA 5LVOA 1QPJA 3RZFA 2PUPA 1H1SA 4EYMA 1XH8A 5D9HA 2EXEA 3SD0A 5HIEA 3FHRA 3FQEA 4J95A 4MXCA 4FIJA 3PXFA 4OTPA 1H08A 3PP1A 3I5NA 3D5WA 4FTNA 4GFOA 4IWPA 4W8DA 4QQCA 5HG7A 2GNFA 3JYAA 4R3CA 2PZPA 1BMKA 2PVRA 4D9TA 2XALA 4JQEA 2PWLA 1M2RA 3NS9A 3O50A 3D14A 3FMMA 2QCSA 4BF2A 2VWYA 3DGKA 3VN9A 3LFCA 2C68A 1NA7A 3RHKA 3H9RA 4QMZA 4I6BA 3PG1A 3CJFA 3BGZA 3M1SA 3W16A 5TO8A 3WOWA 4EZ7A 1L8TA 3ET7A 2EXCX 3IECA 1G8AA 2Y4PA 4PP7A 1W84A 4EBWA 4CQEA 1MQBA 4RJ6A 4I93A 4FKLA 2VO3A 3R1NA 4NIFA 4F1OA 5FTGA 4L52A 3LIJA 5DRBA 2EWAA 2FUMA 2X0PA 4CFWA 3NVMB 2HZ4A 4FIIA 2IVTA 2WOUA 1JKKA 3NYNA 3QUDA 5HX8A 4KIOA 4EOLA 2JKKA 3EFKA 2QOIA 4EORA 3OCTA 2ZFYA 5F95A 3MPTA 4FL1A 5L2QA 4EH6A 1TKIA 3OBJA 5A4TA 5KMKA 2QO2A 2J51A 5HG8A 4DBNA 5IMXA 3QA8A 4ZMEA 3UYTA 4O21A 4G5PA 3CXWA 1ZOGA 3DKFA 1SVEA 2QNJA 5HCYA 5DG5A 5HTIA 4TN6A 3Q2MA 4PF4A 5LVLA 3UDSA 5BV3A 1K3AA 1WAKA 2JDSA 1BUHA 2JGZA 1H26A 5HBHA 4UY9A 4FSTA 4LYNA 2BRBA 3CD3A 3EHAA 4ORKA 1YXUA 4DTBA 4X2KA 3R8UA 4HPUE 4KIKB 2JIUA 1REKA 3R7VA 3AD6A 4Q9SA 4XV2A 4QNYA 5DBXA 3CR0A 3OC1A 4A4LA 4CV8A 3BBTB 3N4VA 4NM0A 3R02A 4I0RA 4O0YA 5IQIA 1BKXA 3VBQA 3AGMA 4F4PA 4RWIA 1TVOA 4PTGA 4JDIA 4QP4A 2R3RA 3V6SA 4NTTA 3V6RA 4LOOA 4JG7A 3CS9A 3NUPA 3BU5A 4MH7A 3W18A 3PJ3A 4EC9A 2XCKA 2XIZA 3BPRA 4OT5A 3OP5A 1RJBA 4IM3A 1JSTA 3PFQA 3QTQA 3TZMA 4F70A 3G0FA 3E62A 2C69A 4EOIA 3QRUA 5B7VA 4UZHA 4ZLOA 3VAPA 3DNEA 2J0KA 4OT6A 3MYGA 5IKWA 4QYHA 3Q60A 2BIKB 3JY0A 3SG9A 4G3CA 2PE1A 2JIVA 4RZWA 2IN6A 2X9FA 4I6FA 3COKA 4G31A 2V7OA 4BDJA 1QPCA 2YCSA 3RCDA 1WMKA 5HG5A 3UOLA 3D5VA 3NUNA 4NW6A 2OSCA 1WCCA 4I23A 4LUDA 3TIZA 4FTAA 3EQHA 4F7LA 3K2LA 3NX8A 3HYHA 4YGAA 1JKTA 4ENYA 5FEDA 4AGWA 4BCFA 4DTAA 1Y8YA 2J0LA 2WTWA 3SG8A 4FZ7A 4LRMA 5EFQA 2JKOA 2BAQA 2RFNA 3FMNA 2Z02A 1BLXA 2KULA 4UYNA 1M7QA 2RGPA 1Q3DA 3AC4A 2X4FA 3LKMA 1WFCA 2GCDA 3D7ZA 3FKNA 3EOCA 3PJCA 2QQ7A 4QYGA 5ACBC 3W55A 4X2GA 5K9IA 2UZDA 3D2IA 2YEXA 3QD4A 4F9CA 5J5TA 2EB2A 4ZEGA 2X9EA 3QGWA 4CZYB 4PL4A 1XH9A 5KMJA 4RJ5A 5I3OA 4G3GA 5D10A 1QMZA 3REPA 2X2LA 2EU9A 3ORLA 4GK3A 1GIHA 2ZOQA 3T3VA 1SZMA 2OKRA 5C03A 5L8KA 3ZHPC 3ZLYA 2H8HA 4YO6A 5FTQA 3TKUA 4FV5A 4OR5A 2JFMA 5C8MA 5TR6A 4CEGA 3SC1A 2Y6MA 4ONAA 2PVYA 4O96A 1WVXA 2FO0A 2HXLA 2XIRA 4S2ZA 5HLNA 3K5VA 5DVRA 2OZAB 5L6PA 5AUVA 4J97A 2F2UA 3S95A 4FOCA 3WZDA 1FBNA 3G33A 4FSMA 3WF6A 3QZFA 5ANOA 1OECA 3NRMA 1OKVA 1Q24A 4C0TA 3WARA 2PZYA 4ZSAA 3U6JA 2BIYA 3TM0A 3FLQA 4DEHA 5HIDA 3WYYA 3ROCA 4DT9A 3A7HA 2BZKB 1BL7A 2XM9A 3L8PA 3PY1A 5A46A 2UZLA 4BCGA 2FVDA 2UZWE 2BAJA 2RKUA 3ACJA 3LHJA 4DH5A 3FPQA 3TDVA 4USEA 3FZ1A 3RAWA 5AV0A 3D5XA 2YAAA 3GQIA 4V01A 2PVNA 4X2NA 2Q0BA 4GU9A 3GC8A 1ZYDA 2XJ2A 2W1EA 3F3ZA 3O71A 3M11A 1ATPE 4O2ZA 4U6RA 2CKEA 4GL9A 4FNYA 3T8OA 5HE1A 2WQBA 3BCEA 4JRNA 3ALOA 1R0PA 3SXFA 4BDCA 4KRDA 2E2BA 5AP6A 5HO8A 3PXKA 4GUBA 4GSBA 4DGGA 4AXCA 2WTKB 3PFYA 4DH3A 4XJ0A 4QP9A 3ZUVA 1CKIA 3QLFA 1OL1A 4U80A 3R1QA 5ANEA 3DXPA 5DOSA 2PSQA 2RL5A 4V04A 3FYJX 3IKAA 3VNTA 3I6UA 1OKYA 2NP8A 2RG5A 3K3JA 3LFSA 2UZVA 3KRLA 5B0XA 2ONLC 3FZRA 4HNIA 4M7IA 5CU4A 2R9SA 5JQ5A 4IB0A 4QO9A 4ASZA 5K4IA 4QP2A 3TTJA 2W1IA 1OUYA 3D94A 4R8QA 2WTVA 4BI2A 2XBAA 4AZWA 3BHTA 4AE9A 2XIYA 3BE2A 4DN5A 4NCTA 5IA2A 4C4JA 5F1ZA 5FXSA 3BYVA 3C4EA 3HL7A 4ITJA 1LP4A 3R2YA 5BVDA 3S0OA 2XK9A 4AGUA 4DEAA 3QKLA 2YWPA 3GXLA 2I40A 2ZM1A 4F7NA 3GU8A 2GNGA 4DEDA 4IB5A 5E92A 1OIUA 2X81A 4U5JA 2J50A 3LFQA 3I0OA 5M09A 1FPUA 4L7FA 5E8WA 4DGLC 2X2KA 4MTAA 1KE6A 4B8MA 3DK7A 2OIDA 3PXRA 3TI1A 1GIJA 3LFNA 5JH6A 4NJDA 3O7LD 1REJA 5CSXA 3RJCA 3ZRLA 5E7RA 4D58A 3D4QA 3EIDA 3L8VA 4EH2A 3KC3A 5IQDA 4IVAA 4HNFA 5HICA 3TWJA 4C36A 5LOHA 2WAJA 3HP2A 4CFNA 3W2CA 4JX3A 1IRKA 2UVXA 1W98A 2GHMA 2XCHA 2OZOA 1PXPA 4YZ9A 3MB7A 4CYJA 1OL6A 2IWIA 1NT2A 1YKRA 2ITZA 5KHWA 4XRJA 4GVAA 4MD9E 1BI8A 5CAPA 3I81A 2BRMA 5LMAA 4O81A 4WO5A 4J98A 2RFEA 4FV8A 3RK7A 4BKYA 4I0SA 1Y8GA 2OICA 3ZC6A 4O0WA 3VF8A 3LFBA 1B6CB 3NCZA 3Q4ZA 3KN5A 2O2UA 3W10A 4YTCA 5EG3A 3ORIA 4X21A 3W0RA 3JVSA 3NW5A 3IW8A 4LMNA 4RC3A 2WMQA 5F94A 5HD7A 3VQUA 3HDNA 1TQMA 3DKGA 4KRCA 4C4EA 3BV2A 5CQUA 4BBEA 4QQJA 4W4XA 3AKJA 4I20A 3JXWA 4O22A 4MNEB 4BYIA 4CV9A 4Q2AA 4PMPA 3CKWA 3F3UA 3A4OX 4QMOA 1VR2A 4BHZA 3S2PA 4ENXA 2W4JA 4FZDB 4IVCA 2YM5A 4YLKA 1Q8UA 1YWNA 4AA0A 4CRLA 2H9VA 3ORXA 1H25A 3ALNA 4BR3A 5FQDC 4IJPA 1YOJA 4WHZA 3FI4A 2IG7A 1UNLA 2VGOA 3ZC5A 4N4SA 3L9LA 4GCJA 1IEPA 4GK4A 4TYHA 3V3VA 1OL2A 2BCJA 4M3QA 1O6YA 3FY2A 3LJ2A 4A9RA 1ST0A 2PY3A 2OF2A 4I5PA 3W2SA 4AN2A 4LRKA 4CZUA 4PPBA 4NWMA 4F9YA 4ZLYA 3MWUA 4O83A 3TZ7A 3SXRA 3W0MA 2J6MA 5ANDA 5AIRA 5EK7A 3K54A 2ITQA 2WMUA 5BVEA 4AZSA 2P33A 3QC4A 5LQFA 4C4FA 3MVMA 2QI8A 4FYOA 1ZMUA 2GTMA 4I94A 4IAYA 5KHXA 3O8PA 5DI1A 5BMSA 1U5RA 2X0GA 2BKZA 4LM5A 4FGRA 4UZDA 4R1YA 3RTPA 2J5EA 4F6SA 1XHAA 5EQEA 4KAOA 4YC6A 3C13A 2B9IA 4BIDA 4ZTQA 1PRYA 3E93A 1KOBA 3QUPA 2YAKA 3QZGA 4NYEA 2R3QA 1PKGA 3W32A 1OZ1A 4G9CA 4ZK5A 3FAAA 4Z9LA 2ITNA 4H36A 1UU8A 5JMSA 3Q04A 3SVVA 4BJJB 4Y73A 1PXKA 3DCVA 3VRZA 3EQDA 4CLIA 3AQVA 5DEWA 2BZIB 2HW7A 2HY81 4L9IA 4XOYA 5AV2A 4MWIA 4D1SA 4ZY4A 3MDYA 2ZV7A 1Q62A 4PDYA 3MY0A 4JJRA 3D83A 4UBAA 4D2RA 1U5QA 4AW5A 4DG2E 2C30A 4J8MA 3R9DA 2CJMA 3MVLA 2J9MA 3DXNA 2RSVA 2ITVA 3UJGA 5IEVA 5JFVA 1XWSA 1ERKA 3BHYA 5BYLA 3L9PA 5DRDA 4ANLA 1O6KA 5IQHA 3IONA 4JBVA 4DLJA 3UOKA 3D5UA 4UMRA 5A6OA 3EH9A 3HX4A 2WZJA 1GY3A 4YPSA 3R2BA 2VX3A 3R7IA 4K6ZA 2GNJA 3GC9A 4LI5A 5A4EA 5ETAA 4S31A 4WIHA 4ACMA 4CT1A 4QMQA 3RBWA 3VULA 2B53A 3W0QA 3JR1A 5CF4A 2XM8A 3NCGA 2HCKA 4K8AA 4CT2A 2H96A 4DGMA 3QF9A 5L4QA 2R3OA 3DBEA 5H8GA 4IVBA 4W9XA 3KGAA 2YFXA 4JDJA 4FKWA 4GKHA 3I7BA 3L8SA 3R83A 2R3JA 3G6HA 1G5SA 3UNJA 4B7TA 2PU8A 4XV1A 4K1BA 3E87A 2XK7A 1LEZA 2HENA 4O4BB 4QQ5A 3TUDA 3GFWA 1Q3WA 4A06A 1OB3A 3HMPA 3PIYA 3IW7A 4ZZOA 1YOLA 4YUQA 4CMOA 4WD5A 3EQGA 3FJQE 4JQ8A 1P2AA 4O4EA 3C4CA 5FDXA 2BHEA 5CSPA 3RPVA 4YJPA 5CNOA 2PZ5A 4USFA 3FMKA 5DR2A 2QO9A 3DS6A 4RZVA 4RRVA 4MVFA 2AYPA 2WIHA 3SOCA 5LARA 5M57A 3W0NA 3R1SA 3HRFA 2P2HA