3LD5A

Human aldose reductase mutant t113s complexed with idd594
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ld5A00
3LENA 4L1XA 2IPGA 3T42A 3LBOA 4R9OA 4LAUA 1EL3A 2HEJA 4NKCA 1MI3A 4WDTA 1Q13A 2PDIA 4ASTA 3N6QA 3UGRA 3MB9A 2IQDA 4OTKA 4F40A 4GA8A 2NVCA 1UR3M 2R9RA 4JQ1A 1ZUAX 2QXWA 3LQLA 4XVDA 4H7CA 4PR4A 2IPJA 2FGBA 2AGTA 1SM9A 4YVVA 4JIRA 2IKGA 4WRHA 3H4GA 3LEPA 3R94A 4XO7A 3KRBA 1VBJA 3CV6A 1IEIA 5LIWX 5AZ0A 1VP5A 4YVPA 3GHSA 3CAQA 3ERPA 2I16A 1HQTA 4QR6A 4LB3A 3R8GA 3R7MA 3UZZA 2PFHA 2PDXA 5JH2A 3D3FA 5HA7A 1X96A 3Q67A 3EB3A 3ONBA 3LNMA 2ALRA 2WZMA 4DBWA 1AH3A 3R8HA 2PD5A 2A79A 4EXBA 2DUZA 5DANA 3UG8A 4HMNA 1RALA 4FA3A 1YE4A 2FZBA 1JEZA 2VDGA 2FZ8A 3RX3A 2ACSA 1RY0A 2IQ0A 3DN5A 4XZNX 4Q7BA 3UZXA 4PMJA 2PDGA 2PDKA 4JQAA 3R43A 3V36A 2PDMA 3BURA 2IKHA 2INZA 3V0TA 4GCAA 4XAPA 3F7JA 4JIIX 2PF8A 4WGHA 1IHIA 1S2CA 5M2FX 2PDYA 4FAMA 4PUWA 3P2VA 2PDWA 2ACQA 3H7RA 2BGQA 2PZNA 4JQ2A 3O0KA 3VXGA 1PYFA 1AH4A 3BUVA 4LAZA 4XVEA 1FRBA 4DBSA 4RPQA 3FX4A 2IKIA 4JQ4A 2IKJA 2ISFA 2HE5A 1Q5MA 3UZWA 2BGSA 1PWMA 5KETA 3C3UA 4L1WA 1ADSA 2PD9A 2WZTA 2C91A 3UWEA 4QX4A 1YNPA 3S3GA 4FALA 2PDFA 1US0A 4GQGA 4IGSA 3QKZA 3RX2A 3WCZA 1EKOA 4WDXA 3GHTA 4YS1A 1OG6A 4XZHA 5LIUX 3V35A 3M64A 1YE6A 4HBKA 3U2CA 2BP1A 3EB4A 4G5DA 4I5XA 3CASA 2FZ9A 3LD5A 3WG6A 1ZGDA 3BCJA 3RX4A 1RY8A 1ZSXA 2PDCA 3B3DA 3G5EA 2J8TA 2FVLA 3UYIA 1PWLA 4XZLX 4GACA 4PUUA 1Z8AA 3CMFA 3LUTA 2IS7A 1MRQA 4EXAA 3V0UA 4FZIA 4JTQA 1YNQA 1PZ1A 4YVXA 4GIEA 4WEVX 1T40A 1XJBA 2HVNA 4DZ5A 2INEA 2PDJA 2HE8A 2PDUA 1MZRA 3CAVA 3COTA 4JTDA 1EXBA 1S2AA 4JTAA 5C7HA 4Q3MA 4DBUA 3LZ3A 3CV7A 3BV7A 4GABA 4ICCX 4LBSA 2IPWA 1K8CA 3M4HA 2DV0A 2PDLA 2PDNA 1LQAA 1X97A 1Z3NA 5HNUA 1AZ1A 4AUBA 4LB4A 1Z9AA 5LIYX 4ZFCA 4QXIA 5LIXX 3WBYA 4XK2A 3G1RA 3ONCA 1Z89A 1M9HA 1AZ2A 2I17A 2HDJA 4LBRA 1EF3A 3R58A 5JH1A 4H8NA 1HW6A 4XZMX 1C9WA 4JTCA 2IPFA 4JQ3A 2HV5A 5AZ1A 1T41A 2F2KA 1A80A 1PZ0A 3O3RA 2ACUA 1X98A 3Q65A 3UP8A 4IJCA 3UZYA 5HNTA 1S1PA 1ZQ5A 3GHRA 4MHBA 2NVDA 4PRTA 1XF0A 4YU1A 3WBWA 2CLPA 2ACRA 1J96A 4JTRA 3V0SA 1GVEA 4IJRA 2F38A 2PDPA 1XGDA 2HVOA 3R6IA 3GHUA 3DOPA 1QWKA 3M0IA 2P5NA 4XZIA 1QRQA 1AH0A 3LQGA 2R24A 2DUXA 3UFYA 3LN3A 5LIKX 3GUGA 4WDUA 2PDBA 2PEVA 3MC5A 4XO6A 4PRRA 2FZDA 1AFSA 3NTYA 3LZ5A 1R38A 4WDWA 3FJNA 2PDQA 3N2TA 2PDHA 3EAUA 4GQ0A 3H7UA 1LWIA 4QBXA 4JIHA 1S1RA 3WBXA
chains in the Genus database with same CATH superfamily
1K6AA 3MPGA 1CXHA 4QGCA 2HBXA 4Z2HA 1KV8A 4WK9A 1IR2A 4HSHA 1ZCCA 4H8HA 2A3BA 3ANVA 4PTNA 3WD2A 3UWYA 2BOEX 4M5PA 2PLCA 4JN8A 3NVTA 3IGXA 3GC4A 2OLHA 4LYKA 1GTHA 1RSCA 3LI1A 1DJHA 1V8EA 1A5OC 5IHRA 3DC0A 4LAMA 1XICA 4D2JA 3WLSA 2RH9A 3ZLGA 4XG1A 4XVDA 3L0NA 2QF8A 4UCFA 2A3EA 4OU1A 3BZGA 4Q8NA 2OT0A 2PGFA 2XSXA 1CB2A 1SM9A 2PF0A 3IIPA 3M0YA 4KWUA 1SMAA 1ME9A 3EX1A 5C2GA 2OWXA 2Z2AA 3CV6A 2HWGA 3PJXA 3N2BA 1B2YA 1WKEA 2WHJA 3G1FA 5H91A 2O0TA 3GLCA 2AMGA 4JN6A 2XFYA 4AD1A 2CERA 1BTCA 5GNYA 8TIMA 5HNNA 1V51A 4ZQRA 4QRNA 1SZNA 3EB3A 5DXYA 3LNMA 4NX0A 3A24A 1P6BA 5C5YA 1HUVA 3ZOAA 2VRKA 3PFMA 3LHVA 4ERIA 1I45A 3VVGA 2EPMX 5EL1A 4IQEA 4LFYA 1AH3A 3L23A 3LLDA 2CHOA 3B40A 5EA9A 3KOZA 3G18A 5D8ZA 9XIMA 4POCA 3RJXA 5DANA 3WQGA 4C91A 1M41A 1TPWA 4AHOA 2QJMA 2WSQA 5CZ0A 3OHMB 1NF0A 4P7OA 2C79A 3LGGA 2FZ8A 1OCJA 3N4EA 5GQBA 1V3KA 2E7FA 2R82A 5BXPA 4JFWA 5HANA 4E3VA 1GQNA 1LLWA 4W8AA 2J6VA 3IIOA 1XBYA 3H70A 4QISA 8RUCA 1F6PA 3A3WA 1A0DA 3NDYA 1E1EA 3LCGA 2ZTJA 2X1SA 4Q8UA 5CKSA 1JNDA 3WENA 4A3QA 4R7WA 1ZALA 3AFBA 4TV5A 1BWLA 1PBGA 3PZIA 3TKFA 3FJLA 3MV01 4U4MA 1LOSA 1TV7A 1A4MA 3H21A 2FJKA 3TAOA 3I6EA 1XQLA 1HKVA 4XVEA 1S2TA 4RDWA 1VQTA 4N6EA 4X0VA 4F9DA 3IVSA 3U9IA 2OVLA 4GISA 1V6UA 1VBUA 2BGSA 3RXZA 2VQUA 1QAPA 2Y62A 1V08A 1K8XA 1XRTA 2GWNA 4HHMA 4EE9A 4XBSA 3V5OA 1DBTA 1CLXA 1ECEA 1R8LA 1YNPA 4MAVA 1E1FA 3CPGA 4ML4A 2V3GA 3RX2A 4LAKA 3FKRA 3PPCA 2B81A 3SUSA 1XV8A 4Q7NA 3GH4A 5ABTA 1OX6A 3BV4A 2YR1A 1LRQA 1EGVA 4A8RA 4ZE5A 3N2CA 2WJZA 4MSSA 3IGHX 2O9OA 4L64A 4J1OA 4A3YA 2O9PA 3ZWTA 1QUMA 2BMBA 4NAEB 4LCSA 4LYQA 3SO7A 1PZ1A 1FFRA 1EXPA 4C1NB 3FA4A 2J77A 4ZGYA 2R1NA 2XFFA 4YTSA 4PUKA 4UTLA 4YHGA 3A6OA 1ZTVA 4A29A 3EPOA 3SCSA 4LS0A 2ZZ2A 3H54A 2RGLA 1WDPA 4MB4A 1KCZA 2X09A 4WJEA 4FHAA 3WJSA 1FVPA 4GX8A 4US5D 3BV7A 3I7RA 3OG2A 4DBDA 3OVGA 5KZDA 4KW2A 4K36A 4DRSA 2WC4A 5C9XA 1K8CA 4LUIA 3GUWA 4PN2A 1QO2A 1GVSA 3W7OA 1X97A 4RUBA 1JR1A 4YHEA 4K8HA 2J7DA 5F2LA 4QXIA 1N8FA 2YYTA 5BZAA 5ECVA 4P8VA 1QDSA 5EMUA 3IJQA 1LCOA 1KKRA 3BC9A 4BF5A 3GRIA 1E70M 3AWNA 4H6QA 4CCEA 1AA1B 3T09A 5FJJA 1ZS2A 2INFA 1PS9A 3I7QA 1N7KA 2NWRA 3AMCA 1DOSA 1KTBA 4GUJA 3TMQA 3ZM8A 3THAA 3UGVA 3QMRA 1EIXA 1GEQA 2V30A 4HTBA 1PZ0A 4ACZA 1RQHA 1W56A 4X22A 8CGTA 1LBLA 1H60A 3E0LA 3UZYA 1H63A 2GJNA 1AW1A 2DUAA 2YL8A 2ACRA 2PPGA 1EUNA 1WOAA 4L6OA 3RU8X 4DI8A 4IJRA 2Y5EA 3T7VA 3H2FA 1CCWB 3FXYA 2GOUA 4YTUA 1R9YA 3EWDA 2VC6A 2HMCA 5CSYA 5MKGB 4DYKA 1W1A1 1VFSA 4QE4A 1D7FA 2TSYA 4US5A 3GXFA 1ECQA 4GY0A 5LGXA 5BMWA 1KGXA 1KTCA 2ZWZA 3M0ZA 2VR5A 3S5SA 5CPMA 2OELA 1VYPX 4X61A 3GXNA 2QPSA 7ENLA 2BY1A 1YXCA 3CWHA 1XYZA 3E96A 1MEWA 4S3DA 4WDWA 4EWND 5AHIA 1F05A 4TMCA 3UJ2A 1ZJIA 1WB0A 3RRXA 1GYMA 2OGJA 3SQSA 3RLGA 1WZMA 1UG6A 3WBXA 3EX4A 4L1XA 3B4UA 3BWWA 2YDSA 1V0NA 3WH9A 2FFCA 5C9WA 3N4AA 4Y96A 3BTNA 3NFUA 4PULA 2PODA 3NJ3A 4F0MA 1WDRA 2CBJA 1GUVA 3A23A 2CXEA 4N9DA 1EJVC 1VCFA 3SFKA 3ZXWA 1FQ0A 2XH2A 2ZX9A 5LNUA 3GR7A 4HP5A 1UZ1A 1UPMB 3DERA 3W1QA 3LHYA 2X7WA 1NELA 1S5NA 3GBDA 3GNNA 1R3YA 4GCXA 2DVUA 3QBUA 1Q8AA 3BCDA 2O7SA 2WNZA 3ZJ8A 1TPB1 5EU9A 2GGHA 3RM8A 1XIFA 2JEPA 2KAUC 2AKZA 3D47A 2DJLA 4Y9OA 3MW7A 2A4AA 3L4VA 3N29A 3BJTA 3ABOA 5I79A 4EAYA 1N55A 1W9VA 3ES8A 2BSLA 3AJXA 4AY7A 3QV6A 4HPNA 1PVNA 2XH0A 1K77A 3OPSA 4PCFA 2W0UA 3CAQA 3DFNA 1SO5A 1HQTA 1OHLA 4RNJA 1BRLA 2VXNA 1NDWA 3TMLA 5K2ZA 3C52A 3W1LA 2EJAA 1X96A 3LTYA 4DWSD 2FTYA 4IXHA 4MWAB 2J7HA 4AX6A 3IJ8A 3Q94A 1F61A 3WDPP 2V8ZA 3U4AA 5I3GA 5I0DA 3N6JA 2Z1KA 4XAFA 1JCYA 4UFJA 3VC5A 3FW6A 1DTUA 4NVTA 3A47A 3UQNA 1B9ZA 1LOLA 3ARZA 4GYKA 4RW3A 4EXBA 4TMBA 2PWUA 3IK2A 2HXUA 3AALA 2VKZG 2OQLA 1NWUA 3NZPA 3OYXA 4Q7BA 2QCHA 2W91A 1HO4A 4XUYA 2D0HA 1W1TA 5E0FA 1R7AA 2WK2A 3R43A 1NWRA 2POZA 3USZA 3Q4DA 4GE8A 1KXHA 4WGHA 3UA3A 4F48A 4WQ6A 3ITXA 4J3ZA 1ZFJA 4J4KA 3THUA 5AHEA 5H2ZA 1ZBWA 4DY1A 2DPEA 2MUCA 1UB3A 1XBXA 4HOWA 4ATDA 1UJPA 3AXXA 4ZOAA 3T2PA 4GQQA 3FIGA 3MUIA 1C8QA 3UXIA 4DF0A 3AZSA 2ATSA 2Y2WA 4JIEA 4QE5A 4GBUA 3SUUA 5I02A 3M7SA 4KESA 2ZXAA 4IPPA 2ABAA 3B8VA 2RJHA 1U22A 1ESWA 2CNCA 3VU2A 1RR2A 2YCLB 3K30A 3K8LA 3ZQ9A 1AJ2A 5JIPA 3GTIA 5FEPA 2BV9A 4CN1A 3W1TA 5HQLA 4O16A 3T0TA 1F8MA 5HR6A 1WAUA 4WDXA 5A6KA 1AQ0A 3EX6A 3T0BA 1SMDA 3NPUA 3EB4A 2Y7DA 4O54A 2G3IA 4DHGA 1PSCA 3BCJA 1BTMA 4PUDA 2PDCA 3HV8A 3B3DA 4HU3A 4S3BA 3UZ5A 2GJLA 3NL3A 3KBWA 1UKSA 3LPFA 4GXWA 3OLIA 3PUDA 3LSCA 1MRQA 5FA5A 3REQB 2H3DA 4LF2A 5CGQA 3ITLA 4E2OA 2OYKA 3BH4A 3NO5A 5HWJA 3BJSA 1WZLA 4I90A 3BW4A 4QEHA 4YVXA 4UWMA 3LGEA 2WSRA 1TPDA 4PMNA 1SJBA 4LUJA 3TTYA 1BGGA 3VGFA 1VB9A 1W31A 3QR1A 3MMDA 1O1HA 2OEJA 3N11A 3I6TA 2FZNA 2Z0IA 1Y0EA 3KCJA 1ZB5A 3COTA 2YB4A 4JTDA 3T2QA 1E9LA 1WXYA 1X7IA 2PWDA 3EDFA 3EWBX 1FWWA 3CL6A 3U2ZA 5D04C 1GHSA 3HQNA 5K4ZA 2VR4A 4GH1A 1FFQA 1AVAA 5EBAA 3DFPA 3PZNA 1UP2A 4J40A 1BHGA 1V02A 3LSBA 4GHRA 4KEZA 3WQVA 4IMAA 1DWAM 1Q6QA 2HRWA 1NOFA 1HJUA 3TJIA 2PBGA 1QNVA 5A6BD 3HPAA 1XIEA 2V38A 1TV4A 3EKGA 3B9OA 3CZ8A 3BLLA 4LW7A 1YIXA 2D1ZA 4Q8QA 3J7HA 2E8ZA 1LDCA 2NXHA 1TTIA 3TN4A 2J9YA 3Q58A 4NHVA 4D72A 4AAJA 5FSDC 3F4VA 2JGQA 1QWGA 4L4OA 1H51A 1CGVA 4RPPA 2DZUA 5FJUA 3C2RA 1FBAA 1KM5A 3U7VA 3S1WA 3IJLA 2RFGA 4JHMA 2CLMA 5K7JA 2OB3A 3UD6A 4AZ6A 4NXKA 1I75A 4GYPA 6A3HA 1RPKA 3IIXA 4MZ1A 2F2HA 4DVOA 1SFSA 3UFYA 1IZKA 2ZWYA 2V5KA 3QHNA 2CWNA 4CU7A 3O7UA 1A5AA 3MDUA 4U5KA 3QC0A 2PEVA 1TX0A 4PRRA 4LF1A 3SN1A 4OKDA 2GWGA 4E4PA 1PV8A 1IT7A 2DY3A 4ZXOA 3UERA 1UR1A 5XIMA 1S1RA 2HISA 3TSMA 3EX2A 4CQDA 3TWBA 1Q3NA 1OZQA 4E0CA 5B7YA 1B3YA 3EXSA 3CHCA 3EMCA 4M6QA 4U10A 4ASTA 3WMSA 2I56A 1H62A 2ABBA 2PLKA 3GC5A 3S2LA 1M1BA 3O6CA 2G95A 1KM0A 1E3ZA 2Q8ZA 4AVNA 1NAL1 3MMWA 3W72A 1VLIA 1BG9A 2MNRA 3G1XA 1LP6A 1NIUA 5A95A 3LLXA 1OCNA 3T0DA 4MYAA 2GQAA 2RHGA 3P62A 3WD1A 2QV4A 1UKOA 4BQ5A 3ZT7A 1TWDA 1OINA 5K4XA 5E0KA 2VEFA 3SI9A 1CXEA 2ZA2A 2C1IA 1M01A 2DORA 3GW0A 4ROPA 3KM8A 1VP5A 1WZKA 4UTFA 1UUOA 1W2VA 4RE0A 2NT1A 3A3XA 4Z2LA 4UNLA 5IDZA 2ZC1A 4N6FA 3UZZA 4UB9A 3PZ9A 2P1FA 3W7EA 1OD0A 5AFDA 4H9MA 3DECA 4MWAE 1K7EA 4RKAA 4N0RA 1YDYA 4LNCA 2FHBA 4MB1A 3NGFA 2PA6A 4CQAA 3KRZA 1JFXA 1QW8A 3N04A 1XBVA 3VOGA 4H1ZA 4MB3A 2E5BA 1LBMA 1PX8A 4ZO8A 3UCQA 2DZPA 3G1DA 2JF6A 1OADA 1HKJA 1V0LA 1EBGA 1UROA 5CJNA 3OIHA 1EJRC 4FA3A 2ZXQA 3U57A 1RY0A 4REQA 2NQZA 4DF2A 2HSAA 2RAGA 4JNMA 1E71M 4NIRA 4AEOA 1B3WA 2XIQA 3MCNA 4PMXA 1W1YA 2A3LA 3SCOA 4QHRA 4NI3A 3S9YA 2WVVB 1ISYA 5I07A 1KW1A 5M3WA 4O1EA 3H7RA 1X38A 4LNYA 3AAMA 3QFEA 3IACA 1PYFA 4UR8A 1QTWA 3L21A 5JQ9A 3UW6A 4M8UA 1EP3A 2IKIA 3R2GA 3W88A 3MUZ1 3GG7A 2HE5A 3ITGA 4GI4A 2AQVA 1Q5MA 4YN5A 2YFNA 1J01A 4AZCB 3WH7A 4KGJA 1GTEA 2KZHA 4Y9MA 4AF0A 1G69A 1AQHA 4WSHA 3FGCB 1SQ7A 3MBFA 3S3GA 2VTFA 3CGTA 3E9AA 3NL2A 3BLFA 5IBXA 4C6EA 3WCZA 1HKWA 1SFLA 1J18A 4KQNA 2CLKA 3MJMA 2RJGA 4LYPA 1RD5A 1DEDA 5LIUX 4BI6A 1V03A 2BP1A 4TUFA 3S2JA 4S3AA 4EOUA 2FZ9A 1OYBA 4S2BA 3SZ8A 2PWGA 1ZSXA 5CEWA 3W2KA 2IW0A 4OOZA 1QW7A 1M7JA 3HGRA 4S39A 2V5BA 1BYAA 3UJRA 5FD0A 3P80A 3OO2A 2G3NA 2P50A 3EBVA 1BQGA 2VT0A 1IR1A 1B3OA 3ZSTA 1J0IA 2YLLA 4YPJA 1T0OA 1S5WA 5A6MA 3F1QA 2I9UA 1XS2A 4IJBA 1PCWA 1XLFA 5CZTA 4LX4A 1DHKA 3B03A 3GXMA 4JTJA 1UWTA 3MMUA 1KGUA 4B4HA 3ARQA 3GW3A 4GRSA 3I3EA 3PZTA 2DEPA 2YDAA 2BGNE 3VD3A 1W9DM 1Z44A 1E6QM 2PLMA 4ECLA 3WLPA 4H6EA 4J3WA 4J35A 3VUPA 4RV8A 4TV6A 3QW4B 4ACYA 4HB7A 1O1ZA 4LBSA 1RA5A 3IJ7A 1B30A 4IQLA 3BMVA 1A5LC 3KS6A 2OU4A 4EWJA 4MUPA 1RP8A 4E38A 2QJJA 5LHEA 3NDZA 3M07A 3OVQA 2IMRA 1XL9A 5LIXX 1JAEA 3ZT5A 2JKPA 3G1RA 3UR5A 4LUSA 4PFMA 2I17A 1P1MA 1M65A 4GXPA 5A94A 4LUTA 4UTTA 3VDAA 4C6IA 5JH1A 3UCDA 4LUYA 1OIMA 3JW7A 1EDTA 1H7OA 4DZIA 5E70A 2E4TA 3JUGA 3Q65A 2QJHA 1XDJA 3SQLA 1TPVA 3DG6A 1UKQA 3MMTA 4JD4A 4YIWA 2F38A 4QNWA 3W38A 3WLJA 3N2OA 3MCOA 4IT1A 1L6FA 2W66A 1O5KA 1QATA 4J3VA 3ZSSA 3S9ZA 3BW3A 2YJQA 3QYQA 4LU0A 1LQ0A 4ADSA 4I8DA 3WLLA 1Q6OA 3L4UA 4QM1A 1GPFA 1M7PA 2ZADA 4UQ9A 4TX6A 3ES7A 3GVGA 5U7SA 4WR3A 2E5DA 4AU0A 5A2BA 3PB0A 1OFAA 1M5WA 1OFRA 2BVTA 3HN3A 4N4QA 3CMJA 3GNPA 4S3EA 4I5UA 4NJGA 5ABHA 2PTXA 3TWAA 1IXQA 3E49A 4UTJA 3PR2A 4AWUA 2X42A 4PUEA 1MI3A 4AZIA 3MKVA 4D6EA 3O6DA 1ME7A 1RLDA 2ON3A 4QS5A 3IJ9A 5AYYA 2E77A 1UHVA 1HIZA 5KZMA 1FDZA 3ABSA 3BDKA 3T05A 2BOGX 1MEIA 2OR2A 1RAKA 3W7RA 4M24A 4MDOA 4F2TA 4W85A 4AEFA 5D32A 3F5LA 3W6MA 3JZEA 2V2CA 4I9TA 3LEPA 2PC8A 4WD0A 2XIJA 4MPKA 3WFLA 4ZODA 3GVQA 1IGWA 5EMJA 4HK6A 5I23A 1PIFA 2ZX5A 4RCXA 4W88A 4IMDA 4YVPA 1QXLA 4DAFA 4U2ZA 3RILA 1XHGA 2YXGA 1V79A 4DX3A 3CO4A 3BSMA 1J5TA 3A4WA 2Y85A 1J0YA 4TVDA 4CVUA 3OZPA 1G5AA 2TYSA 1ALDA 5DT7A 1CGTA 4GPNA 3QV8A 2WXDM 3W1PA 2A79A 3L4XA 3VNYA 3TUUA 1IE7C 1XKJA 3CHEA 4C65A 2VI0A 1J93A 4ZENA 4ZTXA 2DSKA 4W7WA 5BRBA 4G6CA 2ZOXA 4NAFA 3KHDA 3PB2A 1XG3A 4LXFA 1WAWA 1PKMA 3VGEA 5IM51 3IANA 1K9FA 4V15A 2IKHA 1G4PA 3SR7A 3PZVA 3UZJA 3T4CA 4B3KA 2PTYA 2VUYA 1DJNA 5M2FX 3QHMA 4IPJA 4KEVA 4KCUA 5D38A 3TN6A 5HDRA 1FDYA 3H2NA 5EFFA 1F7BA 1E0UA 1O95A 1TPFA 4LCRA 2BGQA 5I2UA 2JIWA 4ONVA 1XINA 3O15A 2ZZ6A 1DXIA 2DT3A 1M7XA 2ZBTA 2QCMA 3P8IA 2J79A 2P53A 3MA8A 2XWEA 2X7VA 3W26A 3P60A 3OP2A 4IP7A 3FAXA 1EPXA 3PZOA 1ZENA 4K1WA 3BZJA 4F66A 1TIMA 3BXWA 4CD7A 3PM6A 1ADSA 5GNXA 2C6QA 3DESA 3K4DA 3AQUA 3V1PA 2C1GA 1ADDA 4FF5A 4UTIA 1GOXA 2EPKX 1QU4A 1WDDA 4AH7A 4J2MA 2PDFA 1XLAA 2YA1A 3NOEA 5FJIA 1E4NA 4QE1A 4L9ZA 1OG6A 3V35A 4HBKA 5IRPA 4HK5A 2QAPA 2NLIA 1RZMA 2RUSA 3ARXA 5BOEA 4WY0B 4A35A 3GAKA 2TRSA 1MNSA 2PS2A 2X1IA 2R1LA 3QRHA 1XDMA 4XB3A 1UR8A 4S2CA 3ICJA 2IS7A 3M43A 2VL4A 5C0QA 1VEMA 3AI0A 3WMLA 2CFFA 1E5JA 3OIXA 4FZIA 1TB3A 2GQ3A 3JVAA 4E4UA 1XJBA 1XIHA 1HGWA 2PB1A 3BG3A 2Z1SA 2DT2A 1MYRA 5I77A 4OECA 4PMZA 2WMFA 4EXQA 4P61A 4XKMA 5CBBA 1EXBA 4R85A 5D9MA 4HNTA 3CEUA 1QPOA 1T6MA 3GR4A 4NZ5A 1TPUA 2DGAA 3EOSA 1RBAA 1P7TA 3CQHA 3CV1A 6TIMA 2J9XA 2PU1A 3NPVA 1TVPA 4NJIA 1W3NA 1CYGA 3WQOA 1TA3B 1LQAA 2RDWA 3QTGA 1BYCA 1BEUA 4ADTA 4AUBA 5KZEA 2ZRUA 1EDGA 1RLCL 4DJDC 3AHZA 4JX4A 3ZVHB 2QEZA 4YWIA 3S5YA 3OVPA 3WNPA 3C6CA 3ONCA 3FEQA 2A7NA 3RDKA 5CLWA 3B4YA 1R0MA 1CWYA 3HU7A 3E5PA 5KSWA 3OEXA 2WANA 1S2WA 4N9EA 4HCLA 1W3KA 4MKSA 4P8WA 2VVSA 3ABZA 4JQ3A 5ABFA 1XCFA 4XIMA 1SUXA 2HV5A 5H1WA 1VFOA 5FI8A 2Z4GA 3GYEA 3KE0A 1VBHA 3K8MA 1YADA 3C2EA 4JY9A 1OT1A 3R0DA 1K6WA 1KRAC 4UZUA 2J7EA 2VC5A 2ZVIA 2YL6A 4UFIA 3YPIA 4Z0SA 1J96A 4IG2A 1CGUA 5LA1A 1SW0A 1C93A 5FAJA 1HVXA 5FL1A 4C7GA 1F6YA 2P5NA 3P0WA 4K37A 3O6AA 1QRQA 1KTNA 4ZCWA 1V7YA 4KMQA 3HQ1A 5HMDA 2VZSA 2X16A 1R3QA 4JYDA 3SCVA 4DWSC 4CNUA 3I7SA 4R34A 2REQB 4J3XA 3K5XA 5C9ZA 3TYAA 3TJXA 1S46A 4AX7A 1NWTA 1CBGA 5L6UA 1C7TA 4JOMA 3LS9A 3W1AA 2R6OA 5KEZA 3MJYA 4JIHA 1LZOA 1A4LA 4JEQA 3THQA 4HZMA 3QZ6A 1J5SA 1F3XA 3EXRA 3L2LA 4ZMGA 4LQ1A 5DBTA 4ZL1A 2PTDA 2CU0A 1TZZA 2QS8A 4ICNA 1QT1A 3UWWA 3KTXA 4GA8A 4C6MA 3F4WA 2P3EA 4CNNA 4N9BA 3H55A 4C6DA 4NILA 1FUYA 3GB6A 1GNXA 2YDQA 3ECQA 1AMKA 5FEXA 3SCPA 4H9ZA 1A50A 3A13A 3TSBA 3DZ1A 3HIJA 4C6JA 4QJ4B 3H4GA 3H23A 1XYBA 1KFBA 3TC6A 3O6YX 1I2NA 2XVPA 1A49A 3M16A 1GT8A 4UFKA 1EC8A 1EUAA 2GLKA 4LPCA 3ERPA 5G5IA 4K68A 3SCWA 1DE5A 1E43A 4MKNA 3T8LA 2O4MA 2ICSA 1KFLA 4IICA 4ERGA 2NW0A 2PDXA 4OV4A 4H04A 5HR7A 3NGJA 1IXOA 5BXSA 1JRCA 3RR4A 2EJ1A 4RDVA 5J5DA 3SSZA 4MFEA 4H6RA 4BK9A 3KTSA 1HNYA 2BBFA 3GVVA 1HJWA 4XWUA 4DLFA 2WLZA 4JS3A 3WDQA 4A8NA 4C60A 5BXRA 3C0LA 2NUYA 3EDJA 1KCXA 4DPPA 3HPSA 3M6YA 1GZGA 4UTWC 3CIWA 4WX2A 1RA0A 2FZBA 1QBAA 2PE4A 2VNCA 2Q3OA 3JU2A 2OOGA 4FX6M 4HNLA 1M3UA 2C71A 4YJ5A 1ZLPA 1W32A 1UC4A 1G6CA 6XIAA 2EG7A 1QASA 1TWWA 1GVRA 5A6SA 3ME3A 1W1B1 5EMLA 5EB8A 4NI8A 2VFGA 3U6WA 3R0UA 2YGYA 2WMIA 5LA2A 2YLAA 3N14A 4WXZA 3EPNA 2RGMA 1AD4A 2QJGA 1B54A 4I9JA 1CXFA 4R88A 2WC3A 1DKWA 4Q4MA 3PZQA 1FRBA 1YX1A 4LV4A 2CLIA 2OZTA 4JDYA 3H4WA 2WCAA 4AW7A 3QSRA 2ISFA 3FXGA 1AL8A 4RDZA 2BVYA 4XSLA 4FNSA 3CK5A 4NG3A 4DM2A 2W3ZA 2WZIA 4MAZA 2GUBA 3LTPA 3A22A 2E25A 3ARTA 2NWSA 4AZBA 2XG9A 4IFKA 1OFEA 2QULA 3ZIZA 1XBZA 3L4TA 1ZAHA 2FVMA 4FR1A 4DUXA 4EPKA 4G5DA 3UWZA 1EJ7L 3CASA 3M41A 1NWSA 5I3FA 2XZ9A 2ZUTA 1GQLA 4MG4A 2JEQA 4V27A 1RK6A 1YYAA 3ALGA 8A3HA 4AG0A 1KLZA 4E2BA 3VD5A 3LNPA 4OBRA 2D2OA 1ML1A 2Y88A 5A8QA 3LUTA 1GOOA 2XDFA 1R46A 2QF7A 4NZ1A 3ZLFA 3PJTA 3PANA 2NZLA 3V16A 2DW6A 3VTRA 3TA6A 3UU0A 3T55A 4GYFA 2ZRVA 3LX9A 4EXAA 1XLMA 3GO2A 3V0UA 1L6YA 1GQJA 1ME8A 5D9OA 1YNQA 3G77A 5AB3A 1NQ6A 4GIEA 3TC3A 2ZQ0A 4NF7A 4GIYA 2WW5A 3RAOA 1DIEA 3HBLA 1HFBA 1A5UA 2BVWA 4LBUA 4L80A 5GJMA 3O06A 4WKHA 4F3HA 2G3FA 3QPYA 3BW2A 2GJXA 4E2DA 4GLEA 1VFMA 2EO7A 1W1VA 1PPIA 4JTAA 5E1QA 3W83A 3PFRA 2OKOA 3QW3A 1XRSA 1XFCA 1LL4A 3UG3A 3KL3A 4IMGA 4X63A 4RV3A 2C8NA 1H5VA 2EEXA 3LXAA 3NPXA 3XISA 3TCEA 2Y5SA 1JYWA 3GDRA 3HOJA 1UMYA 1U1JA 3IJDA 3G0SA 4GGBA 4UC5A 4JKKA 3WQ6A 5LIYX 2CBIA 3BCFA 5I5RA 1K9EA 4XKYA 5A6JA 4HQVA 3F5JA 2E1WA 1YTDA 3FY1A 3GU9A 4RR4A 4AFYA 3BARA 2CKRA 2YZRA 2OQHA 4O8AA 5CC5A 1OCQA 2Q02A 4AD3A 4H7ZA 3DGBA 2D3LA 3WSUA 3P5ZA 2WMKA 4MB5A 1WQ5A 1I4NA 2QGYA 4JFVA 4Q8OA 1WBHA 1WDSA 1H09A 4Z2GA 2CLLA 2AQWA 1MRAA 2F2KA 1W3LA 2CLHA 1ZP3A 3NR0A 1XYFA 1X98A 3STGA 3TZNA 1DJQA 1XSIA 1KR0A 1S1PA 3GHRA 4MHBA 4I9MA 1JNEA 2BHUA 1XFBA 3AOFA 3FFSA 3OW1A 4O1CA 5FJRA 3LK6A 4FNTA 5CG0A 5D33A 1GVEA 3PBUA 2CZVA 2LLEA 4UFHA 3GHUA 1H7XA 3DOPA 1GEHA 5LSMA 2YBVA 2GSHA 1KBBA 1EDQA 4HCHA 5IXEA 2Y63A 3C5QA 2HNEA 1V3IA 5AC4A 1H49A 2FB3A 3N3MA 2EG6A 5LIKX 1PIGA 1OT2A 3ITTA 3U2OA 1DWIM 4DXKA 3B9EA 2Z00A 3CO8A 3WLNA 2JKAA 2PDBA 4C6CA 4WKFA 4ACZB 3EB2A 3C8FA 3H7UA 5CSUA 4NNBA 3QOMA 3N73A 3QYSA 3MWCA 5E09A 5BROA 3MI2A 4AIUA 4E8DA 2UY2A 2XN0A 2XPKA 2PP3A 3PTMA 2QDGA 1A3XA 4GVHA 3W70A 1UIOA 1E0WA 3UGRA 1MXDA 1G0CA 4B5SA 5AC6A 5CBIA 4JHZA 1FOBA 1XLBA 2BWGA 3GFXA 2VO5A 3NURA 1MXSA 1PX4A 1WPCA 3UXKA 4PR4A 5CZJA 4FEZA 4ZXLA 3RM9A 3DU0A 2BDQA 1HO1A 1XGZA 2OWCA 4E4FA 4E3TA 2VGIA 1G1YA 4TVUA 3TE9A 6REQA 3C2FA 1W37A 4ZB5A 2QHAA 3O05A 4JBRA 4WLCA 3R11A 4A2SA 1TQXA 4GK8A 2CXGA 3DEQA 1SVDA 3AIEA 3P81A 5HJLA 4FXJA 2DZXA 4N2YA 1O5QA 4PMDA 3TJLA 4H19A 2FMNA 2QCFA 1BSLA 4CD8A 1J6PA 4JICA 5HQEA 1V0MA 3L5LA 3E2VA 4O10A 1AQFA 4LY4A 3AHVA 1QOQA 4UNKA 4HHLA 3ALFA 4F0HA 5AY7A 1DJYA 1Y5VA 1S2UA 2J66A 5FJOA 3I10A 1JAKA 3VZYA 1OC6A 5C2XA 3GWQA 1AL7A 1P0EA 3L4WA 4PL2A 2BY3A 3K2GA 3RJYA 1RALA 1C8VA 5CXPA 1YE4A 1EC9A 3KAOA 4MNLA 4XUGA 1QK2A 4HSNA 2VZTA 4XZNX 2E6DA 1BRLB 4OZOA 2XN2A 4Y2WA 4WF7A 2ISDA 3NYZA 1OGBA 4Q6JA 4GCAA 4H01A 4BQ3A 2CITA 2WCGA 1E9YB 1ELSA 3VGHA 4MJZA 3EMZA 1JL8A 3GNOA 3OGRA 3GDKA 2I9EA 2ZRZA 4JZ5A 1TYGA 2WQDA 5J5RA 4W84A 2WZHA 3AS3A 4PA8A 3HA1A 4JTKA 1NOUA 2QW5A 1AH4A 3W2NA 1B3ZA 4A8IA 1KM6A 1LOQA 1UH2A 3N19B 4WZHA 3RPTA 1TUXA 4JGDA 4U2YA 1C8XA 5ECUA 2CHNA 3UJEA 2R91A 1THFD 3G1AA 2WJDA 2H3BA 3O16A 4BQ2A 4NYYA 2QLYA 3F2DA 1W8GA 4W9TA 3UR7A 3W1MA 3E5BA 3KVJA 3W0KA 3DX5A 3GHTA 5IOBA 2G5WA 2AL1A 5KZ6A 3RIKA 2C15A 1CW2A 2Z7KA 3B05A 2W61A 4PTVA 1PTDA 2YKKA 3VM7A 4D8AA 3NOYA 5ENLA 1SFTA 3ABXA 3MYOA 4I5RA 4JNYA 5D05A 3WF4A 2EGZA 3C2VA 2FDSA 5A2CA 4I7UA 4G7EB 4DWSB 1SSGA 3P84A 2E9MA 1P0DA 2XIIA 2VX6A 2W4XA 3LV5A 1F4AA 2EBNA 4PCNA 2NV1A 3EDKA 5JBEA 5GPRA 1SR9A 1O68A 3W7CA 3ZVIA 1V3MA 5A3HA 5AYIA 5K9XA 3CM4A 3MSDA 1IEVA 2QUVA 2XWDA 3MKCA 4MZYA 4MY8A 3WQ5A 4U28A 3CZEA 4MF4A 4IMFA 4I8YA 3TR9A 4DYEA 4NXSA 1F76A 4KT2A 3RCYA 4YTTA 2NQ9A 1FWTA 1XW8A 4BY3A 3PNUA 1PX3A 1RD6A 3DUGA 1NVMA 3CTTA 4DO7A 3P82A 1PZ3A 1VPXA 2X0HA 3DH7A 1CNVA 3RM4A 4CU6A 1TCDA 4LY8A 3WL0A 5JVLA 5DCEA 3SIZA 3VIHA 4AISA 1LRTA 1M9HA 4AHQA 5CQ1A 4NAEA 1LUCA 4TR9A 1ADOA 5JU6A 3O2LA 3BPWA 3LMZA 3WMCA 2Z27A 2F9RA 4W5ZA 4W5UA 4C1NA 4K8EA 1NP0A 4JYEA 3TNOA 2NX1A 5C6MA 1SW7A 2H8XA 5CSSA 2P8BA 3LB0A 3M46A 3WIJA 3OU8A 3W1UA 1OFPA 4XSMA 2FHFA 3S2MA 5HAOA 3OQEA 3PBWA 4ZEPA 3WLOA 1W6TA 3FA3A 2H8ZA 3EA2A 4H9VA 5HPOA 1W5QA 4HHPA 3UWUA 2CLPA 1F74A 2J7FA 1BF6A 3ARRA 2ONEA 2ZX7A 2OX4A 4R5EA 3EX3A 2PU0A 1TTJA 2I7GA 2WV8A 2H6RA 4FIRA 4KIEA 1KRMA 1IT8A 1EC7A 2E28A 2NQLA 1OGGA 3IUHA 3DI1A 3QQWA 3N34A 1R9XA 3CZGA 2GUUA 1VAHA 4GC3A 4XX6A 4NJKA 3VMOA 2CZEA 1Y5WA 3C0SA 4MUZA 1LWIA 2IUZA 1UD5A 2DIKA 1DORA 2P3ZA 3U8GA 3T42A 1Q7MA 4R9OA 2OSXA 4AXKA 4PCTA 2V5CA 1Q13A 1CPUA 2VZVA 3WO8A 4ENLA 1I0DA 3NSNA 2Z1XA 2Y7GA 2A7PA 4JTUA 3SSJA 1B1YA 3K46A 3AISA 4IIHA 3DYOA 3TTOA 4MLJA 2FPYA 4C6OA 8XIMA 3AICA 2BASA 1XIGA 1RBOB 2QPUA 3NL6A 5I6SA 2BB0A 3WLTA 5CJMA 5AYBA 4HU4A 2B7PA 1JFHA 1H11A 1GHRA 4ATLA 4FNQA 4AQLA 1DWJM 3T8QA 1H5YA 1V3LA 1TCMA 2J25A 5G2HA 4TX9A 2ZDRA 3DKJA 3SCQA 1IEIA 1UMLA 1UZDA 1WKYA 4FIQA 4KKXA 2WKJA 1XLIA 2PC4A 1ONWA 1XCXA 1SZRA 1AMYA 2D2JA 1ZBVA 2FHCA 5E93A 4NQ1A 4P7RA 1E4LA 3KVLA 4OWGA 3HMJG 3Q67A 3TH6A 4QLJA 2NLYA 2YW4A 4WKAA 1GOIA 3NQVA 1TV5A 2RDUA 4O1AA 5CH9A 3UY7A 4CNPA 1GCYA 1MW0A 4Y8EA 2CETA 4O12A 4V28A 3AUOA 2WZMA 2XM1A 1HL2A 1YRRA 3IJ6A 2F84A 3VCRA 4YNGA 1EJXC 1XQKA 1GVOA 1VF8A 2I5IA 1UUMA 2QT3A 5J8LA 1Z42A 1O5XA 1JEZA 2VDGA 5CPOA 3W7NA 1FCUA 1DV7A 4D6JA 4DYJA 2H9AA 3C56A 3UZXA 3SECA 3B8UA 2UY3A 2PF8A 4O50A 3CZJA 5I24A 4LS1A 1RK5A 3WDRA 4CNSA 3H26A 4PB5A 1XYMA 4PUWA 4Y9PA 3WQ4A 3WJZA 2XN1A 3E0VA 4DM1A 1EQPA 4AYSA 4H7VA 3P5YA 4JQ2A 3LTSA 1WBJA 3WH5A 2BHYA 3S42A 5EFDA 4MWAA 3SGUA 1M04A 2Z26A 1UWQA 1GZ1A 3CWNA 2CZFA 2VFHA 1B4EA 5EYWA 3N3TA 1KGWA 1Q4WA 3DFQA 1TWIA 3LCXA 2HK1A 3VIKA 4DWDA 1FX6A 5AYZA 2QZRA 1W9BM 1B0IA 1B4KA 3NQ6A 4MNKA 1Q65A 3A5VA 5CPQA 2WCSA 3S46A 1G01A 2Z7GA 3IGSA 1JD7A 1CIUA 3LHUA 5G2IA 4IGHA 1E0TA 6ALDA 3WDIA 1KXTA 1W9PA 3CUHA 3FKKA 4YCOA 3LYEA 3PUGA 3HZ3A 1F3TA 3GNDA 3FDGA 3U2CA 4I5XA 1P1XA 4MTVA 1W5PA 1I1XA 1O60A 3RX4A 4S3JA 3E2SA 1ISWA 3PBYA 1Z6KA 3DENA 5DMLA 1H1ZA 1XM3A 4HJWA 1VEPA 4KERA 3M6DA 4GACA 5H8PA 3AHXA 1MW2A 4HJFA 5AC8A 2D73A 1E9ZB 2ZUNA 3B8DA 2DH2A 4GBDA 5C8BB 2C13A 4AF0B 4O0QA 8XIAA 4QDWA 4S3FA 2NSOA 2HS6A 4JTQA 3DFOA 4QIUA 4FLSA 1XUZA 4DIAA 1JF5A 2EPHA 3UETA 4HNVA 4ZR8A 1OWQA 1HJXA 3GNRA 3R79A 1R30A 1SFJA 1MZRA 1UWRA 1XIDA 1K7FA 4XQ6A 3INPA 1DVJA 3CAVA 5A8OA 1Q8JA 3NQCA 4GVGA 4Q3MA 4IFOA 3ZJKA 2WB5A 7TAAA 1QI2A 4AC1X 3VNKA 5BNKA 2XIOA 2GK1A 4WCJA 5D2WA 4YYCA 4GO9A 1Y65A 2IPWA 4W4QA 1LG2A 2NXIA 4MDPA 3V4BA 4P8XA 2ZZ4A 3VKKA 4NL1A 1X6UA 2R1MA 5M1TA 2DQWA 3TX9A 3LCWA 3DXIA 4Z0JA 1OC5A 3CS2A 3AIVA 1RJPA 3SM0A 2PP1A 4GVFA 3T0CA 4O1BA 4YCPA 4L9YA 5CLTA 3REQA 2Y8KA 2WPGA 1RCQA 1UZ4A 4GQBA 3VCNA 1US3A 4HA3A 3EDEA 3OLGA 4IGNA 2WC7A 4CNTA 4XZMX 4GG9A 3I3DA 3PZMA 3QY8A 3FDKA 3BLOA 1IWAA 3NVDA 1FH9A 3GZAA 1JF6A 4KS0A 2CCRA 5KITA 2CLEA 3TYEA 2JF7A 2VRQA 4GI8A 1S5MA 1I2QA 4IJCA 1ZQ5A 3B0VC 3QKEA 3WLQA 2ZCGA 4YU1A 3QC3A 4LC8A 1A0CA 2A6NA 2WYSA 2W6RA 4FX7A 2X05A 2YSWA 3AHTA 5BYWA 1DP0A 4LUSB 4WJ8A 1JVNA 2OJPA 2QUTA 5RUBA 3W37A 2G41A 5LZLA 2VM8A 4LUTB 3R4IA 3DC8A 4Q4SA 4RX0A 3MO7A 4AHPA 3B06A 4B16A 1P5BA 1TWZA 3B9DA 3UG4A 2GDQA 5G4EA 1CT5A 2VEPA 4G8TA 3M5XA 1PEZA 2BY0A 4OOUA 2W63A 1R5YA 3GX9A 3MU7A 5D03A 1AFSA 2PUZA 1YQ2A 2RKXA 4FOJA 2PDQA 4GJJA 3B8SA 3D5HA 4GUHA 5B80A 4DO6A 1FH7A 1KWGA 1TQJA 3PHAA 3UJSA 2OO6A 3SURA 4XBKA 2P76A 5MF5A 2IPGA 5FKYA 4U31A 1OBAA 2ZICA 2H90A 1E5NA 3S47A 3LY0A 1FHDA 3N6QA 4Y7EA 3P61A 2OMAA 4XD4A 4UQDA 1TPH1 4PFHA 3W1RA 4FXSA 3TSDA 1O5RA 2A0NA 3POHA 4O4WA 3ZFHA 4MIMA 1REQA 1VD6A 3USBA 2XGBA 3G1SA 4KCTA 1TTQA 2HQAA 3EOLA 1G67A 3CL8A 4Q8VA 2JFEX 3KP0A 3CHFA 1QNRA 4LCQA 3BAXA 3MP4A 2XSAA 5CBJA 3I3BA 2WMHA 3M5YA 4UMBA 3E3HA 4OV9A 1ZCOA 2ZXDA 1MWOA 3W2LA 3F2CA 4FOUA 3SCTA 3ZT6A 5KMYA 1H2JA 3M1ZA 4X2RA 3OYZA 3APYA 1JPIA 3LDVA 1VJIA 5HA7A 1SJDA 5I3DA 5IDIA 2ZRYA 3DFYA 3QOKA 3NDOA 1HJSA 5ABEA 3LRMA 3O8AA 1SJCA 3TTQA 4HT3A 2PBOA 3T2OA 2DW7A 1RHCA 1XLDA 3WF0A 3C0QA 1VCGA 4K3ZA 3VZXA 3B0UX 4Q4PA 5E5CA 4NRRA 4MJ2A 2QYGA 3A9BA 5CC7A 2FTPA 3NM3A 4I3GA 3VX1A 1GOMA 1DE6A 3GZ3A 3VDBA 3DN5A 5EBUA 4XZWA 3WF3A 4D9PA 1V3HA 1VJSA 2F7FA 2YOCA 4NJHA 3HO8A 4GH3A 4B5NA 4OUEA 1BVZA 1H0GA 4MY9A 3TW6A 4KETA 3KVKA 3D46A 3SADA 1R9ZA 4D1IA 4J3SA 5G1MA 3C0JA 4N4PA 1VFHA 3N17A 3FEMA 2DDXA 1KFEA 2Q8LA 4J5NA 2PZNA 3W7JA 3OQ8A 3H12A 3WK1A 1TMQA 3CT2A 3A5FA 1V6TA 1WE5A 2VEIA 1OF6A 2VEKA 1XPGA 3CQ0A 1LQ2A 2G0WA 3W7GA 1P0BA 1KD0A 2D23A 1TV8A 2V6AA 4F79A 3TXVA 5CAKA 1OEPA 4OHQA 7CGTA 3NNTA 3THDA 4NAFB 5K9CA 1AW5A 1A5BA 1EA9C 4YL2A 3PWGA 3LV6A 4IIDA 2ZIDA 1WUEA 4GY7A 2XGZA 4L4MA 4QX4A 4JXCA 3TLQA 2W5FA 4JCMA 1HZYA 4C1KA 4O15A 1EKOA 2GVEA 4HPXA 1Q63A 4EKJA 5TNVA 1PHQA 1UD4A 2ZUUA 4HN8A 1JCTA 1E55A 4CCDA 3CQJA 5REQA 4MVAA 2C16A 4MADA 4EACA 3H4XA 4HA4A 4UOZA 3E0WA 1QHPA 4UTHA 3WUEA 1NM9A 1ZP4A 3UYIA 2BY2A 4M82A 3OZMA 4XTIA 3EKLA 4FF7A 4J7RA 5AECA 4DI9A 3GDLA 1K9DA 4GZJA 3T6CA 1P48A 3EKZA 1JPKA 4JFUA 3IV8A 3AS0A 4AZCA 4HN4A 2B7NA 3NQ7A 3TXZA 1JULA 3QXBA 3EWWA 3GDMA 2WNQA 5T9BG 1UKTA 4BQ4A 1TREA 1WKFA 1YEYA 2WSPA 5D37A 3HB9A 2VC7A 3OBAA 1S3TC 3MQTA 1MUMA 4GABA 1J0KA 4O11A 4OBSA 3WNMA 3QQ1A 3RYSA 3SGZA 3GFYA 1JQXA 3OB8A 3VPLA 2CKSA 2OLAA 5JXQA 5CZKA 2ZE3A 1EHAA 3GDTA 2QUNA 3NZRA 1AZ1A 4LB4A 3NQ2A 2GJPA 3W85A 4W89A 1F73A 4S38A 5A1AA 2VGFA 5F1VA 4MGGA 3W2UA 4HPHA 1E15A 1BXNA 2YYUA 2PAJA 4CEXC 4NY2A 3T07A 3B0PA 3UF9A 3RLUA 3F5KA 3VO0A 1LM1A 5F2GA 1QOXA 3DI0A 4L1GA 4IMCA 2E68A 2QMKA 2FQIA 2CLFA 4JX6A 1MEHA 3W07A 1DL3A 1C9WA 4JTCA 3T44A 4V33A 3AMLA 2C0AA 3STCA 1P7TB 1A80A 3MUXA 3ENLA 3VILA 2VGBA 1Z41A 4PMUA 1EH9A 1RJRA 4GNKB 4Q8TA 3PPHA 1XF0A 2GGGA 3LPOA 4XD5A 2YCEA 3AIBA 4GNJA 1IZJA 3S1VA 1VKFA 3V0SA 1I8JA 3S1UA 1EWDA 2PDPA 3LLFA 4KWSA 4ERAA 3WK2A 3EA3A 3HPZA 4XZIA 4B3LA 9XIAA 3KWXA 4IH3A 4U3CA 3URAA 7XIMA 1BKHA 3U7BA 1E6RA 4GWEA 4G2DA 4AZ7A 4ZB0A 3M0JA 2J13A 1YTEA 4F8XA 1KM4A 4QG9A 4AWSA 4WDUA 4QQ3A 2XVLA 5ABFB 2OT1A 3IRDA 4K6AA 5JBFA 5LNSA 1HT6A 4H4IA 4K7VA 4PUJA 3WNKA 3ZJ6A 1QI0A 2FZDA 4NRSA 1R3TA 1VBRA 4PEEA 5CSRA 1FXPA 1W1PA 3H6OA 1SJAA 4IIBA 3EAUA 2JK2A 3S4TA 3CPRA 3KEHA 3ZWSA 2PTZA 2V68A 2YBTA 4IG2B 4QSFA 1BXCA 4J9JA 3K1DA 4FNUA 4F0KA 4BFAA 1G9HA 4GNVA 2XGIA 4NKCA 3QMTA 3S5OA 4Z1CA 2PDIA 1ZY9A 4PTDA 2IQDA 2Z1BA 2QIWA 3EEGA 2Y70A 6TAAA 1E6SM 3RO6A 2WBKA 2ANUA 4N42A 1J11A 2R9RA 1EO5A 1DPMA 3QY6A 3SGGA 3HFTA 1I9CB 3U2EA 4A22A 4XD3A 2FGBA 2GZXA 3IS4A 5LKYA 1UR4A 4RNIA 2VVNA 2AGTA 1HP4A 4A05A 5DO8A 1FCVA 3OODA 1SYTA 3CAWA 4CNOA 4YVVA 4R9XA 3A21A 2WSYA 3KRBA 5F4WA 4IPNB 4ZSUA 5FL0A 4CQ9A 3VAVA 3W86A 3C4UA 3KOWA 3BGJA 5LGZA 1FWDC 4CQCA 2NQ5A 3EOOA 2DZBA 1GVIA 4TTGA 3KS5A 3VNLA 2XFRA 1A0EA 2G3JA 4FOKA 2VUNA 2NUWA 3LXBA 4LB3A 3RITA 1US2A 4P2VA 3MS8A 2PFHA 5D2TA 3BOLA 1ZU8A 3CIVA 2A3CA 2E09A 2OPJA 4H8VA 1A47A 1QNQA 1RBLA 1DWFM 5IFPA 3G1VA 1LWJA 4X2PA 4MNJA 1NQKA 1EA0A 5FF2A 4HZ7A 4R3UA 4DJEC 1Q45A 2PD5A 1L6WA 3KL5A 2QCLA 3APGA 2QJNA 3FHAA 3VIJA 3S9IA 3UG8A 2ODOA 1BGAA 1E4MM 2F61A 1XDLA 1A5KC 2OODA 1SO4A 1ICPA 3GKAA 4PH6A 4LVGA 2QR6A 4QTGA 2FFIA 4KWVA 3GTXA 1R2RA 2XJ7A 2WHLA 1HKMA 3P14A 3TAKA 4IWWA 3CH0A 4PMQA 2PDGA 4PEKA 3R5EA 1ZJAA 3V36A 2ZZ7A 3GIPA 2BODX 3PBGA 2BX7A 2ZZ5A 2VP8A 1IHIA 2XZ7A 4KWWA 1QPNA 4RXGA 1FWIC 4RDYA 4QNEA 2HCVA 2UY5A 3WN6A 4QDMA 2VWSA 1T96A 4S3CA 1OX4A 1N82A 3KDNA 3BUVA 1MUWA 3QHOA 3T08A 2BXYA 3TK7A 2AL2B 4NZ3A 1V6XA 3BJFA 4PC8A 3VGGA 3VD9A 3WMBA 1CZ1A 1E6ZA 4H9TA 2IXUA 3BGAA 4L6HA 1OD8A 1VFTA 2ZRXA 4LEFA 3SBFA 1FCQA 1WO2A 2GVYA 1Q7QA 1TZ9A 3UBPC 1ITXA 1R87A 3R12A 4HVXA 2BXZA 3KRSA 3O1NA 2FMOA 2ASHA 1C90A 3UR2A 3ISIX 3GXIA 2WMIB 1RCXB 3NSXA 2XHYA 2AGKA 5AKQA 5F2IA 4ZQCA 2EAWA 3MVIA 2EPOA 3KXQA 4PTWA 1RY8A 3NL5A 3NUKA 2V2DA 5HMFA 1L8PA 1PKYA 5CZSA 3CB8A 4LVAA 1HXJA 2FVLA 3PJWA 1W5NA 5C71A 3VOHA 5BOOA 5DN1A 5I78A 3ARSA 1Z8AA 1UA3A 7TIMA 2E9BA 3U5YA 3BICA 3VGDA 4CN6A 1ONRA 4US6A 4ILSA 2PRMA 1MDRA 2X41A 3SUWA 5AYXA 1KB3A 4FI4A 1GQIA 3MHUA 1UOZA 1T40A 3A12A 3W74A 4BZYA 4IFKB 2YCIX 4AMAA 1ONXA 1XC4A 2Z28A 3ANUA 1QHOA 3PTDA 2J74A 3GYCA 4S3KA 4BKNA 3MYPA 2FLIA 4AVFA 1YPFA 2TODA 4O57A 2JIEA 4QG8A 2KX9A 1GOKA 1V7AA 1JJKA 4WOZA 5LHFA 3PTKA 2HROA 1VFLA 3ZYZA 3GE7A 1SSDA 1FWEC 1WDQA 1QPQA 2YDRA 3EPMA 3ARWA 3OOQA 4RL3A 3NQAA 1XX1A 1M68A 5HNUA 4WJXA 1SR0A 3T40A 1CEOA 3TW9A 2EF9A 4J2PA 1ZJHA 3ZS4A 4YTQA 2ZUSA 4KIRA 4QDPA 1G4SA 1K1DA 1JYXA 4H9UA 4NZFA 4HYWA 4IGMA 4Q32A 3G6MA 1KFKA 2GJXB 5D02A 2PURA 1BAGA 3N4FA 3SN0A 2VD8A 4BEQA 1D3GA 1OX5A 2GVLA 4QROA 3K1GA 1UUQA 2VCAA 3TC7A 4CCZA 4M81A 2GDUA 3OGSA 3HG3A 1UWUA 4A8LA 1VIZA 4XV0A 4UXDA 1IEQA 5LA0A 4JKLA 4XKYB 4BWLC 4OJYA 3M0IA 1QNSA 4FMVA 5FEZA 1HN1A 1RUSA 4ICMA 3LQGA 1VFUA 5A6AA 4MM1A 4B9YA 5LXEA 4X60A 3MT1A 1UIPA 2OZ8A 4DF1A 3ZR6A 5BU9A 2J78A 4X9YA 4AD5A 4DN1A 4J3TA 2HNHA 1RCOB 3W6LA 1D3HA 5EKYA 4HYRA 1SZEA 4KRUA 3K8KA 3FJNA 3GU1A 4PTMA 3WUFA 1E1CA 2R1KA 3G3DA 1OSEA 3WQPA 1KXQA 1DXFA 1VCVA 5FF4A 4BS0A 3B8WA 3LENA 3BMWA 3PJUA 1PTGA 4O13A 3AUJA 1BF2A 3PF3A 2DT0A 1W8SA 3VOCA 2WLYA 1P6WA 4ZOBA 3BSHA 1WYIA 5E0CA 2Z2UA 3LHTA 5A8MA 1JIBA 1H41A 4CU8A 4L6DA 4B15A 4QQUA 1SO3A 3D0CA 3FS2A 4DJFC 4Q4RA 4QJ3B 1EBHA 4MZ8A 1FHVA 2B31A 3B8TA 3GY1A 3UG5A 4JIQA 1FTXA 3GSMA 1W3HA 3U4FA 1OZMA 3FAWA 3CB3A 4JIRA 3W22A 1O4UA 4HKPA 1J0ZA 1S3HA 4Q4QA 1GG1A 3IAQA 3QFWA 4D6DA 1M6JA 2GSJA 1H50A 3W27A 1KO0A 2CEQA 3V5FA 4LRTA 4FB7A 1UD2A 3N12A 4RZ6A 5DBUA 1FXQA 3U3HA 4P8UA 4HNCA 4AWTA 1EHNA 5HMSA 4Z1YA 5K9DA 1OG0A 3NZ1A 5CC3A 3SJNA 1P0NA 3AIUA 3S1GA 3HPXA 4A3RA 4PCSA 2ZX6A 4L65A 1RP9A 1AD1A 1TR1A 2J7CA 1TVLA 4DBWA 4M29A 3WH8A 1MO0A 1N8IA 3S2CA 3O63A 3K13A 4IQJA 3HJZA 1TTPA 3ZR4A 6REQB 4MNMA 2CZ5A 4KRTA 4M0XA 2VFEA 4L9XA 3DHPA 2OEMA 1TX2A 1LJYA 2NV9A 3RX3A 2IQ0A 3RO8A 4KBXA 1VFFA 4GZEA 3M0VA 3W25A 5CGMA 5AOUA 4JIIX 3P3BA 4EAMA 1S2CA 2PGEA 3W00A 4IUGA 4FAMA 3WELA 3SAZA 5TIMA 3AYVA 4OGZA 1BLIA 1T5AA 1FWRA 1BVNP 2NXGA 3DHDA 5CPTA 1V0KA 2DZAA 1E0XA 1ITUA 2Y5JA 3TOYA 2Y7EA 1JCMP 3STEA 1W3JA 2DH3A 1FH8A 3VDGA 3TDFA 2X1TA 4KFNA 3C3UA 1EYWA 5I3HA 3JR2A 5H8UA 1TPC1 3MI3A 2QCGA 2C91A 1UWSA 3UWEA 2RDTA 1XI3A 1W3IA 2HXTA 3QM3A 2FGZA 3XINA 3VA8A 3R25A 3NQMA 3CHDA 4YS1A 1GKPA 2EKGA 4UTKA 1YE6A 4PBFA 4O28A 1WXJA 5FCZA 3G0UA 1PDYA 4WVXA 3EXTA 4WHBA 4JL1A 2JQXA 4WGXA 5AVHA 2J8TA 1XSJA 4Z08A 4XZLX 4DAIA 1JZ5A 3HG5A 1V4YA 4ADUA 1V6YA 1YBQB 4I7VA 2CC0A 2OZ0A 2VURA 1GZJA 4JCLA 1PYMA 4M56A 3MVTA 5DEZA 1VH7A 1Y7VA 5E6YA 4NU7A 5DY3A 2G97A 4ALDA 4BA0A 3S1XA 1G4TA 2HVNA 1G7UA 3A4AA 3ATYA 3CUGA 3CPUA 3W76A 1JCNA 1GOQA 2R1PA 3FSTA 2J9ZA 3MO4A 1D7KA 3UR8A 5J04A 3SUTA 2O9RA 2CPUA 3G0XA 1XLKA 3WNNA 1UA7A 3AXIA 3RLHA 1KXVA 3MZ2A 3H53A 4AC7C 4AZ5A 3GIQA 3ZJ7A 2X0SA 4P5UA 3W7LA 3LM7A 2VMFA 2IXVA 6CGTA 4KPLA 2Q09A 3N9KA 3VDHA 1EQCA 3TROA 2D22A 1IIGA 4CUCA 1FY6A 3TU9A 3WD4A 4JIPA 2P88A 4JL2A 2Y24A 3IV3A 4Y8FA 4FLRA 3W24A 2WHMA 1DHPA 2YA2A 2YL5A 1XKYA 1M53A 4QAIA 1EPVA 2I5GA 2XH7A 2D2HA 3U5UA 3P93A 3IVTA 4H8NA 3H2OA 1FWBC 4MJ4A 4YYFA 3PWAA 4PB3A 4EX4A 1I0BA 2X2GA 4WUIA 1N2VA 2ACUA 1EEPA 2ZXBA 4W8LA 4C90A 1PZ2A 2NVDA 1Q2RA 3UYCA 2J6XA 2WAGA 2WOQA 3VFCA 3NG3A 4Z1AA 3TIMA 4HU0A 4F2BA 3P74A 1EB3A 4TOQA 3FSUA 4KCVA 1TV2A 3W7MA 3FYYA 2PWVA 1LUCB 2G37A 3MSGA 3VD4A 1MQQA 1UC5A 3FNDA 1UH3A 2CWXA 5ABGA 2DUXA 4DXXA 3LRLA 3C61A 1BXBA 4ZVJA 3KVMA 4B90A 1RH9A 2WKGA 4F0RA 4C6BA 1XCWA 4PODA 4B5VA 2VRJA 4NJJA 2DIEA 3N2TA 1FWHC 2FYMA 3ARYA 4OBTA 1CB7B 3IVUA 2Y6ZA 3NIYA 4R7JA 2YX0A 1GW1A 4EK7A 4BI5A 4R33A 3M0KA 4TVCA 3BSGA 2XVGA 4Q4OA 4JTLA 2YB1A 3OTRA 4WDTA 1ZL1A 3L67A 4IFRA 4ZO6A 3W4RA 3MHFA 1UR0A 3B0XA 4HOZA 4U33A 1E72M 3DYPA 5D9PA 4GJIA 2Y89A 1PKLA 5HBFA 1UR3M 4M19A 4A3UA 4UTUA 3F4CA 4C7FA 2B0MA 3T78A 4IF2A 4O19A 1OB0A 3NCOA 4ROQA 3KCOA 2DU2A 4PB4A 1X6LA 1XC6A 3U0HA 2ZDSA 4C7DA 3CU2A 4YTRA 1G94A 3KBJA 3BLKA 1D3CA 1VBJA 2D0FA 3R1ZA 4IZGA 1AG1O 2BLEA 3WJYA 4KGLA 1S2VA 1XRVA 1S5VA 4IIFA 5BRPA 5FSEC 2EG8A 4P7LA 4QR6A 1JI1A 3KDOA 3D3AA 4M3PA 5C54A 1KCLA 2NX9A 3RUBL 3WYZA 3WX7A 3OVRA 1XXXA 4BEUA 4DZAA 3ARVA 1GVFA 4HPJA 2J62A 4DLMA 1XYLA 2V3DA 3WDJA 1BQCA 4O53A 1H4PA 5TBOA 4QEEA 1KC7A 4HNOA 1BYBA 3BOFA 4X0NA 4Q33A 5U4NA 4DPQA 1VGAA 1O66A 2FPVA 3GKFA 3RLVA 3PVFA 4XD6A 2DUZA 1GG0A 2WNWA 3IJIA 1EJUC 4IIGA 3AO0A 4GC4A 2GQ9A 1I2PA 3RR1A 3B0YA 1K3UA 1IF2A 1HG3A 2J88A 4P7NA 3OA3A 3WBEA 1AJZA 1NARA 2ZUMA 3URQA 3H8AA 2PDMA 3GBEA 5D8WA 4W93A 2XFWA 4DJDD 2X30A 4IP5A 2Q8XA 3OBKA 5EMMA 4HYVA 1G7VA 5DQPA 4GGHA 3VKDA 2PDYA 2Y61A 4AYGA 4D6HA 7PTDA 4EVZA 2F6XA 3MKKA 2Y8UA 4IQDA 1PJ9A 1OFDA 3H22A 3G3MA 3E1F1 3ITYA 3G8RA 4DBSA 3NYDA 3FN9A 4HA0A 2L5HA 2VQTA 3QQ0A 4PUNA 2DP3A 1FP9A 3L2IA 2IKJA 4A6GA 1BYDA 3BQ5A 3KLLA 4Y90A 4LGXA 3AWOA 1EFZA 2H9AB 2SFPA 2UV8G 1U5JA 4B91A 3BAIA 5C2CA 4LAOA 1KNWA 1R86A 1R3RA 1WUFA 1QHZA 2QCNA 3LOTA 1LBFA 5KTLA 3QR0A 2BZNA 3SIMA 4TU1A 4GQGA 4O1FA 1TMLA 2ZA3A 2W92A 1Q4NX 4AEEA 2WQPA 3LBCA 4PMYA 1VS1A 2C1HA 2ZC8A 2VX4A 4FX8A 4M1BA 4MOZA 5CJ5A 3TONA 3LCFA 3PSVA 1A3HA 1OYCA 3LD5A 3WG6A 3QN3A 1NTHA 4O17A 2Y0FA 3ZZ1A 3TQPA 4PCPA 3P6LA 2HVMA 4BF9A 3QTPA 4OVXA 4HNNA 3HGOA 3ITVA 3P67A 2ESCA 4DJDA 2VJXA 1QBBA 3W2JA 1Q6LA 1NF7A 3EOUA 3A3HA 3PK7A 3U48A 3AMDA 1ISVA 3W23A 2PI6A 2VFFA 3AYTA 2EXOA 5HJXA 2C0HA 2Y8VA 4H2HA 3WLMA 2WJFA 2Y4SA 3WKZA 1UKPA 1WCGA 5BW6A 1J2WA 3UPBA 3L68A 2PDUA 2PGWA 5SWUA 4PE8A 1JCXA 1UYQA 3TTSA 3IUIA 1EWEA 3CUFA 1E73M 3ARUA 4MPQA 2QAFA 3LM3A 2WVSA 3T4WA 1CENA 4QCFA 2YXOA 2C7FA 2BTMA 4A2RA 2WVUA 1MVYA 3LZ3A 4B2DD 3CV7A 1XPYA 4M7SA 3UVIA 4G56A 2P10A 1XD0A 3LBMA 1HVQA 1ZBCA 3UESA 2CESA 4GKLA 2GFTA 2DSUA 2ISSA 1P0KA 3TFCA 4KEUA 4V1XA 4B9ZA 3BLDA 3CWOX 1Z3NA 1W9XA 3DGRA 1FP8A 1FWGC 3E0IA 2WM1A 1N8WA 3KWSA 3O0FA 3W84A 3TYBA 2FJUB 2J7GA 4G7EA 4DWSA 4ZZ9A 4C6NA 1JCJA 1WNOA 2HDJA 1CXIA 4J3UA 3GXDA 5AHFA 2PWHA 1JDFA 4I9AA 1K8YA 4NZCA 3WL1A 3W1NA 4EANA 2OYLA 1EZ2A 2HBVA 3CUJA 2A3HA 4LC6A 1KBJA 3E0FA 4JTFA 1H1NA 4EF9A 1EX1A 5AZ1A 3IUDA 2GK1B 3FYPA 4L4PA 1HJQA 3PSWA 4V2XA 4LSBA 3PBVA 3DBPA 4PUMA 1AW2A 2R94A 4O1DA 3WBWA 4RE2A 4Z2JA 5TQLA 2QVHA 4AMCA 1EEXA 5EY5A 1DQXA 5AVNA 4GI9A 2G4FA 3EWXA 1A53A 4CVWA 3OZOA 4B2DA 3WK0A 5A6LA 2EHHA 3MZNA 1XH2A 4OT7A 1KFJA 3SB0A 4D6CA 4AD2A 2QKFA 2QGHA 3G2GA 3NTYA 2D24A 3LZ5A 3T1GA 1L2UA 3FVMA 3DG3A 4UUIA 1F5ZA 1LF1A 4XAYA 3Q45A 3MSYA 3VIOA 3GDBA 3TJ4A 3F4NA 5LNWA 4AIEA 3N9SA 3RN6A 2CBUA 1EL3A 3IEBA 2HEJA 2G4JA 3MTWA 4E8GA 1UZHA 3WQWA 3HQOA 5GJNA 4C5YA 4F40A 3DFSA 1EP1A 5E9AA 1DXEA 3B04A 3O07A 1L6SA 4BHYA 1FA2A 2Z1VA 3WQ8A 1JDCA 3BLEA 4E5TA 2QXWA 4PYSA 4UCGA 1TRIA 3KBNA 4GYPC 3W7HA 2W9MA 1TVNA 5LXXA 4UTWA 1FWJC 4GUGA 2C14A 1XG4A 2J8GA 5FF7A 3GG0A 1YHTA 3E2QA 2BFGA 3GK0A 2FVKA 2IKGA 1EIBA 1GKRA 3S8HA 1D8WA 1KRBC 1KFWA 1LL7A 3PNZA 5LIWX 1NFGA 3L66A 3TN3A 5LNVA 3M7WA 1Y5XA 4LVBA 3CAKA 2X0YA 3FYOA 1GOWA 3CYJA 3GAYA 3R13A 5CGTA 4D6GA 1TR9A 2W79A 1GORA 1CXKA 2D20A 3QV9A 3VKBA 5JH2A 3D3FA 4JR5A 4CN4A 3ONBA 3EZ4A 3TV8A 2YIHA 5C70A 4CD4A 1G4EA 2RDXA 2J24A 1REQB 2O9TA 3VOJA 3M44A 5A8GA 3R8HA 4Z17A 2V69A 1XIIA 1ITCA 1UD6A 2VWTA 4UIOA 2GL5A 4TIMA 3ITOA 5DCBA 2OG9A 4HMNA 4JY8A 3PG9A 4KEMA 5IFTA 1Q2SA 1GVQA 4M51A 4NNCA 3NEHA 3GC2A 3WF1A 1H7RA 1F2JA 2YXXA 2UY4A 1AQMA 1H7NA 3G8EA 3GG1A 4NUWA 5I06A 2ZTKA 1PO9A 2INZA 3F7JA 3W82A 2FGLA 4B92A 2DIJA 5DLCA 1BD0A 1K02A 3WD3A 5A6BA 4D8LA 4OE7A 3AIQA 7A3HA 1X7FA 5HXMA 1CECA 5A6TC 2GGJA 3DDMA 2UZ9A 2TMDA 4C6PA 1F9CA 2VELA 2GGEA 5BOFA 1DJWA 3KZPA 3KBVA 5HULA 3K4AA 2BVDA 2DZSA 5BCAA 4IIEA 2E3ZA 1JCLA 4UR9A 2A3AA 2TPSA 4M7TA 1GPWA 1ZNNA 3UVAA 4HA1A 4ZOCA 4JQ4A 1Q66A 5D09A 1VJZA 4F0SA 1JUKA 4ZFMA 4ZA0A 3KL0A 3W81A 1E6NA 1PAMA 1TG7A 5H8MA 2AAMA 3ITCA 2Q6ZA 2W67A 1NDZA 3EEZA 3G6LA 5FESA 4QG6A 2G96A 2DVXA 1JZ3A 4LV9A 1WDWA 1ZAIA 1XLJA 3M5VA 1Q6EA 1R47A 2WMJA 1RPXA 1US0A 3E02A 1ITQA 2CHRA 1XLCA 2I5QA 3TA9A 1ZBKA 4D71A 1MNZA 4RXFA 3W9ZA 1RXOB 1SO6A 3DG7A 4AWEA 5DXXA 2D0GA 1YW1A 1CLKA 4O18A 4RZ4A 1ZGDA 2I57A 4XAZA 3GVRA 3G5EA 1HKIA 2P8CA 3UPMA 4LWWA 4HZ8A 4BCEA 1IWPA 1LROA 4IL2A 2HS8A 3CMFA 4MJMA 3V1HA 2GVJA 7REQA 4A3HA 5D9NA 4S23A 4W7VA 3LHWA 3TYUA 1KM2A 4WXYA 4WEVX 4WIWA 1E51A 5D2YA 2PDJA 2X1RA 4JFTA 1UOKA 3QVQA 3QGVA 1UASA 3UCCA 5REQB 2C3ZA 1TIWA 3BK0A 4QCEA 4H41A 3CT7A 4YLWA 3S6DA 5IBXC 2XTKA 1SPQA 4JTHA 1POJA 1B57A 2QCDA 3HG4A 2VDIA 1VRXA 1XIBA 1W17A 1VZWA 3W75A 3OZYA 4GMEA 1EGZA 2DQXA 2QDHA 1NDVA 2XU2A 1X39A 4WOQA 2WKLA 3VYLA 4QS6A 2J75A 1IYXA 4O4VA 2A7RA 1OFQA 4XBJA 4JTIA 2ZZ1A 4H3DA 4FR6A 4JTEA 5C7VA 1NP2A 2V0TA 3RG6A 3IIZA 1X1OA 2V9DA 1HF6A 4LBRA 4L61A 3TZFA 2FKPA 5I3JA 1JI2A 1Q6DA 4D1JA 3UY8A 4C6KA 1XP3A 1J12A 1B9BA 4MYXA 3LCIA 1LT8A 1H0IA 3XIMA 3IRSA 5DMNA 3WEZA 2OSWA 1IT0A 1Q6CA 1JG9A 1T41A 1UD3A 1QW9A 4B3ZA 3O3RA 1C91A 3M0HA 1J0JA 4JFSA 2OLSA 3CQIA 2WHKA 2POTA 1UWAA 4EP8C 3AHYA 1FWFC 1IEWA 1GJWA 3ZR5A 1TELA 3D6NA 1KKOA 2YBUA 4QLLA 2V67A 1AH0A 4KCWA 5CPLA 1QK0A 3VE9A 5F2MA 4HCDA 4ZQMA 3UA4A 4GYJA 3TCSA 1GJUA 4WSKA 1UD8A 2C18A 2OEKA 2JGYA 3WUBA 4D8ZA 4K38A 3MC5A 4UTTC 1EZWA 4ZBCA 3WK3A 4GINA 1R38A 2A2IA 3AC0A 4MFDA 1I2OA 1W0MA 5BWAA 3PN8A 1VENA 4ATWA 3VUSA 3VE7A 2OO0A 2XSBA 4H2CA 1HKKA 1GYLA 1DJIA 1IIHA 1UBSA 3T9PA 4R7OA 3SY8A 3DFHA 1HGYA 4I6KA 4OTKA 2WZEA 3CHVA 3AU2A 3I4KA 5G4HC 2OOFA 1B3XA 1X8FA 4MLRA 5D30A 1SZFA 4TTUA 3OA5A 3QGAC 2IPJA 2P0OA 3LA4A 2OX1A 2VD9A 2OQYA 4IHCA 1I60A 1SGJA 3VK5A 4LTSA 4LANA 5JIWA 1TFVA 4JAWA 2OSYA 1J79A 2G3MA 3W02A 2YCKX 3WY1A 4XO7A 4C6QA 4Q8PA 2ALDA 4JTTA 3ZLHA 4PMOA 2XUCA 4RLIA 3VKCA 5XINA 3W7KA 4UQCA 1YXYA 2JBMA 4IISA 5G4WA 2F6KA 1A5CA 4PGLA 1JZ7A 2PZ0A 5E6ZA 1QPRA 3FLUA 3BGGA 4AD4A 3R8GA 4CD5A 3BVJA 5F7UA 1UW9A 2FIQA 1C8YA 5AHMA 2GPTA 2MANA 2F6UA 4LOCA 3OBEA 3NSMA 2DSWA 3NPWA 1B3VA 3WJXA 5GNZA 1VHCA 4RJEA 1K9TA 2VZUA 1C9DA 4FNRA 4GX9A 3CXOA 1TPEA 3UPWA 3R89A 2ZUVA 1GONA 4XISA 3SN4A 3NA8A 4DZHA 1NU5A 3VNDA 1DWHM 3SRFA 4AZHA 1GK8A 9CGTA 3FK4A 3W1XA 1NY1A 3UJFA 2J47A 4OFCA 4JHOA 3GD6A 3V0TA 3UNDA 4JEJA 3CLWA 3GH5A 2CZDA 1TJ0A 3QPZA 1KM1A 2I1OA 1FWAC 3IK4A 2X2YA 1Z32X 2AOSA 3CEPA 1L9WA 3UNTA 3VGBA 3LI0A 3CMGA 1OIFA 1SU5A 4GZIA 5DF0A 3P8JA 3OJGA 1WV2A 5IHSA 3O0KA 3L0KA 1VC4A 4LAZA 1XLLA 4TQTA 3VINA 3UEQA 3SJ3A 1JYVA 2OXNA 2WNNA 2Z1WA 5BWFA 3KHJA 3FX4A 1TUFA 1IWBA 3H24A 5DELA 3OGVA 2Q01A 3UZWA 3POCA 2QJIA 5T91A 1PTAA 3STFA 3SEPA 1HX0A 3S83A 2W27A 3QY7A 2PD9A 3Q37A 2PCEA 3C2YA 3BG5A 3BE7A 5AN7A 3MP5A 2EPLX 3VIIA 3HQPA 1OFBA 3KOFA 2QV5A 4FALA 1P43A 2VFDA 3KOYA 4RW5A 2CBVA 1XUUA 2O92A 1XGEA 2AAAA 3PUOA 1WOBA 3S0CA 1UP3A 1W2PA 4JNZA 1BWVA 2ISWA 4LVFA 3HJEA 1OX4B 5TF0A 3RU6A 3KLKA 1F6KA 4Q8MA 1OABA 1UR2A 5HJYA 1XIJA 1E56A 2PSNA 5FJTA 3GS6A 3TQVA 1OQFA 4QAWA 4DNHA 4FPSA 3MUCA 4O14A 3SRDA 3I4EA 1PWLA 3VCCA 5DMYA 1IV8A 1QOPA 4PUUA 2OWWA 3BMXA 1PIIA 1FWCC 3N1AA 2QDEA 3KP1A 3VNZA 4O52A 2EPNA 4IX0A 4Z2KA 1KLYA 1U5HA 2WBGA 1MW3A 1MUCA 3NQBA 2WWCA 1JUBA 3UWQA 3MP3A 2HE8A 4Y6GA 3HURA 1DQWA 3N2XA 2XH4A 3VIFA 1CGWA 5K3VA 3W3OA 1AODA 2G50A 3EA1A 1L6GA 3FJ4A 3PULA 3W73A 3EWUA 4HMDA 1U33A 1S2AA 4J27A 1H7PA 4Z1DA 1EOMA 2B7QA 4UMAA 4ICCX 1BWKA 2PRLA 5BRQA 1PE1A 3W7DA 4GJ1A 1C29A 4TXEA 7ODCA 5A5WA 3WDHA 4HOXA 1RQBA 3G22A 4XAGA 3AYSA 1OK6A 2XM2A 3FHQA 1KRCC 3B97A 1GKQA 3HM7A 3HGSA 3N6HA 3L2MA 1WA3A 1LRNA 5FIPA 1NFPA 3NQFA 4W7UA 3M5ZA 1Z9AA 1NH6A 4A21A 2J7BA 2ZKMX 3NAVA 4EPDC 4IL0A 1JYNA 3EWYA 2A21A 1C3FA 3M47A 5I09A 3GTNA 2Q3RA 2QPXA 5MKGA 4HTYA 1T8XA 2WWDA 3N2MA 1POKA 3CTLA 1F8IA 2V81A 3LERA 1TV3A 2G8ZA 2VYOA 5G1YA 1DJGA 1UR9A 2PCQA 5A8NA 5KINA 2FB2A 2V3EA 1FWSA 1MFVA 3RNDA 4MWAD 2WSKA 5FJPA 4LJ3A 5T8GA 1FHLA 1O12A 4PRTA 4CQBA 4NX5A 4LT9A 3LCLA 4JYFA 1VBGA 1NOWA 4IPLA 5F4SA 3L12A 4DNMA 2ZYFA 1SW3A 1Z7AA 3W29A 3QV7A 3OG3A 1WXZA 2R24A 1LLZA 2DJXA 3CYVA 4UTMA 1E40A 4LS2A 1K4GA 3SFWA 1E6PA 3TLLA 1XISA 2ZVRA 1EGMA 4ZTYA 1PUDA 2TAAA 1UBPC 2CYGA 3R0KA 5GJPA 5HINA 3THCA 3BG9A 1OCBA 3F03K 5CCZA 2EQDA 4Y9NA 1CLVA 1GGOA 3MSRA 2E5CA 5FF3A 1QI3A 4LRSA 1F4HA 4ZSTA 5I7GA 2VZOA 1RQEA 3B9NA 3LBOA 3VNIA 3GU2A 1FDJA 4LYRA 2I14A 5GVJA 3MB9A 4MY1A 2YA0A 2J27A 4DXVA 4PBEA 2ZX8A 4IMEA 1DJXA 1V77A 1U1UA 1ZUAX 3L4YA 3ZMRA 2QCEA 4FNPA 4HSOA 1O6IA 2NUXA 1A5SA 4FXRA 4U5IA 4REQB 4H9XA 1E1CB 4WRHA 1VRDA 3UXDA 1V3JA 3AZRA 5AHNA 5HUOA 5LYRA 3NQDA 1VYSX 4HNUA 3WEOA 5FEWA 1RVKA 1BKSA 4Q22A 3GHSA 3CIXA 1ODZA 4PSPA 1QO5A 1GW9A 3BANA 9RUBA 3S5ZA 1YDVA 3R7MA 1EO7A 4HIBA 4QSHA 1JDAA 1KCKA 4BI7A 3ABQA 2BS9A 3ID7A 1TJ2A 1H3GA 1TE1A 3QZAA 1NJJA 1J6OA 2E6YA 1YLVA 1JXJA 3AJ7A 2ALRA 3FV9A 2NQHA 1T8QA 2OFJA 3TYZA 1X1ZA 2BXVA 1U83A 5HATA 4UZSA 5EMKA 3MWAA 1ZPTA 2XIMA 5D2VA 3IPWA 2XINA 3I6RA 1LORA 3SY5A 5HOSA 2QNEA 3W01A 3BLPX 2E40A 4RE3A 4PL1A 1R85A 1R2TA 4DELA 1XH1A 1JZ6A 4TX8A 1H61A 1C7SA 5JMUA 4DQWA 4O8RA 1JRBA 4PMJA 3PZGA 1JXKA 4JQAA 4M6UA 5A69A 3BURA 2YCLA 2XIBA 1XR2A 4JTSA 1LWHA 4URIA 1P6CA 3E2RA 3QEZA 1R3WA 3SY1A 4H6KA 3WH6A 3HFYA 2R8WA 3P2VA 2AMXA 3AXKA 2PDWA 3R10A 4PZVA 3DBNA 3E6EA 3KRUA 3PWIA 1KBKA 2FPTA 1JDEA 2HPMA 1KM3A 5H6HA 3E12A 3SRKA 1V6VA 4KWOA 1PB0A 4B5TA 3L5MA 2OYMA 5T9CE 1DJZA 6PTDA 1J9YA 4ZQNA 3RMEA 2VOTA 1B90A 1AUSL 3GXTA 3M0MA 1JZ8A 3JS3A 1Q6FA 3F2BA 3CUXA 1JPDX 1KR1A 3QH2A 1DIKA 2NT0A 2OGYA 5HUPA 3TVAA 1D9EA 3TOPA 2FTWA 1FHUA 1EJWC 3SRHA 4HZ6A 5MHBA 3WF2A 2FDMA 3S6OA 3QZEA 1M7OA 3RGTA 2E8YA 1UQYA 3SCNA 5XIAA 3M64A 4GI6A 1EF2A 1BFNA 1KBLA 4W8BA 1TRDA 3NO1A 1S38A 3PY2A 2HJPA 4H8UA 1ONEA 1V02E 2FH8A 4GUFA 4ZO9A 4IXXA 4XTDA 1MXGA 2HK0A 1EYEA 3KW3A 4D6FA 4RE4A 4FSAA 4M80A 1UCWA 3GH7A 4QITA 2AL2A 2ZUWA 4OQVA 1HTIA 2DVTA 3HV9A 3RRAA 3APTA 1NDYA 4PMRA 2VHLA 2ZE0A 3WZ0E 3OLDA 3KUMA 2INEA 3WD0A 1E3XA 3G1HA 4XZ9A 1FCBA 1EP2A 1LL6A 3JRKA 3NEVA 2YPIA 4C6LA 1RVGA 4OIFA 4TO8A 1MSSA 2D69A 3LPGA 2ZRWA 3WQFA 1K7XA 1MQPA 1Q6RA 4L56A 5C7HA 1X6NA 5DCDA 1FKXA 1SZGA 3CV2A 3M0LA 3LRKA 1R3VA 3PS7A 2CIPA 3RPDA 3GTHA 4HGXA 3M4HA 2CW6A 2QQ6A 3DCPA 3QJAA 3BL3A 3DYMA 4KFOA 2ZFAA 3CUZA 4CD6A 2XVNA 3WFAA 1CI1A 2JALA 2PMQA 4DO5A 2XYLA 4H83A 1Z89A 3L0GA 1TJPA 3GQYA 2ZA1A 1Q6GA 5HQMA 3GM8A 3NQ8A 4JTGA 1A5MC 2WM0A 3HTWA 4YWSA 1T7LA 3H2MA 2NX3A 2ADAA 4GY1A 1HL9A 2OZ3A 4GFSA 3ATZA 4IX2A 5HNTA 1KBIA 5L9FA 4N02A 2A5HA 3PPFA 3NQEA 1YKWA 1OF8A 3WEMA 1UP0A 1TJ1A 4JTRA 1YXDA 3NXLA 3QMSA 3R6IA 1MMFA 3EWCA 3VKAA 4DBEA 1QWKA 3TQ0A 5FOOA 1DTNA 3GNXA 2GGIA 4IP4A 3AZTA 4GUIA 3RCMA 4B5WA 3CBWA 3FVDA 5C9RA 4XZBA 1PCKA 2O4QA 2OTDA 2VC9A 4EIVA 1R6WA 3PPGA 3Q2DA 1HJVA 3W53A 2VENA 1LT7A 3QLDA 3UWVA 3N9RA 2QVNA 2PDHA 3CZKA 3UXLA 4F4RA 4AD0A 2VDHA 3W2MA 1ZJBA 2V5JA 1TMHA 4NP7A 3L9CA 4C5ZA 2B4GA 1GVYA 4HU8A 5BU6A 2V63A 1XLGA 1E0VA 2W62A 1J2BA 4QJ5B 1IGSA 5HWNA 3LPPA 1I1WA 2VCBA 1W3TA 1HP5A 2EKCA 4ZB2A 1CGXA 1T99A 2X8RA 3PZUA 3L4ZA 2NVCA 3EDDA 2FZMA 1YPIA 3O9NA 1JGIA 4YXGA 4FK9A 2WVTA 3KOXA 3VZZA 4NNAA 2VCCA 2E1DA 3SCRA