3LD5A

Human aldose reductase mutant t113s complexed with idd594
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 106
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ld5A00
4XZHA 2INEA 4IJRA 1GVEA 4G5DA 1LQAA 1MZRA 4YVVA 3D3FA 3V0UA 3COTA 1X96A 3LUTA 5KETA 2PDPA 1AH4A 4L1XA 1AZ1A 3M4HA 4LAUA 3FX4A 3LQLA 3Q65A 4WDXA 2PDJA 3UZXA 3H7RA 2FZBA 4JQAA 2PZNA 4XO6A 1IEIA 4FZIA 1Z8AA 1YE6A 1ZSXA 1Z3NA 2ACQA 3WBXA 2HV5A 3S3GA 4WEVX 4ZFCA 5AZ0A 3LD5A 4XO7A 4PRTA 4DBSA 2ISFA 2FVLA 3CV7A 3R8HA 5HNUA 3V36A 2NVDA 1OG6A 4WDUA 3BUVA 3V0SA 2IKHA 1US0A 2P5NA 3F7JA 2PF8A 3M64A 1VBJA 1RALA 4L1WA 3G1RA 1RY0A 3GHSA 3V0TA 2PD9A 4XZMX 3UFYA 3UZYA 4PMJA 3WCZA 3QKZA 1T41A 3Q67A 4Q3MA 1UR3M 1YNQA 3GUGA 2IPFA 3UP8A 3R43A 3H4GA 2PDKA 3ONCA 4JTQA 1X98A 4DBWA 4MHBA 4WDWA 3UZZA 2PDXA 1Q13A 2IPJA 4QR6A 3GHRA 3WG6A 2FZ9A 4XVEA 1PYFA 4GACA 4XZLX 3R58A 1S2AA 3LENA 3CV6A 4WRHA 2HVOA 1XJBA 2PDUA 1XGDA 2AGTA 4IJCA 2R24A 3CASA 2BGSA 4YVXA 2HVNA 4R9OA 3LN3A 3KRBA 3WBWA 1K8CA 3UZWA 1XF0A 2PDQA 3R6IA 2PDLA 3M0IA 2ACUA 4RPQA 4GQGA 4XZIA 4LB4A 2F2KA 2IQDA 2J8TA 1EF3A 4LBRA 2PDFA 5HA7A 2PFHA 3LZ5A 3U2CA 1S1RA 5JH1A 4GA8A 1VP5A 2I16A 4LB3A 2WZMA 3UYIA 3O0KA 2FZ8A 4H7CA 2IKGA 3G5EA 1QRQA 2HEJA 2DUZA 4JTRA 1MI3A 4ICCX 2PDBA 1QWKA 4QXIA 5C7HA 1AH0A 2FGBA 4JQ2A 3BURA 4Q7BA 4F40A 4JTDA 1ZUAX 3T42A 2PDYA 4GABA 4YS1A 3B3DA 2HDJA 1PZ0A 2A79A 1YNPA 3C3UA 4QX4A 3DN5A 4JQ4A 3R94A 1HQTA 4GCAA 2BGQA 3MB9A 1PWMA 3NTYA 4XAPA 4AUBA 4JQ1A 3N6QA 1S2CA 2I17A 1ZQ5A 3CAQA 3BCJA 4PRRA 1AZ2A 3UGRA 4ASTA 2INZA 2PDWA 3P2VA 1YE4A 3LZ3A 1M9HA 3EB4A 3UWEA 2IKIA 5LIWX 1IHIA 4IGSA 3GHTA 3CMFA 2PDHA 1RY8A 4JIRA 4DBUA 2WZTA 2PDCA 3EB3A 4XVDA 1ZGDA 4H8NA 1Z9AA 3O3RA 2HE5A 5LIKX 2PD5A 5M2FX 4HMNA 4LAZA 1X97A 3ERPA 3R8GA 3UG8A 4FALA 2F38A 5LIUX 4GIEA 4EXAA 3LQGA 4HBKA 2R9RA 2HE8A 1T40A 3H7UA 5AZ1A 1AH3A 5HNTA 1EKOA 1A80A 5JH2A 1ADSA 3LEPA 1PZ1A 3V35A 4PR4A 4JQ3A 3RX4A 1R38A 2ALRA 3WBYA 2DUXA 3LNMA 4PUUA 1Z89A 3N2TA 1LWIA 4OTKA 2IS7A 4I5XA 1J96A 2QXWA 5LIYX 2PDNA 2VDGA 1S1PA 2PDGA 2IPWA 1Q5MA 2ACSA 1FRBA 2C91A 3FJNA 4JIIX 4EXBA 4XZNX 3ONBA 4JTCA 3RX2A 2DV0A 1AFSA 4PUWA 3GHUA 5DANA 3RX3A 4WDTA 4YU1A 2FZDA 3EAUA 3LBOA 4DZ5A 3VXGA 4NKCA 2IKJA 4XK2A 2IPGA 4FA3A 4GQ0A 2BP1A 2IQ0A 5LIXX 4YVPA 2PEVA 3MC5A 2NVCA 1EL3A 2ACRA 1C9WA 3CAVA 4LBSA 1EXBA 4FAMA 2CLPA 4JTAA 4WGHA 3BV7A 2PDMA 4QBXA 1JEZA 4JIHA 1MRQA 2PDIA 3DOPA 1HW6A 1PWLA 1SM9A 3R7MA
chains in the Genus database with same CATH superfamily
4JHMA 2BOFX 4LBUA 3R11A 4A05A 4GYKA 3B0XA 2VURA 3L4UA 3ZR4A 1EB3A 3UCQA 3COTA 5CSUA 3W72A 4P7LA 1H3GA 3MPGA 2OT1A 3NM1A 3THQA 2WQDA 1SYTA 4TVDA 1UP0A 2GJPA 1UR8A 4OBRA 5HNRA 3MUAA 2G0WA 5D8WA 3POHA 1H5YA 2OWCA 5HUPA 3TC7A 4R33A 5AZ0A 2CLIA 3ATZA 3DXIA 4NZJA 1MYRA 3ITCA 4NVTA 3UERA 4AEEA 4AB4A 1QASA 2F6KA 3D6NA 4L80A 4WDUA 2V63A 2CBUA 4R85A 3CYJA 4D6EA 2Y7EA 5CGMA 2JGQA 3REQA 4L1WA 5I79A 1CTNA 3CZKA 3GZAA 4AEOA 3W86A 4PBFA 1ONEA 4N9BA 1HT6A 4Y9NA 2QUVA 1OIFA 1OFBA 2A3HA 1D2KA 1SO6A 5I0DA 3KE0A 3HQNA 1HN1A 4ZMGA 2VC9A 3VK5A 2E25A 3EYPA 1I0BA 3G1SA 3WLPA 1XLFA 4A4AA 5I03A 2E8YA 4CN4A 2YW4A 4RNHA 2I9UA 4ZA0A 4B9ZA 2P88A 5HPOA 3BLDA 5AC7A 4AZ7A 1DKWA 2RFGA 2VX4A 4L1GA 1NOWA 3SRDA 4MDOA 5IFTA 1ECEA 4MKNA 2C13A 4WSJA 4EAMA 2PCEA 3FS2A 3SI9A 1MEIA 2F6XA 2VX6A 4AXKA 4J28A 2Y85A 5CZJA 1SFJA 2RKXA 5HK4A 1DL3A 1GVQA 4C60A 3HMCA 4PFMA 1Z32X 2CBJA 2WMKA 1X6NA 4DVOA 1S5NA 2CBIA 2DZVA 2RUSA 1IXPA 3W1UA 2E1WA 3SY1A 2X1TA 3RJYA 1LRTA 3Q94A 4EOUA 1QNQA 4ADUA 1HKMA 4J2MA 4MADA 3UR7A 2PDQA 3R0KA 4H9YA 1M01A 3WFLA 4C90A 4B5TA 3EKZA 2TMDA 3URQA 4EP8C 3LHZA 3FVDA 3PBVA 2IQDA 3WJSA 1RD6A 4RDWA 3E2VA 2XN0A 1KFEA 4OGZA 4W86A 5I3IA 4LY4A 3EWWA 5IHRA 2GDVA 1OFEA 4ROPA 1VB9A 3ZO9A 1IV8A 4K8HA 2OYMA 3TK7A 4IPPA 4CU6A 2I16A 3VE7A 2J77A 4CQCA 3TA6A 3KVKA 3UG5A 3I3BA 2F61A 1A3WA 3K30A 5LA1A 1NH6A 1UMYA 2CHOA 3ARUA 4KWOA 2DUZA 2DGAA 4DWSD 3PZUA 1HO1A 5A8NA 4GC3A 5BXPA 5M03A 1PDYA 1V79A 3FDKA 3W28A 2I5QA 2WMIA 4AD0A 4GLEA 4HTBA 3VUPA 3I7SA 4MVAA 3OQ8A 4ROQA 5FI8A 3M6YA 4C91A 1Q4NX 2Q6ZA 2ZUVA 2WCGA 2HJPA 4TVCA 1AG1O 1MW1A 1KNWA 3TWAA 3I68A 4TV6A 4AHQA 3DBPA 3BCDA 3AQUA 1OF6A 2YCJA 3N6QA 3F03K 2C7FA 2J25A 2YXGA 1EJWC 1TMHA 2YXXA 3UU0A 3M5YA 5D4YA 3O63A 2PP3A 1OSEA 2ZX5A 3EB4A 4A35A 3ITTA 5AYZA 2HRWA 1SZNA 3R13A 3CMFA 2PDHA 4UMCA 3HGRA 3OGVA 3OBAA 4WY0B 2Z26A 4B90A 4BCEA 1DTUA 4HNUA 1TUXA 1UASA 3GVQA 4M6QA 1LBMA 1E71M 1P6WA 2I5IA 1UH2A 3U7VA 1BXCA 3TQVA 3AC0A 3OYZA 4L65A 3A3HA 1P1MA 4HBKA 1LWJA 1EDTA 1T40A 3H2MA 1W9VA 3XISA 1HO4A 4WHBA 1KR1A 4CNPA 2GUYA 5AHFA 4B3LA 1JQVA 3VCNA 5ENLA 3DHPA 3WMCA 3HPFA 2HK1A 4ZOCA 4JQ3A 4ES4A 2VGGA 1XD1A 4UC5A 3NQGA 5AYXA 4HNTA 1QK2A 5BWAA 1KFWA 3N9RA 3QHMA 5I3GA 3K1DA 4DF1A 3TLQA 1BXBA 2QAFA 3H12A 2XZ7A 4IFOA 1KBIA 4JFTA 3TW7A 3IRSA 1FRBA 4IUGA 3DFSA 4GUGA 1UKQA 1UWQA 1OYCA 1ME9A 4YHGA 3W7PA 2I7GA 2FZDA 1P5BA 4ICNA 1JYVA 1R3SA 4E6MA 3ITYA 3AIEA 2CNCA 4S39A 4PTDA 3KRZA 3OZPA 3L12A 2KZHA 1IZJA 4TXEA 3S6TA 4LY8A 3NCOA 5LZLA 2NQ9A 3QJAA 4QBXA 1XUUA 1JFHA 2PC8A 3CU2A 2NW0A 1KBBA 3E5PA 3UCDA 3QPZA 1RH9A 1KM0A 3S5OA 3WQCA 1GCYA 1R2RA 2PTYA 1MEWA 3DU0A 3PFMA 4F0RA 5C6MA 3W7MA 3AYVA 4XKMA 9XIMA 3RRXA 2DSWA 3KHJA 1LCOA 4OT7A 3BOXA 4IIHA 1GTHA 1FWFC 1VC4A 5BZAA 1JCNA 3LRMA 3W6MA 4LV4A 3GM8A 1XYCA 5LNUA 1EJUC 1W8SA 1VENA 2ACQA 2X1UA 5IDIA 5FACA 1X38A 2ANUA 3GRIA 5HANA 1B1YA 4KEVA 4M3PA 3AAMA 1WKYA 1E1CA 1NAL1 1UMLA 4JS3A 5HNUA 3GIPA 4IP4A 3KRSA 5T91A 4EXQA 5BU9A 1XWYA 2W62A 8XIMA 3GTHA 1K8YA 1YPXA 3OVRA 1EHAA 2GGEA 4PMOA 4HPHA 3N4EA 2NWRA 1VPQA 1JCYA 4WOZA 3SRHA 2F9RA 3ARXA 3HM7A 2XIQA 3B8TA 5FEPA 2CKRA 1S2VA 1NDZA 2O56A 5AHNA 2WSRA 3W6YA 1XLBA 4U5KA 4LWWA 1GOQA 2PGEA 2QNEA 2ZDSA 5JBEA 3WCZA 3G6LA 1WOBA 3S5SA 4Q3MA 2WVVB 8RUCA 1PTGA 3T7VA 3BICA 3PC0A 2GJXB 2Z27A 1P0NA 5J04A 5A6AA 3TH6A 3WQOA 5CG0A 2VKZG 2VDIA 3Q2DA 2BOEX 3NA8A 4DBWA 5ABGA 4MHBA 1JG9A 1Y5WA 4C6FA 4WDWA 4C5YA 1R47A 1PS9A 2XH4A 1OCQA 3STCA 3AALA 4XTIA 1UWAA 1I75A 3EDEA 3GHRA 3BLIA 3WLTA 2OSXA 1TA3B 4XZLX 1UKTA 7ENLA 3CZGA 1RP9A 4GZEA 4OECA 2VZVA 1ISVA 1TR9A 2YDRA 1GW9A 3MHFA 2YOCA 1CW2A 2XH7A 5DY2A 4DRSA 2GGGA 4GUFA 3WLKX 4NZ4A 1K8CA 1QWGA 1QHZA 4IWWA 4BF5A 3R12A 3W0KA 4LVAA 4KCTA 4UFKA 3VNZA 3ABQA 5FJTA 1ISWA 4DY1A 4HCHA 3BAIA 3PAOA 2PGWA 3TYBA 1CB2A 1RA5A 3MWCA 3P74A 1M7PA 5HA7A 3VIMA 2FZNA 1I0DA 7PTDA 1M7OA 3DECA 3P82A 3OGRA 2NQLA 4IFRA 2H90A 3G3MA 4E0CA 2EPKX 4Q4QA 5LGXA 3LTPA 4NRSA 1SSDA 2OKOA 2CXGA 1VRXA 5F2IA 4W4QA 1FH7A 3LA4A 4CNOA 5M17A 1Y5VA 5TQLA 3NXFA 1BXNA 1WKEA 5AECA 1W6TA 2VDHA 2PRLA 5BWFA 1E9IA 5C7HA 1TVLA 4MGGA 3AIWA 4DWSC 3RRAA 1ZUAX 3AU6A 4URIA 5C9RA 4RPPA 2XISA 4ZBCA 4O1AA 1KLZA 4US6A 3KOYA 4KCVA 5EYWA 5DT5A 1YNPA 3MZ2A 4HMDA 4NYUA 3FYYA 1JQXA 1M6JA 2MANA 2XZ9A 1PWMA 1IR2A 1A5CA 3VNDA 2INZA 1CLKA 1KFKA 2QUTA 5C7VA 1MZHA 3G24A 1YE4A 2G3JA 1B3ZA 3K8MA 1U30A 3R1ZA 3ABSA 2WW5A 1VIZA 3WFZA 1RY8A 4A8IA 4E3VA 1EEPA 4ZENA 3UJSA 1TV5A 3USZA 3EDKA 3C4UA 1RZMA 2Q02A 3GS6A 3ECQA 3BG3A 3HG4A 3LLXA 3OG2A 1IYXA 1MDLA 4F4RA 4B9YA 4BEQA 2Q3OA 4DUOA 1PJ9A 5LNWA 1R9YA 1ZCOA 2H9AA 3L2LA 4DUXA 1U5HA 2ZDRA 1QNVA 2R6OA 4I9JA 1VCFA 9RUBA 4MUPA 4IF2A 4MAVA 2PP0A 5DEZA 5AYYA 4K3ZA 3KCOA 2AMGA 3LV6A 4UTIA 3B8IA 5CZ0A 3T8QA 5CBIA 5HPCA 2FJKA 4UTLA 2WO5A 1FHUA 3M5XA 1KB3A 1ZJHA 2BVDA 3G1FA 2RDWA 2OB3A 1YXCA 2O9RA 3BJFA 4I5XA 2OEJA 5J5DA 2IPWA 4MZYA 3U2OA 2YZRA 3MMDA 4JNZA 2TODA 3NZPA 4K37A 1QVBA 2PB1A 4GE8A 4PEKA 1VKFA 1EHNA 1LM1A 2VR2A 4RZ4A 1PKNA 2ZTKA 2A3AA 3RXZA 3A64A 1TV3A 2PWGA 4ZCWA 2DZSA 5EPDA 4L9ZA 2QUNA 3LTSA 3MC5A 1R3YA 2WLZA 1UH3A 4ENLA 5JBDA 1BD0A 1VRDA 4O10A 3SQLA 1C7TA 2QJHA 3NAVA 1FDYA 1H50A 2H8ZA 4XIMA 2VWSA 2E68A 5CJMA 2BSLA 3AS0A 1I8JA 1YDOA 4RV3A 3T0AA 3LCLA 2BXYA 3URAA 2Z1KA 3CMJA 4WY0F 3KLKA 3T2QA 4LAUA 3BMVA 1UROA 1R9ZA 3GR4A 1W9UA 4JTSA 4JQAA 1JL8A 4Z42C 4ZSTA 2EPHA 3EA3A 1JPDX 1P7TB 2QPUA 5E93A 4O53A 2X1RA 2J75A 1OCBA 4FZIA 1FTXA 3B9OA 1N82A 1KQYA 2X7VA 3DFQA 3P62A 4ZFCA 1E6QM 4IT1A 1TPH1 3LD5A 1DXIA 4AZ5A 3CQKA 4EVZA 1AQFA 5CZKA 3ITVA 5A94A 3EX3A 4HN4A 1ZHAA 1ICQA 3GU2A 2GQ8A 1OG6A 2Y2WA 3OG3A 4XZ9A 4GNJA 4HPXA 1XBZA 3UG4A 1RK6A 3H6OA 3W7GA 1EO5A 4R7JA 2ZX6A 3BLFA 3EMZA 3PJTA 4ALDA 3AUJA 3SECA 1RALA 5LNVA 3G1RA 3EPNA 1TRDA 2EJAA 3CMGA 3W83A 1SU5A 3G1YA 4PUNA 1W1IE 4OOUA 2RDTA 4ONVA 3M44A 4IFKA 3ELFA 1EP3A 3SIZA 4B2DD 2OYLA 4M7TA 4YJ5A 3NPVA 1YNQA 3W2UA 2IXUA 5C55A 3UPMA 4QNEA 3WLMA 5A8PA 4WK9A 2G5WA 1XP3A 5AC6A 2PWVA 1VFSA 2D0HA 1PYFA 3N9KA 3BSHA 3OOQA 4PMUA 3H21A 4GHRA 4FLSA 4XAZA 1WDDA 4Q8MA 3BG9A 4DJEC 3WLNA 5RUBA 4HTYA 4E2VA 5JU6A 5A3HA 3PUEA 1XJBA 2GPTA 4IX2A 3STPA 1WXZA 3DHDA 2JKEA 2QUUA 2H9AB 2DZWA 3MI2A 4W87A 1W5QA 1LBLA 2OLHA 3OLDA 4TV5A 4NJGA 2XPKA 1KCXA 3WBWA 1V5XA 3CT2A 6CGTA 1JCTA 1TYGA 3IWPA 1KQZA 3T6CA 2B7OA 1O7AA 4Q6XA 4IMDA 4PUJA 2V38A 4GQGA 5A6SA 2DJLA 1E0TA 3OB8A 3F5JA 1XRFA 2HNEA 2ZADA 1I2RA 2OG9A 1YBQB 4KCUA 3TC6A 3WLRA 1IEXA 3QC0A 2WV8A 3FYOA 4ORIA 1A5SA 3EKGA 5CGTA 4AD5A 3T78A 5I6SA 4BS0A 4BI6A 2ODOA 4NJHA 3E1F1 4CQBA 2XGZA 4LYKA 2CPUA 1H1YA 3PULA 1EX1A 4JDYA 4S3AA 4KIEA 4PCNA 3NQVA 4LB3A 5A6KA 3H7VA 3PB2A 1SFSA 1YIXA 3LBMA 4C6IA 3CAKA 3IANA 2E28A 4W8AA 1SW3A 3ISIX 3PN8A 3Q58A 4DAFA 2ZC1A 2BMBA 1XBYA 1WUEA 1XYLA 3W3OA 3BURA 3C2OA 4Q7NA 4ZVJA 4AVFA 4JTDA 6ALDA 3ANYA 3L23A 1V6XA 1J93A 4GABA 3K2GA 4GY0A 4AMAA 2DP3A 4G1NA 3NZQA 2YLAA 4AC7C 2XH0A 3WN6A 3DYMA 1GOMA 2BNJA 1PBGA 4LUIA 5FJJA 3GNRA 3B8DA 4U33A 5A8OA 1XCWA 1UWRA 2EBNA 1YW1A 4RNIA 1DWGM 3FA4A 5DN1A 4NYYA 3T08A 3ID7A 3VD5A 2NQZA 5EKYA 6PTDA 2I17A 1OT2A 3A4WA 4QE1A 1MRAA 2DU2A 4MWAE 5T26A 3GQYA 1OBAA 5H91A 1WDSA 4CNTA 4A3RA 5MHBA 3LZ3A 3PG9A 3E0WA 3RGTA 4FXJA 4ZGYA 3WJWA 1GVIA 1G7VA 2J9ZA 1UIOA 4B5SA 3W53A 1P1XA 2VVSA 4XVDA 3W7QA 4K68A 4H8NA 3HJZA 1QHOA 4C6PA 1TSIA 1GHRA 4JTGA 3GKFA 2P8CA 5CZTA 4E2DA 1UWIA 3SCVA 4R7WA 3G0UA 4NHVA 4EXAA 3A22A 3LHTA 3TSDA 4HA3A 3KCLA 2Y89A 5DMLA 2FTYA 2HE8A 5FJUA 3IGXA 5HNTA 5LNRA 1XGEA 1BHGA 2VI0A 3QM3A 4FNQA 2ZE3A 3H23A 4ZOBA 4GFIA 1DJWA 4HZ8A 2GVJA 3OHIA 2ABBA 1LOSA 1JAEA 4KRZA 4F2UA 3BQ6A 3GAYA 4QITA 4C1NA 1QK0A 3LNMA 1NTHA 1R8LA 5DY3A 1L6GA 5BYWA 5GPRA 3KTXA 3E12A 2P8BA 3PB0A 3T2OA 1ECQA 4Z1DA 3LPFA 3W1QA 3AXIA 2VDGA 2WM0A 1V3IA 5CSYA 1DWFM 3NDYA 2D0FA 2J74A 1HJWA 1L6YA 1KKOA 4K7YA 3V18A 4M81A 5BW6A 3LBOA 4FI4A 1V6VA 4O1EA 2VRKA 3A12A 3AXXA 1XH0A 2P3ZA 6REQA 3W07A 1GQNA 4AIUA 4JAWA 1EIBA 3IJDA 3C6CA 2C71A 3N19B 1S5WA 2FLIA 2Y8UA 2AKMA 3ES8A 3W75A 2AL1A 1T8XA 4MZ1A 1VBUA 4IG2A 4QG9A 4RE3A 1JEZA 3KBNA 1O68A 4IMFA 3WH9A 5HBFA 2WSQA 4OUEA 2E9LA 4UWMA 3HFTA 1FXQA 4IJRA 1OZQA 4KEMA 1LQAA 1XICA 1YPFA 1CENA 3VX0A 3U6WA 1EDQA 4H6KA 4J27A 2VM8A 3NYDA 1AZ1A 2A4AA 3JZEA 2A0NA 4G7EB 3W1RA 1RJQA 4GVIA 2A3LA 3GC2A 2A7RA 3QW3A 1GWJA 4MFEA 3PBGA 4GMEA 6TAAA 4KH2A 4AFYA 3A4XA 2X41A 3TE9A 5BOOA 3VGDA 1JD9A 4WF7A 1SO4A 2AKZA 4IX0A 1O12A 1JDDA 3T4WA 4EWJA 3UQNA 3TW6A 3BANA 2VTFA 6REQB 1EPVA 2DQWA 1F6PA 1B4KA 3MVTA 2YZ5A 4UOQA 1Q2SA 3C8FA 2JFEX 1W1ZA 1VBJA 3FSUA 4KS0A 3PSVA 3W9ZA 4FR6A 3BAYA 3UR5A 3AZRA 3LNPA 1C8YA 3EDFA 1VHCA 1JJKA 4UZSA 1IZCA 1HG3A 2PI6A 3QC3A 3V0TA 2PD9A 4RE4A 3TJXA 4ATDA 3LM3A 1OX6A 1XKYA 1UBPC 5FF4A 2DW7A 3C2RA 3UFYA 1O5KA 4JN7A 1XYFA 3U5UA 5A69A 3EMQA 3UZJA 4W8BA 1HF6A 4O15A 1W32A 2ZRVA 2EPMX 4JYFA 3VYLA 1W8GA 1FWHC 4IIGA 1VLIA 5FF0A 4X0VA 3PZVA 4M6UA 3AIBA 5JMUA 1GKPA 3QW4B 2WMJA 3LXAA 3S9ZA 1CDGA 1WP6A 3VKCA 3IGHX 1R6WA 1OFDA 2YFNA 4JIPA 1UHVA 3LK6A 3AXHA 4UTWA 1UR1A 4WRHA 1T5AA 4F79A 1LG1A 4HIBA 4POCA 4WR3A 4ZO7A 3C0LA 3IUIA 4IJCA 4OHQA 2QCCA 2O4QA 2C3ZA 2XYLA 3B8SA 1EWEA 1L6FA 4C6BA 1HP4A 2D3LA 3QQWA 5DQPA 3QY7A 4QJ1A 1GEHA 3N3MA 4PMDA 1EBHA 3LRLA 1TTIA 4L61A 2OZ8A 5G4WA 3KW3A 1UUOA 3MCMA 1U22A 4DUWA 4UBPC 2E9MA 3LZ5A 2EQDA 5DMYA 4K7VA 3TWBA 2WLYA 3MHGA 3I4KA 1UKPA 4Z0JA 3O6YX 3VIIA 2FYMA 2D3NA 1JRBA 1VZWA 3P61A 4NI8A 2WVSA 1CXIA 5HOSA 1EC7A 4PH6A 3WEOA 2Y7FA 2DZPA 4M80A 2OQHA 4H7CA 5GJPA 4K6AA 4Y8EA 3A3WA 2E5DA 2DIKA 3FA3A 3W37A 1AUSL 2UWFA 1EA9C 1ONRA 4BHYA 3AS1A 1JZ7A 4MSSA 4JQ2A 1F6KA 1VBRA 1B30A 2YDQA 4IH3A 3H2AA 2E4TA 1GQIA 3L66A 2NUYA 3W26A 1V6YA 3WLJA 4YS1A 1XLJA 2PRMA 5K4ZA 2BTMA 4KIRA 3BC9A 4JQ4A 2E67A 3OBKA 1IT7A 2EG7A 1BYCA 1AW2A 3R8RA 3P5YA 1GKQA 3WK3A 3P6LA 3BCJA 3W7NA 1Z41A 3WELA 5HMEA 4KQNA 5CPNA 2Z1SA 3UWUA 3FJ6A 4JY9A 4IL2A 3TIMA 1FWGC 2GSHA 2ZUNA 1JPMA 1Y5XA 3GWQA 1A47A 3UWEA 4IGSA 4GX9A 3BGGA 1TE1A 4H9MA 4JIRA 1B3OA 3U5YA 3DFNA 3VAVA 1OK6A 1DHPA 2QCEA 1PEZA 3WLSA 2Z2AA 1JI2A 3ERPA 4A3YA 3B97A 4UNLA 4PBGA 2Y5EA 3UWVA 1GJPA 4ZOEA 1DWJM 4LF1A 5MF5A 4QJ3B 3LQGA 4BF7A 4C6EA 3E5BA 4D6HA 4GK8A 1DXEA 3E2RA 1A80A 2YYTA 2QCGA 4DZHA 2Z00A 4IOTA 4CN6A 5DF0A 1UZ1A 1ZBKA 1KLYA 3FSTA 3TYDA 3F2BA 4LEQA 1B90A 5D37A 3CJPA 1TPDA 1SQ7A 4CU8A 3HGOA 2DUXA 5GNXA 2RGMA 2PWFA 5CBBA 3NDZA 1SO5A 4HU8A 3AHTA 1Q5MA 2ACSA 4NL1A 1Z7AA 3S2NA 4W7VA 4RDVA 4GC4A 5LNSA 4N6FA 4AAJA 3T44A 3ARQA 2OEKA 1GVSA 3GG8A 4HOWA 1E51A 3TQPA 4NKCA 1IR1A 1DYSA 4NASA 3BDKA 2ZRWA 1QR7A 1B57A 4N42A 1YYAA 1QW7A 4LQ1A 3H55A 4IZGA 1S2WA 2PEVA 3H2FA 4GBDA 3LLFA 3LPPA 1H51A 4KRUA 1V02A 3RCNA 3AS2A 4J4KA 3F4WA 4I8YA 5DCEA 4ZOAA 4J3VA 4A8LA 3H4WA 1W54A 3DCPA 2R1MA 3QY8A 1IXQA 4X61A 2INEA 4DO4A 4G5DA 1XW8A 3W1AA 3D3FA 3V0UA 4UR7A 1FCVA 3H2NA 3THAA 4BJHA 1TR1A 3FX4A 4GH1A 1A0EA 4O1DA 1OABA 2DVXA 2PODA 3GUWA 3W6LA 2PDJA 3H7RA 3HA1A 2WZEA 3IIVA 1DEDA 4O28A 1V3JA 2YR1A 2VR5A 4LCSA 2QMJA 4KWSA 4QE4A 3I6RA 4EPDC 1FFQA 3ZWTA 4QDMA 1L9WA 4QSHA 1H7XA 4V1XA 5D2WA 1MO0A 1O5RA 1Q85A 2VENA 3DBNA 4O18A 5CPMA 1QAPA 3QEZA 3V0SA 1PZ2A 4Y9PA 1BRLB 2ZICA 3W7HA 2R91A 4JKLA 1E6PA 2P5NA 4QP0A 3CV2A 3M64A 4GNKB 4JTHA 2G3NA 5CPTA 1EGVA 2ZXAA 1IEVA 4KKXA 2W66A 3D47A 3DEQA 4U2ZA 4JEQA 3D3AA 4ZXOA 1P6BA 5EMLA 3WQVA 3NGJA 1M04A 5IRPA 1C92A 4QDPA 1RCXB 3LV5A 3VOGA 1XLMA 2DFAA 1V0LA 4N0RA 3GDRA 4O54A 5H8MA 2OZTA 2D2OA 4HHMA 4LC8A 4F2BA 4UFHA 1TVNA 4OBSA 1D7FA 1FOBA 4IMCA 4W93A 4DJEA 3PPFA 1FWEC 1EA0A 1XH1A 2VRJA 3SZ8A 2G97A 2O7SA 4QR6A 4DI8A 5F1UA 1YRRA 2YFOA 4C7DA 4WKAA 2RJGA 4LT9A 2ZOXA 2G8ZA 1Z44A 3HV8A 1JUEA 2E6YA 3ARRA 3ME3A 1DJIA 4FNPA 3L21A 4RW5A 3WNPA 2P3EA 4JZ5A 3CUJA 3WF4A 3BAWA 1KM4A 5CGQA 1CB7B 3FJLA 4M1RA 3U4AA 4JX5A 5AN7A 4E38A 3KRBA 4IM4A 3NUKA 3MBFA 2QCMA 1E0WA 4V15A 2A6LA 4H9UA 2ACUA 5I5RA 3MMUA 1ZCCA 2BHYA 3UETA 4BWLC 2X8RA 3BL3A 4Z2JA 3UJ2A 2BWGA 3NL6A 4RE2A 1HXJA 5A8MA 1TCDA 1AK5A 1CGVA 2FKPA 1EUNA 3A13A 1FWBC 4Z1CA 3NPXA 2BVTA 4J5NA 2ZTJA 4GGHA 4JCLA 1TA3A 4DLMA 4KT2A 1PTAA 1D3GA 2DIEA 1XRVA 1F76A 4LOCA 4MWAC 4DAIA 2WQPA 2PSNA 2WZMA 3HU7A 4CKQA 4EIVA 2GVYA 3NSNA 4IQEA 1DQWA 1QRQA 2HEJA 1KCLA 1YEYA 1QATA 1NF7A 4GINA 1JF5A 3GYCA 3OPSA 4DPQA 4H7VA 1EZ2A 1KCZA 4Q8TA 2GQAA 5E70A 3PJXA 1Q6GA 2GQ3A 2D1ZA 3M16A 2EPLX 3CL7A 1WBJA 4C5ZA 4B5UA 3BW4A 3T2PA 3ZVHB 1EGMA 4BQ2A 3VIOA 2XWEA 1C91A 3FJ4A 1J0KA 5TIMA 2Y63A 4EPBC 1BSLA 2PUZA 5IOBA 1Y65A 1ADOA 4GQBA 4L6DA 3ZR5A 1IEWA 1QNPA 4AWUA 3AOFA 4GCAA 3KWXA 3PUOA 4XAPA 3K4WA 4XAGA 2ZUWA 4H7ZA 2DZTA 1KFLA 4FXRA 1NVMA 5CC5A 2Z24A 1JAKA 2UY4A 1TO3A 3C61A 1G7UA 4W9TA 4QEHA 5EL1A 3L7RA 3WUFA 4F8XA 1BFNA 1XLEA 4LANA 3VNLA 2FIQA 4FB7A 3WK1A 3CQ0A 2EEXA 4RX0A 4H9ZA 5CJNA 1NWUA 5BMXA 1IQ8A 3M0MA 4LUJA 2V68A 2WB5A 3GIQA 1VPXA 8A3HA 4O50A 5HNNA 3AMCA 1QNOA 4LYRA 3DFPA 3WQEA 2Z0IA 3RNDA 1BKHA 4BWLA 4UTMA 1SFTA 4W84A 3W82A 3TROA 3GDKA 2ZZ6A 1RLCL 4NQ1A 3P5ZA 3CWOX 1CXKA 2I1OA 5EMMA 3GC5A 3WDHA 4U4MA 2A21A 4MJ2A 4US5A 4OVXA 4ZB0A 3SN1A 4B2DA 2Z1BA 1TKKA 1UPPA 2BFGA 1A50A 1LWIA 3CUIA 4G6CA 4QCEA 3MUY1 2QXWA 3NOEA 3V5OA 3POCA 4O1FA 5B7YA 4MYXA 3VABA 2C91A 4HA4A 1A49A 3B03A 3L67A 1U5VA 1JNDA 2D69A 3WNLA 5BXTA 1F6YA 1CGWA 1EQPA 1XLDA 2BS9A 2V8ZA 3W7EA 3HGJA 3UESA 4X60A 2CFFA 4QLLA 3U9IA 1H09A 4FA3A 3A9BA 3N4FA 4UTHA 2CW6A 2YBVA 2IQ0A 5D38A 2NVCA 3GVWA 4M82A 4G56A 4OU1A 2PURA 1VQTA 3IVTA 5G1MA 4MG4A 1DV7A 3BH4A 2POZA 3VGBA 1MQRA 4GYPC 3CTLA 3TTSA 3S6OA 4JN6A 1A53A 4OUIA 1L8PA 4XZHA 3SCWA 2L5HA 1GPFA 3OTRA 5J8LA 1WPCA 4GVHA 4DWSA 1ZENA 4ZE4A 3N6JA 2VNCA 1E56A 1YNYA 3FAWA 3GDBA 2VFFA 2Z1WA 1AD1A 2R94A 4IISA 4L1XA 2JBMA 4U3AA 3NQCA 2NV2A 4Q4MA 2I57A 3FGCB 1HP5A 5BRQA 1PSCA 4CN1A 4BK9A 3WEMA 3V16A 3N11A 3PWAA 1JDFA 2ZA3A 2V6AA 1O66A 4JTIA 1QTWA 1J0ZA 3HBLA 3V36A 4N4PA 3KLLA 3DC8A 1LLZA 3G1VA 1Q8AA 3WQ4A 2J7EA 1XYZA 5E0FA 2VEGA 1E6ZA 3WBAA 1XQLA 2PTZA 3TJIA 1B2YA 4RK8A 2OODA 1JVNA 3VD9A 3L0GA 4KEZA 2OFJA 2BDQA 4XX6A 4BY3A 3I3DA 3NG3A 4HNOA 2ZZ4A 5CPLA 3HQPA 4MJ4A 1MEHA 4GVGA 1BF2A 1KA9F 3ZOAA 5BXRA 5KEZA 3WUBA 3QYSA 4DF0A 5D2YA 1ZBCA 2E6DA 4J9JA 1MW0A 3FDGA 1XCXA 1TPFA 2NUXA 3S5NA 4FNTA 2E9BA 3GX9A 1F61A 2J9XA 3QKEA 1HKJA 4DZAA 4GFSA 4OE7A 5FF7A 1ZS2A 4J7RA 3KDNA 4LEFA 4L64A 2ZX8A 3MVIA 2OQLA 3MWAA 1O94A 1K8ZA 3I7RA 5IDZA 2B7QA 4HU4A 2P0OA 1N8WA 4YN5A 4C6KA 3CUHA 2JE8A 2ZFAA 2I56A 1J2BA 2AAMA 1L6SA 3CASA 3VIPA 3SJNA 3PBWA 3N13A 1ONXA 1VFTA 1O1ZA 3W71A 3G1HA 3UZWA 3IVUA 5L9FA 5F2GA 2Z28A 3W1PA 3B9AA 4AIBA 3NO5A 2VEPA 4S23A 3KOFA 1G6CA 1FDZA 3CZLA 5KINA 4NNCA 3RHGA 2AL2B 4U31A 5F2LA 4E2BA 1VYRA 2R8WA 1ZP3A 1W5MA 2BY1A 1JCXA 1W31A 1OYAA 4O12A 1HUVA 2GWGA 3NZ1A 4US5D 2V5DA 2AAAA 3C0JA 2GZXA 2OQYA 2Q71A 3ZZ1A 4QS5A 3V4BA 2J27A 3BGAA 3UCCA 1Y0EA 1SJDA 4Z2KA 2PC4A 1BLIA 3THUA 1CXEA 3PK7A 2VZUA 1DOSA 2NVAA 2VQUA 2IUZA 3HG3A 4H8HA 3ZLFA 1TIMA 2QKFA 2C19A 4BZYA 3GTIA 1VCVA 1WZLA 2CZ5A 5FJOA 1XIDA 2FTWA 2GGIA 1D8WA 5FEWA 4Q33A 1KWKA 2BHUA 3G3DA 3GE7A 4HSNA 1OX5A 1R9XA 1OADA 1QWKA 3P0WA 3E74A 3ARYA 2D20A 5F2MA 4PSPA 4GUIA 1ENUA 4IG2B 5CJ5A 2V3FA 2X2GA 1PZ3A 3LX9A 1GK8A 4D8ZA 1P48A 2DSKA 1PIGA 1EYEA 5AYIA 1OCNA 1UWSA 1C7SA 1BG4A 1GOXA 3SUTA 1PZ0A 3C3UA 4HCLA 2G4JA 4RZBA 4AZCA 1HQTA 2NLIA 1QI0A 3NPUA 1YKWA 1SUXA 1I2NA 4B5NA 3OZMA 3SCPA 1W1B1 3SDOA 5K9CA 1T99A 3DHUA 3GW3A 3VOCA 3O7UA 4GIYA 2E6FA 3TCSA 1IHIA 1EC8A 4K39A 5GQBA 5LSMA 3T09A 5DT7A 4YXGA 2GJXA 4X9SA 4ZQNA 3F4DA 4KFOA 2VEMA 3QQ1A 2CZVA 5LYRA 3FOKA 4QJ4B 1TFVA 5LIKX 2W4XA 3MYPA 2PLJA 1KM1A 1RCOB 1TZ7A 1JULA 3VOJA 4GI8A 3PJUA 2WAGA 1O5QA 4AZ6A 3DFTA 2JQXA 3AHXA 5AZ1A 1FHDA 1K4GA 3W74A 4H19A 1H63A 1NF0A 4I6VA 1EO7A 5AC5A 4YTSA 3V35A 3GU1A 4FNRA 2Z4GA 1ELSA 3WY1A 4DBEA 3RCYA 2CWXA 4GGBA 2J88A 4XUGA 4UZUA 3FVMA 2YA1A 5AY7A 1TWIA 4ZTYA 2J4GA 5I06A 3V5FA 1HX0A 1J5SA 3QLLA 1KCKA 2C16A 4A3UA 2PDNA 1B3WA 1I9CB 2VP8A 3NOYA 3W1NA 4Q8UA 4W89A 5A8QA 2QS8A 1GUVA 1VFHA 2J78A 1BKSA 3CUGA 4G8TA 4GQQA 4MB4A 3TYAA 4B3ZA 1QJWA 2CHNA 1V6TA 1Q7MA 3VD4A 2IKJA 1JPKA 3B0VC 1LL7A 1UD6A 4BR1A 4GQ0A 4ZB5A 3V3WA 4NZCA 1YDNA 2BXVA 3W24A 4LCQA 4C6JA 2RDXA 2FB3A 3TFCA 4LBSA 3LXBA 2DIJA 3G1XA 1YDVA 1GQLA 1J8VA 3S42A 2C6QA 1JUBA 1VD6A 3BLLA 1A4MA 4ZSUA 1AJ0A 3EX2A 1V08A 3E96A 2WSKA 4GQRA 3CWHA 3IUDA 4JFVA 2EPOA 2E77A 3WLHA 5I00A 1OYBA 1FKWA 2GOKA 1E15A 1MZRA 5I23A 2VC7A 3VE9A 4PTMA 4CCZA 1PKLA 3TOPA 2CEQA 4ZO6A 3CHFA 5GVJA 4HNCA 2Y8VA 4GUHA 4Z17A 2EKCA 1BSIA 1GKRA 1F4HA 2Y4SA 5AHIA 3W2LA 2CITA 3LU2A 4PB3A 3WBXA 1MXDA 3BPWA 2WWCA 2ZRZA 5F7UA 4ADSA 1WDWA 2C0AA 4GYPA 4OQVA 5DXXA 3MV01 2QGHA 3SO7A 1PIIA 4H1ZA 1Q4WA 3WJZA 1UD3A 1KRCC 2IKHA 3B9EA 2VFDA 3W1LA 3W2NA 4Y90A 4IL0A 2I14A 2XVNA 1GG0A 1RY0A 1SPQA 2O0TA 4Q4PA 3UD6A 1GJWA 3IGUA 1XDMA 2CIPA 4ZQCA 3M0KA 2V81A 1WX0A 4TVUA 3KUMA 4FNSA 2WOQA 2WHKA 2WJFA 2DZBA 3B0UX 3WQGA 3GB6A 5EMJA 3UPBA 3W01A 3S2CA 3RLVA 3UZZA 3OZOA 5A2CA 2VQTA 3TUUA 3CEUA 3TTQA 4LW7A 3OLGA 4FF5A 2GFTA 3R58A 3DFHA 1QMLA 1UIPA 4YNGA 3CV6A 1WV2A 3TX9A 2WVVA 1QBAA 4MB5A 3EWUA 3WZ0E 3C2YA 4JTFA 1PKMA 3RPMA 4GO8A 3TTOA 1XF0A 4HP5A 2GJNA 5JXQA 2RGLA 3VTRA 3SFKA 4AIEA 2HZGA 4IIEA 1WA3A 4S2CA 1NARA 4UQAA 3CZEA 3N14A 3L4WA 1V3KA 4JFSA 1ZU8A 1TPVA 1XYMA 4UFIA 1OG0A 1HGWA 4FX8A 3DI1A 1UBSA 4DI9A 3MUZ1 3IAQA 3NQFA 3WNMA 3CNYA 1QUMA 4CCCA 3AROA 3N2BA 1ZBWA 4DHGA 4DIAA 1O1HA 2YSWA 5HUOA 5G2WA 2ZRXA 4LTSA 4KEUA 1RD5A 5G2IA 1V93A 4F48A 3KHDA 4GPNA 3NR0A 3EGJA 5I3DA 3G18A 3EXRA 4ACYA 4ZQPA 1GOWA 3ZLGA 1QPOA 1ODUA 3CC1A 1TPC1 2E09A 1JCJA 2PE4A 4M6VA 4ACZA 3QFEA 4EX4A 4QXIA 3RO8A 4IUOA 3M5VA 1IGSA 2OSWA 3PBUA 2XJ7A 4LC6A 4TU1A 1D8CA 3G1DA 4HSHA 4JCMA 5JIWA 3WD4A 4HOXA 3M47A 2OJPA 4C6MA 4QX4A 4LAOA 2VZTA 1UD2A 5GNZA 2XM1A 2VFIA 2WWDA 3NM3A 3DKLA 1AL8A 3ABXA 3LS9A 1BWKA 3DI0A 2ADAA 3OVPA 3KL0A 1E0VA 2E3ZA 4MF4A 4P8XA 3VM5A 3CHCA 3SUUA 1TVPA 4INFA 2QVHA 3ARWA 3CPRA 3MYOA 1SW7A 2E8ZA 1M9HA 2FPVA 2IKIA 2Y70A 4PCTA 4G9PA 5T9CE 1GHSA 1SZGA 2FTPA 3RILA 1VFLA 1W5OA 3GVVA 4QISA 2FGZA 1AQ0A 5B7ZA 1JXKA 4MWAB 2FPYA 3P80A 5IFPA 3UG8A 4FIRA 4WUIA 2CZEA 1V3HA 1XH2A 1C93A 1O6IA 4MWAD 3AICA 3AIQA 4JGDA 3A3XA 2QYGA 3NZGA 1AH3A 3GXDA 1XIEA 4FS9A 4NAFA 5I02A 2QJJA 1DE5A 3CYVA 4W5ZA 5E9AA 3AHZA 1J18A 3V75A 3FYPA 1K7EA 3U0HA 4TQTA 5C2XA 1TJRA 4R34A 4REQB 1E73M 4HZ6A 3TTEA 2BODX 4RZ6A 2PZ0A 5EFDA 4Q7IA 2QCFA 3UVAA 3WL1A 2FHCA 3THDA 3L5AA 1TRIA 3PUDA 2QGYA 3FJNA 4PYSA 4JIIX 4XZNX 4PSRA 5D9NA 2J66A 3KBJA 4WJEA 2FH8A 3MKCA 1XS2A 2CLKA 3HGSA 3F4NA 4OV4A 4PTWA 4LCRA 1TPWA 1DORA 3GFXA 5E6YA 4N02A 4LU0A 3XINA 4GZIA 1AODA 4FLRA 3GK0A 3EOOA 1D9EA 2DSUA 1YX1A 2BHZA 2AQWA 1NP2A 5AVHA 2V5KA 4QLJA 5GJMA 2BB0A 2PWDA 2ISSA 4QHRA 2RH9A 5CC7A 4HZ7A 3S6DA 4I5RA 1LOLA 1TPUA 1UR0A 1XIJA 2ALDA 1R3VA 1H5VA 2HS8A 1F3XA 1O4UA 5HDRA 1QPRA 2VXNA 3VFCA 1UB3A 1K4HA 3O0FA 5KETA 4IFKB 2HXUA 2FVKA 5CPSA 4ECLA 1DJQA 4BF9A 3Q65A 2QZRA 4WDXA 1M1BA 4NG3A 3AYSA 4FEZA 3F2DA 1R3RA 4DJDC 1LOQA 4LAMA 3WMSA 3F4VA 3QMTA 1AVAA 4BEUA 3RLUA 1IEIA 3VKJA 2J62A 3S5YA 1R30A 3GNNA 2VD9A 1ZTVA 3NWRA 3QH2A 3MSDA 3U2EA 2HBVA 1TJPA 2H6RA 3LSCA 3MCOA 1JGIA 1W9PA 4NJIA 4P7RA 3OLEA 4DM1A 1BQGA 1US0A 2PPGA 1A5BA 3BOFA 3IJ7A 2TPSA 1TMQA 5EU9A 1CGUA 4YWSA 3FGCA 4JIEA 1W3NA 1XFBA 3ENLA 4GX8A 4EF8A 5D8ZA 2VCBA 2X1SA 1JD7A 1M5WA 1W3HA 3RM8A 5D09A 4HJFA 1W1A1 4JKMA 1BTCA 3FIGA 4UTUA 3QKZA 1FHVA 1W3IA 3C52A 1XD0A 4YL2A 2FFIA 2J8GA 2J9YA 5MKGA 1E4LA 1YTDA 1FWWA 4EWND 1PPIA 1VFUA 1JGMA 1KM2A 2ESCA 4Q4SA 1J9YA 4O57A 3W22A 5HR7A 2WMFA 4CLMA 3RCMA 1Q13A 4AX6A 2R1KA 3CAWA 1UUMA 4BI5A 2XHYA 4HCDA 4Q4KA 3WF3A 3TQKA 2FZ9A 3L4TA 2XSXA 3H24A 1EJXC 4JL2A 3V1HA 2JALA 2ZUTA 1B4EA 2WPGA 3ES7A 1WDPA 3IACA 4H8UA 1VYSX 4Z1AA 3KS6A 4NIRA 3WDPP 3VNIA 5H8UA 4E3TA 1PL9A 3M5ZA 1HJXA 4Z2LA 3WUGA 4C6QA 2OKTA 1R2TA 1FH8A 4LAKA 4P7QA 2W0UA 7XIMA 4ATWA 1RPXA 4GYJA 3UT0A 5MKGB 3PFRA 2FQIA 3THCA 4CVUA 3M0IA 1LRNA 3I6EA 1LL4A 2JIEA 3L4VA 3K5XA 1FCBA 3L5LA 1VJSA 4XZIA 4FNUA 4MZ8A 4F66A 3W87A 1VFFA 1C9DA 4W85A 1L2UA 3C3NA 1W17A 3NNTA 1EP1A 1E6XM 4J3SA 3RITA 1GVYA 1IXNA 4XSMA 3ZFHA 2H8XA 3L0KA 1G0CA 3AWOA 4XAFA 4P8VA 1S1RA 2W79A 4TX9A 2G4FA 4DM2A 2ATMA 1XGZA 2GGHA 3VX1A 3PBMA 3VOIA 3T9PA 3AXKA 2CCRA 3MDWA 1MSSA 1UD8A 5T9BG 1XHGA 1KXQA 1RQHA 1HFBA 1YBQA 1SZFA 4A6GA 1E40A 5FL1A 1FBAA 4QS6A 3AISA 5AOUA 2ZZ3A 4PMRA 3DYOA 3VIHA 4MYAA 4B3KA 3T42A 2PDYA 2VJXA 4I7VA 3KVLA 5D02A 1WNOA 1TUFA 1N8FA 2W27A 1C8QA 5HULA 4FOUA 2Z1VA 1ALDA 2GUBA 3SR7A 2WHJA 2Y5SA 3IIZA 4X0NA 3K13A 4P7NA 3BARA 3VIGA 1G4SA 3L0NA 1E4MM 3SFWA 4ASTA 3GFYA 2C8NA 3MMTA 5EMYA 2V3DA 1W37A 3HZ3A 4E5TA 5A6BA 2VFGA 5TAOA 2YCKX 3VDBA 1QCWA 3UY8A 2JF6A 3RF9A 3PTDA 3QVQA 2G95A 4PMZA 1XXXA 3FA5A 4IMAA 2NX1A 1WO2A 2W5FA 1OFPA 2ZQ0A 1RP8A 5C2CA 1WXJA 2BY3A 2F38A 3T0BA 5CSSA 3NQAA 3UXKA 2IW0A 1R0MA 1XLLA 2R9RA 3SM0A 3V5CA 3IV3A 1TV8A 5IBXA 3QFWA 3NO1A 1ADSA 2OR2A 3ALGA 2VGFA 3BLEA 5FF3A 3YPIA 3MHUA 4PR4A 3NL2A 3APGA 1VPYA 4MNMA 3QSRA 3WBYA 3ZVHA 3SB0A 4H6EA 1KFCA 1HJUA 3W2JA 3DH7A 4KERA 3JR2A 4RW3A 4OTKA 3H53A 3BW3A 1JYXA 1GW1A 3W1MA 4HNLA 1B0IA 4LF2A 3EEGA 1X7FA 1AMKA 4WXZA 5JVLA 4PUWA 4U2YA 4CU7A 1VEOA 4LYQA 4IQJA 4X3ZA 1F4AA 1OGBA 2P50A 2IPGA 3M7WA 4D72A 3JVAA 3NIYA 4AH7A 4KBXA 2A85A 4QG8A 4P8UA 4XBKA 2VR4A 3PANA 5D9MA 1P4CA 4BKNA 3OJGA 1EXBA 4O17A 1A5UA 3TYEA 4QG6A 3T0TA 4MFDA 3RR1A 3FXGA 1ZRQA 2QPSA 3HG2A 1WDRA 1KWGA 4J35A 4P2VA 1OX4A 1US3A 5HMSA 5AHEA 1GVEA 4JFUA 2VO5A 1JYNA 4D6CA 4OZOA 1KGXA 1XL9A 3WX7A 3NURA 2VFHA 1P6CA 2Z7KA 4PL1A 1TQXA 3UXIA 4CNSA 4UIOA 4F2TA 3RJXA 3TVAA 4MM1A 3OP2A 4CD5A 4PCSA 5FIPA 2E6AA 1MFVA 1WB0A 2QQ6A 1QO5A 3DUGA 4GYFA 1YPIA 3WF2A 4XO7A 5FKYA 3S1UA 4DBSA 3ABZA 1B5TA 1LJYA 1CECA 4ZEPA 4AEFA 3WDIA 3KVMA 5IBXC 4PEEA 2OYKA 3EPOA 2VX5A 4LFYA 4C1LA 4AX7A 3GVRA 4Q4RA 4F0MA 2PTDA 3SGGA 1QXLA 2FDSA 2XU2A 1JR1A 2QJNA 2XM2A 4DXXA 2O7QA 4KPLA 3AFBA 2INFA 4OV9A 2VEIA 2Z7GA 2VEKA 1U83A 3H8AA 5BOEA 1Q66A 3WKZA 3SY5A 4R9XA 4PMJA 4R27A 5K9XA 1RUSA 3DGRA 2YBTA 3WQPA 1GTEA 3QHNA 4I90A 2BZNA 2QF8A 4PMXA 3B4YA 3RUBL 3H4GA 3VMOA 3UA3A 4QNWA 1M68A 3IVSA 3EMCA 4JTKA 5C54A 1Y8BA 4ACZB 1K9DA 1E5NA 2WCSA 1WCGA 4UTTC 2IPJA 3MBDA 1TTJA 1CWYA 4XD4A 3MDUA 3T07A 1S2AA 3GTFA 5LHEA 3TYUA 3GBEA 5CPOA 4AXNA 3EOSA 3W7DA 3S1WA 2Q3RA 4CD6A 2WANA 1NU5A 2P1FA 4F0LA 4Y7EA 2J7CA 3U7BA 1Q6OA 5C0QA 3LI0A 1H2JA 1R85A 3STFA 1FCUA 3BMXA 2ABAA 5I07A 4U5IA 3Q4DA 5A2AA 4B5WA 1FWIC 3R10A 2W9MA 1YXDA 1EJVC 2J7HA 4GNVA 3LGEA 2PMQA 1J0IA 5LXEA 2A2IA 4GKLA 1A5OC 3PZ9A 1CGYA 3UJEA 2E1DA 4TTGA 1N8IA 1PHQA 1Q6RA 1WZMA 2EXOA 4W88A 4KW2A 7A3HA 3O07A 4J3XA 3NPWA 1KBJA 1EOMA 4AISA 2GJRA 5AC4A 1OQFA 2RAGA 3GTNA 3OBEA 2XGBA 4A3HA 2REQB 1XIBA 1LT7A 4KWWA 3WNOA 1XX1A 2WKLA 5AHLA 3KTCA 1OWQA 1HL8A 2CWNA 3KVJA 4J3TA 4IXXA 3O0KA 4H9VA 3TAKA 3UWQA 4H04A 1OB0A 1LYXA 1VS1A 1M65A 5U4NA 3T0DA 1JYWA 1W3KA 1V4YA 1HVXA 5TBOA 3OGSA 2IXVA 5D05A 3DYPA 4DWSB 1RCQA 1VJIA 4JKKA 5D03A 1E1CB 1W3LA 1XPGA 3S2MA 1T8QA 1K9TA 4LUTB 2EO7A 2ZBTA 3B3DA 3QSTA 1QBBA 5K4XA 2BGNE 1MQPA 3CZJA 4GCXA 1UQYA 4D71A 4CD4A 4YYCA 4UTTA 1FWAC 5BRBA 4AF0B 2PP1A 1R87A 4D1JA 4NU7A 1UC4A 1KKRA 2CZFA 1W1TA 1HIZA 1GG1A 4MPQA 3M0HA 1LTDA 3H22A 1NELA 3ZQ9A 1JCMP 1UKSA 2TYSA 3GZ3A 3VNJA 2HQAA 1QPQA 2VCCA 3OA5A 1ICPA 4HA1A 1ZP4A 3N18A 4IIDA 4AD1A 1AD4A 1L0PA 1YDYA 1XR2A 1LG2A 3GNDA 3WO8A 5AB3A 1BG9A 3EDDA 5HWMA 3WQ5A 1E5JA 4LRTA 1ZAHA 2WMGA 4NJJA 1EJSC 2GYIA 2ZE0A 3KZPA 2YL9A 3MJYA 4CQDA 4IPNB 4HQVA 1ZFJA 3A21A 3CUZA 2OEMA 3VKAA 3MMWA 3KL3A 3I3EA 1GYMA 1X1NA 4UFJA 3GNXA 1R3QA 2DVTA 2DZUA 1ZNNA 3TONA 1QI4A 2RHGA 3KP1A 5T8GA 4LVDA 3SW6A 2WCAA 3VFLA 3LHUA 1XKJA 3E0FA 2Y88A 3SGUA 4PMYA 3SGZA 2GQ9A 1J0JA 2HK0A 1I2OA 4JTJA 4PUUA 5FD0A 3VU2A 1OZMA 3WJYA 1KFBA 4I3GA 4PL2A 1H1NA 3PUGA 4XSLA 5LGZA 1VF8A 3DERA 3B04A 2BG5A 3PPHA 1R7AA 5EGRA 3M0ZA 1I1WA 2XIIA 3CK5A 2JK2A 3ONBA 4RXFA 4ZQOA 2WJEA 5I78A 3W1TA 4EF9A 4LXFA 4RDYA 1NP0A 3PZGA 2C14A 1CLVA 5CAKA 1Q8JA 1C8XA 2Z2UA 1Q6CA 4NNBA 1VHNA 3M0XA 1UWUA 2DORA 3O05A 5JQ9A 3O9NA 1LF1A 3LYEA 4GI6A 4OBTA 3MKVA 1FA2A 4AMCA 3B8WA 3LI1A 3WEZA 3H2EA 4WGHA 3S4TA 3BXWA 4N9CA 1OFAA 4YYFA 2ZVRA 2XH2A 3N2CA 3G1AA 2UZ9A 4A21A 3AXMA 3R2GA 5HWJA 4Q6JA 1J0YA 1GYNA 3NQMA 2Z2BA 1RJPA 4TR9A 3R7MA 1HKWA 5M3WA 3G77A 4XQ6A 2WC4A 3B8UA 2G3FA 4K38A 5G4HC 4LUSA 3S5ZA 1NJJA 3VNYA 1GZJA 1O95A 3PP7A 1AH4A 3GXTA 4MWAA 4HNVA 1P0KA 2D2JA 3SQSA 1FQ0A 3PZIA 1RJRA 3OW1A 2YB1A 3HQOA 3QR1A 4GZJA 5CG7A 3B4UA 5DCBA 2NWSA 1YE6A 3N9SA 3PNZA 4PZVA 3U3HA 4DO6A 4S3DA 1XUZA 4WEVX 1H62A 1V6WA 4A8RA 5HQLA 3CV7A 1TMLA 2GLKA 5TF0A 4ERGA 1MQQA 1WE5A 2NXIA 2A3BA 3E0LA 4KF1A 4JIQA 3BQ5A 1R2SA 4FO4A 2RDUA 1ITXA 1PHWA 1KXVA 1KBKA 3KXQA 4ZR8A 4JFWA 1V8EA 4OKDA 1OF8A 1W9XA 3AHYA 3VGGA 1G5AA 4JR5A 4L9YA 1IF2A 2XFWA 1JXJA 1PXGA 1KR0A 3ANUA 4RLIA 3PR2A 4AW7A 4L5ZA 3WQFA 4H01A 2YCEA 4L4MA 1BPLB 1BYDA 3E0IA 3PZQA 2PGRA 3SBFA 2VZSA 1I4NA 1T41A 4YMZA 3CT7A 1A0CA 3LHWA 3AZSA 3UP8A 2BVWA 4RDZA 1H41A 2VOTA 3GSMA 1NWSA 1JPIA 3ONCA 3OZYA 3GBDA 1ICSA 2OGYA 3P67A 1LWHA 1EX5A 1OD8A 1D3HA 1PCWA 4O19A 1KFJA 3UR2A 4AHPA 3KP0A 4QSFA 3MP5A 1K03A 4NI3A 1RBAA 3P8IA 3T81A 3DAQA 3QGAC 1MVYA 4RR4A 3W85A 3BO9A 5CZSA 4GVFA 1T0OA 4Z2GA 2HVOA 3NZRA 2UY5A 1XGDA 3CS2A 4D2JA 4FP1A 2VX7A 1OHLA 2ZWYA 1MXSA 2CLMA 3KX6A 3S0CA 1CT5A 3CPGA 1V7YA 2D73A 4LVGA 3TP4A 5LXXA 3VIKA 4LSBA 3PBYA 4TIMA 4FXSA 1J6PA 4GXWA 4I8DA 1Q6QA 5XINA 5ABEA 2JEPA 2Y0FA 2YCLB 2CU0A 2NQHA 4MB1A 4HK6A 1ISYA 4LGXA 1MFUA 3F1QA 2PDFA 4DB7A 3ZSSA 1UZ4A 3RM4A 2QCHA 3S46A 3MJMA 4O14A 2J24A 2VT0A 4CEUC 1O60A 2DT2A 4PUEA 3S47A 2AL2A 3T1GA 1MW3A 1E1EA 1TZ9A 2V82A 4O8AA 5A95A 3LM7A 4P7OA 3QTGA 3TR2A 1HGYA 3QOMA 4DELA 4AZBA 4RNFA 4JICA 3VDHA 4JTRA 5CSRA 4ICCX 1JZ8A 3QYQA 5BMWA 1XRTA 2WMIB 1TB3A 3EWXA 4A2SA 3EXSA 4ZO9A 4EACA 4KGLA 1RXOB 1Z42A 4Q4OA 1S2TA 2WBGA 3GD6A 3UNDA 3GU9A 4S3JA 4BQ5A 4DXKA 1I2QA 1OIMA 1SMDA 1I6NA 1X1OA 3VMPA 4JD4A 4HHPA 3F5KA 3VIFA 3UY7A 4R3UA 2QF7A 4S3GA 3TDFA 4YLWA 2I5GA 3WH6A 1F05A 1HKVA 3FNDA 3NJ3A 4RUBA 1MUCA 2GVLA 3QR0A 3SAZA 2YDAA 1U5JA 4AUBA 4HMEA 1RV8A 1YLVA 3NQ8A 4I7WA 4L6OA 4QCFA 2C1IA 3VMNA 1S3HA 4HA0A 3ZJ7A 4S3KA 2XIBA 5CC6A 2GDUA 3BJTA 4Y9MA 4LX4A 4IICA 1QOXA 4GY1A 1UZHA 3E0VA 3CHDA 4U28A 1XLKA 2X0YA 4OFCA 2QDDA 3GXNA 1POJA 3W7RA 4R7OA 4EKJA 2PWEA 4KWUA 2ZWZA 3SY8A 1YXYA 4QQ3A 2V2CA 3MZNA 1MW2A 4UQBA 2WYSA 1JCLA 3WUEA 3APYA 2VZOA 4GIEA 1Q6DA 3UZ5A 1QU4A 3DG3A 3WQDA 4WJXA 1WBHA 3H7UA 4O0QA 3GH7A 3SCRA 4JN8A 2R1LA 1UUQA 4PTXA 5M1TA 3PM6A 3E2QA 3PPCA 3VVGA 1IE7C 3AI0A 3CEPA 4IGMA 3RX4A 1QW8A 2O4MA 2V30A 1LRQA 1P0DA 3SCTA 2KX9A 1LDCA 1Z89A 3F2CA 1S5VA 3RIKA 3TXVA 3IJQA 4GY7A 3RFAA 1S1PA 3RN6A 4CD7A 2J6VA 1K6AA 5HMDA 3TN4A 1FDJA 3AYRA 4H2HA 2TSYA 1GEQA 1NM9A 1FKXA 1PB0A 3VDAA 3R79A 5DANA 4RE0A 1GPWA 4ZODA 5A6LA 1IT8A 1Q3NA 2YL8A 4M5PA 3BVJA 4CQ9A 2XFYA 4B15A 3HV9A 3V1PA 3JS3A 4L7ZA 1A5AA 4KGJA 3S2JA 2Y61A 2G96A 4FAMA 2QJGA 3N2MA 2NT0A 5B80A 3LMYA 4KFPA 1J12A 4QAWA 5PTDA 1JZ2A 3P84A 2PWUA 4HZMA 4NT0A 4PUKA 1SM9A 1BWLA 2WC3A 3HTWA 3ZMRA 2J7DA 1KTBA 3USBA 5G5IA 1KM6A 4M19A 1W3TA 4J3UA 1RBOB 2PDPA 3TN5A 4O11A 5DX7A 1DIDA 1CGXA 1SSGA 1IWPA 3PTQA 5DCDA 3CPUA 2POTA 5ECVA 5FSDC 4UTJA 4CEXC 5CH9A 1OK4A 4PODA 1F7BA 1LT8A 4RZ5A 4XO6A 3PJWA 3FEMA 4NJKA 3OA3A 3SN0A 3W76A 4IP7A 1S46A 1UJPA 2FFCA 4K36A 2FVLA 1VEMA 3RLGA 2W63A 3NQ7A 4FK9A 7TAAA 1HVQA 1WXYA 5C2GA 3WBEA 1G94A 2A6NA 3NQBA 3AYTA 4I9AA 4I6KA 3WYZA 3DFYA 2Q8XA 2QPXA 2ZVIA 1GOOA 1EGZA 2XSAA 2V2HA 4LNYA 3NEVA 1SMAA 3G8RA 2QJMA 3M46A 3W70A 3W7JA 2WHMA 2GVGA 1L8NA 9XIAA 4AHOA 5K2ZA 3PHAA 2CLFA 1JUKA 1GNXA 3GTXA 3GXMA 2QCDA 1KGWA 3JW7A 1OEPA 2PDKA 3T8LA 4DWDA 5I3JA 3WH8A 4RL3A 1QI5A 4D6FA 1SJBA 2CLEA 3MI6A 4RNJA 1QDSA 1IIGA 1VBHA 3LHVA 1JFXA 4RXGA 2NQ5A 5BXSA 2X30A 1B9ZA 2ICSA 1O5XA 3LCGA 1UQZA 1AJ2A 2CLHA 2NX9A 1Q63A 2P53A 4MLJA 1EJTC 1Q6EA 5DLCA 1I1XA 2ZYFA 3AO0A 3EZ4A 2QV4A 3W02A 3MW7A 2HCVA 1Q65A 4MKVA 4O1BA 1R5YA 2XUCA 2EHHA 1FY6A 1JNEA 2GSEA 2R24A 3HPAA 3MT1A 3N15A 4QE5A 3UWWA 3HF3A 5G1TA 3CB8A 4NILA 2BVYA 4YVXA 4R88A 1JIBA 1XM3A 4HGXA 5C9ZA 5DMNA 5L6UA 5A5WA 5HMFA 3EWYA 2YJQA 4K1GA 3R6IA 4O0KA 1BTMA 5A8GA 1TELA 3WF1A 1NSJA 3VOHA 1ZL1A 4XUYA 1SJCA 2F2KA 1JZ4A 2TAAA 3DIPA 5C9XA 4QQUA 1H49A 3CHEA 4C65A 1ZJAA 5HWNA 1W1PA 4RJEA 3O8AA 3G0XA 2OOGA 3WQWA 3FKRA 3AJXA 3BSGA 3R5EA 3ZJ6A 4GA8A 4HHLA 3N29A 3QY6A 5FJRA 4PMNA 4UOJA 1KC7A 4GIAA 3UXDA 3TR9A 1UCWA 3EDJA 2DZXA 3ANVA 2QIIA 3P8JA 1A5LC 4H4IA 1PVNA 5A6MA 2YA0A 3W2KA 1WYIA 3D46A 2OGJA 3QV7A 2X05A 2ON3A 3LCHA 4NX5A 3FLUA 5FF2A 3L2IA 2GOUA 4JX4A 2ZZ5A 4DNHA 1P0BA 4Q7BA 2X7WA 4IQDA 4KFNA 3HURA 4F40A 1B31A 1OVDA 3CIWA 3REQB 3STEA 1V3LA 3WJXA 5I2UA 5DRIA 5CCZA 4HB7A 5FAGA 3UNTA 1G67A 3BJSA 3R94A 3U48A 2BGQA 2QUMA 3S1XA 1REQA 3M0LA 2FPTA 3G6MA 7CGTA 4MJMA 4OJYA 1GORA 1ZALA 2F2HA 2Y8KA 1W56A 1EEXA 2HROA 3L5MA 3LGGA 5I3KA 1DIOA 3GHTA 3RMEA 3OHMB 4IIFA 5CC3A 3EB3A 3EWCA 2Q01A 4LUTA 1ZGDA 3OODA 3L9CA 1XINA 4C7FA 3AMKA 3BZJA 3HIJA 1X97A 4AYSA 2ISWA 4B92A 4TMCA 3MUIA 3LERA 3LB0A 2CC0A 5LIUX 2VUNA 2QEZA 4KETA 2HMCA 2WPBA 3TMQA 3DFOA 2OLSA 4UCFA 1XIIA 3INPA 4K8GA 4M24A 3ARPA 2EJ1A 3BK0A 2QDEA 2CYGA 3F5LA 1XISA 1DQXA 1H7PA 4O8RA 3PS7A 3WSUA 1SW0A 1LUCB 4Y6GA 4H2CA 1JDEA 4C6LA 1TJ0A 3M7SA 3UXLA 1JPHA 4XIAA 2YL6A 2BX7A 1GGOA 2ALRA 3QGVA 5H6HA 5J5RA 2NZLA 1XYAA 3C86A 1WKFA 4FOJA 3ATYA 3K1GA 3WIJA 4S2BA 3NSMA 5I3FA 2V69A 2G41A 3H2OA 3NL5A 2D2GA 3W7CA 3GVGA 4Q8QA 4UB9A 4TX6A 2VFEA 4YTRA 1AFSA 3BW2A 1OGSA 3LBCA 4PN2A 4DZ5A 2WJZA 4XK2A 4DNMA 4PTNA 3T05A 4HU0A 3O6DA 3S2LA 4GH3A 3LSBA 2BY0A 1JZ3A 4W5UA 2OU4A 3L2MA 1E72M 3ZXWA 1C29A 3CAVA 3GR8A 1TV2A 4E4FA 3UG3A 1UH4A 3RPDA 4E4UA 4WVXA 5EBUA 1VLWA 3NO3A 4UMAA 4JIHA 2WNQA 1H0GA 1M7XA 4IGHA 2GL5A 1HW6A 3KDOA 2YIHA 1XFCA 3HQ1A 4FLOA 4M51A 5I3HA 3CHVA 3GH4A 3NQDA 2YKKA 4AZGA 3VGHA 1UYQA 3QF0A 4A8NA 4HSOA 1F07A 1E1FA 4AZHA 2OXNA 3A5VA 4X63A 3RPTA 3UZXA 1F8IA 3ABOA 4JYEA 3OO2A 1HNYA 2PZNA 2DH2A 3CBWA 5FCZA 4C6OA 4I7UA 3NVDA 1KTCA 1NEYA 5XIMA 2HV5A 2W92A 4XKYA 3W23A 2GVEA 1JRCA 4BI7A 1BYBA 2ISFA 3B40A 2YXOA 1VIWA 4AY8A 3KCJA 3VUSA 1BAGA 3SJ3A 1REQB 1R86A 3IEBA 4UFLA 4KCWA 4HPNA 2B81A 1BVNP 3UVIA 1J2WA 1V02E 2J79A 4YWIA 3EX6A 1H60A 1VCGA 2X0HA 3TKFA 3SADA 2VUYA 1MNZA 4AG0A 4GKTA 1XLGA 1A3HA 2QDHA 5I7GA 1T7LA 3MI3A 3NL3A 4JTLA 5IHSA 4JTTA 4LYPA 2C15A 1SFLA 2X0SA 3C2VA 3GUGA 1IT0A 4ZB2A 4IMGA 2PRHA 4GJIA 3R43A 3MTWA 4HPJA 3CL8A 4V28A 1WAWA 5KZDA 2OCZA 3SUWA 1X98A 1SZRA 1I60A 3UEQA 3IGSA 1OINA 1ZY9A 1Q7QA 3ZYZA 1LUCA 2I9EA 4IPLA 1CPUA 3EXTA 1G69A 4K2SA 2FDMA 3TNOA 3VDGA 1IIHA 1F3EA 2V9DA 1FWCC 1FCQA 2G3MA 6A3HA 1CZ1A 4N9DA 3F4CA 2V5BA 5ABFA 3B8VA 2OMAA 1GYLA 1WOAA 4E8GA 1KV5A 2HVNA 2MNRA 5EY5A 4BQ4A 3URBA 1S2UA 1X8FA 5AKQA 1GT8A 3ZSTA 3EPMA 2XN1A 3TC3A 3EWZA 4CCDA 2QMKA 3LOTA 2ZZ1A 1KV8A 4GI4A 4ML9A 1BWVA 3FEQA 3PTMA 3PF3A 1M03A 1H11A 2X40A 1PE1A 4GWEA 4N9EA 3DESA 2QHAA 3IK4A 4NAEA 2PFHA 4LS2A 2NSXA 2PTXA 3VKBA 2CESA 3BE7A 1V0KA 3TCEA 3WL0A 5JIPA 1XC6A 3GXFA 2OSYA 3VC6A 3LCXA 3TXZA 1ZZMA 2ZA1A 3HO8A 3CWNA 1B54A 4PFHA 4XD3A 4IJBA 2VC6A 1NIUA 1S5MA 2WHLA 3UYIA 2HISA 2WMHA 3ARSA 4A22A 2NXHA 2G37A 3Q45A 1AW5A 1RK5A 3WD2A 2YX0A 2YCIX 4UQDA 3RM9A 3QMRA 4E4PA 2VELA 3EX4A 3ZT5A 5BROA 1NWRA 3N34A 1W91A 4IMEA 9CGTA 1G4EA 4CVWA 1W2PA 2NQJA 2ZXDA 1VGAA 5JBFA 5K7JA 4AVNA 2A7NA 5CKSA 1V3MA 3QGKC 3M9YA 4UNKA 3DN5A 3M07A 4DJDA 3EEZA 2AOSA 3IJ6A 3S1VA 4DJFC 3M0YA 4QDWA 3BAXA 4PCFA 3N04A 4PRWA 3CQIA 3VINA 5BNKA 1TV7A 3W7IA 1X6LA 3UGRA 5I24A 1QPNA 2E40A 3LLDA 5C71A 3LG3A 3A6OA 1EPXA 2NXGA 3H70A 1XSIA 2Z1XA 3CL6A 4O1CA 3E6EA 1RQEA 2W6RA 2DPEA 3PWIA 1M7JA 3CH0A 3MO7A 1I2PA 2YB4A 4PCPA 4UNIA 1N2VA 3C2FA 4LAZA 3R8GA 3VZYA 1IWAA 1UWTA 4HYWA 5H2ZA 3AS3A 3PTKA 4HVXA 1TQJA 3AWNA 2EG6A 1Q6FA 4M56A 1BVWA 3W4RA 4NNAA 3LDVA 3B9DA 5JH2A 1V51A 3FHAA 3KEHA 3BGJA 5XIAA 1W5NA 2V2DA 1TX0A 3DHFA 2XIMA 5KTLA 5HJXA 1UD5A 3UW6A 2WZIA 2G50A 3CLMA 1DBTA 1YADA 3IIXA 4PBEA 1XBXA 2EF9A 2V5LA 1F2JA 3WD1A 1DP0A 1UC5A 1H4PA 5F1VA 1P43A 3HN3A 1H7RA 4RV8A 5G1YA 2J8FA 5KMYA 4GJ1A 5BU6A 2WKJA 2XVGA 2WSYA 3ALFA 4Q8OA 4L4PA 5SWUA 3WH7A 4L4OA 4NZ5A 3RX3A 4PB4A 3VXGA 3VCRA 2CHRA 3CTTA 3ZLHA 1Q6LA 3BLOA 3SSJA 1WAUA 2AGKA 2E7FA 5E6ZA 4YVPA 5HAOA 4E8CA 3R4IA 5HATA 3ICJA 4WQ6A 3V7PA 3URNA 3PNUA 1KM3A 4AZIA 5LA2A 2X1IA 4OWGA 3TSBA 4JL1A 4DXVA 1MRQA 1NDYA 1QO2A 1HL2A 3C5QA 3ZJKA 5HR6A 4V27A 5LHFA 2B7NA 1DXFA 3II1A 4GOAA 3JRKA 4Y9AA 3WLIA 1ODZA 3AJ7A 3M43A 2XN2A 4MUZA 4J3ZA 2JIWA 3LUTA 3I10A 3W2MA 5E9XA 3M4HA 3AIVA 1QFEA 2R1PA 2EG8A 3UWYA 1CBGA 2WNWA 3EWDA 4IPIA 4W7UA 2FZBA 1LORA 1J79A 3KBMA 3GG7A 1LL6A 4EANA 4HKPA 1CIUA 3VZZA 5D04C 4JTUA 3QPYA 4M8UA 4XG1A 2OVLA 2GSJA 1IEQA 5D9OA 2V5CA 1HKKA 7TIMA 1BGAA 1KTNA 1HJVA 2D24A 2WVTA 3FN9A 3BUVA 4JNMA 3NQ2A 4B4HA 2BY2A 3SRKA 1AW1A 3TZNA 1OFQA 3DG7A 1UA3A 3P81A 4HK5A 1MUMA 1ONWA 4XKYB 5BOFA 2FMOA 3ZT7A 5KSWA 1TV4A 3T40A 4H00A 2GGJA 4LRSA 1E9LA 1PDZA 3W25A 1J10A 3MP3A 3UJFA 2Z6JA 1LP6A 1OFRA 3IV8A 4U10A 1XG4A 1T6MA 5D9PA 3OLIA 4DO5A 3N17A 2OTDA 2QV5A 1F3TA 1UKOA 4N7QA 1HTIA 3PY2A 3TU9A 1M53A 4D1IA 3FXYA 3T55A 3VILA 4QTGA 4JHOA 4F0HA 1XC4A 2HPIA 4IGNA 4WGXA 5LKYA 5KZEA 3JU2A 4FR1A 1KRBC 4GACA 2HXTA 1DTNA 3KOXA 4H6QA 4YTTA 5FESA 4MJZA 4DUVA 1K7XA 3ZVIA 1CGTA 1JF6A 4HD5A 4IXHA 2HBXA 3TYCA 3AIRA 4MNLA 4UR8A 2ZXBA 4HK7A 5C70A 3CXOA 1EWDA 3H4XA 4IP5A 3EWBX 4HOZA 3WD0A 1POKA 1G1YA 2Y1HA 2PDLA 3QV6A 2VRQA 4D8LA 4XBSA 4HYVA 2XFFA 2EAWA 2VWTA 2XVLA 2CLOA 1EF3A 5FSEC 3GLCA 3RU8X 3S8HA 4XZWA 3N12A 1XLCA 1K9FA 2Y62A 1NDVA 1SGJA 4XV0A 4UTWC 3W7OA 2ISDA 3SQMA 3MP4A 3MQTA 4H41A 4D9PA 2O9TA 1PAMA 1ZPTA 3O06A 3WENA 4NSBA 1VP5A 3QHOA 4CCEA 4PGLA 2ZZ2A 2NT1A 3QR3A 5IXEA 3O1NA 5FEXA 2FZ8A 3G5EA 3CO8A 2VVNA 2UV8G 3STGA 3UGVA 4UMBA 1RAKA 4MNKA 2DSZA 1MI3A 1LLWA 1CXFA 2PS2A 3KTSA 3XIMA 4OOZA 1F73A 4QM1A 2FGBA 2HPMA 1SVDA 1Z48A 5KITA 3HMJG 3NFUA 1XSJA 2QULA 3RDKA 3FFSA 2QT3A 3QTPA 4Q8NA 1UW9A 6TIMA 3NSXA 2Y24A 1RQBA 3BAJA 4H8VA 2XGIA 3AMDA 1DJHA 4NZ1A 3ZIZA 2QCLA 4NX0A 3OIXA 3QLDA 2VEFA 4UOZA 3K8LA 4B16A 1FFRA 2ZUUA 3P3BA 2JF7A 4XD5A 3L4ZA 3BOLA 5HINA 1MUWA 1EZWA 1FUYA 1HL9A 2YPIA 3SCSA 3WQ6A 4UFMA 3L68A 2ZA2A 4PRRA 5EMKA 2W91A 5F4XA 1DPMA 3N73A 4AC1X 4KRTA 4E8DA 4GD0A 3S9YA 5DMMA 1NDWA 2VMFA 1E3ZA 1ZAIA 2YBUA 1K6WA 3OYXA 3PG8A 3GYEA 2E0PA 4O16A 4Y96A 4CQ8A 3HJEA 2Z25A 4R5EA 1XBVA 3EOUA 1ZLPA 2WZTA 5CEWA 3UYCA 1TREA 3ZS4A 1XIFA 2OLAA 4BFAA 1Z9AA 4F0KA 3VD7A 2HE5A 1PKYA 1CCWB 2E5CA 4FLQA 4HMNA 1IWBA 3W88A 3IARA 2YGYA 4NZFA 1RR2A 4B91A 3TOYA 1WQ5A 3IRDA 4ZFMA 1FP9A 5K9DA 4D8AA 4KESA 2DT1A 3H2CA 4B5VA 1E55A 3W00A 3NQ6A 3BMWA 1AQHA 4QROA 4A29A 1PZ1A 3VIJA 4GZ7A 1QNRA 1XYBA 4EPEC 3FHQA 2WSPA 1RLDA 3TFXA 2QJIA 3BAKA 1XV8A 3N2TA 2VD8A 4AIOA 4DBDA 3IJ8A 4NP7A 1R3WA 1KM5A 4JDBA 3LCIA 1J4EA 1S5TA 4S3BA 3NDOA 2ATSA 4KWVA 4V2XA 4C6CA 4W8LA 1JI1A 2PAJA 3GH5A 3QPEA 4WDTA 4XD6A 3EAUA 3HPZA 5JUVA 4MTVA 1TWSA 3U2ZA 3O6CA 1E70M 2BP1A 3TZFA 2VYOA 3ARZA 3S1GA 4O4WA 1CI1A 4PUMA 1V6UA 1EL3A 4MY9A 2X2YA 3VCCA 8TIMA 2G3IA 4J2PA 2ACRA 4LUSB 5D30A 1XIHA 1H7NA 3SCQA 2A3EA 4JNYA 1GOKA 1F5ZA 1KXTA 2PLKA 4S1FA 2XINA 2PDMA 3LPGA 3C56A 1DWAM 2C79A 2PBOA 3DOPA 1PWLA 4TO8A 3EA1A 3VNMA 3IK2A 1RPKA 2AQOA 1M3UA 2A1YA 2Y5JA 4I5UA 1WDQA 4JXCA 4Q8WA 5EBAA 3HPSA 4LS1A 1NQKA 3MO4A 3NXLA 4YVVA 2V3GA 5I77A 2FZMA 1X96A 2R14A 3FV9A 2DJXA 2V3EA 3UXAA 3W29A 1UR4A 3U57A 1QW9A 4NZ3A 3CH9A 3ITXA 5AYBA 5CBJA 1XQKA 1S39A 5HQEA 4YHEA 4JX6A 4UCGA 4Y8FA 5ABFB 1E0XA 2A7PA 5ABHA 1ISXA 1VBGA 1R3TA 3L4YA 2P10A 2WVUA 4DJFD 4FF7A 1PYMA 3GG0A 3FCPA 3HG5A 3S3GA 4CQAA 2ZRUA 2QW5A 3ARTA 4PRTA 3IJIA 1NFGA 1H61A 1X1ZA 2QR6A 2NV1A 4PC8A 2Q8LA 4WXYA 4NF7A 3CLWA 1C3FA 1EF2A 3F7JA 4GRSA 4HMCA 2CKSA 1A3XA 4Z0SA 4NAEB 1ZJBA 4ZO8A 4YIWA 3KOWA 2CBVA 3Q37A 4O0ZA 5U7SA 4JHZA 3W1XA 4XZMX 3MA8A 4N6EA 1BYAA 3TSMA 4WOQA 1VFOA 1TTQA 3G8EA 4GO9A 3CM4A 1UR3M 4V1YA 1X6UA 1YQ2A 5C5YA 2XIJA 4TOQA 1NQ6A 4JTQA 4X2RA 3U4FA 4WKFA 1B3YA 4REQA 5EFFA 1BF6A 2ZX9A 3MY9A 1U1HA 2J47A 1FWSA 3N25A 3ZM8A 3AHVA 4TX8A 1KXHA 3WG6A 4NUWA 1UA7A 3AIUA 1NOUA 3M0JA 3T4CA 3BLPX 1XDJA 2FGLA 3PAJA 5E09A 2DDXA 3ABRA 4DQWA 4XISA 3MV11 1CXLA 2PDUA 2OO0A 4J40A 3WD3A 3QV8A 2AGTA 4Q22A 1E4IA 2VL4A 1KGUA 4Z1BA 5D2XA 1K3UA 2BGSA 5E5CA 4ILSA 1YTKA 4V33A 3GNOA 1CYGA 3A47A 4C6DA 1VAHA 4F0SA 1DQUA 1NOFA 1DWIM 4XZBA 3WK0A 2PLMA 4AF0A 3QN3A 3TYZA 4RPQA 4NXSA 2DEPA 4S38A 3TNBA 3SIMA 2XDFA 1MMFA 4P61A 4WKHA 3P14A 1E6RA 2J8TA 1X7IA 2O9OA 4EAYA 3W27A 2ZXQA 5DRCA 4RKAA 3S83A 3GNPA 5C9WA 1UOZA 2QLYA 2MUCA 4GXPA 3SEPA 3TTYA 3B06A 3WDJA 1TX2A 1MXGA 3IS4A 4DLFA 3HOJA 2GJLA 2H3BA 3A23A 3O15A 4QRNA 1EJ7L 3B0YA 3UF9A 2IKGA 4ORMA 4JYDA 1KW1A 2J7GA 1UP3A 1PX4A 3TA9A 3FAXA 4M1BA 2OPJA 4Y2WA 4F3HA 5CLWA 3LRKA 4B4FA 4H83A 4FXFA 3G0SA 4DJFA 1FWJC 1KRAC 4BA0A 1W9BM 3N4AA 4RCXA 3RR4A 6ENLA 3GDMA 4A3QA 2QIWA 2HDJA 2E5BA 2NSOA 3L65A 2A79A 3IPWA 4MIMA 1L6WA 4HYRA 1GJUA 4GG9A 2Y7GA 4WZHA 4C7GA 4Q8VA 3CAQA 1US2A 2OZ0A 2PDWA 2NX3A 3P2VA 1N55A 3OEXA 1TWWA 1PV8A 2REQA 5LIWX 3AMGA 2J7FA 4PA8A 1RA0A 1TJ2A 4XB3A 4F9DA 2Z6IA 1DJXA 1QPKA 3D0CA 1B9BA 1UG6A 2FJUB 2PDCA 4P5UA 2VGIA 4FPSA 5CLTA 3O3RA 3LPOA 3R0UA 3HFYA 3PSWA 1VYPX 3T0CA 1S3TC 3PZOA 5M2FX 1DJGA 3O6AA 3BSMA 1K8XA 1ME8A 2EKGA 3KRUA 4QAIA 3DG6A 2QAPA 3ZWSA 4GJJA 1H0IA 2FH6A 2F84A 2BASA 3W81A 3GXPA 3PPGA 1EDGA 3R25A 4L6HA 4MMWA 2YYUA 2YL5A 3WMBA 2PTWA 5FAJA 3GIYA 1G4PA 3CIXA 3CUXA 3OIHA 1OC7A 3WNNA 4WSKA 3E49A 5G4EA 4FSAA 3UWZA 4DYEA 3LGDA 4AU0A 4Z08A 4Z1YA 1X8CA 2HWGA 2YCLA 1GOIA 2HNHA 1GVFA 2CLLA 3VD3A 2QCDB 3GDTA 3APTA 2X16A 1XCFA 2BBFA 3MSGA 3WLOA 3I65A 1V0NA 3BV4A 1OC6A 2B31A 2IS7A 1D7KA 1Q45A 1FH9A 4C6NA 1U1UA 2PDGA 5F4SA 1VFMA 3MUXA 3W38A 5FL0A 2EPNA 4JTCA 2OWWA 1E0UA 4H9TA 2DV0A 4OIFA 3RO6A 2BOGX 2BXZA 2YDSA 4YU1A 1HJSA 1AMYA 3M0VA 1XDLA 3OQEA 1LLOA 4ZZ9A 3DZ1A 3K46A 3CQJA 1K7FA 3HB9A 2OT0A 5LIXX 3P93A 4TTUA 4AQLA 1ZB5A 1GZ1A 1VEPA 4QLKA 3VPLA 2CLPA 4JTAA 1GVOA 2JEQA 2WK2A 1QOQA 2VHLA 2ZX7A 5DBTA 4CNUA 5EMUA 5GJNA 1Q7ZA 1XRSA 7REQA 4DYJA 2GK1B 5G2HA 1QI2A 1ITUA 1PCKA 1HKIA 3IIPA 1JZ6A 4QEEA 1F9CA 5BRPA 2DY3A 4UQ9A 3MCNA 4LALA 4AWSA 1H1ZA 2UBPC 4UTFA 1JZ5A 1K1DA 4D6GA 3R0DA 1KO0A 2ZUSA 7ODCA 1KBLA 3KBSA 3LHYA 5FJPA 1RHCA 1EJRC 3RYSA 3M41A 1W0MA 1LZOA 1FVPA 2IMRA 4UUIA 5HJYA 1Z8AA 3GC4A 1ZSXA 2CZDA 1TE6A 5EA9A 1A0DA 3WDQA 1EQCA 6XIAA 1BGGA 1NWTA 2F6UA 3BCFA 3FK4A 2A5HA 5ECUA 1J6OA 3R8HA 3LCFA 4HT3A 2NVDA 3DX5A 4NXKA 3TMLA 4G7FA 5C8BB