3LD5A

Human aldose reductase mutant t113s complexed with idd594
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ld5A00
4XZHA 1EL3A 3MB9A 1YE6A 2ACQA 3UGRA 3WCZA 4GABA 4XZIA 1EKOA 4JIHA 2DUXA 2ALRA 4LAUA 4JTQA 1UR3M 1X98A 2PDKA 3BV7A 3LN3A 2HVNA 3RX4A 1PZ0A 2IPJA 4L1WA 3V0SA 3DN5A 3R6IA 3WBWA 4GQ0A 5DANA 2J8TA 2HVOA 1EF3A 1LQAA 3VXGA 1PWLA 4JQ3A 4F40A 2PDXA 3R43A 2IQDA 1S2CA 2PD9A 4JQ1A 1IEIA 4LBSA 4JQ4A 1QRQA 2PF8A 3C3UA 3EAUA 3H4GA 2F2KA 5JH2A 1PZ1A 3R8GA 3G5EA 4WDUA 3V35A 4OTKA 3WBXA 5AZ0A 4FAMA 4GA8A 4H8NA 2PDGA 3BCJA 4YVVA 1Q5MA 4XZNX 4DZ5A 1EXBA 3CMFA 4PMJA 3ERPA 3LENA 3WG6A 4GQGA 1S2AA 2F38A 3N2TA 5LIUX 3LZ5A 4XK2A 1FRBA 5C7HA 2WZMA 1S1RA 1XF0A 2PZNA 3EB3A 3EB4A 4FZIA 1C9WA 1ZSXA 2FVLA 4HMNA 3R7MA 2A79A 3F7JA 1IHIA 3CAQA 2PDLA 2FZDA 5LIWX 4DBUA 4JIRA 3COTA 4QXIA 4PRTA 3KRBA 3M0IA 5M2FX 3G1RA 4LB4A 3H7RA 2PDWA 4XAPA 4WRHA 1VP5A 5LIKX 1JEZA 1S1PA 3LUTA 4JTCA 1MZRA 4I5XA 2IKIA 3LQGA 3ONCA 3MC5A 2HDJA 4XVEA 3GHSA 4RPQA 3UZXA 3D3FA 3V0TA 2PFHA 1ZGDA 2PDPA 1PYFA 1XGDA 3UZZA 2IS7A 3V36A 1T41A 2BP1A 2PDBA 4PR4A 1MRQA 2PDFA 2IPWA 2HV5A 2PDIA 4LAZA 4WDWA 3FX4A 4XO7A 4JIIX 1HW6A 4IJCA 5LIYX 1US0A 3Q65A 2VDGA 1OG6A 3H7UA 3UZWA 4MHBA 2PDNA 4Q7BA 5HNUA 3O3RA 2QXWA 2PDJA 3GHTA 1QWKA 3CAVA 4PUUA 5HA7A 1M9HA 2PDQA 2PD5A 3GHRA 4H7CA 2NVCA 2PDCA 2FZ9A 3UZYA 4ZFCA 4YS1A 3RX3A 1ADSA 2IKGA 2BGSA 1ZUAX 1XJBA 3CV7A 4DBWA 4AUBA 1K8CA 1Q13A 3GUGA 1X97A 3B3DA 1YE4A 1X96A 4GACA 4JQ2A 1ZQ5A 3U2CA 4JTDA 4L1XA 4YVXA 1VBJA 2PDUA 1RY8A 1AZ2A 3RX2A 4R9OA 4QR6A 2HEJA 4WDTA 2PDMA 2AGTA 3LD5A 2IQ0A 3QKZA 4WDXA 4FALA 3O0KA 3R94A 3CASA 3GHUA 5KETA 1SM9A 2HE5A 4GIEA 2INZA 3DOPA 4G5DA 1YNQA 2IPFA 2HE8A 2CLPA 3LQLA 1AH0A 3FJNA 4WEVX 4EXBA 4JTRA 1T40A 3UYIA 2PDHA 3P2VA 3R58A 1R38A 3BUVA 2C91A 2BGQA 2ACUA 1J96A 2FGBA 3LBOA 2ISFA 2NVDA 4LBRA 4IJRA 4XO6A 3Q67A 5JH1A 4XVDA 3UG8A 1GVEA 4ICCX 1RY0A 4Q3MA 4IGSA 3ONBA 4YU1A 2IKJA 4QX4A 3M4HA 1A80A 2DUZA 2PDYA 3LEPA 2PEVA 4JTAA 4NKCA 3T42A 1Z9AA 3N6QA 1PWMA 4QBXA 4EXAA 2I17A 2DV0A 4XZMX 3S3GA 2WZTA 4HBKA 4JQAA 4PRRA 1LWIA 5HNTA 5LIXX 1Z3NA 4YVPA 5AZ1A 2INEA 3UWEA 3UP8A 3LZ3A 3WBYA 1RALA 1YNPA 2R9RA 1Z89A 1Z8AA 2IKHA 3UFYA 2ACRA 1MI3A 1AH4A 3M64A 4XZLX 2I16A 3CV6A 1HQTA 4ASTA 4DBSA 3LNMA 1AH3A 2IPGA 3BURA 4FA3A 1AFSA 4LB3A 2P5NA 3R8HA 3V0UA 2FZBA 4PUWA 4GCAA 4WGHA 3NTYA 2R24A 1AZ1A 2FZ8A 2ACSA
chains in the Genus database with same CATH superfamily
3L4UA 1EL3A 4Q8TA 3NJ3A 1FFRA 1B2YA 2XISA 1KW1A 3H70A 2XVGA 2BFGA 2ZUNA 3AZRA 5FD0A 3N9KA 1ADOA 1ZB5A 4E4PA 5MF5A 3ABQA 3EWYA 4ENLA 4LC8A 1KLYA 3UD6A 3RIKA 3LLDA 4AVFA 5DRCA 3AXKA 4EP8C 3PJUA 4MG4A 5HJLA 3WQEA 1LOQA 1EB3A 1V6WA 3C2RA 2J6XA 2WANA 4RE0A 2WMFA 3PPCA 3QN3A 1M53A 4GI9A 1LDCA 3MJMA 3STGA 1DJGA 3UF9A 5A94A 3W00A 4LUSB 2QAFA 3B8UA 1XHGA 5EMUA 5HJXA 4AEFA 2OSYA 4W8BA 4JIPA 3RO8A 2VXNA 3GXDA 1LWJA 1FA2A 1ZY9A 2Z7GA 2XH4A 4PMUA 3B8DA 3DCPA 4OV4A 3B8TA 1X8FA 1M7OA 3BOFA 3WBXA 2PDGA 4B3LA 1V6VA 2VR5A 3KVLA 1EHNA 1W9VA 1IF2A 3KOZA 3QQWA 3GDTA 2QT3A 4R7JA 5BRPA 4P8UA 3DYPA 3M0LA 4JCMA 2R1PA 2PUZA 2V3FA 4O15A 4IOTA 3H55A 1S1RA 4GGHA 3EDEA 3ARVA 1PYMA 3V75A 4E38A 1NU5A 4HMNA 4GYPA 3UYCA 3KP1A 2GDVA 3ZVHA 3SQLA 4ZXLA 4CNSA 3SUWA 3PPGA 1JNDA 1LF1A 1ALDA 1O95A 4D6DA 1M6JA 3R0UA 3MZNA 1AW2A 4U28A 4DBUA 2DEPA 2ZOXA 3GDBA 2NW0A 1PVNA 1OD0A 3MTWA 5DCDA 3WX7A 1X38A 1B3XA 1BGGA 3GTFA 2Y8VA 2Z25A 2Y0FA 4J7RA 1WUFA 1RP9A 4AZGA 2PLMA 4QDMA 2QCCA 1XM3A 2ANUA 1HO1A 2J6VA 1TV7A 3TSBA 1R3WA 5XIAA 3HPZA 2J62A 2PC4A 1XIEA 3WLMA 4UNKA 1L8NA 5D9MA 5HJYA 1T41A 3N2XA 4CQAA 3CLWA 5KZMA 2HSAA 1UUMA 5ECVA 3DFQA 1R30A 2A7NA 3BJSA 4F0MA 5BMWA 1H49A 5CZ0A 4FLQA 3UXAA 2Z2BA 4AD4A 3TFCA 1UC5A 5BRBA 4AWTA 4Q7IA 4AMAA 4AEEA 2WMIA 1CENA 1KBIA 3NL6A 4IL0A 1FXQA 3W74A 2RDWA 3CK5A 3KDNA 2FH8A 1W3IA 4FPSA 2PS2A 4AYGA 5HMDA 3W7NA 7REQB 1MEHA 1K02A 3DI1A 3ABSA 3AWNA 3QTGA 1CXLA 3T78A 1TYGA 2GVGA 4B90A 1HX0A 1ICSA 1GQJA 5EKYA 1V6YA 3SW6A 2NQZA 4OT7A 5D09A 4FXJA 4AUBA 2KAUC 3TAOA 3WZ0E 2YCKX 3CB3A 1FWBC 2TRSA 4PCTA 3BSHA 1B5TA 2NZLA 3OIHA 3POCA 3SUUA 4NF7A 2DQXA 3I3BA 3KHJA 1VBJA 4HMCA 3AXIA 4WX2A 2D69A 3QFWA 3RX2A 4QITA 3CWNA 4R33A 3K8MA 3TZFA 2Y7EA 4H8UA 4WHBA 3SN0A 1PL9A 2A5HA 2ISWA 4LCQA 3LY0A 2ZXDA 4F0LA 3MSDA 3UBPC 1TA3B 4PMXA 2B7NA 4RNJA 2D2GA 4DPPA 2BVDA 4RCXA 3RK8A 4ZB2A 1KGUA 1XDJA 5LXXA 4PCPA 1IIGA 3SCWA 4P8VA 1QI4A 3ICJA 4E2BA 2E09A 4C6BA 2C1HA 5CZTA 2C91A 1B1YA 1UBPC 2BGQA 2ACUA 3FEQA 3KOFA 1Q3NA 4HA0A 3B40A 5A95A 4UTWC 3A3WA 3N2CA 3OW1A 3C0QA 4LGXA 3U57A 1OSEA 4LNYA 3XIMA 1TR1A 2EPNA 4Z1YA 4MKVA 1DIDA 3WNPA 1NQ6A 1X1ZA 2Z1WA 1PB0A 3CQIA 4OECA 4QQ3A 1AUSL 2DUZA 3LEPA 4JTAA 3XISA 5FOOA 3A13A 1EDQA 3UR5A 4O52A 3WF2A 1US3A 3C0JA 1YHTA 3DHUA 1L6FA 3QR1A 3N3TA 2XINA 2DH2A 3WQGA 1POJA 3VZYA 4W7VA 5HNTA 1KV8A 1FOBA 1BQCA 3HFTA 1QPOA 3LV5A 1V5XA 5RUBA 3DG3A 4J3VA 2FHFA 4O57A 3HF3A 4BQ5A 1ICPA 1Z8AA 3PTDA 4D6FA 2DQWA 4C6KA 2F61A 4JPGA 5C9ZA 2CLOA 3ITCA 4QRNA 4NP7A 1EJWC 2VR2A 5GNZA 4XZLX 3VX1A 1UA3A 3CV6A 1UZ4A 1XLGA 1PO9A 1DOSA 1S46A 4JFWA 1PHWA 1O66A 2GUUA 1LQ2A 2W0UA 2GJPA 1TPVA 3WJWA 3CHVA 5AN7A 2J27A 4HPXA 3IJ9A 1AQHA 3W1NA 3SM0A 3ZM8A 3ZS4A 1TV3A 1TKKA 5BYWA 4JIHA 1RCOB 2A3BA 3EOSA 2HK1A 4UFKA 1F3EA 3GXMA 3LN3A 2HVNA 4CQ9A 2YLLA 4F9DA 2WC4A 1PZ0A 4K38A 1TRIA 3UNDA 3R8RA 5JIWA 3C0LA 2V3EA 1K9TA 3QV6A 3WBAA 3ZJ8A 4A3UA 2P0IA 2VRKA 4KFNA 4WKAA 1B90A 1EJXC 2NUWA 4NJKA 4QAWA 1TX0A 5G4HC 1NWUA 2X1UA 1DEDA 4EKJA 2I5QA 2D1ZA 3NDZA 1V7YA 1JCXA 2WKJA 2BBFA 4WK9A 3OODA 1H5VA 3S6OA 3S5YA 1FY6A 3TFXA 4IZGA 1DHKA 4OTKA 3I7RA 4LPCA 4AY8A 4C6EA 4FAMA 4I6VA 5AECA 4WJEA 4XZNX 4JFSA 4GUFA 2DVUA 4R34A 4FR1A 1U1HA 1XS2A 4N42A 4U4MA 4EX4A 1OX6A 1JZ7A 3OYXA 1EJ7L 2F38A 3SJ3A 3UG5A 1R7OA 3LZ5A 4HKPA 4GY0A 3GH5A 3WLLA 2G3IA 2CBJA 3BWWA 2V2HA 1N82A 4Y9MA 3L2LA 4OGZA 3QJAA 3MUAA 2YB1A 1EIBA 4JTKA 4GQBA 4GNVA 1TZZA 3AOFA 3OIXA 3W9ZA 4YTQA 4XBKA 1WUEA 2J9YA 3C52A 3VVGA 1PIIA 3HV8A 2JFEX 2OLHA 3IIXA 3NWRA 4LF2A 3SUTA 5A6MA 1XQLA 1M68A 3DEQA 4HMDA 3CAQA 4C1NA 3B8WA 3KHDA 3QBUA 4AIOA 2YL5A 2X2YA 2CLEA 1H7PA 1V6UA 4IIGA 3ABZA 2H8ZA 3W7GA 4RE3A 1MNZA 4U2ZA 4FNTA 2XFFA 1MVYA 3NO1A 1MZRA 5C70A 1VBGA 1SQ7A 4IXXA 1LLZA 1TVNA 1M04A 3AHXA 4M56A 4ML4A 4HYWA 2PRMA 2PDFA 3W7DA 3OGRA 1EUAA 3N29A 2CZDA 1ZALA 4G7EB 3LGEA 1CYGA 4GZJA 3VO0A 2PLCA 2OEJA 3VGFA 4XZBA 2OODA 1WKDA 5DBTA 4Q6XA 4AX6A 1CEOA 4MHBA 3MHGA 5DT7A 3UNTA 4DJFA 1AD4A 3U8GA 4XAYA 4JN7A 4PUUA 2RDTA 2QGYA 3K5XA 1GOKA 3O6DA 4XD5A 1TWZA 3H2EA 2ZWZA 2PWUA 3M5VA 2WMKA 3THQA 3NVDA 4MJMA 3KEHA 4Q4SA 5D8WA 3H26A 1H63A 3VD9A 3CU2A 4Q7NA 1Z69A 4A6GA 2QUMA 1X96A 2P3ZA 2J7FA 2Q71A 4JTFA 1J79A 3P3BA 4YCOA 1H1YA 3ZWTA 4JGDA 5DO8A 3TTEA 3IJLA 2WNNA 4QR6A 2VUYA 4HK5A 2VDIA 1KM1A 3CL7A 2WNQA 3VMNA 1OIFA 4HNLA 2CYGA 1WKEA 2X40A 3O0KA 3CASA 2WMGA 3NNTA 1WV2A 4G5DA 1XD0A 4CEUC 1P0KA 1TREA 4GVGA 1K3UA 3C56A 1G1YA 3ANUA 5I3DA 4TV6A 2EO7A 3MBDA 1QDSA 2HJPA 1ODZA 3C2FA 1BVZA 4IHCA 4N2YA 4XG1A 2PP0A 2VOTA 1P43A 2FGBA 2GVYA 3K13A 3UWYA 5LYRA 3LPOA 3GXIA 3ZMRA 5XINA 4WR3A 2PWFA 4WD0A 1ME9A 1YYAA 3OBAA 4O17A 4PUMA 2VC7A 1B3WA 3E2QA 1TVLA 3SGUA 1QHZA 3WK1A 3PZVA 4FR6A 2C16A 1IWPA 3QPEA 2YSWA 2QUVA 2ZWYA 1U30A 2YIHA 3ZR6A 5FF2A 4ACZA 1OX5A 2L5HA 1WDPA 4ERGA 4HTBA 5CLTA 4BA0A 4US5A 1U5JA 1UOKA 5JVLA 3MVTA 3F4CA 3UP8A 3DU0A 1UR4A 2A7PA 2DDXA 5JQ9A 3MCOA 3R79A 1WDDA 3DHPA 1G5AA 1W9DM 2E25A 1K8XA 1VCGA 2X1TA 2A3HA 1F3WA 1M7PA 4H8VA 3BAXA 1GPFA 4AHQA 4D6EA 4LCRA 1K9EA 3CBWA 3WDQA 3HJEA 5IBXA 2C13A 4QEEA 3M6YA 3WH7A 4GH1A 3BLFA 4MWAD 1RVGA 3V4BA 2J7DA 3S1VA 2E8YA 1R3SA 1S3HA 4IIFA 3KL5A 2YXGA 3RM9A 4FX6M 3N3MA 1AZ1A 1VLWA 2FB2A 1OCQA 5F4SA 7CGTA 3P60A 4AWEA 5E9XA 2OO6A 3PUOA 3RILA 1Q7QA 5JBFA 1A5MC 1YXYA 3RPTA 4LAUA 4JTQA 2OGYA 1ODUA 3ITLA 3F2DA 4AFYA 3UZJA 1ZP4A 2NX3A 1W2PA 1JPKA 2D20A 4AQLA 3CZJA 4PMQA 4CNUA 1ZJHA 1QI0A 4MPKA 3LI1A 1V93A 5DANA 3EX3A 5M3WA 3NL5A 1LQAA 1IIHA 1ZTVA 3VFCA 3CEUA 1PHQA 3NQ2A 3WEZA 2ZZ3A 5AVHA 2PBGA 4X0VA 2J9XA 1V6XA 4JDBA 1RBOB 1UWIA 3W7LA 3DYMA 2JGYA 1LROA 5HULA 1F8IA 2OQYA 3GTNA 1VFUA 3A9IA 1UPMB 4L6HA 3EAUA 3V5CA 3ARZA 1QNQA 3CEPA 2XGIA 4DF1A 3G5EA 2E9LA 4HSHA 2DZBA 5D2TA 1UWUA 3B9AA 2XPKA 1I2RA 2XM1A 3G3MA 1FVPA 4WSJA 1TWSA 1B9BA 3LENA 1QJWA 1MUMA 1E6SM 2P76A 2X42A 1S38A 2FFCA 3P0XA 4GLEA 3WLIA 2QJJA 5AHEA 3VOHA 3C2OA 5FIPA 3KX6A 2YCLA 4JIQA 4MDOA 2V5CA 6XIMA 4HZ7A 3I3EA 3AIRA 4Q8QA 3GG7A 3GIPA 4OQVA 3IGHX 1RR2A 2A6LA 2TSYA 1EP3A 2X1RA 4GFSA 1NFPA 3EB3A 1FDYA 1KQZA 1SZGA 1CTNA 3VIHA 1BEUA 4YTTA 3GC2A 4KMQA 1C92A 2NWSA 1ZSXA 4A21A 1DWJM 4P2VA 2BSLA 1MFVA 3URNA 3MANA 5HNRA 5SWUA 3W1QA 2ZBTA 1DJYA 4C6NA 4QHRA 4XBSA 3COTA 4LXFA 4WZHA 3E02A 3CXOA 3APTA 5M2FX 2FFIA 1QASA 3LHUA 3MSRA 1ISXA 3TR9A 4OIFA 3E49A 2OZTA 1MSSA 2XZ9A 4OBTA 3VGGA 2B7QA 1H5YA 5KZEA 3RG6A 3U3HA 2O92A 1TE1A 3CQJA 3A4AA 3BMVA 2OYKA 1UR8A 1E72M 5FAJA 1TWDA 3S6DA 1XYLA 3WQ5A 3HMCA 5AY7A 2NWRA 2ZUTA 5BNKA 1OCBA 3BAIA 2YBUA 3O7UA 3VABA 1C93A 1K8YA 2PDIA 3QYQA 4GINA 3NQ7A 3LSCA 3PM6A 2VD8A 3KL3A 1GEHA 4IH3A 3WJYA 1US0A 3GVRA 2IW0A 2YKKA 1GZ1A 4GNJA 4NNCA 1GJPA 1QHOA 2OTDA 4ADTA 1DIOA 4K1WA 3G8RA 5CH9A 1K6AA 1WOBA 3RMEA 5C7VA 2BTMA 3QEZA 3ALFA 1WOAA 4CU8A 2Z6IA 2QQ6A 4O1AA 5IHRA 2NVCA 4PBGA 4E4UA 4NZJA 4J4KA 5E93A 1YTKA 1FKXA 3IVUA 4WQ6A 1VBHA 4DJEC 1H11A 1XC4A 1XCWA 4U10A 1DBTA 3TYAA 6REQA 2V30A 4W4QA 1CI1A 3S2CA 1RV8A 2VL4A 2AMXA 1GYMA 1S5MA 2UY2A 4DXKA 1ZQ5A 3VNMA 5J5DA 1BHGA 2W27A 5E09A 2G4FA 4K39A 4ZO6A 3QHOA 3SGGA 3W1MA 1GG1A 2PDMA 5D37A 4Q4QA 2Q8XA 3NM3A 3DG6A 2C8NA 4CU6A 6A3HA 4ZXOA 4PGLA 2ZUUA 2C14A 4NZCA 2WJFA 1J10A 2GQ8A 2QLYA 2PZ0A 2WVVB 3F4NA 3ORWA 1Q6FA 1I0DA 3E3HA 4BKNA 4UFJA 3FKKA 4Z1BA 2IPFA 4L61A 1GONA 1ME8A 4S3BA 4PSPA 3SZ8A 1GVFA 3ARTA 3IJQA 4F0HA 2J13A 5T9CE 2J8GA 3CPRA 3ZT6A 3VIOA 4J2PA 2YA2A 3D6NA 3E5PA 1SO4A 2XIOA 3SFKA 4O4VA 3O15A 3BUVA 1F4AA 1WDWA 4S3DA 1UWSA 1SFSA 3VKAA 1LLOA 4MOZA 3QTPA 4KF1A 3UG8A 4QG9A 2VZTA 4J5NA 1VEOA 4XD3A 1QHPA 1J11A 5LNSA 3FFSA 3SAZA 3S5OA 3HQPA 1IZCA 5LA1A 4AIBA 5TD4A 4WKHA 3KM8A 2PURA 3JZEA 4EF8A 3TNOA 3PBUA 2BHZA 1QVBA 1OF8A 1KTBA 1AJZA 3W1AA 1V0MA 3V1PA 4HIBA 4EXAA 3T4WA 3RAOA 1JDDA 1J5TA 5AHLA 3WENA 2WW5A 1ICQA 3RDKA 1TJRA 3L4ZA 3E2SA 1CGWA 4IGMA 1K8ZA 4D8ZA 4HJWA 4RXFA 3AU6A 1A3WA 3B4YA 5KZDA 4DWSA 3PZNA 3LI0A 4WJXA 3FIGA 1OK6A 3T0TA 3VD7A 2VWSA 3FNDA 3W72A 1J6PA 4H7ZA 4AF0A 1D7FA 3M0XA 4RE2A 5I7GA 2FPYA 3MDWA 2CXGA 3UA3A 3FHQA 3GVQA 4MTVA 4NXSA 1EZ2A 4XAFA 1B3ZA 4FNRA 4IFKB 1PKYA 1VF8A 1ZFJA 2CBVA 1EGZA 3BURA 4G6CA 2J66A 3TWBA 4IISA 1Y5VA 4ZO7A 3O8AA 4KKXA 4A29A 4GCAA 4RPPA 1H50A 1W5QA 4BQ2A 4US6A 1OFPA 5EL1A 1KWGA 2YYUA 1XFBA 3WY1A 1TUXA 2DT0A 3RPMA 1EP1A 4M6QA 1YDNA 2GSEA 2D0FA 5ABFB 3BV7A 1E55A 1WXJA 2FPVA 3O9NA 3OOQA 1PCKA 3QZ6A 4UTJA 2GWGA 4DPQA 4WKFA 3GNOA 1BFNA 2WSPA 3UWUA 3H2NA 1O5QA 4JQ3A 2UWFA 5DXYA 1IYXA 2XVNA 3H2FA 4O18A 3IAQA 2UV8G 3NXFA 4M6UA 4CQBA 3AQUA 2E6AA 4E0CA 1QRQA 3W76A 4NZ4A 2GL5A 2CU0A 2WCAA 1ISZA 3SRDA 4C1KA 3EDJA 2OSWA 3RITA 1NQKA 3BCJA 3OO2A 3EOUA 3VA8A 2J77A 1CXIA 1QPKA 1HJWA 3V7PA 3MMUA 3H22A 3WF0A 5C8BB 3P62A 4HYVA 4O0QA 4XZWA 4H6QA 2D0HA 2C15A 1MRAA 1UR0A 2GSJA 3HPAA 4PZVA 3OJGA 1G0CA 1D8WA 1OFBA 2ZX6A 3RU6A 1XLHA 4AF0B 1B4KA 4AVNA 1PKMA 3GSMA 1NF7A 5HINA 3MBFA 3QW4B 3GUWA 3S5NA 4CU7A 4O1BA 1CGUA 3AMCA 3E38A 4QS5A 3W86A 4QFUA 2KX9A 1K9DA 4FMVA 1W1IE 5EYWA 4GD0A 4DYEA 3VNLA 1AMYA 1G01A 2VTFA 3BG3A 3IVTA 5GJNA 4DNMA 3W7PA 1DL3A 2Y24A 4O0KA 3BAYA 2QCEA 3PJTA 3UXKA 3LB0A 1J8VA 4I9JA 2JKPA 4MPQA 1GG0A 1RK6A 3H2AA 1LYXA 2C79A 3WL0A 1M03A 1UHVA 2VC6A 1KBKA 1KKRA 1B9ZA 4IX0A 1DWIM 2PFHA 2G37A 1T0OA 3V36A 1BQGA 2E5DA 1O5RA 4PR4A 1JDAA 1KXQA 1FQ0A 3UWZA 5C9UA 2F84A 2D3LA 3FX4A 5CC3A 3EB2A 1EO5A 5C55A 1ZRQA 2V68A 3VGDA 2YDRA 1R3RA 1OG6A 4L6DA 3STEA 2AAAA 1IXPA 4ORMA 1A5UA 1WZMA 1RCXB 4LWWA 2VEKA 5FCZA 3M1ZA 3HO8A 4E5TA 2IXUA 3MQTA 1R8LA 1OCNA 4ATWA 1BWKA 4H9VA 3KWSA 3KBSA 4LV4A 2ZDRA 2CWNA 3F2BA 3TUUA 2VVSA 3JW7A 1ZBCA 1JRBA 3AS0A 4M82A 1ZJBA 1Z41A 1XH0A 3NL2A 1GCYA 1N2VA 3ES7A 3KBWA 1X97A 3U4FA 4IPPA 1P6CA 2QCHA 3NPUA 4Q8VA 1CT5A 2J78A 2QULA 3PJXA 4PB3A 4QJ4B 1SFJA 4JTDA 3LHTA 5BROA 3U2CA 3VPLA 3WH6A 4ZE4A 3D3AA 4JICA 4NJHA 1JZ3A 1G4EA 4NG3A 5HDRA 2E40A 5IOBA 4FLOA 1IQ8A 1EIXA 4YTUA 4AY1A 4J2MA 2EJAA 2WBGA 3QKZA 1GZGA 1VPYA 5C9WA 2WAGA 2HE5A 5LA0A 2V82A 2PODA 3OZPA 3NEHA 5A2CA 3LQLA 3N14A 1XUZA 2BXZA 5A8OA 3GZ3A 3WYZA 3V5OA 7ODCA 3N4AA 3ARSA 1E5JA 2Z4GA 3D46A 1J9YA 2HBXA 1BPLB 4GY7A 1QUMA 1V3LA 4AWUA 4D72A 1GKRA 2NVDA 1TG7A 5EBAA 5JH1A 1SO3A 3AHTA 4KCVA 1QCWA 2RGLA 3IV3A 3EA1A 3HM7A 4GPNA 4IJBA 3VC6A 4S38A 3BICA 2P3EA 2MUCA 2NLYA 5DEZA 1XW8A 4CN1A 4JX4A 3RF9A 4BQ3A 5A8QA 1W3TA 1H7RA 1PWMA 2D0GA 3GO2A 2XSBA 3KS6A 3P8JA 4QLLA 3FYYA 4MUZA 3AC0A 4M6VA 3EKLA 4ZQRA 3CQHA 4HBKA 3E0IA 4V1YA 4XKYB 2WVTA 3TYDA 5AC7A 3L2MA 5CBJA 5EGRA 4WSHA 1TUFA 2INEA 3MKVA 3FHAA 1E71M 1MFUA 2ZXAA 1OX4A 2F6KA 2H3DA 3PB2A 3OB8A 3PTKA 3NZRA 2MNRA 3AROA 2GDQA 3NDYA 4UTWA 4MJ2A 3I68A 4W7WA 1XBVA 4FB7A 1ZBWA 1O6IA 1IR2A 1Q4NX 3QPYA 1VB9A 1IZJA 1EOKA 3RLUA 2V3GA 4MAVA 1AFSA 4ZOBA 5DMNA 4FK9A 2E67A 3V0UA 1YXCA 3MUZ1 4QDPA 1FH8A 2PTYA 1ISWA 5FL0A 1TIWA 3BVJA 2GUYA 1TZ7A 3TYUA 3K1DA 1U2YA 4MGGA 2DSWA 3AO0A 3OEXA 1TJ0A 2CZ5A 3PZGA 4B5WA 1EKOA 1F07A 1VLIA 2VFDA 2PF0A 3MO7A 1EWDA 1UMLA 4KWWA 3FJLA 3RX4A 4CD7A 1VHNA 5FJJA 3V0SA 1UC4A 3BK0A 3B9DA 2Z2AA 4M1RA 3KBJA 5HPCA 1E73M 3K46A 1FWRA 1BYBA 3MI6A 2WM0A 4H83A 3UR7A 1PWLA 4F40A 4Y9OA 3DI0A 2QDDA 4YPJA 4PA8A 4FHAA 3T08A 3G77A 1QNRA 4H9UA 1KFWA 1LP6A 3TZNA 1NWSA 3QY6A 1MDLA 5CPSA 1DJQA 1I6NA 5D2YA 5U7SA 1RUSA 1EX1A 2A2IA 3E2VA 3UJEA 4A3RA 1GW9A 3PG9A 1Q66A 3B0UX 1L9WA 4CVWA 5JUVA 1L2QA 2Z28A 3RGTA 1SFLA 2ZZ6A 1XG4A 4Y9NA 1D3CA 2GVLA 2BXVA 2H8XA 4H8NA 1EX5A 1J01A 3LPPA 2WCSA 3FW6A 3CS2A 3QLDA 3VFLA 2QCMA 3OVRA 4XISA 2C3ZA 3S0CA 2ZVRA 3WUFA 4PN2A 1JG9A 2ABBA 3VUPA 1M01A 1MXGA 3L12A 4DBDA 3LG3A 3MHUA 2BB0A 2PWHA 3T40A 1WCGA 3H6OA 2WSYA 4TOQA 3W2JA 2G50A 3M0JA 3V18A 2DORA 5BZAA 3EB4A 2DP3A 1I4NA 2JIEA 2OX4A 2A79A 2ZADA 5IXEA 1KRBC 4RDVA 3WD1A 1HZYA 5E0FA 5A8PA 1XG3A 1KM6A 4Q8PA 3F5JA 5CEWA 3QOMA 5JBEA 3CUGA 4IMFA 1JULA 1HKWA 1GT8A 4LALA 4ORIA 2DSKA 4LUTB 3AYRA 1WPCA 4LF1A 1HGYA 4JTCA 5BOEA 4GCXA 5D8ZA 1L6YA 4LRSA 5JBDA 3LRLA 1KA9F 4WLCA 5AHFA 5FEXA 4DVOA 2HDJA 1OZQA 1F9CA 3WQPA 4D1JA 1FWHC 2CLKA 3AI0A 3CT7A 5F2GA 3S9YA 3HPXA 2HTMA 5EFFA 1ONEA 3DESA 3IJDA 4E8CA 1VIZA 4EANA 1QNVA 1IGSA 4WOZA 3DX5A 4Z2JA 3BTNA 4PMYA 1WE5A 3N9SA 4NJGA 2VFIA 4MFDA 2XFRA 3CAKA 4JTIA 4LUYA 1EUNA 3W73A 1YRRA 1UR2A 4JEJA 2F2HA 3GD6A 3LS9A 5K7JA 4AD0A 4E2VA 3RMJA 4H7CA 3EKGA 2ZDSA 2PDCA 3BGAA 2V9DA 1JD9A 1TWIA 1MUCA 3PR2A 4P7LA 3TYBA 4Q8OA 3YPIA 4K1GA 2JK2A 1ZUAX 2ZA3A 2WHMA 1TTPA 1Q13A 3IJ8A 1E0WA 3QC3A 4CCZA 1O5KA 4KCUA 1YLVA 5MHBA 4ADSA 4CEXC 5HQMA 1C8YA 1Z44A 2J9ZA 2YFOA 1PTGA 4B3ZA 1FWSA 3OGSA 4DO7A 1E0UA 1Y8BA 3TX9A 3LSBA 1N7KA 3RUBL 1MXSA 2E9BA 4F2BA 2X7VA 3AALA 1VC4A 2VI0A 2WNWA 3LD5A 3DC0A 2D2OA 3I7SA 1E9ZB 1MW3A 4WDXA 1WKYA 3AAMA 2J7CA 3KZSA 4IQDA 3R94A 4O12A 4GYFA 1SM9A 3C3NA 3E12A 2ON3A 3JZUA 4NAFA 1MDRA 3F03K 3UR8A 1TTJA 2CIPA 1JL8A 2IXVA 4QJ1A 2W61A 3VGEA 4Q4OA 3MMDA 4HA1A 4H41A 3UETA 2EJ1A 2CETA 4BI5A 3CPGA 3QQ0A 3WKZA 3AMGA 1XSIA 2GFTA 4FX8A 4BFAA 1LWHA 3N18A 4U2YA 1R0MA 3GDLA 4GYJA 5ECUA 3VNDA 5KITA 4MY1A 1JYWA 3WEMA 1KR1A 3LLFA 3HGJA 4CQ8A 2QMJA 1SFTA 3KE0A 4PFHA 1RQEA 1JZ6A 4FXFA 1NJJA 4MAZA 2F9RA 1M3UA 4PB5A 4HZMA 3W28A 1QXLA 4F79A 2WVUA 3H7VA 3STPA 1GOOA 2VEMA 3T42A 1Z9AA 1YEYA 5GPRA 2ZXQA 4AD5A 1S2VA 3TIMA 1HGWA 2ZC8A 3F5KA 5AYXA 3H4XA 4P7OA 4ES4A 3EXTA 3G0SA 3B0YA 1MMFA 1FWJC 5AZ1A 3GG8A 1YTEA 1VBUA 4DZAA 3W3OA 1OFRA 2JQXA 2TYSA 1L6GA 4YTRA 3CZKA 5I3GA 3TCEA 2EEXA 4JZ5A 4HSOA 1UZ1A 2I56A 4JTEA 2A0NA 1UCWA 2A3CA 1HTIA 3M44A 3LNMA 2OG9A 5MKGB 1P6WA 3WJZA 3QKEA 4MSSA 3NL3A 3NFUA 1W5NA 1FHUA 1KCXA 2NSXA 3PG8A 3UJ2A 1OC7A 3W7CA 1QK0A 1QW9A 4DJFC 4XZHA 3SB0A 4HHPA 2JIWA 1M5WA 1E6XM 3KRSA 1HT6A 4IQJA 3BLEA 1WO2A 3NQGA 4RX0A 5FL1A 3S2NA 4MWAA 3REQB 1VJSA 3AMDA 1CB7B 1EBGA 4XTDA 3KBMA 1L0PA 4MZYA 4A8LA 3QHMA 4MMWA 1W6TA 2DZWA 2NT1A 3DN5A 4MIMA 2ZX9A 4GQ0A 2XWDA 3NGFA 1S2UA 5CXPA 4DUOA 4DJDD 2RUSA 2WXDM 2YA1A 1ECQA 3BC9A 3GM8A 3LMYA 1E4NA 2NUXA 2P88A 1U5VA 1KTCA 4X2RA 2QJGA 1CLVA 5REQA 4LAMA 5G4WA 3W22A 3GYCA 4JQ4A 1GYNA 4HQVA 1PDYA 2RJHA 4Q4PA 5CC7A 4HNNA 2OCZA 4L9XA 8RUCA 1TV2A 5JH2A 4K68A 3DXIA 4NNAA 3T8LA 4C7DA 3HOJA 4PUNA 4F0SA 3UG4A 1BLIA 3R0DA 2ZRVA 1F61A 2YB4A 1K77A 4DZ5A 1MW0A 5C5YA 5HQEA 1FH7A 4UMAA 3WG6A 1A5OC 3BO9A 1YIXA 1AMKA 2X05A 3MA8A 1B54A 3F4WA 4L64A 5C7HA 2JEPA 2NX1A 3NOYA 3QMTA 5LA2A 3VIIA 1VYPX 2GQ9A 2J7GA 4NAEB 4BI6A 2PZNA 5AHIA 4W8LA 1QBBA 1DJIA 5FF3A 3W7JA 4CUCA 4H9XA 3U2OA 1I1XA 5I3IA 4RV8A 2Q8LA 1K7EA 1XQKA 3L0GA 1JZ8A 1H2JA 3F1QA 2HBVA 1QPRA 4OUIA 1KXTA 1WDRA 4Z2GA 2R91A 4EPEC 1GJWA 4LFYA 1QU4A 3A4JA 3ANVA 4KIEA 3WNNA 4RNFA 5BWFA 3QOKA 4C90A 2XH0A 4QXIA 3USZA 1TPFA 5I03A 1EDTA 3KOXA 5KEZA 4LB4A 1VH7A 4E6MA 3DFSA 3GG0A 2VKZG 1OC5A 2X41A 4BEQA 4DO5A 2GVEA 3PWGA 1ISYA 2B7PA 4CD6A 3MC5A 1XUUA 2Y8KA 4IIDA 4DN1A 1KNWA 2ISDA 2JKAA 3A12A 2ZZ2A 4FNQA 3W83A 1XD1A 1VEMA 2IS7A 3VDCA 1F6KA 2RDXA 4CD5A 3CTLA 2GPTA 3O6AA 1Q6QA 2IUZA 3FKRA 4PUDA 4JIIX 4GIAA 3TTQA 2REQA 3R11A 5FEWA 4J40A 3NO5A 3Q65A 1XRFA 3W37A 3D5HA 2HROA 1XGEA 1XWYA 2A85A 2QCDA 5HNUA 2YDQA 1BXCA 1S39A 1Q45A 4PBEA 5H1WA 4FOJA 3RYSA 5KZ6A 4GC4A 4IFRA 3R89A 2PDQA 4UC5A 2VX6A 3KTCA 2G0WA 3FN9A 4DAIA 1TPWA 5FJTA 4S3FA 3L5LA 1YKWA 1TQJA 2ZE3A 2IKGA 1QI2A 4HHLA 1DWAM 4PMZA 1PKLA 2QW5A 3OA3A 3UCCA 3E0VA 4PYSA 3ZJ6A 2F8QA 4JCLA 1HVQA 4S1FA 4S3EA 3M0ZA 4O13A 3KRUA 4GC3A 4L1XA 2J4GA 2XFYA 4IG2A 1ZENA 2W67A 2XG9A 3L4YA 1K7FA 4QS6A 1LT8A 5HANA 4UCFA 5KSWA 3NGJA 3ENLA 3S46A 5C2GA 4GZEA 4TMCA 5CG0A 3KTXA 3TONA 1JUKA 1JQVA 4KERA 3DOPA 2VHLA 1QFEA 2QUTA 4MNMA 1S5NA 4EXBA 3CUIA 3AU2A 5DT5A 1NOUA 2PDHA 3PF3A 1FWNA 1WZKA 3R58A 1GWJA 2FHBA 3L65A 3LDVA 3MPGA 4UTLA 1P7TB 4XUGA 4W85A 3HFYA 2PTDA 5I23A 1XSJA 1EEXA 3NAVA 3EXRA 3RR4A 2VGGA 2XN0A 4Q3MA 4IGSA 3ONBA 2XM2A 4GX9A 3GFXA 1A80A 5CAHA 1KTNA 1HG3A 3L4XA 5K2ZA 2D2HA 4JNZA 1IEXA 2QCDB 4U3AA 4UUIA 3U2EA 4N7QA 4DIAA 3S2JA 5BXPA 1A5AA 4TX9A 2X0SA 4OOUA 1EJUC 1SMAA 4PRRA 3F5LA 1LWIA 3R1ZA 2V63A 1VFOA 1I2OA 1A0DA 5D32A 5DELA 4IPNB 5CC6A 1KFEA 1C8XA 3ZFHA 1A49A 1Z89A 3N2MA 2ACRA 3LU2A 4CQDA 2ZX5A 5C54A 2YFNA 1VJZA 3N19B 4DBSA 5F4XA 2VYOA 1BSIA 2WV8A 4MZ8A 1V0LA 5A6KA 3NXLA 3N6HA 4GY1A 4A05A 2XHYA 2ABAA 3EGJA 4KQNA 4PC8A 2A3EA 3WLOA 4EIVA 4L5ZA 3WD4A 1SW0A 3QH2A 4HNOA 1KXVA 4W87A 3C8FA 4Y8FA 3W24A 4U31A 3S1UA 1QO5A 1KFLA 1LT7A 2CNCA 5I2UA 2X1SA 3ARYA 4A2RA 2Q8ZA 1ZPTA 5CSUA 1HL2A 3MWAA 2QV4A 4YCPA 3LCWA 1VJIA 3PWIA 3R6IA 2CEQA 3WBWA 5FAGA 3BGGA 4LY4A 1OYBA 4XIAA 1T5AA 1YDYA 3CGTA 3FGCA 3IAPA 2Y4SA 3RRAA 1TWWA 4F48A 3AUJA 2P0OA 4B5UA 4Q8WA 3LMZA 1GW1A 4AX7A 1SYTA 3C3UA 1P1XA 7A3HA 4Q32A 4Q33A 4IT1A 4H04A 4D6IA 3TN4A 3R8GA 4HA3A 3WUBA 2G97A 4JIEA 4WJ8A 2DIEA 2Z27A 2HS6A 3PAJA 2DZUA 3P5YA 3BAKA 4H01A 1TFVA 3CMFA 1W5PA 3H24A 4ZQPA 4LJ3A 4C6IA 1E15A 4HYRA 3W7OA 3LXAA 1J0ZA 1NOFA 5C6MA 3MUY1 1CCWB 1I2NA 3WLTA 4ZCWA 3EX1A 1CW2A 4Q4KA 2ZUMA 4PEKA 1OG0A 5A6JA 2QDEA 1J0YA 4I9AA 4H9TA 1P4CA 1XLDA 3GNPA 1EP2A 3D0CA 3W6LA 4W9TA 1KBLA 3C8NA 2CESA 4Y2WA 2AGKA 5GVJA 1W37A 3HGOA 1BWLA 1ZJAA 4PRTA 3UY7A 3NOEA 4QISA 1BYCA 1E9YB 5CBIA 4CLMA 2PRHA 4NRSA 3TA9A 4C5ZA 1F2JA 3EMCA 1W9PA 4I5XA 2GVJA 1DXFA 2WZEA 4DZIA 1C7SA 1LUCB 1HVXA 3VNKA 2XH7A 3EX4A 1EOMA 1GOXA 3UZXA 1LL6A 5BWAA 4DLFA 1O4UA 4DWSC 1RLDA 5LNRA 4H6KA 3TJ4A 4D8LA 1XSKA 2Z7KA 5BXSA 2W3ZA 1G94A 5FJPA 3CLMA 1NY1A 3O6YX 1JPDX 1ME7A 4FX7A 4LUSA 5D03A 5LIYX 1ZS2A 3PSWA 3RR1A 4GISA 1RQBA 4MM1A 5LGXA 4GBDA 2PPGA 2YLAA 4G9PA 2VDHA 1FDZA 1XPGA 3KXQA 1QWKA 5HNNA 1ZJIA 4KCTA 4S3GA 4O11A 2WCGA 4YS1A 5C9RA 2GJRA 2CERA 4TU1A 1XJBA 1ENUA 5BOFA 4LAKA 1YPFA 5BU6A 4PFMA 4B5NA 4Z17A 3PWAA 3ITOA 3GKFA 4L7ZA 3WK2A 1J6OA 4UFLA 4JTJA 1TZ9A 1E0VA 3WD3A 1CECA 3G6MA 2DZPA 1OGBA 1RXOB 5CPLA 3PZOA 3W7RA 1RY8A 1W3KA 2W79A 4R9OA 5K4ZA 2FIQA 2NXIA 1KM3A 3WN6A 3ABXA 3AYTA 1ECEA 1GUVA 1J5SA 4I7UA 1Q8JA 4C6LA 4NNBA 3NG3A 2BY1A 3WK0A 1H3GA 5AYZA 2FDSA 5JMUA 3B8VA 4E2OA 3BAJA 3EPNA 2GZXA 2E9MA 4Z1DA 1QAPA 2INZA 1UKPA 3EXSA 1BXBA 1BYDA 1DVJA 2BHYA 2CLPA 4TQTA 4UIOA 1Q6DA 1DWHM 3M41A 4Q4MA 4JKMA 4B5TA 1VFHA 1JDCA 4RDWA 3WQDA 1OWQA 2DSVA 3GDMA 2OEMA 4PBFA 4D8AA 4TVUA 1XDMA 1NDYA 4M6PA 4I9MA 4YXGA 3ZXWA 3FV9A 1EC8A 3ZT7A 2BXYA 3TR2A 3RFAA 5CC5A 3LBOA 4XO6A 2AL2B 2C0AA 3Q67A 4I5UA 4KRZA 4EVZA 1UPPA 3AZTA 3W71A 1IWBA 1M65A 4UXDA 4YLWA 2OO0A 2OX1A 4TMBA 3V16A 3W4RA 5FKYA 3A23A 4NI3A 4I8DA 3SQMA 4C5YA 3GIYA 3GXTA 4OU1A 2CLFA 5I3FA 3B4UA 1J0KA 1GQKA 2BVYA 4LYPA 3FVDA 2EG8A 5IHSA 2VRQA 1JI1A 4FXSA 3W6MA 1ZU8A 1AD1A 7REQA 2ZTJA 4GBUA 4WUIA 3GFZA 6TAAA 2QUNA 1Z3NA 4RZ6A 4O10A 1V02A 1KKOA 4GUJA 4JXCA 4S2CA 3QF0A 3RCNA 3BOXA 3N13A 1TVPA 2P1FA 3LCFA 2C1IA 9RUBA 1GKQA 1QBAA 4IM4A 4A22A 3MWCA 3LCIA 4PULA 4QTGA 1ZZMA 3FAXA 3O6CA 3QV9A 4ASTA 5KMYA 3GXPA 1GVRA 2UY3A 3W2NA 1DYSA 2R14A 2V67A 3MO4A 3RXZA 3AIEA 2ONEA 2QYGA 2RDUA 2V5KA 1LJYA 2FZ8A 3N17A 4AZCB 1TA3A 1DQUA 2Q3RA 4N9DA 2ACQA 2CZFA 3G3DA 4CD8A 1XDLA 4PE8A 3SCTA 4QE4A 3SGZA 3VINA 5DY3A 1G7VA 3MV11 1C91A 5A3HA 3KL0A 4GUIA 4L1WA 3MMTA 5FI8A 4K36A 3NQVA 1X6LA 2OSXA 1AJ2A 1IXNA 2X7WA 4FNUA 4J3XA 3KUMA 1PJ9A 1R3VA 3QY7A 3CZGA 1BKSA 3DIPA 1A53A 2WYSA 3VXGA 1GGOA 4CCEA 2ZZ4A 1ZCCA 4AD2A 5BXRA 4O54A 1F3TA 3GXNA 5G5IA 5LSMA 3K30A 2INFA 1SU5A 1IEWA 3GNRA 3H12A 3H8AA 2PD9A 3RJXA 4JQ1A 1H7WA 2YL6A 2YL9A 3WLQA 3THAA 4MVAA 3BV4A 3H53A 3VE9A 1W1TA 1UQZA 5HATA 3SCNA 2Z1VA 1MEIA 3WQ4A 3W7IA 4PTXA 3FA3A 3VOIA 2E4TA 2TAAA 4U5KA 3K1GA 2CITA 1UIOA 4PTNA 1GOIA 3T2OA 4HNCA 1JF6A 2OQHA 1VAHA 1XR2A 4YVVA 4KRUA 1Q5MA 3EMZA 2H6RA 1E6RA 2PCEA 4PMJA 3QZEA 4AISA 4W5UA 5FJOA 4O1CA 4W89A 3SY1A 4ZQCA 2FTWA 5G4EA 4UR7A 4BWLC 4KWOA 4YJ5A 5A6AA 3CHEA 2V2DA 3S6TA 4I5RA 4KFPA 4FLRA 5ABEA 4IX2A 4UTIA 3TMQA 3S83A 4AZ6A 1J0IA 1ONRA 1TJPA 3AIBA 3LPGA 2YPIA 4FZIA 3ZO9A 2ASHA 3B0VC 1SJBA 3ZJKA 1J12A 4M8UA 4RZBA 3R7MA 4TTUA 5ABGA 2Q02A 4PCFA 4UQAA 5CPNA 1A3HA 1P48A 1KV5A 4XWUA 8XIMA 2BS9A 2NXGA 2J25A 4DI8A 4GKTA 2WJDA 4CCDA 2EPMX 4MNKA 2BX7A 1B3OA 2BZNA 1H09A 3KVMA 1XYMA 2NVAA 4IMGA 4XAPA 1S1PA 1RK5A 2GJXA 4OUEA 1O68A 3KVJA 4LEFA 2ADAA 3I4EA 7TAAA 1U1JA 2F6XA 3LXBA 1S2TA 3ARPA 3HV9A 2GGJA 1YX1A 1OVDA 4I7VA 1RH9A 3MSYA 1OF6A 4HSNA 5CJ5A 2ZRXA 3ITGA 2IPWA 4S3KA 1NP0A 2O9TA 3QFEA 1V51A 2DT1A 3MVIA 3QRHA 4WDWA 2NT0A 4Q8NA 4XO7A 1HN1A 4YHGA 3VKJA 1Z32X 4AIEA 4ZMGA 1S3TC 3OGVA 4V2XA 3SCQA 5D9OA 1IR1A 4F8XA 4C6PA 3H2CA 2CC0A 3N12A 4K8HA 3RLVA 3RM8A 5HQLA 2FTPA 1EGMA 3LYEA 3L4TA 4DYJA 4XV0A 4HU0A 2QVHA 3UZYA 5GJPA 2R6OA 3HA1A 1OYCA 2HQAA 4QSHA 2AOSA 1EQPA 3E6EA 3QV8A 1JVNA 3DFNA 3GE7A 3OU8A 1IV8A 4UR8A 1SJAA 1NSJA 2DSZA 2BODX 2ZQ0A 4LS0A 3W0KA 3BDKA 3G1XA 4J3TA 1A5CA 3C2EA 2PP3A 3B3DA 2E77A 2BWGA 2E28A 3W7EA 3WLHA 3P6LA 3KFTA 4MB4A 5M1TA 3C2VA 3C0SA 1UP0A 3CZLA 1IXQA 1IWAA 3TLQA 4REQB 4KH2A 2VC5A 2POTA 3ITXA 4E2DA 6TIMA 3UJRA 3WLRA 4UQBA 7PTDA 1K9FA 2I5IA 3LTYA 3ZVIA 2PP1A 2QUUA 8A3HA 2VX7A 5EY5A 4LVFA 3UPMA 2B4GA 4CD4A 4DAFA 1DJXA 2XIBA 1O1ZA 1YPXA 2WK2A 2WOQA 3GHUA 2A6NA 3SFWA 3GNXA 3DFPA 1C3FA 1TCDA 1AH0A 1SO6A 1ONXA 4L1GA 1DWGM 5A6TC 5DRIA 1JJKA 1J2BA 5G2IA 1H7XA 4O14A 1TV4A 1OC6A 1FHLA 4GO9A 2ZXBA 3E9AA 2QPSA 1HO4A 2C1GA 2GJXB 3VMOA 3CIVA 2XIMA 4M7SA 4DY1A 4L4PA 4QNEA 3PUDA 3NA8A 2WKGA 1JZ4A 3C6CA 2D23A 1Q4WA 1UUQA 2ZE0A 1G9HA 1TV5A 4G7EA 2J24A 3U4AA 1TPB1 4LH8A 1AQMA 1ESWA 5H91A 1D8CA 3M4HA 3CWHA 4QEHA 4B9YA 3DKLA 3MW7A 3EEZA 1LQ0A 4R85A 4DXXA 3MT1A 1L2UA 2Y6ZA 1LBFA 3T9PA 4LVBA 4D2JA 2CZVA 3BMWA 5A5WA 4FI4A 1CXFA 3S3GA 4B2DA 3TEVA 1Q2SA 4DB7A 2HRWA 3B06A 3W07A 1MQRA 4YVPA 1OY0A 3DECA 1JYXA 3LOTA 2AQOA 4S3JA 5DLCA 1TPDA 1RALA 1EJRC 2XH2A 1TSIA 1GVYA 1XLKA 3SIZA 1NEYA 1HXJA 5HWNA 3FY1A 3TLLA 2I16A 1KRAC 1HQTA 1KGXA 2BDQA 4FF5A 2BY0A 3UPBA 1E51A 2XZ7A 5HXMA 1S5WA 3AS3A 4QIUA 1WKFA 3W82A 1JIBA 2WKLA 1XIDA 3EA2A 4GI6A 1DTUA 4A8NA 2W62A 4WXYA 4I7WA 3SCUA 4MNLA 5CSRA 3MB9A 3APGA 3CL6A 3VNIA 1BTMA 1GOMA 3VTRA 4GABA 3FS2A 2VZVA 1W3LA 3SCOA 1JR1A 3K2GA 4MZ1A 5G2HA 4PH6A 4A3QA 4HOXA 1BXNA 3TE9A 3HMJG 5DMMA 4OE7A 4O1EA 1DE5A 1GORA 3IK4A 1AL8A 1EF3A 2BY3A 3IRDA 2FTYA 2ZRWA 3OP2A 4POCA 1MUWA 4US5D 3WD2A 3PK7A 2E6YA 4QM1A 4MB3A 1UR9A 1VD6A 1NWRA 1B3VA 4DJDA 5CAKA 4QDWA 2W6RA 4ZOCA 3DHFA 3AHZA 1DTNA 5K9DA 4BI7A 1OK4A 1BG4A 3VX0A 3TQVA 3ARXA 1XRTA 2XSAA 3OLGA 2A3AA 4M51A 1QI5A 1W9XA 2WQPA 4GQGA 4L56A 1JZ5A 2VX4A 3VZZA 2Z1SA 5LIUX 2V5JA 1M7JA 1IT0A 1ISVA 3I7QA 2XUCA 5F2LA 3MS8A 1X6UA 3VOGA 3UG3A 3PBYA 4KEUA 2H9AB 3TSDA 5FF4A 3TV8A 3KOWA 1UZHA 1Q7ZA 2E7FA 4MLRA 1EGVA 1XP3A 3BE7A 5D9PA 2CBIA 3F7JA 3MJYA 3TA6A 4NQ1A 2PDLA 1RA5A 3HJZA 1OGSA 3WL1A 1ML1A 2J7BA 3N2BA 3TN5A 2VNCA 4DM1A 1W32A 5KTLA 4FS9A 4GUHA 2GK1A 3FXGA 1X1OA 2QCLA 2EQDA 3T09A 5C2CA 1TELA 3PZMA 2J74A 3LHVA 3JR2A 3IGUA 3E0FA 1ZGDA 2O9PA 3WK3A 5H8UA 1WDSA 2PDBA 3C4UA 1E6QM 4S2BA 4EF9A 2WWCA 3LCLA 3ZR5A 5I24A 4LAZA 4S39A 2ZZ1A 3O05A 1EYWA 1K03A 1US2A 3HU7A 4QQUA 2OFJA 1XRSA 1E4MM 1WBJA 2HXTA 4AD1A 1U33A 1XIGA 4JEQA 3EEGA 1NIUA 3EX2A 3B9EA 5HA7A 3GTIA 3FXYA 2PD5A 3IUHA 3WQFA 2VT0A 5E0KA 4GG9A 4CGTA 3WDRA 3CUFA 3PBWA 2EXOA 4MWAC 1OJXA 1UASA 3TW6A 2Y5SA 3BLLA 4HMEA 1UQYA 3CIWA 1EZWA 3SJNA 3WUEA 2EPHA 3WNLA 3GUGA 4AY7A 2BVTA 1E9LA 4J3WA 2VQUA 3RU8X 4GACA 4HNTA 4JQ2A 5F7UA 2WWDA 1SJDA 3IIOA 1J2WA 1SZEA 3GW3A 4ONVA 2VFHA 3WQVA 4ZA0A 1S5VA 3SQSA 4P8WA 5A6LA 2G96A 4FLSA 3NZ1A 2VWTA 4MNJA 2DZAA 4A4AA 2I57A 4N0RA 3MCMA 2ODOA 3BL3A 3U5UA 1LM1A 2AQWA 5GNYA 2Y88A 2XSXA 3KW3A 1FCUA 1LLWA 5M03A 3LHYA 1H1ZA 2GOUA 2WMHA 1HKMA 4IMAA 5DX7A 5PTDA 2QCNA 4M24A 4GNKB 3WMSA 4IIEA 5AC4A 1IT8A 2GK1B 3LCHA 4FXRA 1SZRA 4XB3A 1VCFA 3VM5A 3MI2A 4MF4A 1C29A 3WLKX 1UA7A 1HJVA 3A5FA 1F76A 1XGZA 1Q6RA 2ISFA 3VKCA 3SIMA 1FWFC 1XYAA 2FB3A 2ZCGA 4IMCA 3A6OA 1SSDA 1OB0A 3KOYA 3OHMB 5U4NA 3PUGA 4YU1A 3LK6A 3DERA 4X61A 1YBQB 3AXHA 3W01A 5DCEA 4KT2A 1DJZA 4JDYA 5D02A 3OPSA 1IZKA 2R1KA 3IIPA 1HJXA 1WXYA 1GZJA 3VM7A 4DUXA 3PPHA 1GK8A 2I17A 3GIQA 1J18A 4AZBA 1JDFA 1U1UA 3NYZA 4GI4A 1HIZA 2DIKA 4KPLA 3UXIA 1V77A 4AW7A 2EBNA 2EG6A 3EMQA 2EAWA 4I6KA 4Z2KA 4XX6A 1XIMA 2X09A 3TQPA 5G1TA 2OXNA 3GB6A 7ENLA 3AJ7A 4F3HA 3E0WA 3PB0A 4LB3A 4ZQNA 1K7XA 1WYIA 3GYEA 1OFEA 5I09A 2ZKMX 4V27A 2HWGA 1BSLA 2EF9A 2G3FA 1QPNA 4Q22A 1CGYA 2WVVA 5B7YA 1YE6A 3OYZA 1UW9A 3W87A 1REQB 1I0BA 4QCFA 1EH9A 4FNSA 1FWEC 2UY5A 3OHIA 3EDDA 3G22A 2D22A 1PCWA 2Z0IA 1MYRA 3G18A 3L5AA 4INFA 3DG7A 4HCLA 4EPDC 3HPSA 4ZQMA 1TE6A 3MMWA 2WZHA 4UBPC 2XGZA 4JFVA 1P0DA 1PSCA 1V08A 4DUWA 2PDXA 1RZMA 1KFJA 1Y5WA 3ID7A 5HWJA 1V0KA 1T8QA 2E0PA 4RW3A 1W2VA 2PF8A 1FBAA 3CHDA 5AC5A 4K8GA 3TU9A 4LVDA 2F2KA 4V1XA 2O56A 2GQ3A 1VYSX 1JCJA 4LVGA 3B04A 3TROA 4LSBA 1HJSA 2FVKA 2V3DA 3PC0A 4UMCA 3L2IA 2QDHA 5DQPA 3GWQA 1LCOA 1KBBA 2ZVIA 2PGFA 4QNWA 3P82A 3STCA 4WVXA 3VAVA 3KTSA 2FH6A 3S9IA 4MB5A 2XIJA 4UFMA 3SUVA 4O19A 3S4TA 3I65A 3R0KA 4XAGA 3S47A 2O7SA 1YXDA 3NZQA 2ALDA 5D2XA 1BAGA 2OJPA 4IFOA 1XLIA 3PPFA 4RNHA 2DT3A 3P67A 1EA9C 4HU4A 4W86A 4AH7A 5C71A 2NLIA 4DQWA 3GAKA 3BSGA 2G3MA 1PIGA 3NPXA 3QYSA 4IFKA 2FVLA 3T44A 2RJGA 1H62A 3CQKA 5TF0A 5E1QA 1IHIA 3CV2A 1K6WA 4AD3A 4KEZA 4LX4A 3QM3A 2CLHA 3L0KA 1UD6A 3A4WA 4GO8A 2X0HA 1ITXA 2VP8A 2VZSA 3KLLA 3SCSA 1E5NA 3G1RA 1KM2A 4WRHA 3AHVA 3KS5A 5LIKX 3THCA 3A3HA 1AW5A 4CN6A 1QMLA 5ABFA 3VU2A 2PE4A 4GYKA 2VEIA 3Q58A 2Q01A 4LANA 1XIJA 5HAOA 5CZJA 4RPQA 4H19A 3VIKA 3LX9A 4F2UA 4DF0A 3CWOX 1XGDA 1JCLA 3DC8A 3VCCA 1MNSA 2Y7GA 4IPLA 2HVMA 5CGQA 1X39A 3VIMA 4TV5A 4YHEA 2ZZ5A 2VGFA 1PPIA 4N02A 2HV5A 4ZOAA 1FDJA 1Q7MA 3FSTA 1AQ0A 1HKKA 3DFHA 2EKGA 3F4DA 2CHNA 2A4AA 4LV9A 3VDAA 2AQVA 5HMEA 3H7UA 4H6EA 3GR7A 4X60A 3RO6A 3HZ3A 3OG2A 2DH3A 3EPOA 3EWBX 1XBZA 3OTRA 1MWOA 3VMPA 3MY9A 3WDJA 1JDEA 1PX8A 2R82A 5BMXA 1DJHA 4AG0A 4GZIA 3QXBA 3M6DA 2CLLA 1JZ2A 4CNPA 1BVWA 1E3XA 1I2QA 4K37A 4KIRA 4J35A 4Y96A 4H2CA 4A3HA 3RX3A 2G8ZA 5DCBA 3GQYA 3NYDA 1D3GA 3PFMA 2BGSA 4DBWA 5CZSA 1UKTA 2OELA 4PL2A 2FYMA 4LYKA 2BOFX 3W88A 3UU0A 3RLHA 1UH4A 2O4QA 5HUPA 1W1VA 1XYCA 3PZIA 1VFMA 2OEKA 5J5RA 3BCDA 3QR0A 4RDZA 1UD3A 1LL4A 4LS1A 1J93A 3DHDA 3BLKA 3OZMA 3CYVA 2FVMA 5IRPA 5H2ZA 4IIHA 3M5XA 1UR1A 3S5SA 1VRXA 3VNJA 2AAMA 5CLWA 2DU2A 2Y62A 1I9CB 5J04A 2Y85A 1JCYA 4PCSA 3UWQA 3OVQA 3HTWA 3MP4A 4UZUA 3BG9A 4LYQA 1XIFA 2OGJA 3LHZA 2I9EA 2Z1XA 4R7WA 3WLSA 3W1PA 4E3VA 4JTUA 1R46A 5ENLA 2QF7A 4JR5A 4AHOA 2FGLA 4IJRA 5FF7A 2WLYA 3RJYA 2I14A 1C7TA 1DQXA 1GVEA 3RPDA 2QR6A 2O9RA 4DELA 1ZHAA 4A8IA 3TK7A 3T0AA 4CN4A 4M7TA 2OVLA 5A8GA 3S8HA 3BZJA 4OKDA 3H23A 3ABOA 4C6FA 2JALA 1Q6EA 3AFBA 2Y2WA 3EDFA 1CIUA 3UPWA 3KZPA 3EOOA 1V6TA 3NEVA 4JBRA 2ATSA 1B4EA 4CKQA 5C9XA 3PNZA 1GNXA 1NAL1 1FH9A 2OWXA 5TIMA 4DHGA 1UP3A 5LIXX 4M29A 2AL1A 3Q37A 2FKPA 1DV7A 4AEOA 4L4MA 3L0NA 1E9IA 3LZ3A 3WBYA 5E6YA 1MI3A 3AS2A 1DXIA 3HB9A 3HN3A 1AA1B 2VRJA 4ATLA 4LY8A 4OBSA 3QGKC 1EA0A 1KBJA 2CXEA 3ZVHB 2QDGA 3SRHA 3A4XA 2YZ5A 2FZBA 4B5XA 4PUWA 2GJNA 2HZGA 3IUIA 1VFFA 4JOMA 4NU7A 3C2YA 3VIFA 1NM9A 3WCZA 4JYDA 1D9EA 5AC6A 1YNYA 1TMQA 4H2HA 2PLKA 1BVNP 1PTAA 1PZ2A 1VBRA 4JX6A 3WJXA 4HHHA 1XRVA 1XLLA 3WDIA 2YBVA 1DWFM 1VIWA 4IP7A 3PZUA 4ZTYA 3K8LA 4JL2A 4OJYA 4EAYA 3E1F1 3NSNA 1HKIA 4DI9A 1EXPA 4FF7A 5LNWA 4ILSA 2VCCA 2J8TA 4TR9A 1TV8A 5HMFA 2FJUB 5EMLA 4GXWA 5XIMA 2EGZA 4JS3A 4KCWA 1FUYA 2IQDA 3APYA 3QC0A 4XD4A 1WBHA 3WF1A 1Q85A 2GOKA 4JN6A 3FA4A 3PZTA 2OLAA 3ATYA 3OQEA 3A24A 2WMIB 3L5MA 2QNEA 1M41A 4AIUA 5T8GA 1CBGA 2V5LA 4PTDA 1YADA 4DRSA 3AIWA 1UH2A 1TPH1 1E43A 5D38A 1A4MA 3P81A 2E1DA 1KWKA 5FJIA 4XKYA 4ZGYA 1I8JA 3P61A 1Y5XA 1UWQA 4NSBA 1JAKA 1SO5A 2YW3A 4YYCA 4AXKA 1NF0A 1H0IA 2R1NA 1N8IA 3L67A 4U3CA 3MCNA 1KRMA 1GVOA 1UROA 3UJFA 4XK2A 5D04C 1ITUA 1JQXA 1W91A 3KRZA 1S5TA 3MP5A 5CBBA 3ZYZA 2VFEA 3QV7A 1XISA 4ZQOA 1P0NA 5AB3A 1HP5A 3AHYA 5EMYA 4UNIA 4GKLA 3N4FA 3GTHA 5K4XA 3WUGA 2VC9A 2G5WA 2YL8A 1Z42A 3CV1A 3CMGA 2WQDA 1XLMA 1F8MA 3DBPA 2VGBA 2OKOA 2QAPA 2XVPA 2PDWA 4JL1A 1Z6KA 3DBNA 1A5LC 4EXQA 4R88A 5CSYA 3E96A 3GHSA 1E3ZA 3QY8A 3D3FA 3V0TA 1CZ1A 1OM0A 4YYFA 2OZ8A 1W0MA 3WLJA 3SBFA 4BWLA 4XUYA 2PCQA 4I90A 4W88A 4MJ4A 1GVQA 5DY2A 1JAEA 1UD8A 2PI6A 5HPOA 3O0FA 4C60A 2ZX8A 3TH6A 3T55A 2VR4A 4Y6GA 1LRTA 4FIQA 1TTIA 3PN8A 4NUWA 3CL8A 4DX3A 5D2WA 2CHRA 3SR7A 2WMJA 1F5ZA 2XIIA 3AXXA 3CMJA 3LLXA 2C0HA 3ARWA 2VENA 1UIPA 3TQKA 2AMGA 3SEPA 4DM2A 4GRSA 2ZFAA 4H00A 4MADA 2WSRA 3M7SA 1O12A 1GPWA 4B5SA 3BLOA 2I7GA 3E0LA 2YX0A 4ZENA 2ZICA 1V0NA 3EYPA 3PTMA 2E6FA 4GHRA 1F73A 3T81A 1HL8A 2VX5A 3UERA 4J3ZA 3ZR4A 5EU9A 1E56A 1MQQA 3UWVA 4D71A 3DUGA 1CNVA 1LRQA 3EWZA 2CKSA 2XN2A 1OBAA 1ONWA 2FZNA 3BW2A 4BF9A 3KBNA 4RZ4A 1VZWA 2BGNE 4YVXA 4GXMA 3CH0A 2ZIDA 4DNHA 2O7QA 4ZVJA 1AODA 4HZ6A 4WDTA 3MDUA 5AHMA 1B57A 4DO6A 4NASA 1HNYA 4XTIA 2V8ZA 1JXJA 1QATA 3M46A 4TX8A 5A69A 1X1NA 2ZYFA 5EPDA 1JPIA 5KETA 3NURA 3MHFA 1XX1A 2PSNA 8XIAA 1V3HA 1YNQA 3Q2DA 1R3QA 1RP8A 4ECLA 3RCYA 2WHKA 4LUTA 4WEVX 3CYJA 3P14A 4WXZA 4E8GA 1CB2A 2YZRA 1PTDA 4E3TA 2GGGA 1F6PA 3LTSA 1RBAA 1IEQA 1G6CA 4I8YA 1GOWA 3OLEA 4QJ5B 5K3VA 1R38A 1GVSA 1J96A 1E1FA 1I1WA 1W1B1 2A1YA 1A3XA 1YDVA 2Z26A 5I5RA 3OZYA 3T05A 3WEOA 4UOZA 4C6DA 4Y90A 3LV6A 2Z6JA 1RJRA 1AVAA 2QVNA 1CLKA 1A5SA 1H61A 1DJWA 1JFXA 1EC9A 3DZ1A 4LCSA 4PMNA 5AYYA 3W84A 2XIQA 2A3LA 2PDYA 5A1AA 1W3HA 2PEVA 3P84A 3TWAA 4OZOA 3K8KA 2Y5JA 2NV9A 3N6QA 3L68A 5CPQA 1GHRA 2DV0A 2QPUA 2GUBA 2PTWA 4UCGA 4JQAA 3PVFA 3HIJA 4LOCA 4MY9A 4PEEA 3M47A 3BJFA 4D9PA 4YL2A 5E5CA 4BS0A 3BMXA 3SADA 3W25A 3QR3A 2QCGA 4CNNA 1H41A 3P0WA 4Q6JA 5HMSA 1N55A 5LGZA 1ITQA 5CCZA 1HFBA 2WSKA 3NR0A 3URAA 3OVGA 4EE9A 3OZOA 3DDMA 4EPBC 1WQ5A 3CPUA 3MU7A 1VFTA 2LLEA 1J0JA 2ISVA 3AYSA 1HJQA 2BASA 3A64A 1JYVA 1V03A 3W2KA 3R8HA 5CJMA 1NWTA 3BXWA 3GAYA 5IDZA 4J1OA 4C1NB 2WLZA 4IXHA 3PBGA 3G1HA 3QMRA 4HHMA 2NQ9A 1E1CA 3EWXA 2ACSA 2BHUA 5D05A 1UYQA 2PU0A 3CO8A 3P74A 1HL9A 2RAGA 4PMOA 2ICSA 4UTFA 4TXEA 4TVDA 5AOUA 4DO4A 4XSMA 4NILA 4HK7A 2IQTA 1CGTA 3S9ZA 4E8DA 1NDWA 3M07A 3OBKA 1QPQA 1A47A 1ZBVA 4OFCA 4QP0A 4NVTA 3DGBA 1YW1A 2OB3A 1UZDA 4G7FA 1F05A 5AKQA 2OOFA 2DPEA 1XBXA 4FEZA 3FCPA 4QE1A 3NQEA 2B0MA 1S2CA 3UEQA 3BG5A 4HPNA 2VVNA 2CCRA 2X0YA 1IEIA 4B16A 4ALDA 2VUNA 4MJZA 4RDYA 1ZAJA 3P7YA 1R5YA 4F4RA 4JN8A 2F7FA 2PB1A 3GG1A 3TC7A 4XQ6A 4NYYA 1EPVA 4UOJA 3W1XA 5AYIA 1X7FA 1E70M 4IP4A 1E4LA 4RJEA 3UA4A 4DEFA 4GA8A 2GDUA 4X3ZA 1RBLA 1U83A 3IIZA 3GK0A 1OABA 3NVTA 4LAOA 3ANYA 3T4CA 1EXBA 2ZRUA 1I45A 4RW5A 3N2TA 4NHVA 1VKFA 4HZ8A 3I6TA 5F2IA 1FWAC 1K4GA 3WD0A 1R9YA 5I3JA 2Y7DA 5IFTA 1XF0A 3U48A 2DT2A 1UKSA 3GVVA 1D7KA 3VDHA 4J28A 4HB7A 5IDIA 4JX5A 4JYFA 4UMBA 5MKGA 3ITTA 4Z0JA 5AVNA 3EWCA 3VC5A 3M9YA 3MI3A 1EDGA 4B4HA 3QPZA 5I6SA 1SW3A 2FZDA 4DBEA 1BYAA 2Y89A 2DFAA 2R1MA 5BU9A 3PFRA 1E1CB 1E1EA 4F2TA 3KRBA 4BQ4A 4J9JA 3NO3A 3H7RA 4R27A 1UB3A 3REQA 3LUTA 5C2XA 4OBRA 3BZGA 2IKIA 2VZUA 3NZGA 3QHNA 2PWDA 2H90A 3ZT5A 5B7ZA 1GKPA 1H1NA 3VE7A 3HURA 4P61A 2CLMA 3UJSA 3URQA 4LRTA 1LORA 1A0CA 2BOGX 1BF2A 3TJLA 3UZZA 4HVXA 1MRQA 2V6AA 4S3CA 1YTDA 2ZTKA 1L6WA 5TAOA 4LEQA 1XLCA 1KFKA 1HW6A 4UQ9A 2JF7A 1XI3A 1BGAA 3N04A 3WNMA 3B8SA 2QGHA 4LVAA 3IGSA 1UKQA 1XKJA 4GGBA 4WY0F 3GTXA 1U5HA 1RA0A 1W8GA 3Q4DA 1W1PA 1UJQA 3VOCA 2QXWA 3QGVA 3TC6A 1W9BM 2D24A 3C61A 3UXDA 4ACZB 1JF5A 3GR8A 3UT0A 3UZ5A 4EACA 5I00A 3AIUA 1IE7C 2Z24A 1W1YA 2E1WA 2QKFA 4P8XA 4OWGA 3IJ6A 4HPHA 1DPMA 3VDBA 3UVAA 1SPQA 3MV01 4H7VA 3PP7A 2NQLA 4GI8A 3UQNA 1LTDA 3NUKA 4O4WA 2Q6ZA 1VFLA 1MEWA 3GXFA 4K6AA 4ZSTA 2VGIA 1VYRA 4NAEA 5EMMA 3NZPA 4HD5A 2YGYA 3GS6A 3KCLA 4IL2A 4BJHA 2CFFA 4MB1A 4NZ3A 4NXKA 3F2CA 3LXCA 4P7QA 4M1BA 1X6NA 3I3DA 1TTQA 4ZSUA 4DJDC 4YTSA 2GWNA 4G1NA 4NX5A 4HJFA 3OLIA 4S3AA 2DVTA 1Q8AA 2UZ9A 1ZCOA 3MP3A 3Q94A 4ZZ9A 1XC6A 3TQ0A 3GC5A 4I3GA 4JAWA 3BOLA 4RXGA 4JTRA 3UYIA 3SECA 3AISA 3P2VA 4LC6A 4XD6A 4GH3A 1T96A 5A2AA 2ZA1A 1KR0A 3LM7A 3G0UA 3B05A 4GX8A 4NI8A 4EAMA 3P5ZA 3GC4A 2DZXA 3E74A 2I9UA 3NQMA 1KM4A 3ECQA 1ZBKA 4IQEA 3CTTA 1R7AA 3ME3A 4JKLA 1IT7A 4UTMA 1JCTA 2OKTA 1SW7A 1KFCA 2X1IA 3CUZA 1KO0A 1XXXA 3WJSA 3O16A 3DGRA 4DYKA 4TUFA 4UQDA 4AZIA 2XYLA 2FPTA 3W1RA 3QZAA 3MYOA 4K8EA 2WZTA 1FWGC 5EFDA 4KGLA 3GBDA 4HA4A 5K9CA 5DXXA 2DGAA 4HP5A 3TYCA 2WO5A 1FFQA 2OZ0A 3R13A 4UB9A 1RPKA 3TC3A 2YCLB 4K7YA 1IEVA 3U9IA 4GZ7A 3UWWA 1VS1A 4KETA 2C71A 2PGEA 1PX4A 1T99A 2NQJA 4RNIA 4M0XA 1Z7AA 1XYFA 4N6FA 1N8FA 1CXHA 4NT0A 3IVSA 4DJED 2P5NA 2J47A 3WH8A 5I3HA 1J0HA 2WPGA 1KCZA 3DAQA 3AWOA 4B92A 2HXUA 4R5EA 3W70A 3MKCA 3GVWA 3IUDA 4R7OA 5LNVA 3IEBA 4AWSA 4NZ5A 3GW0A 2CLIA 4ZB0A 1GJUA 3RM4A 2BNJA 4CNTA 3ZLFA 5EMKA 3IWPA 1QOQA 1O60A 3T7VA 4DZHA 3B8IA 3FVMA 4DF2A 3TYZA 1UMYA 4PMRA 4PTMA 2FJKA 3B9NA 2Y70A 1P7TA 4XKMA 3B0PA 2IMRA 3S1WA 2QJMA 1A5BA 2HVOA 3IARA 1I2PA 1UD2A 1WB0A 1OD8A 1LBLA 3R43A 2ESCA 5CGTA 3VD4A 3QSTA 4Q4RA 3QSRA 4GUGA 1V3MA 4WCJA 3CUJA 1XCFA 3LA4A 3VGHA 4N9BA 4FOUA 2AKMA 4W84A 1UUOA 3I4KA 1F74A 3TOYA 2DZTA 1K1DA 3H4GA 4NRRA 3WMBA 5D9NA 2PMQA 4O8RA 3NPVA 5E70A 4GJIA 3T07A 3UGVA 3USBA 2VMFA 1RD5A 1A5KC 4Y9AA 2C6QA 3O06A 3ATZA 2OZ3A 1V79A 3TOPA 2CKRA 2NV1A 1FWDC 4EWND 5I77A 3ERPA 1EF2A 4X22A 1XYZA 3EA3A 1XFCA 1MZHA 1S2AA 4RUBA 3TYEA 6REQB 2C18A 2XVLA 3DKJA 2V0TA 1CXEA 2D73A 1O7AA 3DFOA 3EWWA 1FRBA 1Q6CA 3W2LA 4JTGA 3FSUA 2NQ5A 1LRNA 3W6YA 3LRKA 3TVAA 1Q63A 3WO8A 1TMHA 2POZA 3W7KA 1DIKA 2X16A 3NQAA 5CG7A 3J7HA 1C9WA 3O63A 3SCPA 4Z08A 1TQXA 3G1AA 5FJRA 2O55A 5EMJA 6ENLA 2EG7A 1KXHA 1YDOA 5CKSA 2B81A 1H7OA 4PTWA 1V4YA 3F4VA 4Z1CA 1I60A 1NFGA 1DORA 2GQAA 2H3BA 5DMYA 4KW2A 1OHLA 3B0XA 1HKJA 1FHVA 3KVKA 2B31A 3IS4A 1VP5A 3WDHA 1JEZA 1F3XA 4GJJA 4J3SA 4PMDA 4ACYA 4AAJA 5H6HA 4B91A 3V3WA 4XVEA 2OT0A 1PX3A 3LRMA 3FLUA 2BY2A 3WH9A 1DKWA 5ABTA 1X8CA 3C86A 4K2SA 3LBCA 2BP1A 3LM3A 4XZ9A 1ITCA 3BPWA 4NZFA 4UFIA 1VEPA 4YWIA 3VKKA 3THDA 1E6ZA 2CBUA 3A5VA 2CZEA 2P53A 3ITVA 2CHOA 4QE5A 3GX9A 4MKNA 4HPJA 3QMSA 3UZWA 4QG8A 4FNPA 5LZLA 1FCBA 2GSHA 3GKAA 1E0XA 2YDSA 4JYEA 3TKFA 3O3RA 5FSDC 2PDJA 3GHTA 3G1FA 3KP0A 2PA6A 3WH5A 3HQNA 3LBMA 4UQEA 1D2KA 1E0TA 3FYOA 4MYXA 3WMCA 3TN3A 2Y8UA 4PCNA 2V69A 5JU6A 2F6UA 4MLJA 4V33A 2C19A 2QZRA 4JTTA 4HNUA 3CUXA 1E6PA 4ZO9A 4DWSB 1L8PA 2R1LA 1T8XA 3BLIA 5C0QA 4I9TA 3U7BA 5FJUA 4TIMA 1FWIC 4Z0SA 4Y7EA 4LUJA 2CW6A 6ALDA 1PKNA 3M0HA 3N2OA 1DXEA 2W4XA 4KS0A 4HU8A 3VNZA 1MXDA 1KM0A 1KD0A 1TB3A 4Q8MA 3BJTA 2Y61A 1XINA 4WGXA 3HQOA 2AGTA 1GTEA 3SN1A 4L65A 5FSEC 3E5BA 4WOQA 1PE1A 4O28A 1GEQA 3QW3A 3EBVA 3KBVA 4AB4A 1CGXA 4FALA 5A6BD 4EOUA 1G4PA 4R53A 3G8EA 1PV8A 1DJNA 8TIMA 3WQ8A 3I6RA 2FMOA 3AIVA 4G1KA 5IFPA 4A35A 3W23A 1XH2A 4HT3A 1UP2A 4UTTC 1LUCA 2BLEA 4WY0A 1P1MA 4RKAA 3W53A 4ZR8A 2P50A 5EBUA 4M3PA 4C6OA 3GLCA 2DW7A 3GY1A 4X63A 5FA5A 3UY8A 4GIYA 1LG2A 2OU4A 3PBVA 3NQCA 4DUVA 1F4HA 5AC8A 1TO3A 3TXZA 3G1VA 3POHA 3BLDA 3UCDA 3MUIA 3DYOA 3WF3A 3T2QA 1JPMA 1LZOA 3NM1A 3OBEA 1EFZA 4BHYA 4NKCA 5I02A 3U6WA 1WX0A 5FACA 5DFAA 3ZOAA 5I79A 2MANA 2V38A 1N8WA 4QAIA 5LHEA 1V7AA 2YBTA 1QWGA 1W1ZA 1WZLA 2XWEA 1FX6A 3W85A 2HK0A 2J79A 2DIJA 1YNPA 1NH6A 2RHGA 4PUJA 3L23A 5BXTA 4Z1AA 1TR9A 1UKOA 4QLJA 4HN8A 5LKYA 1P0BA 1XKYA 1U22A 2EPKX 2PWEA 1POKA 3IPWA 3GDKA 4GK8A 2JGQA 4B3KA 1HKVA 3II1A 2VCAA 1YQ2A 1AG1O 2QCFA 4WSKA 5D30A 4IUGA 5L9FA 2OPJA 1SZFA 2J7HA 2R24A 1Y0EA 1G7UA 1R2SA 4DWDA 2V81A 2BMBA 4IMDA 1E6NA 4YN5A 1HP4A 1UR3M 3B9OA 4UNLA 1G4TA 1X98A 1CWYA 1KB3A 2IPJA 2E3ZA 2BOEX 3GNDA 4S23A 3BW4A 1XH1A 2QV5A 3GU2A 1W3JA 1KCKA 4WY0B 1J4EA 3EKZA 3LNPA 1WAUA 4YMZA 1FCQA 1EC7A 4WIWA 1SR0A 3LGDA 2AL2A 3N34A 4L80A 7XIMA 5TBOA 3TSMA 2ZRYA 3WBEA 4GYPC 3ZJ7A 3TMLA 3BQ6A 3TJXA 2QHAA 3CT2A 1NOWA 3JVAA 3WMLA 2QS8A 1OFOA 1QT1A 3BAWA 3FK4A 4W5ZA 3S2MA 2DZSA 4RR4A 1H51A 4ERAA 1R87A 1LL7A 1TJ2A 4AC7C 3GNNA 2J88A 4J27A 3W2UA 3HPFA 3R4IA 3W27A 4R3UA 2O9OA 5AHNA 2O0TA 4BR1A 1UJPA 4BK9A 4Z2LA 1GYLA 2OWCA 1VGAA 4DLMA 4O16A 3SY8A 1EBHA 4L6OA 3PJWA 3CIXA 1BWVA 4RZ5A 3WQ6A 1EPXA 4V15A 3ZLGA 4OVXA 2Q09A 4G56A 3L4WA 4TX6A 2VEGA 4AMCA 1UWRA 1XIIA 5FEPA 3JS3A 4O50A 1TPC1 3W1TA 2FGZA 3FDGA 5ABHA 5TQLA 4K3ZA 4C65A 1M7XA 3VD5A 5F4WA 4PTVA 5LIWX 5CZKA 5CJNA 2OWWA 2DSUA 3SSZA 1BRLA 1QOXA 1AJ0A 4Y8EA 3W26A 4AZCA 1JUBA 3NPWA 2WVSA 4TVCA 2JF6A 4ML9A 1NFBA 1R6WA 1AL7A 3STFA 1RJQA 2JBMA 2QPXA 1HJUA 1PS9A 1DIEA 3FJ4A 1CDGA 1AK5A 1QI3A 1RHCA 2TODA 1R9XA 2VELA 4GVHA 1WXZA 3T6CA 1GQLA 4RLIA 1VFSA 3SY5A 4MFEA 3M0VA 5HUOA 2G3JA 3GU1A 4X9YA 1Y7VA 2DZVA 2R94A 1JUEA 2DUAA 3H54A 4UQCA 4X9SA 3L4VA 3I10A 4O1DA 1P6BA 4ZFMA 1XPYA 3PTQA 3TCSA 3CAVA 3VI2A 2YA0A 3EDKA 3A21A 4M5PA 4NJIA 5GQBA 3O2LA 3WF4A 5B80A 1M9HA 1UOZA 1A50A 2XDFA 6PTDA 1EO7A 2NXHA 4ZOEA 1DHPA 4IICA 2XVKA 4JHOA 1OINA 3UCQA 4LS2A 3GZAA 1E40A 3RNDA 1A4LA 4KWUA 1W31A 1LBMA 2NUYA 3M0KA 4NJJA 5F1UA 1TX2A 1ZAHA 2CWXA 1OX4B 1C9DA 3ZIZA 2PRLA 1MO0A 2W63A 2WZIA 2VZOA 3CAWA 5I78A 3U0HA 1ELSA 3PZ9A 2PGWA 3WLNA 1W17A 4A2SA 4IQLA 2W9MA 4RK8A 1HF6A 9XIAA 3M5YA 4MUPA 3WSUA 4OHQA 1NARA 2FMNA 4H9MA 2B7OA 2YJQA 2FZMA 1V8EA 3RLGA 4P7NA 1CLXA 3WIJA 2W5FA 5EA9A 2IQ0A 1QNOA 3CH9A 1WZAA 3T8QA 2JE8A 3BW3A 1IGWA 5D4YA 1WDQA 2OYMA 1RD6A 2HISA 1QTWA 1BRLB 1R47A 4GIEA 1V3KA 1EWEA 1XBYA 2HS8A 4KWVA 4W93A 4AHPA 1KFBA 4ZB5A 1XV8A 1S2WA 2VEFA 4JFTA 2PTZA 3EWDA 2GGEA 4L4LA 1W56A 2OOGA 2YW4A 3A3XA 1DE6A 4G8TA 4M19A 3R10A 2FDMA 2TPSA 1R9ZA 5I07A 2P10A 1K4HA 1TRDA 4LBRA 3OQ8A 4HTYA 1XL9A 3QGAC 1WA3A 1JNEA 4ZO8A 3TAKA 2HNEA 2IKJA 3PANA 3GH7A 1IXOA 4HN4A 1VCVA 1O1HA 1OGGA 3N6JA 4AXNA 2I1OA 2OR2A 5F1VA 4C6MA 1OT1A 4QBXA 4HNVA 1MW2A 2FHCA 1JCNA 4XZMX 3T0BA 3VK5A 2VO5A 3KLKA 4BF7A 4ZODA 3U5YA 1JYNA 4ZE5A 5HWMA 4B5VA 3TN6A 2W92A 4LBUA 4GQQA 1FXPA 3LHWA 1OADA 3ITYA 1H0GA 4B15A 4AZHA 4D6JA 3L66A 5CGMA 1FCVA 4TO8A 5I06A 3UR2A 1EJVC 3PY2A 3THUA 2VEPA 3BANA 2R9RA 4IPIA 2QEZA 1TPUA 1KGWA 1SUXA 4ROPA 1Q6GA 1EEPA 3PSVA 4O1FA 3GDRA 2XJ7A 2XU2A 1WNOA 1UBSA 4MWAE 5F2MA 4Y9PA 4IMEA 4HCHA 1SGJA 3PS7A 5BCAA 3T0DA 3ALGA 4ICNA 4Z2IA 3BSMA 3SUSA 3WFZA 4REQA 2VQTA 3FA5A 5D33A 3W1UA 4FIRA 3WLPA 4MKSA 3VYLA 2TMDA 1KQYA 3N15A 1W5OA 2NV2A 2NSOA 2EPOA 1ZLPA 2WJZA 1FWWA 2HMCA 4O8AA 1KRCC 4WF7A 3MKKA 2PLJA 3CHFA 2JEQA 2WHLA 1FWTA 3GBEA 3AUOA 4URIA 1XLJA 1QNPA 3BLPX 1R3YA 2PTXA 1O94A 3ARUA 5H8PA 3HGRA 2ZC1A 4EWJA 4B2DD 1XLBA 2DJLA 2NQHA 3QQ1A 3WQOA 3DENA 4PUKA 5LXEA 4PUEA 1NTHA 2YYTA 4UOQA 4GIRA 5FF0A 4D6CA 2D3NA 3WQWA 3AYVA 2Q3OA 4NL1A 9XIMA 1QNSA 3GRIA 2PGRA 3BH4A 3NQ6A 4L9ZA 4XBJA 1UWTA 4YWSA 5M5DA 2XN1A 2JKEA 3IK2A 4FSAA 3SI9A 3PNUA 3TP4A 1AW1A 2GLKA 1PZ1A 3NQBA 4QJ3B 2G95A 3IRSA 3HG4A 3V35A 3HBLA 2ZUSA 3W2MA 3VUSA 2UY4A 5AZ0A 2KZHA 4A3YA 2WC7A 1B3YA 4JNYA