3LD2A

The crystal structure of smu.2055 from streptococcus mutans ua159
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
SMKISPMLLSDIEQVVELENKTWSEQNTPVPLPVASKDQIIQKFESNTHFLVAKIKDKIVGVLDYSSLYPFPSGQHIVTFGIAVAEKERRKGIGRALVQIFLNEVKSDYQKVLIHVLSSNQEAVLFYKKLGFDLEARLTKQFFLKGQYVDDLIYSYDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title The Crystal Structure of smu.2055 from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 45
structure length 159
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3ld2A00
3VWEA 2CNTA 3R9FA 2P6GA 1Q2CA 1Z4EA 4B5PB 2ZXVA 1GHEA 3E0KA 2GANA 4XNHB 4E2AA 4YGOA 5IV0A 4ZBGA 3LD2A 1KZFA 1R57A 4UWIA 3W6XA 4HNYB 2PR1A 2B58A 2G0BA 4R9MA 3SXNA 5I0CA 2I00A 1YGHA 4KOVA 4PK3A 2FE7A 2RC4A 4MY0A 1FY7A 2OZUA 1XMTA 4LX9A 4UBRA 3F5BA 5DWMA 1BOBA 1IB1E 3WR7A 3EY5A 2Q4VA 2ZW6A 1YLEA 4CAVA 3IWGA 2B5GB 1KUYA 4NEXA 3K9UA 3S6KA 2PR8A 3R9EA 2EVNA 2NMTA 1M4GA 1CM0A 4AVBA 2B3VA 2D4OA 1U6MA 4JWPA 2Q7BA 4B5OA 3BLNA 5KTAA 2O28A 1VHSA 1P4NA 2FL4A 2P6FA 2Z11A 4KVOE 4KZTA 2J8MA 5JPHA 4XPKA 3CXQA 2R1IA 5ISVA 2Q0YA 4OLLA 3KKWA 5IX3A 3T9YA 2BSWA 3DSBA 1Y9KA 3TO7A 1Q2YA 4QB9A 1KUVA 3EO4A 4HKFA 1WK4A 3BJ8A 4KOWA 4R57A 4XPLA 4Y49B 1NE9A 3GYAA 4FD5A 1ON0A 2Y0MA 4KOXA 2ZPAA 3FNCA 5KTCA 1IIDA 1I1DA 4RS2A 2Z10A 3TCVA 1Z9UA 2BL1A 4JJXA 2PDOA 2ATRA 1S3ZA 4X5KA 2B3UA 5F47A 1PUAA 2ARHA 1RXTA 2FIWA 4XPDB 2BUEA 4GS4A 3NE7A 5F49A 2FCKA 2CNMA 2VXKA 1SQHA 4KOTA 2Z0ZA 4AB7A 3PZJA 3P2HA 4PV6A 2WPXA 4HNXB 3PP9A 2OH1A 5GCNA 3TOAA 2FS5A 4MBUA 4ONUA 4II9A 3S6FA 3TO9A 1B6BA 2D4PA 2OU2A 5HH1A 1MK4A 4EVYA 4FD6A 2Q44A 4R87A 2B5GA 5DWNA 1IICA 1V0CA 5FVJA 4FD7A 2FXFA 4KOYA 1S7LA 1UFHA 3G8WA 4XNHC 3GKRA 3C26A 4JD6A 2HV2A 4KORA 4R3LA 3DR6A 4YRHA 2GE3A 1MJAA 3DR8A 2ZW7A 3FRMA 1Z4RA 2B4DA 2FSRA 3EXNA 4AG7A 1K4JA 4RI1A 2HUZA 1VKCA 4IF5A 3FB3A 1MJ9A 2GIVA 3CXSA 2DXQA 4JXQA 1KUXA 4MI4A 3D3SA 2C27A 4NSQA 3IGRA 2VI7A 3ZZIA 2VEZA 3TE4A 3G3SA 4MY3A 2FT0A 4MHDA 3D2MA 1XF8A 3N7ZA 4JLYA 4KUAA 3EC4A 2F5IA 3MGDA 4QC6A 3I3GA 1OZPA 4LUAA 4AVCA 4KOSA 3RYOA 4CAXA 2G3AA 3H4QA 3P2FA 3PGPA 2OB0A 2Q4YA 2REEA 1QSNA 2VBQA 4YFJA 1S7NA 3QAHA 2CNSA 2PRBA 5J8CA 5C88A 3R1KA 1Q2DA 3TOBA 3TT2A 1L0CA 4KLVA 4QVTA 5C82A 4AG9A 1M44A 3W6SA 1M4IA 5EC4A 5HMNA 1YX0A 1S5KA 4B5PA 3FXTA 4KVME 4HNWB 2BEIA 4H6ZA 2P0WA 4MJ8A 2VZZA 3R96A 4PK2A 3I9SA 4DNCA 1M4DA 2I79A 4H6UA 1PU9A 4U9YA 4KVXA 2J8RA 3V8IA 1P0HA 2ZW4A 2VZYA 3DDDA 2Q04A 4M3SA 3SHPA 1RO5A 3QB8A 2JDDA 3LODA 1XEBA 1BO4A 2K5TA 2JDCA 4QUSA 3B8GA 4PSWA 5J8FA 1LRZA 4AVAA 1I12A 2CY2A 4BMHA 2KCWA 2OZGA 3TO6A 4J3GA 3UY5A 4F0YA 1IYKA 3R95A 3OWCA 2H5MA 4H89A 4OADA 3W91A 2ZW5A 3FIXA 1M1DA 2X7BA 1QSMA 4CAWA 4UWJA 2AE6A 4U5YA 2G3TA 3ZJ0A 4QBJA 4NCZA 3S6GA 4IUSA 1QSTA 4R3KA 1YK3A 1S7FA 2A4NA 5H86A 3D2PA 1CJWA 4UA3A 1WWZA 2PQ8A 2IL4A 2AJ6A 2FIAA 4E0AA 1S60A 5E96A 2PSWA 4ORFA 5F48A 1S7KA 4K30A 2PC1A 1Y9WA 2R7HA 3F8KA 3D8PA 1YREA 3BJ7A 3GY9A 2J8NA 1J4JA 4CRZB 3FYNA 3SXOA 2VQYA 5IB0A 2R98A 3EFAA 2OZHA 4JXRA 4KUBA 4L89A 3R9GA 3CXPA 1MJBA 1IYLA 4KLWA 4OAEA 2WPWA 4KOUA 1TIQA 1NSLA 4CS0B 4I49A 2REFA 4M85A 1YVOA 1NMTA 2JLMA 1I21A 2B4DB 3S6HA 3TFYA 1QSOA 5F46A 5CNPA 2P6EA 4F6AA 1Y7RA 3VWDA 5EBVA 2HQYA 3JUWA 4NXYA 4Y49C 2QIRA 3T90A 3JVNA 4NF1A 3FBUA 1YR0A 3TTHA 4U9ZA 2QMLA 1B87A 4E8OA 5KTDA 2B4BA 3DNSA 2JEVA 2QECA 1XE4A 4XPDC 5JQ4A 4L8AA 2R8VA 3F0AA 2EUIA 4FD4A 1N71A 1YVKA 4CRYB 1QSRA 4PSXA 5H84A 1XIXA
chains in the Genus database with same CATH superfamily
1ZG8A 1BPNA 1F2OA 4LQGA 4UCMA 1LAPA 3VWEA 1TKHA 2CNTA 3R9FA 2P6GA 1Q2CA 3IFEA 4A37A 1Z4EA 4B5PB 2ZXVA 3PB4X 1GHEA 3E0KA 2GANA 1RTQA 3NFZA 4XNHB 4YGOA 5G21A 4E2AA 2BO9A 4O23A 2PCUA 4ZGYB 5IV0A 4P4JA 4PXDA 4UCNA 5I4MA 1VHEA 2WSAA 2QVPA 4UCPA 4ZBGA 4ZX8A 1LAMA 5BWAB 3LD2A 3SJEA 1KZFA 2Z3OA 1R57A 2V8VA 4UWIA 3W6XA 5LYLA 4HNYB 2PR1A 3RAMA 4UIAA 4CGMA 4FBEA 1TF8A 3CPAA 3GLJA 2B58A 3FF3A 2G0BA 4NJRA 4A32A 1BPMA 4R9MA 2PJ5A 3SXNA 5I0CA 1Z2LA 1YGHA 2I00A 4KOVA 1AUGA 1ZG7A 4PK3A 4C2XA 4EFDA 4M6IA 2FE7A 2IMOA 2RC4A 2AFMA 3IU1A 1ZLHA 4MY0A 1FY7A 2G9DA 2OZUA 4MFZA 5AGEA 1XMTA 4IHMA 4HPSA 4LX9A 4UBRA 4CYNA 3F5BA 5DWMA 1BOBA 2C6GA 3SJGA 1IB1E 3QNVA 4CYOA 2DPTA 1TF9A 3WR7A 4MFLA 4OC5A 3EY5A 4MXUA 3FEEA 4ZY1A 3CT9A 5HVHA 2Q4VA 3S9NA 2ZW6A 1YLEA 3D4UA 3DLJA 3IWGA 1AYEA 2B5GB 2PIYA 1IGBA 3DGVA 4CAVA 1KUYA 4NEXA 3K9UA 4BBHA 3S6KA 3SI0A 5EMIA 4P4IA 2PR8A 3R9EA 2EVNA 5HVFA 2CTBA 1M4GA 2NMTA 3KHZA 4Q36A 4R8FA 5K8PA 3RNZA 1CM0A 4AVBA 2YNEA 2B3VA 4GM5A 3ISXA 1ELMP 1Y0RA 2D4OA 1YMEA 1CP7A 1U6MA 4MHYA 2ZEMA 3KHXA 4JWPA 2Q7BA 4B5OA 3BLNA 5KTAA 2HB6A 2O28A 1VHSA 1P4NA 2FL4A 2Z3KA 2P6FA 2Z11A 1IOFA 4KVOE 4KZTA 5G20A 4NGPA 4C2YA 2EO8A 1XJOA 2J8MA 4R76A 2PVWA 4P44A 2WUUA 5JPHA 2C6PA 4NGNA 3CXQA 2R1IA 2HC9A 4TWEA 4XPKA 5ISVA 3VH9A 2Q0YA 1F57A 4OLLA 5AG6A 4MHPA 3KKWA 1ZLIA 3NE8A 5IX3A 3K9TA 3PB9X 3T9YA 2BSWA 2J9AA 3DSBA 3PFEA 1Y9KA 2AFUA 4FUUA 1Q2YA 3TO7A 3MN8A 4QB9A 3B3TA 1KUVA 3EO4A 4HKFA 1WK4A 3BJ8A 4KOWA 2PJ1A 4R57A 4XPLA 4Y49B 1NE9A 2V77A 3GYAA 4FD5A 2PE3A 1ELLP 1FT7A 1ON0A 2Y0MA 1XMBA 4KOXA 2ZPAA 3FNCA 4MHZA 5KTCA 1IIDA 4G1PA 4MCPA 4MCRA 3KR5A 1I1DA 4RS2A 4MFPA 2Z10A 5LRJA 4NGQA 2ZELA 3TCVA 1Z9UA 4UEFA 2BL1A 4JJXA 2EWBA 2PDOA 4MFQA 4MRIA 2ATRA 5G1ZA 1S3ZA 4X5KA 2B3UA 5F47A 3PBBA 1PUAA 3B2YA 4CAEA 2ARHA 1RXTA 2FIWA 3D7FA 4Q38A 4XPDB 4A31A 2V8HA 2BUEA 4GS4A 1PCAA 2ZOFA 4NGSA 2O53A 3NE7A 5F49A 2FCKA 2CNMA 2VXKA 1SQHA 4KOTA 2Z0ZA 4AB7A 1Z8LA 3PZJA 3P2HA 4NFRA 4Q7AA 4DYOA 4PV6A 2Q51A 5K8NA 2WPXA 3BI0A 3PP9A 4HNXB 4KSIA 2OH1A 3KGQA 5GCNA 3TOAA 1DTDA 2FS5A 2JEWA 4UIBA 2PJAA 2EK9A 4MMOA 2PJBA 3D7DA 3KQZA 3IWEA 4MBUA 3SI1A 4ONUA 4Z65A 4II9A 3S6FA 4NJQA 4YWYA 3TO9A 3NH5A 1UWYA 1B6BA 2D4PA 2OU2A 5HH1A 5DS0A 1MK4A 4X8IA 2ZEPA 4FD6A 2Q44A 4EVYA 2OOTA 4R87A 5IB9A 2B5GA 3NH8A 2BOAA 4UFWA 1IICA 5DWNA 1V0CA 2QJ8A 4UFVA 5FVJA 4FD7A 3H8EA 2FXFA 4KOYA 4P4DA 1S7LA 4MFJA 4B11A 1UFHA 3G8WA 4XNHC 5AG7A 1IOIA 5D29A 4ZX9A 3S9MA 3PRTA 4MCSA 3GKRA 3C26A 4JD6A 2HV2A 4KORA 2GLFA 4R3LA 4B10A 2Z3MA 3DR6A 4YRHA 5LRGA 2ZEEA 4DUKA 3FJUA 2GE3A 1MJAA 3DR8A 1Z8WA 4X2TA 2ZW7A 2XEFA 3FRMA 1Z4RA 1YQEA 2B4DA 2FSRA 3EXNA 4AG7A 1K4JA 4RUHA 4OIDA 2Q43A 2HUZA 2VL1A 2CF4A 1VKCA 2EK8A 4RI1A 2Q7SA 4IF5A 3V7ZA 3FB3A 1MJ9A 2GIVA 1IY7A 2NYQA 3D67A 4B13A 3CXSA 8CPAA 2DXQA 1XFOA 1KUXA 1TKJA 1X10A 4JXQA 3B3SA 4IAVA 4MI4A 2YNCA 3D3SA 3V38A 2C27A 5AG4A 4NSQA 4UF4A 3IGRA 2VI7A 4UFXA 3PB8X 2AFXA 1BAVA 2VEZA 3GUXA 5LYDA 3ZZIA 3TE4A 3G3SA 1Q7LA 4YU9A 3D66A 4OC2A 4MY3A 1LANA 2FT0A 1CPSA 1JQGA 4MHDA 4UEZA 4F9UA 3D2MA 1XF8A 3N7ZA 4JLYA 3SJXA 5F09A 2YGWA 2AFOA 3KASA 4K3NA 5JGFA 4KUAA 3EC4A 3FECA 2F5IA 2V8GA 3MGDA 2ZOGA 3WC6A 4QC6A 3I3GA 1OZPA 3IJ3A 1VHOA 1GYTA 3SJFA 4LUAA 4AVCA 2IQ6A 4KOSA 3RYOA 3TC8A 4CAXA 4WWVA 4H2KA 4PQAA 2G3AA 1AMPA 1M4LA 2XEIA 3H4QA 3P2FA 3PGPA 2OB0A 3D7GA 4A39A 2Q4YA 3IIBA 4A95A 2REEA 3LMSA 1QSNA 1TKFA 2VBQA 1YW4A 2F8HA 2GFQA 4YFJA 1S7NA 3QAHA 4UEEA 4CYQA 2CNSA 5LYFA 2PRBA 5J8CA 1CPXA 2ZEDA 5C88A 3KL9A 3R1KA 1Q2DA 4A2ZA 1TXRA 1ARLA 3TOBA 1L0CA 3A9LA 3FVLA 4KLVA 4QVTA 2C1CA 3TT2A 5C82A 4ZY2A 4AG9A 1M44A 2CIJA 1EE3P 3WC7A 3W6SA 3B7IA 3WC5A 1M4IA 4OIWA 5EC4A 2PJ9A 2ZEOA 3B3VA 3JRUA 5HMNA 1YX0A 5CBMA 5JM6A 1S5KA 4CYPA 3N5FA 4B5PA 3FXTA 3KQXA 4KVME 4HNWB 4EMEA 4P6YA 2CXAA 2BEIA 4H6ZA 3BHXA 1LCPA 2P0WA 2I3CA 1X12A 3FX6A 4MJ8A 2VZZA 4WJBA 5AG5A 3R96A 4PK2A 2PRQA 3I9SA 2GREA 4ZI6A 4DNCA 4MFKA 4OMEA 4P4BA 1M4DA 1HEEA 2I79A 4H6UA 1PU9A 4U9YA 4KVXA 2J8RA 4RN7A 3V8IA 2PJ3A 5D8NA 1QQ9A 1P0HA 1F2PA 2ZW4A 3VATA 2VZYA 3PB7X 3DDDA 3GB0A 4FAIA 2Q04A 4M3SA 6CPAA 3WT4A 4A94A 1CG2A 3SHPA 1RO5A 5K8OA 3QB8A 2JDDA 3LODA 1XEBA 1NSAA 4ONWA 3GIUA 1BO4A 4P4FA 4C2ZA 2ABZA 2DF5A 2K5TA 4FWUA 2JDCA 4QUSA 2ZEHA 2QYVA 3D68A 3B8GA 4PSWA 3VARA 4R7MA 3CZXA 2ANPA 4EWTA 5J8FA 1LRZA 4AVAA 1FNOA 1QMUA 1I12A 1JWQA 7CPAA 5J1QA 2CY2A 4BMHA 3CDXA 2KCWA 4BINA 2OZGA 3TO6A 4J3GA 3UY5A 4F0YA 4JZ0A 4NGRA 1IYKA 3HUVA 3R95A 3OWCA 2GLJA 3ISZA 4OC4A 3IU2A 3PEIA 2H5MA 4ZY0A 3FEDA 4H89A 4OC1A 4OADA 1CX8A 2PJ6A 3W91A 2ZW5A 2GU2A 1VIXA 2WYRA 3FIXA 4B6ZA 4CGPA 4IK2A 5HXDA 2XEJA 4PXBA 1M1DA 2X7BA 3TX8A 1QSMA 4C7IA 4CAWA 1KWMA 4UWJA 2AE6A 4U5YA 2G3TA 4M6HA 3ZJ0A 4QBJA 3IWWA 3LACA 4NCZA 1ZG9A 3S6GA 4IUSA 1QSTA 4LQ6A 4AXVA 1R43A 4R3KA 3RZAA 1YK3A 2XEGA 1S7FA 2A4NA 1Z8XA 5ELYA 4JYWA 2PJ8A 2AFWA 1YLOA 5H86A 3D2PA 1CJWA 4UA3A 1CP6A 3FH4A 3NA6A 3S9LA 4A38A 2RB7A 1WWZA 2PQ8A 2IL4A 1YW6A 2AJ6A 2EBJA 2FIAA 4E0AA 4B14A 1S60A 5E96A 2PSWA 4P4EA 2AFSA 2RFHA 3IC1A 3QAYA 4M6GA 4ORFA 3H5ZA 5F48A 1S7KA 4K30A 4CGNA 2PC1A 1Y9WA 2R7HA 1Y0YA 3F8KA 4B12A 3D8PA 1YREA 3B35A 3BJ7A 5K8MA 3KR4A 3GY9A 1LOKA 1HDQA 2J8NA 5HVGA 1OBRA 2POKA 1J4JA 2CTCA 2Z3PA 3FYNA 3SXOA 3B3CA 4NGTA 4CRZB 5CPAA 3H8FA 2PJCA 2ODFA 4A33A 3RBUA 4PXCA 2VQYA 3IO1A 1R3NA 3PB6X 4ZYQA 5IB0A 2BCOA 2PJ4A 2Q4ZA 2JBJA 3BI1A 4BD9A 2R98A 3HLPA 4OC3A 3KI9A 1Y7EA 4A30A 3EFAA 2OZHA 4JXRA 4KUBA 4W9YA 4L89A 2WZNA 3R9GA 4F0XA 5JH9A 3CXPA 1MJBA 1IYLA 4KLWA 4OAEA 2WPWA 4KOUA 5G22A 1TIQA 1NSLA 4CS0B 4I49A 2PIZA 4KS9A 4OC0A 1A2ZA 2REFA 4OKOA 1XOVA 4M85A 1YVOA 1NMTA 2Z3NA 2O4HA 2JLMA 3I1UA 1I21A 2B4DB 5THWA 3S6HA 3TFYA 1QSOA 1VGYA 2AFZA 5F46A 4CGLA 4PPZA 5CNPA 3NH4A 3D7HA 2P6EA 4OP4A 4PXEA 2DPSA 1Y7RA 1CBXA 1YSJA 4F6AA 1HDUA 2YNCC 3LWUA 3VWDA 1ARMA 1XRYA 2IJZA 5EBVA 2HQYA 4GXHA 4KSFA 3JUWA 2DEAA 2ZEGA 5A28A 4NXYA 4MCQA 2PJ7A 2QIRA 4Y49C 3SI2A 4DJLA 5LRKA 3T90A 3T8WA 3KZWA 3JTKA 3JVNA 3L2NA 4NF1A 4CPAA 3H8GA 1BLLE 4C7HA 3FBUA 1LFWA 1YR0A 1Z5RA 2NSMA 1H8LA 3K2KA 3TTHA 2YNDA 1XBUA 2C6CA 2ZEFA 4F8ZA 3B3WA 4U9ZA 4R6TA 2QMLA 1PYTB 2OR4A 3MRUA 2V8DA 4P10A 4C68A 1B87A 4E8OA 2ZENA 3PBEA 4X3RA 1Z8TA 5KTDA 3WABA 3PFOA 4NGMA 2B4BA 3DNSA 2PJ2A 2JEVA 2QECA 1IU8A 4F9VA 2FVGA 1XE4A 2F7VA 4XPDC 5JQ4A 4L8AA 2R8VA 4CGOA 3F0AA 5LYIA 2EUIA 4FD4A 1N71A 4MHNA 1YVKA 2JBKA 4CRYB 3BXMA 1QSRA 2PJ0A 3RO0A 3CPXA 4P45A 4CAFA 2Z3LA 1ZO0A 1DE4C 4KSAA 4PSXA 5H84A 3FMCA 5A27A 3IEHA 1XIXA 4TNUA 2PVVA
chains in the Genus database with same CATH topology
4UCMA 3VWEA 2CNTA 3R9FA 2P6GA 1Q2CA 1Z4EA 4B5PB 2ZXVA 1GHEA 3E0KA 2GANA 4XNHB 4E2AA 4YGOA 5G21A 4ZGYB 5IV0A 4UCNA 2WSAA 4UCPA 4ZBGA 5BWAB 3LD2A 1KZFA 2Z3OA 1R57A 4UWIA 3W6XA 4HNYB 2PR1A 4CGMA 2B58A 2G0BA 4A32A 4R9MA 3SXNA 5I0CA 2I00A 1YGHA 4KOVA 4PK3A 4C2XA 2FE7A 2RC4A 3IU1A 4MY0A 1FY7A 2OZUA 4MFZA 5AGEA 1XMTA 4LX9A 4UBRA 4CYNA 3F5BA 5DWMA 1BOBA 1IB1E 4CYOA 2DPTA 3WR7A 4MFLA 3EY5A 2Q4VA 2ZW6A 1YLEA 4CAVA 3IWGA 2B5GB 1KUYA 4NEXA 3K9UA 4BBHA 3S6KA 2PR8A 3R9EA 2EVNA 2NMTA 1M4GA 4Q36A 1CM0A 4AVBA 2YNEA 2B3VA 2D4OA 1U6MA 4JWPA 2Q7BA 4B5OA 3BLNA 5KTAA 2O28A 1VHSA 1P4NA 2FL4A 2Z3KA 2P6FA 2Z11A 4C2YA 4KVOE 4KZTA 5G20A 2J8MA 2WUUA 5JPHA 4XPKA 3CXQA 2R1IA 5ISVA 2Q0YA 4OLLA 5AG6A 3KKWA 5IX3A 3T9YA 2BSWA 3DSBA 1Y9KA 3TO7A 1Q2YA 4QB9A 1KUVA 3EO4A 4HKFA 1WK4A 3BJ8A 4KOWA 4R57A 4XPLA 4Y49B 1NE9A 3GYAA 4FD5A 1ON0A 2Y0MA 4KOXA 2ZPAA 3FNCA 5KTCA 1IIDA 1I1DA 4RS2A 4MFPA 2Z10A 3TCVA 1Z9UA 2BL1A 4JJXA 2PDOA 4MFQA 2ATRA 5G1ZA 1S3ZA 4X5KA 2B3UA 5F47A 1PUAA 4CAEA 2ARHA 1RXTA 2FIWA 4Q38A 4A31A 4XPDB 2BUEA 4GS4A 3NE7A 5F49A 2FCKA 2CNMA 2VXKA 1SQHA 4KOTA 2Z0ZA 4AB7A 3PZJA 3P2HA 4PV6A 2WPXA 4HNXB 3PP9A 2OH1A 5GCNA 3TOAA 2FS5A 3IWEA 4MBUA 4ONUA 4II9A 3S6FA 3TO9A 1B6BA 2D4PA 2OU2A 5HH1A 1MK4A 4EVYA 4FD6A 2Q44A 4R87A 2B5GA 5DWNA 4UFWA 1IICA 1V0CA 4UFVA 5FVJA 4FD7A 2FXFA 4KOYA 1S7LA 4MFJA 4B11A 1UFHA 3G8WA 4XNHC 5AG7A 3GKRA 3C26A 4JD6A 2HV2A 4KORA 4R3LA 4B10A 2Z3MA 3DR6A 4YRHA 2GE3A 1MJAA 3DR8A 2ZW7A 3FRMA 1Z4RA 2B4DA 2FSRA 3EXNA 4AG7A 1K4JA 4RI1A 2HUZA 1VKCA 4IF5A 3FB3A 1MJ9A 2GIVA 4B13A 3CXSA 2DXQA 4JXQA 1KUXA 4MI4A 2YNCA 3D3SA 2C27A 5AG4A 4NSQA 3IGRA 2VI7A 4UFXA 3ZZIA 2VEZA 3TE4A 3G3SA 4MY3A 2FT0A 4MHDA 3D2MA 1XF8A 3N7ZA 4JLYA 2YGWA 4KUAA 3EC4A 2F5IA 3MGDA 4QC6A 3I3GA 1OZPA 4LUAA 4AVCA 4KOSA 3RYOA 4CAXA 2G3AA 3H4QA 3P2FA 3PGPA 2OB0A 4A95A 2Q4YA 2REEA 1QSNA 2VBQA 4YFJA 1S7NA 3QAHA 4CYQA 2CNSA 2PRBA 5J8CA 5C88A 3R1KA 1Q2DA 4A2ZA 3TOBA 3TT2A 1L0CA 3A9LA 4KLVA 4QVTA 5C82A 4AG9A 1M44A 3W6SA 1M4IA 5EC4A 5HMNA 1YX0A 1S5KA 4CYPA 4B5PA 3FXTA 4KVME 4HNWB 2CXAA 2BEIA 4H6ZA 2P0WA 4MJ8A 2VZZA 5AG5A 3R96A 4PK2A 3I9SA 4DNCA 4MFKA 1M4DA 2I79A 4H6UA 1PU9A 4U9YA 4KVXA 2J8RA 3V8IA 1P0HA 2ZW4A 2VZYA 3DDDA 2Q04A 4M3SA 3SHPA 1RO5A 3QB8A 2JDDA 3LODA 1XEBA 1BO4A 4C2ZA 2K5TA 2JDCA 4QUSA 3B8GA 4PSWA 5J8FA 1LRZA 4AVAA 1I12A 2CY2A 4BMHA 2KCWA 2OZGA 3TO6A 4J3GA 3UY5A 4F0YA 1IYKA 3R95A 3OWCA 3IU2A 2H5MA 4H89A 4OADA 3W91A 2ZW5A 3FIXA 4CGPA 1M1DA 2X7BA 1QSMA 4C7IA 4CAWA 4UWJA 2AE6A 4U5YA 2G3TA 3ZJ0A 4QBJA 4NCZA 3S6GA 4IUSA 1QSTA 4R3KA 1YK3A 1S7FA 2A4NA 5H86A 3D2PA 1CJWA 4UA3A 1WWZA 2PQ8A 2IL4A 2AJ6A 2FIAA 4E0AA 4B14A 1S60A 5E96A 2PSWA 4ORFA 3H5ZA 5F48A 1S7KA 4K30A 4CGNA 2PC1A 1Y9WA 2R7HA 3F8KA 4B12A 3D8PA 1YREA 3BJ7A 3GY9A 2J8NA 1J4JA 4CRZB 2Z3PA 3FYNA 3SXOA 4A33A 2VQYA 5IB0A 2R98A 4A30A 3EFAA 2OZHA 4JXRA 4KUBA 4F0XA 4L89A 3R9GA 3CXPA 1MJBA 1IYLA 4KLWA 4OAEA 2WPWA 4KOUA 5G22A 1TIQA 1NSLA 4CS0B 4I49A 4KS9A 2REFA 4M85A 1YVOA 1NMTA 2Z3NA 2JLMA 1I21A 2B4DB 3S6HA 3TFYA 1QSOA 5F46A 4CGLA 5CNPA 2P6EA 4F6AA 1Y7RA 2DPSA 2YNCC 3VWDA 5EBVA 2HQYA 4KSFA 3JUWA 5A28A 4NXYA 4Y49C 2QIRA 3T90A 3JTKA 3JVNA 4NF1A 4C7HA 3FBUA 1YR0A 3TTHA 2YNDA 4U9ZA 2QMLA 4C68A 1B87A 4E8OA 5KTDA 2B4BA 3DNSA 2JEVA 2QECA 1XE4A 4XPDC 5JQ4A 4L8AA 2R8VA 4CGOA 3F0AA 2EUIA 4FD4A 1N71A 1YVKA 4CRYB 1QSRA 4CAFA 2Z3LA 1ZO0A 4KSAA 4PSXA 5H84A 5A27A 1XIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWE A;  2CNT A;  3R9F A;  2P6G A;  1Q2C A;  1Z4E A;  4B5P B;  2ZXV A;  1GHE A;  3E0K A;  2GAN A;  4XNH B;  4E2A A;  4YGO A;  5IV0 A;  4ZBG A;  3LD2 A;  1KZF A;  1R57 A;  4UWI A;  3W6X A;  4HNY B;  2PR1 A;  2B58 A;  2G0B A;  4R9M A;  3SXN A;  5I0C A;  2I00 A;  1YGH A;  4KOV A;  4PK3 A;  2FE7 A;  2RC4 A;  4MY0 A;  1FY7 A;  2OZU A;  1XMT A;  4LX9 A;  4UBR A;  3F5B A;  5DWM A;  1BOB A;  1IB1 E;  3WR7 A;  3EY5 A;  2Q4V A;  2ZW6 A;  1YLE A;  4CAV A;  3IWG A;  2B5G B;  1KUY A;  4NEX A;  3K9U A;  3S6K A;  2PR8 A;  3R9E A;  2EVN A;  2NMT A;  1M4G A;  1CM0 A;  4AVB A;  2B3V A;  2D4O A;  1U6M A;  4JWP A;  2Q7B A;  4B5O A;  3BLN A;  5KTA A;  2O28 A;  1VHS A;  1P4N A;  2FL4 A;  2P6F A;  2Z11 A;  4KVO E;  4KZT A;  2J8M A;  5JPH A;  4XPK A;  3CXQ A;  2R1I A;  5ISV A;  2Q0Y A;  4OLL A;  3KKW A;  5IX3 A;  3T9Y A;  2BSW A;  3DSB A;  1Y9K A;  3TO7 A;  1Q2Y A;  4QB9 A;  1KUV A;  3EO4 A;  4HKF A;  1WK4 A;  3BJ8 A;  4KOW A;  4R57 A;  4XPL A;  4Y49 B;  1NE9 A;  3GYA A;  4FD5 A;  1ON0 A;  2Y0M A;  4KOX A;  2ZPA A;  3FNC A;  5KTC A;  1IID A;  1I1D A;  4RS2 A;  2Z10 A;  3TCV A;  1Z9U A;  2BL1 A;  4JJX A;  2PDO A;  2ATR A;  1S3Z A;  4X5K A;  2B3U A;  5F47 A;  1PUA A;  2ARH A;  1RXT A;  2FIW A;  4XPD B;  2BUE A;  4GS4 A;  3NE7 A;  5F49 A;  2FCK A;  2CNM A;  2VXK A;  1SQH A;  4KOT A;  2Z0Z A;  4AB7 A;  3PZJ A;  3P2H A;  4PV6 A;  2WPX A;  4HNX B;  3PP9 A;  2OH1 A;  5GCN A;  3TOA A;  2FS5 A;  4MBU A;  4ONU A;  4II9 A;  3S6F A;  3TO9 A;  1B6B A;  2D4P A;  2OU2 A;  5HH1 A;  1MK4 A;  4EVY A;  4FD6 A;  2Q44 A;  4R87 A;  2B5G A;  5DWN A;  1IIC A;  1V0C A;  5FVJ A;  4FD7 A;  2FXF A;  4KOY A;  1S7L A;  1UFH A;  3G8W A;  4XNH C;  3GKR A;  3C26 A;  4JD6 A;  2HV2 A;  4KOR A;  4R3L A;  3DR6 A;  4YRH A;  2GE3 A;  1MJA A;  3DR8 A;  2ZW7 A;  3FRM A;  1Z4R A;  2B4D A;  2FSR A;  3EXN A;  4AG7 A;  1K4J A;  4RI1 A;  2HUZ A;  1VKC A;  4IF5 A;  3FB3 A;  1MJ9 A;  2GIV A;  3CXS A;  2DXQ A;  4JXQ A;  1KUX A;  4MI4 A;  3D3S A;  2C27 A;  4NSQ A;  3IGR A;  2VI7 A;  3ZZI A;  2VEZ A;  3TE4 A;  3G3S A;  4MY3 A;  2FT0 A;  4MHD A;  3D2M A;  1XF8 A;  3N7Z A;  4JLY A;  4KUA A;  3EC4 A;  2F5I A;  3MGD A;  4QC6 A;  3I3G A;  1OZP A;  4LUA A;  4AVC A;  4KOS A;  3RYO A;  4CAX A;  2G3A A;  3H4Q A;  3P2F A;  3PGP A;  2OB0 A;  2Q4Y A;  2REE A;  1QSN A;  2VBQ A;  4YFJ A;  1S7N A;  3QAH A;  2CNS A;  2PRB A;  5J8C A;  5C88 A;  3R1K A;  1Q2D A;  3TOB A;  3TT2 A;  1L0C A;  4KLV A;  4QVT A;  5C82 A;  4AG9 A;  1M44 A;  3W6S A;  1M4I A;  5EC4 A;  5HMN A;  1YX0 A;  1S5K A;  4B5P A;  3FXT A;  4KVM E;  4HNW B;  2BEI A;  4H6Z A;  2P0W A;  4MJ8 A;  2VZZ A;  3R96 A;  4PK2 A;  3I9S A;  4DNC A;  1M4D A;  2I79 A;  4H6U A;  1PU9 A;  4U9Y A;  4KVX A;  2J8R A;  3V8I A;  1P0H A;  2ZW4 A;  2VZY A;  3DDD A;  2Q04 A;  4M3S A;  3SHP A;  1RO5 A;  3QB8 A;  2JDD A;  3LOD A;  1XEB A;  1BO4 A;  2K5T A;  2JDC A;  4QUS A;  3B8G A;  4PSW A;  5J8F A;  1LRZ A;  4AVA A;  1I12 A;  2CY2 A;  4BMH A;  2KCW A;  2OZG A;  3TO6 A;  4J3G A;  3UY5 A;  4F0Y A;  1IYK A;  3R95 A;  3OWC A;  2H5M A;  4H89 A;  4OAD A;  3W91 A;  2ZW5 A;  3FIX A;  1M1D A;  2X7B A;  1QSM A;  4CAW A;  4UWJ A;  2AE6 A;  4U5Y A;  2G3T A;  3ZJ0 A;  4QBJ A;  4NCZ A;  3S6G A;  4IUS A;  1QST A;  4R3K A;  1YK3 A;  1S7F A;  2A4N A;  5H86 A;  3D2P A;  1CJW A;  4UA3 A;  1WWZ A;  2PQ8 A;  2IL4 A;  2AJ6 A;  2FIA A;  4E0A A;  1S60 A;  5E96 A;  2PSW A;  4ORF A;  5F48 A;  1S7K A;  4K30 A;  2PC1 A;  1Y9W A;  2R7H A;  3F8K A;  3D8P A;  1YRE A;  3BJ7 A;  3GY9 A;  2J8N A;  1J4J A;  4CRZ B;  3FYN A;  3SXO A;  2VQY A;  5IB0 A;  2R98 A;  3EFA A;  2OZH A;  4JXR A;  4KUB A;  4L89 A;  3R9G A;  3CXP A;  1MJB A;  1IYL A;  4KLW A;  4OAE A;  2WPW A;  4KOU A;  1TIQ A;  1NSL A;  4CS0 B;  4I49 A;  2REF A;  4M85 A;  1YVO A;  1NMT A;  2JLM A;  1I21 A;  2B4D B;  3S6H A;  3TFY A;  1QSO A;  5F46 A;  5CNP A;  2P6E A;  4F6A A;  1Y7R A;  3VWD A;  5EBV A;  2HQY A;  3JUW A;  4NXY A;  4Y49 C;  2QIR A;  3T90 A;  3JVN A;  4NF1 A;  3FBU A;  1YR0 A;  3TTH A;  4U9Z A;  2QML A;  1B87 A;  4E8O A;  5KTD A;  2B4B A;  3DNS A;  2JEV A;  2QEC A;  1XE4 A;  4XPD C;  5JQ4 A;  4L8A A;  2R8V A;  3F0A A;  2EUI A;  4FD4 A;  1N71 A;  1YVK A;  4CRY B;  1QSR A;  4PSX A;  5H84 A;  1XIX A; 
#chains in the Genus database with same CATH topology
 1ZG8 A;  1BPN A;  1F2O A;  4LQG A;  4UCM A;  1LAP A;  3VWE A;  1TKH A;  2CNT A;  3R9F A;  2P6G A;  1Q2C A;  3IFE A;  4A37 A;  1Z4E A;  4B5P B;  2ZXV A;  3PB4 X;  1GHE A;  3E0K A;  2GAN A;  1RTQ A;  3NFZ A;  4XNH B;  4YGO A;  5G21 A;  4E2A A;  2BO9 A;  4O23 A;  2PCU A;  4ZGY B;  5IV0 A;  4P4J A;  4PXD A;  4UCN A;  5I4M A;  1VHE A;  2WSA A;  2QVP A;  4UCP A;  4ZBG A;  4ZX8 A;  1LAM A;  5BWA B;  3LD2 A;  3SJE A;  1KZF A;  2Z3O A;  1R57 A;  2V8V A;  4UWI A;  3W6X A;  5LYL A;  4HNY B;  2PR1 A;  3RAM A;  4UIA A;  4CGM A;  4FBE A;  1TF8 A;  3CPA A;  3GLJ A;  2B58 A;  3FF3 A;  2G0B A;  4NJR A;  4A32 A;  1BPM A;  4R9M A;  2PJ5 A;  3SXN A;  5I0C A;  1Z2L A;  1YGH A;  2I00 A;  4KOV A;  1AUG A;  1ZG7 A;  4PK3 A;  4C2X A;  4EFD A;  4M6I A;  2FE7 A;  2IMO A;  2RC4 A;  2AFM A;  3IU1 A;  1ZLH A;  4MY0 A;  1FY7 A;  2G9D A;  2OZU A;  4MFZ A;  5AGE A;  1XMT A;  4IHM A;  4HPS A;  4LX9 A;  4UBR A;  4CYN A;  3F5B A;  5DWM A;  1BOB A;  2C6G A;  3SJG A;  1IB1 E;  3QNV A;  4CYO A;  2DPT A;  1TF9 A;  3WR7 A;  4MFL A;  4OC5 A;  3EY5 A;  4MXU A;  3FEE A;  4ZY1 A;  3CT9 A;  5HVH A;  2Q4V A;  3S9N A;  2ZW6 A;  1YLE A;  3D4U A;  3DLJ A;  3IWG A;  1AYE A;  2B5G B;  2PIY A;  1IGB A;  3DGV A;  4CAV A;  1KUY A;  4NEX A;  3K9U A;  4BBH A;  3S6K A;  3SI0 A;  5EMI A;  4P4I A;  2PR8 A;  3R9E A;  2EVN A;  5HVF A;  2CTB A;  1M4G A;  2NMT A;  3KHZ A;  4Q36 A;  4R8F A;  5K8P A;  3RNZ A;  1CM0 A;  4AVB A;  2YNE A;  2B3V A;  4GM5 A;  3ISX A;  1ELM P;  1Y0R A;  2D4O A;  1YME A;  1CP7 A;  1U6M A;  4MHY A;  2ZEM A;  3KHX A;  4JWP A;  2Q7B A;  4B5O A;  3BLN A;  5KTA A;  2HB6 A;  2O28 A;  1VHS A;  1P4N A;  2FL4 A;  2Z3K A;  2P6F A;  2Z11 A;  1IOF A;  4KVO E;  4KZT A;  5G20 A;  4NGP A;  4C2Y A;  2EO8 A;  1XJO A;  2J8M A;  4R76 A;  2PVW A;  4P44 A;  2WUU A;  5JPH A;  2C6P A;  4NGN A;  3CXQ A;  2R1I A;  2HC9 A;  4TWE A;  4XPK A;  5ISV A;  3VH9 A;  2Q0Y A;  1F57 A;  4OLL A;  5AG6 A;  4MHP A;  3KKW A;  1ZLI A;  3NE8 A;  5IX3 A;  3K9T A;  3PB9 X;  3T9Y A;  2BSW A;  2J9A A;  3DSB A;  3PFE A;  1Y9K A;  2AFU A;  4FUU A;  1Q2Y A;  3TO7 A;  3MN8 A;  4QB9 A;  3B3T A;  1KUV A;  3EO4 A;  4HKF A;  1WK4 A;  3BJ8 A;  4KOW A;  2PJ1 A;  4R57 A;  4XPL A;  4Y49 B;  1NE9 A;  2V77 A;  3GYA A;  4FD5 A;  2PE3 A;  1ELL P;  1FT7 A;  1ON0 A;  2Y0M A;  1XMB A;  4KOX A;  2ZPA A;  3FNC A;  4MHZ A;  5KTC A;  1IID A;  4G1P A;  4MCP A;  4MCR A;  3KR5 A;  1I1D A;  4RS2 A;  4MFP A;  2Z10 A;  5LRJ A;  4NGQ A;  2ZEL A;  3TCV A;  1Z9U A;  4UEF A;  2BL1 A;  4JJX A;  2EWB A;  2PDO A;  4MFQ A;  4MRI A;  2ATR A;  5G1Z A;  1S3Z A;  4X5K A;  2B3U A;  5F47 A;  3PBB A;  1PUA A;  3B2Y A;  4CAE A;  2ARH A;  1RXT A;  2FIW A;  3D7F A;  4Q38 A;  4XPD B;  4A31 A;  2V8H A;  2BUE A;  4GS4 A;  1PCA A;  2ZOF A;  4NGS A;  2O53 A;  3NE7 A;  5F49 A;  2FCK A;  2CNM A;  2VXK A;  1SQH A;  4KOT A;  2Z0Z A;  4AB7 A;  1Z8L A;  3PZJ A;  3P2H A;  4NFR A;  4Q7A A;  4DYO A;  4PV6 A;  2Q51 A;  5K8N A;  2WPX A;  3BI0 A;  3PP9 A;  4HNX B;  4KSI A;  2OH1 A;  3KGQ A;  5GCN A;  3TOA A;  1DTD A;  2FS5 A;  2JEW A;  4UIB A;  2PJA A;  2EK9 A;  4MMO A;  2PJB A;  3D7D A;  3KQZ A;  3IWE A;  4MBU A;  3SI1 A;  4ONU A;  4Z65 A;  4II9 A;  3S6F A;  4NJQ A;  4YWY A;  3TO9 A;  3NH5 A;  1UWY A;  1B6B A;  2D4P A;  2OU2 A;  5HH1 A;  5DS0 A;  1MK4 A;  4X8I A;  2ZEP A;  4FD6 A;  2Q44 A;  4EVY A;  2OOT A;  4R87 A;  5IB9 A;  2B5G A;  3NH8 A;  2BOA A;  4UFW A;  1IIC A;  5DWN A;  1V0C A;  2QJ8 A;  4UFV A;  5FVJ A;  4FD7 A;  3H8E A;  2FXF A;  4KOY A;  4P4D A;  1S7L A;  4MFJ A;  4B11 A;  1UFH A;  3G8W A;  4XNH C;  5AG7 A;  1IOI A;  5D29 A;  4ZX9 A;  3S9M A;  3PRT A;  4MCS A;  3GKR A;  3C26 A;  4JD6 A;  2HV2 A;  4KOR A;  2GLF A;  4R3L A;  4B10 A;  2Z3M A;  3DR6 A;  4YRH A;  5LRG A;  2ZEE A;  4DUK A;  3FJU A;  2GE3 A;  1MJA A;  3DR8 A;  1Z8W A;  4X2T A;  2ZW7 A;  2XEF A;  3FRM A;  1Z4R A;  1YQE A;  2B4D A;  2FSR A;  3EXN A;  4AG7 A;  1K4J A;  4RUH A;  4OID A;  2Q43 A;  2HUZ A;  2VL1 A;  2CF4 A;  1VKC A;  2EK8 A;  4RI1 A;  2Q7S A;  4IF5 A;  3V7Z A;  3FB3 A;  1MJ9 A;  2GIV A;  1IY7 A;  2NYQ A;  3D67 A;  4B13 A;  3CXS A;  8CPA A;  2DXQ A;  1XFO A;  1KUX A;  1TKJ A;  1X10 A;  4JXQ A;  3B3S A;  4IAV A;  4MI4 A;  2YNC A;  3D3S A;  3V38 A;  2C27 A;  5AG4 A;  4NSQ A;  4UF4 A;  3IGR A;  2VI7 A;  4UFX A;  3PB8 X;  2AFX A;  1BAV A;  2VEZ A;  3GUX A;  5LYD A;  3ZZI A;  3TE4 A;  3G3S A;  1Q7L A;  4YU9 A;  3D66 A;  4OC2 A;  4MY3 A;  1LAN A;  2FT0 A;  1CPS A;  1JQG A;  4MHD A;  4UEZ A;  4F9U A;  3D2M A;  1XF8 A;  3N7Z A;  4JLY A;  3SJX A;  5F09 A;  2YGW A;  2AFO A;  3KAS A;  4K3N A;  5JGF A;  4KUA A;  3EC4 A;  3FEC A;  2F5I A;  2V8G A;  3MGD A;  2ZOG A;  3WC6 A;  4QC6 A;  3I3G A;  1OZP A;  3IJ3 A;  1VHO A;  1GYT A;  3SJF A;  4LUA A;  4AVC A;  2IQ6 A;  4KOS A;  3RYO A;  3TC8 A;  4CAX A;  4WWV A;  4H2K A;  4PQA A;  2G3A A;  1AMP A;  1M4L A;  2XEI A;  3H4Q A;  3P2F A;  3PGP A;  2OB0 A;  3D7G A;  4A39 A;  2Q4Y A;  3IIB A;  4A95 A;  2REE A;  3LMS A;  1QSN A;  1TKF A;  2VBQ A;  1YW4 A;  2F8H A;  2GFQ A;  4YFJ A;  1S7N A;  3QAH A;  4UEE A;  4CYQ A;  2CNS A;  5LYF A;  2PRB A;  5J8C A;  1CPX A;  2ZED A;  5C88 A;  3KL9 A;  3R1K A;  1Q2D A;  4A2Z A;  1TXR A;  1ARL A;  3TOB A;  1L0C A;  3A9L A;  3FVL A;  4KLV A;  4QVT A;  2C1C A;  3TT2 A;  5C82 A;  4ZY2 A;  4AG9 A;  1M44 A;  2CIJ A;  1EE3 P;  3WC7 A;  3W6S A;  3B7I A;  3WC5 A;  1M4I A;  4OIW A;  5EC4 A;  2PJ9 A;  2ZEO A;  3B3V A;  3JRU A;  5HMN A;  1YX0 A;  5CBM A;  5JM6 A;  1S5K A;  4CYP A;  3N5F A;  4B5P A;  3FXT A;  3KQX A;  4KVM E;  4HNW B;  4EME A;  4P6Y A;  2CXA A;  2BEI A;  4H6Z A;  3BHX A;  1LCP A;  2P0W A;  2I3C A;  1X12 A;  3FX6 A;  4MJ8 A;  2VZZ A;  4WJB A;  5AG5 A;  3R96 A;  4PK2 A;  2PRQ A;  3I9S A;  2GRE A;  4ZI6 A;  4DNC A;  4MFK A;  4OME A;  4P4B A;  1M4D A;  1HEE A;  2I79 A;  4H6U A;  1PU9 A;  4U9Y A;  4KVX A;  2J8R A;  4RN7 A;  3V8I A;  2PJ3 A;  5D8N A;  1QQ9 A;  1P0H A;  1F2P A;  2ZW4 A;  3VAT A;  2VZY A;  3PB7 X;  3DDD A;  3GB0 A;  4FAI A;  2Q04 A;  4M3S A;  6CPA A;  3WT4 A;  4A94 A;  1CG2 A;  3SHP A;  1RO5 A;  5K8O A;  3QB8 A;  2JDD A;  3LOD A;  1XEB A;  1NSA A;  4ONW A;  3GIU A;  1BO4 A;  4P4F A;  4C2Z A;  2ABZ A;  2DF5 A;  2K5T A;  4FWU A;  2JDC A;  4QUS A;  2ZEH A;  2QYV A;  3D68 A;  3B8G A;  4PSW A;  3VAR A;  4R7M A;  3CZX A;  2ANP A;  4EWT A;  5J8F A;  1LRZ A;  4AVA A;  1FNO A;  1QMU A;  1I12 A;  1JWQ A;  7CPA A;  5J1Q A;  2CY2 A;  4BMH A;  3CDX A;  2KCW A;  4BIN A;  2OZG A;  3TO6 A;  4J3G A;  3UY5 A;  4F0Y A;  4JZ0 A;  4NGR A;  1IYK A;  3HUV A;  3R95 A;  3OWC A;  2GLJ A;  3ISZ A;  4OC4 A;  3IU2 A;  3PEI A;  2H5M A;  4ZY0 A;  3FED A;  4H89 A;  4OC1 A;  4OAD A;  1CX8 A;  2PJ6 A;  3W91 A;  2ZW5 A;  2GU2 A;  1VIX A;  2WYR A;  3FIX A;  4B6Z A;  4CGP A;  4IK2 A;  5HXD A;  2XEJ A;  4PXB A;  1M1D A;  2X7B A;  3TX8 A;  1QSM A;  4C7I A;  4CAW A;  1KWM A;  4UWJ A;  2AE6 A;  4U5Y A;  2G3T A;  4M6H A;  3ZJ0 A;  4QBJ A;  3IWW A;  3LAC A;  4NCZ A;  1ZG9 A;  3S6G A;  4IUS A;  1QST A;  4LQ6 A;  4AXV A;  1R43 A;  4R3K A;  3RZA A;  1YK3 A;  2XEG A;  1S7F A;  2A4N A;  1Z8X A;  5ELY A;  4JYW A;  2PJ8 A;  2AFW A;  1YLO A;  5H86 A;  3D2P A;  1CJW A;  4UA3 A;  1CP6 A;  3FH4 A;  3NA6 A;  3S9L A;  4A38 A;  2RB7 A;  1WWZ A;  2PQ8 A;  2IL4 A;  1YW6 A;  2AJ6 A;  2EBJ A;  2FIA A;  4E0A A;  4B14 A;  1S60 A;  5E96 A;  2PSW A;  4P4E A;  2AFS A;  2RFH A;  3IC1 A;  3QAY A;  4M6G A;  4ORF A;  3H5Z A;  5F48 A;  1S7K A;  4K30 A;  4CGN A;  2PC1 A;  1Y9W A;  2R7H A;  1Y0Y A;  3F8K A;  4B12 A;  3D8P A;  1YRE A;  3B35 A;  3BJ7 A;  5K8M A;  3KR4 A;  3GY9 A;  1LOK A;  1HDQ A;  2J8N A;  5HVG A;  1OBR A;  2POK A;  1J4J A;  2CTC A;  2Z3P A;  3FYN A;  3SXO A;  3B3C A;  4NGT A;  4CRZ B;  5CPA A;  3H8F A;  2PJC A;  2ODF A;  4A33 A;  3RBU A;  4PXC A;  2VQY A;  3IO1 A;  1R3N A;  3PB6 X;  4ZYQ A;  5IB0 A;  2BCO A;  2PJ4 A;  2Q4Z A;  2JBJ A;  3BI1 A;  4BD9 A;  2R98 A;  3HLP A;  4OC3 A;  3KI9 A;  1Y7E A;  4A30 A;  3EFA A;  2OZH A;  4JXR A;  4KUB A;  4W9Y A;  4L89 A;  2WZN A;  3R9G A;  4F0X A;  5JH9 A;  3CXP A;  1MJB A;  1IYL A;  4KLW A;  4OAE A;  2WPW A;  4KOU A;  5G22 A;  1TIQ A;  1NSL A;  4CS0 B;  4I49 A;  2PIZ A;  4KS9 A;  4OC0 A;  1A2Z A;  2REF A;  4OKO A;  1XOV A;  4M85 A;  1YVO A;  1NMT A;  2Z3N A;  2O4H A;  2JLM A;  3I1U A;  1I21 A;  2B4D B;  5THW A;  3S6H A;  3TFY A;  1QSO A;  1VGY A;  2AFZ A;  5F46 A;  4CGL A;  4PPZ A;  5CNP A;  3NH4 A;  3D7H A;  2P6E A;  4OP4 A;  4PXE A;  2DPS A;  1Y7R A;  1CBX A;  1YSJ A;  4F6A A;  1HDU A;  2YNC C;  3LWU A;  3VWD A;  1ARM A;  1XRY A;  2IJZ A;  5EBV A;  2HQY A;  4GXH A;  4KSF A;  3JUW A;  2DEA A;  2ZEG A;  5A28 A;  4NXY A;  4MCQ A;  2PJ7 A;  2QIR A;  4Y49 C;  3SI2 A;  4DJL A;  5LRK A;  3T90 A;  3T8W A;  3KZW A;  3JTK A;  3JVN A;  3L2N A;  4NF1 A;  4CPA A;  3H8G A;  1BLL E;  4C7H A;  3FBU A;  1LFW A;  1YR0 A;  1Z5R A;  2NSM A;  1H8L A;  3K2K A;  3TTH A;  2YND A;  1XBU A;  2C6C A;  2ZEF A;  4F8Z A;  3B3W A;  4U9Z A;  4R6T A;  2QML A;  1PYT B;  2OR4 A;  3MRU A;  2V8D A;  4P10 A;  4C68 A;  1B87 A;  4E8O A;  2ZEN A;  3PBE A;  4X3R A;  1Z8T A;  5KTD A;  3WAB A;  3PFO A;  4NGM A;  2B4B A;  3DNS A;  2PJ2 A;  2JEV A;  2QEC A;  1IU8 A;  4F9V A;  2FVG A;  1XE4 A;  2F7V A;  4XPD C;  5JQ4 A;  4L8A A;  2R8V A;  4CGO A;  3F0A A;  5LYI A;  2EUI A;  4FD4 A;  1N71 A;  4MHN A;  1YVK A;  2JBK A;  4CRY B;  3BXM A;  1QSR A;  2PJ0 A;  3RO0 A;  3CPX A;  4P45 A;  4CAF A;  2Z3L A;  1ZO0 A;  1DE4 C;  4KSA A;  4PSX A;  5H84 A;  3FMC A;  5A27 A;  3IEH A;  1XIX A;  4TNU A;  2PVV A; 
#chains in the Genus database with same CATH homology
 4UCM A;  3VWE A;  2CNT A;  3R9F A;  2P6G A;  1Q2C A;  1Z4E A;  4B5P B;  2ZXV A;  1GHE A;  3E0K A;  2GAN A;  4XNH B;  4E2A A;  4YGO A;  5G21 A;  4ZGY B;  5IV0 A;  4UCN A;  2WSA A;  4UCP A;  4ZBG A;  5BWA B;  3LD2 A;  1KZF A;  2Z3O A;  1R57 A;  4UWI A;  3W6X A;  4HNY B;  2PR1 A;  4CGM A;  2B58 A;  2G0B A;  4A32 A;  4R9M A;  3SXN A;  5I0C A;  2I00 A;  1YGH A;  4KOV A;  4PK3 A;  4C2X A;  2FE7 A;  2RC4 A;  3IU1 A;  4MY0 A;  1FY7 A;  2OZU A;  4MFZ A;  5AGE A;  1XMT A;  4LX9 A;  4UBR A;  4CYN A;  3F5B A;  5DWM A;  1BOB A;  1IB1 E;  4CYO A;  2DPT A;  3WR7 A;  4MFL A;  3EY5 A;  2Q4V A;  2ZW6 A;  1YLE A;  4CAV A;  3IWG A;  2B5G B;  1KUY A;  4NEX A;  3K9U A;  4BBH A;  3S6K A;  2PR8 A;  3R9E A;  2EVN A;  2NMT A;  1M4G A;  4Q36 A;  1CM0 A;  4AVB A;  2YNE A;  2B3V A;  2D4O A;  1U6M A;  4JWP A;  2Q7B A;  4B5O A;  3BLN A;  5KTA A;  2O28 A;  1VHS A;  1P4N A;  2FL4 A;  2Z3K A;  2P6F A;  2Z11 A;  4C2Y A;  4KVO E;  4KZT A;  5G20 A;  2J8M A;  2WUU A;  5JPH A;  4XPK A;  3CXQ A;  2R1I A;  5ISV A;  2Q0Y A;  4OLL A;  5AG6 A;  3KKW A;  5IX3 A;  3T9Y A;  2BSW A;  3DSB A;  1Y9K A;  3TO7 A;  1Q2Y A;  4QB9 A;  1KUV A;  3EO4 A;  4HKF A;  1WK4 A;  3BJ8 A;  4KOW A;  4R57 A;  4XPL A;  4Y49 B;  1NE9 A;  3GYA A;  4FD5 A;  1ON0 A;  2Y0M A;  4KOX A;  2ZPA A;  3FNC A;  5KTC A;  1IID A;  1I1D A;  4RS2 A;  4MFP A;  2Z10 A;  3TCV A;  1Z9U A;  2BL1 A;  4JJX A;  2PDO A;  4MFQ A;  2ATR A;  5G1Z A;  1S3Z A;  4X5K A;  2B3U A;  5F47 A;  1PUA A;  4CAE A;  2ARH A;  1RXT A;  2FIW A;  4Q38 A;  4A31 A;  4XPD B;  2BUE A;  4GS4 A;  3NE7 A;  5F49 A;  2FCK A;  2CNM A;  2VXK A;  1SQH A;  4KOT A;  2Z0Z A;  4AB7 A;  3PZJ A;  3P2H A;  4PV6 A;  2WPX A;  4HNX B;  3PP9 A;  2OH1 A;  5GCN A;  3TOA A;  2FS5 A;  3IWE A;  4MBU A;  4ONU A;  4II9 A;  3S6F A;  3TO9 A;  1B6B A;  2D4P A;  2OU2 A;  5HH1 A;  1MK4 A;  4EVY A;  4FD6 A;  2Q44 A;  4R87 A;  2B5G A;  5DWN A;  4UFW A;  1IIC A;  1V0C A;  4UFV A;  5FVJ A;  4FD7 A;  2FXF A;  4KOY A;  1S7L A;  4MFJ A;  4B11 A;  1UFH A;  3G8W A;  4XNH C;  5AG7 A;  3GKR A;  3C26 A;  4JD6 A;  2HV2 A;  4KOR A;  4R3L A;  4B10 A;  2Z3M A;  3DR6 A;  4YRH A;  2GE3 A;  1MJA A;  3DR8 A;  2ZW7 A;  3FRM A;  1Z4R A;  2B4D A;  2FSR A;  3EXN A;  4AG7 A;  1K4J A;  4RI1 A;  2HUZ A;  1VKC A;  4IF5 A;  3FB3 A;  1MJ9 A;  2GIV A;  4B13 A;  3CXS A;  2DXQ A;  4JXQ A;  1KUX A;  4MI4 A;  2YNC A;  3D3S A;  2C27 A;  5AG4 A;  4NSQ A;  3IGR A;  2VI7 A;  4UFX A;  3ZZI A;  2VEZ A;  3TE4 A;  3G3S A;  4MY3 A;  2FT0 A;  4MHD A;  3D2M A;  1XF8 A;  3N7Z A;  4JLY A;  2YGW A;  4KUA A;  3EC4 A;  2F5I A;  3MGD A;  4QC6 A;  3I3G A;  1OZP A;  4LUA A;  4AVC A;  4KOS A;  3RYO A;  4CAX A;  2G3A A;  3H4Q A;  3P2F A;  3PGP A;  2OB0 A;  4A95 A;  2Q4Y A;  2REE A;  1QSN A;  2VBQ A;  4YFJ A;  1S7N A;  3QAH A;  4CYQ A;  2CNS A;  2PRB A;  5J8C A;  5C88 A;  3R1K A;  1Q2D A;  4A2Z A;  3TOB A;  3TT2 A;  1L0C A;  3A9L A;  4KLV A;  4QVT A;  5C82 A;  4AG9 A;  1M44 A;  3W6S A;  1M4I A;  5EC4 A;  5HMN A;  1YX0 A;  1S5K A;  4CYP A;  4B5P A;  3FXT A;  4KVM E;  4HNW B;  2CXA A;  2BEI A;  4H6Z A;  2P0W A;  4MJ8 A;  2VZZ A;  5AG5 A;  3R96 A;  4PK2 A;  3I9S A;  4DNC A;  4MFK A;  1M4D A;  2I79 A;  4H6U A;  1PU9 A;  4U9Y A;  4KVX A;  2J8R A;  3V8I A;  1P0H A;  2ZW4 A;  2VZY A;  3DDD A;  2Q04 A;  4M3S A;  3SHP A;  1RO5 A;  3QB8 A;  2JDD A;  3LOD A;  1XEB A;  1BO4 A;  4C2Z A;  2K5T A;  2JDC A;  4QUS A;  3B8G A;  4PSW A;  5J8F A;  1LRZ A;  4AVA A;  1I12 A;  2CY2 A;  4BMH A;  2KCW A;  2OZG A;  3TO6 A;  4J3G A;  3UY5 A;  4F0Y A;  1IYK A;  3R95 A;  3OWC A;  3IU2 A;  2H5M A;  4H89 A;  4OAD A;  3W91 A;  2ZW5 A;  3FIX A;  4CGP A;  1M1D A;  2X7B A;  1QSM A;  4C7I A;  4CAW A;  4UWJ A;  2AE6 A;  4U5Y A;  2G3T A;  3ZJ0 A;  4QBJ A;  4NCZ A;  3S6G A;  4IUS A;  1QST A;  4R3K A;  1YK3 A;  1S7F A;  2A4N A;  5H86 A;  3D2P A;  1CJW A;  4UA3 A;  1WWZ A;  2PQ8 A;  2IL4 A;  2AJ6 A;  2FIA A;  4E0A A;  4B14 A;  1S60 A;  5E96 A;  2PSW A;  4ORF A;  3H5Z A;  5F48 A;  1S7K A;  4K30 A;  4CGN A;  2PC1 A;  1Y9W A;  2R7H A;  3F8K A;  4B12 A;  3D8P A;  1YRE A;  3BJ7 A;  3GY9 A;  2J8N A;  1J4J A;  4CRZ B;  2Z3P A;  3FYN A;  3SXO A;  4A33 A;  2VQY A;  5IB0 A;  2R98 A;  4A30 A;  3EFA A;  2OZH A;  4JXR A;  4KUB A;  4F0X A;  4L89 A;  3R9G A;  3CXP A;  1MJB A;  1IYL A;  4KLW A;  4OAE A;  2WPW A;  4KOU A;  5G22 A;  1TIQ A;  1NSL A;  4CS0 B;  4I49 A;  4KS9 A;  2REF A;  4M85 A;  1YVO A;  1NMT A;  2Z3N A;  2JLM A;  1I21 A;  2B4D B;  3S6H A;  3TFY A;  1QSO A;  5F46 A;  4CGL A;  5CNP A;  2P6E A;  4F6A A;  1Y7R A;  2DPS A;  2YNC C;  3VWD A;  5EBV A;  2HQY A;  4KSF A;  3JUW A;  5A28 A;  4NXY A;  4Y49 C;  2QIR A;  3T90 A;  3JTK A;  3JVN A;  4NF1 A;  4C7H A;  3FBU A;  1YR0 A;  3TTH A;  2YND A;  4U9Z A;  2QML A;  4C68 A;  1B87 A;  4E8O A;  5KTD A;  2B4B A;  3DNS A;  2JEV A;  2QEC A;  1XE4 A;  4XPD C;  5JQ4 A;  4L8A A;  2R8V A;  4CGO A;  3F0A A;  2EUI A;  4FD4 A;  1N71 A;  1YVK A;  4CRY B;  1QSR A;  4CAF A;  2Z3L A;  1ZO0 A;  4KSA A;  4PSX A;  5H84 A;  5A27 A;  1XIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...