3LD8B

Structure of jmjd6 and fab fragments
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
217
Chain Sequence
b'DIVMTQSPSSLAVSAGEKVTMSCRSSQSLYYSGIKKNLLAWYQLKPGQSPKLLIYYASTLFTGVPDRFTGSGSGTDYTLTITSVQAEDMGQYFCQQGISNPYTFGAGTKLEIKRADAKPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLSSTLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional arginine demethylase and lysyl-hydroxylase JMJD
publication title Interaction of JMJD6 with single-stranded RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ld8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ld8B01
2VSDA 1YECH 3OX8B 4OLZH 1OHQA 1UH3A 3VCLB 4G9DB 2E7CA 1XT5A 3PV7A 1K8DA 4NJAL 5C0FB 1AXTL 1I9JH 4EUPB 3ZE2F 5KVDL 4Z95H 1IQDA 3JTTB 4KJPC 2D7PA 4XWGL 4PJHE 2DLFH 1LVEA 2RHEA 1U3HC 5GGQL 2R0WH 2XPGA 3RPIA 4JQIH 1QRNA 3AROA 3DROA 5CWSB 2F74A 1DLFL 4MAYD 4ERSH 1RIHL 1LO3L 2BHYA 2BNRB 1U8KB 4G3YH 1MHPH 2ILLA 4ZNEA 3P11L 1X4ZA 2NY2B 5GS2H 3NZ8B 1T5XB 3UJTH 3O2DL 5CEXB 2FX9H 3U46B 4DKFH 4F2MB 3ZHDA 4QWWD 3BPOC 5I1CL 4BZYA 1JV5B 1ZLUH 4M4RA 5IW6A 32C2B 5AYUL 5GGUA 4HKJB 4G6KL 5ISZD 2D31B 3DI3B 1QD0A 1WZMA 2FNBA 2NY3C 4RRPG 3WN5A 1BWWA 2C3XA 3EYSL 5CP3A 3T0BA 3D18A 3IGAA 2VITA 1KN4H 4P23B 2A73A 3MRCB 2E7LC 1NAMH 3B5HA 1GGBL 3OR6A 4HT1H 4DWHA 1A9EA 2WWKT 2VL5B 3DMMC 4LCWD 1A2YB 4X9GA 3CCHA 1C5BL 3RWDA 5HHNA 3RU8H 1HHGB 3A67H 2YA1A 4KJQD 1INQB 1FVDA 1NDGA 1Q0YL 3JUZA 1H9VA 5HHQB 5EBGA 4OCXL 2P5WA 1Q38A 4XPTL 3QNXB 4WUUA 5I1HL 1CE6B 5HHOA 5SX5K 4G6FD 5AYQA 2Q8AH 2VXVL 5EN2A 1TMCB 2WUBL 3KNBA 4W4OA 1QSZA 5ALBH 3VXMB 3HI1A 2PNDA 3JWDL 4HXBH 3RUGB 3RY4A 3SKOB 3FO0L 1MUJA 2Z4QB 2MNUA 1V3MA 3CU7A 4WWKA 2FX7H 2V9TA 1T20A 1UWXH 2BMKB 2OTUA 3QNZA 1EJOH 3WHE0 2YD9A 5SWSB 4J4PC 4MNGA 5MENE 4G8FB 4CW1A 2IBZY 2PYFB 2VLKA 4WI6A 4HPOH 4NPYA 4OV5B 3BSZH 2J6EH 4LSVL 2CK0L 4YHPA 4TOYL 4OQ1A 1NC2B 3HE7D 3MCG1 1T1ZB 3PP4L 1T4KA 3P4OA 3QDGA 1OGTA 1ACYL 1WIUA 4JRYB 1CI5A 3UTTD 5DRWA 4XPAH 2BVEA 5ID1B 3CLEH 4AK1A 2AJXL 4V1DD 2A74A 3ZE0E 5IMOB 1HSAB 5HVGB 3QISA 2YOCA 3JWOC 3N1GC 3CLFH 3P0VL 1P5VA 3VFOA 3FFCE 3VRIA 1A7OL 1S7TA 2FIRT 3DBXB 3MYJB 3V4UL 3NH7L 2H2SD 4BFEA 4N5EC 2Q8BH 3PWVB 5I8CB 3N9GL 1QOKA 5SV3A 2IGFH 4PV9B 4R9HA 5LBSL 4MJIB 1XR8B 4GAGL 2H1PH 2DDQH 3IDYC 5C7XH 3C5SB 3GSWB 1NCNA 1QLEL 1RZFH 3PGDA 2FX8H 5F6HI 1EHXA 3CDGA 4YAQA 5GRYA 2CRMA 5FA4B 1O5DT 5DO2D 3BWAA 4XBGA 4NZDA 4ZSOA 2DF3A 4O02L 1R3HA 2VN4A 5H8DA 2DMCA 1MCEA 5JW5A 5CZVH 5DS8A 3CX5K 5T33H 3U0PA 1J1OL 1SVZA 3PWPE 2MKWA 3QEHB 2P8PA 1WWCA 4HS6B 4JO2H 3QEQE 4JANB 4MA7L 3P9LB 4P5MB 2DQJH 1NMBL 3KPSD 2FJGB 4JM2C 3UCRA 3VXUB 4JN1H 3C6LA 4GH7B 4GAYA 1V7ML 3EGSB 2QQNH 4U1SA 3TYGH 1RU9H 2D7TH 1MFBL 4IRSA 4G43A 2BXYA 3PUCA 2HTKD 1P7HL 3T0DA 1SYSB 3IJYA 1AH1A 1DQLL 2BP3A 2PN5A 2AK4D 2BVOB 1ZA6B 4ORGB 4RAUB 3VXSE 1T89C 4OUUA 4NFCA 3NACL 2J3SA 3HCVB 2HH0H 3CC5A 1JZ7A 1LMKA 4F9PA 4FFZL 4ZD3L 5EU6E 2ZKHL 3RVXC 3BPNB 1ZS8A 3VH8G 4QXTB 5L88L 3RDTC 3HC4H 3HPJA 3ZE1E 1RZKH 3QUML 1D9KA 5FYLD 1OAQH 2W38A 4M48H 2VYRE 1OLLA 2B5IC 1TETH 4PJ5D 1ONQA 1I7UB 4HQQH 4E5XB 5C0EB 4IJ3C 3GI9L 1H8NA 2OCFD 2B4CH 2WINB 4I77H 1MELA 2DQFB 3RQ3A 1JNNH 4MDIB 5IT2L 5C08A 1DFBL 1Y0LA 4L3EA 5INDA 5K93A 3OKEA 3QIWA 4JFEA 1KB9K 2BOCB 3TH3T 1MFAH 3K7UA 5CS7A 5EZJB 4M03A 5IVXF 3BE1H 2Q6WB 3Q3GA 3BZ4B 5E6YA 4LAQH 3ES6B 5DQ9B 4XPHH 4QLRA 4JFFD 2H6PA 2NY5L 3O3BB 2NY1B 2XQYK 1IRAY 2QADD 4XP4H 2IPTH 5I18H 1JPFA 5JDSA 1UM4L 5LGHH 4QRSA 3L7EA 1FVEA 5DD0L 2DQHL 4Y4HA 1JUFB 4FNLH 1T83A 4NRZB 1DANU 3MRHA 1W0VA 3RNQB 3MLZH 5JMRA 3W9EA 1U8MB 2A9NL 2YBRA 2L0DA 3V6OE 4HMEA 1RUKH 3ZYIA 3QUYC 5HDQL 4LCCC 2CLZB 4LLQB 5FUCC 3G08B 3PV6B 3U9UA 4K7PL 3UX9B 3QUXC 5FKPB 3W39A 3DV6B 3AAZB 1GOGA 1J1XH 3BVNA 3KLSA 2I07A 1MCQA 3CFIC 3T0EE 2BJMH 5L8LB 1PKQA 3JZ7A 1ZKAA 1BEYL 1TJIL 2YPLB 1JZ5A 1CDYA 1CK0H 1GGTA 2P8LA 3SCMB 3GMOA 1OAYL 3H9SB 1ZEAL 4AIZB 3MUGA 1FPTL 3FQRA 1CT8B 1TZIB 1ZHBB 1J5OH 4NKOB 4UOW0 3IS0X 3CIQA 4HKZB 3WLWC 3PF2A 4WI5A 3R1GL 1VB9A 5DFTA 2F58H 3RZCD 4K71C 1KELL 4KTDL 4PP2A 5HYSA 5JHDE 4X6FA 1NFDE 4EN3A 1T2XA 4X6BB 1ZVYA 4QHLB 3DYOA 3C2SA 4OM1H 5KSUA 1FC2D 3KYNA 2ZSWB 3EIFA 3I9GH 3REWA 2QEJA 1G0YR 1T0MB 2EC8A 4QXUL 2IAMB 1BZ7A 2BVQB 1WTGT 4LLAA 5JA8B 4XXDA 2X42A 3WS3A 4GKNB 4I48A 2W0KA 4KHTH 4PG2A 2VLRB 3RKPA 1CF8L 2XN9B 4HGKC 3PDOA 1HKFA 4N68A 3QDME 1I3RA 1I85C 1VPOL 2P5EA 1UCBH 3RTQB 3LIZH 4OD2A 4PJHF 5F8QC 4U3CA 1SM3H 2NY0C 3BAEL 4JZNB 3ZKXC 1A7RL 1V7NH 8CGTA 5GHWH 1S3KL 2HVKA 2CIIB 4YXKH 3THML 3S88H 4WO4A 3PP3K 4TNVK 1MJUH 2Z31A 5GQBA 2GK0B 4ZFZB 3IVKB 3AU1B 3QXAB 3OKLA 4M62H 2PO6B 1PSKH 4X0KA 4P5TB 4QT5B 1NCCH 5BS0B 3FN3A 4Q9RL 1A3LL 2ITCB 1DDHA 2PR4L 1LE9A 4R2GB 1U2CA 4OV6F 4EXPX 1E6OL 3QR2A 4MA3A 1RUQH 3MRPA 1A47A 2E9BA 4Y5XA 4OQTH 1S7VB 4U6VH 3D85D 4PRHD 5LQBH 4X6DE 1VFAB 2GJZB 5EBWA 4URTB 3WHXB 4UIMB 5CGTA 3CXHJ 5BOZG 1Y6NR 3WXVH 3IXTB 4ODVH 3PDDA 2KL6A 2YRPA 3Q6GL 2X10A 1JF1B 4YHMH 2X9WA 1IT9H 4FN0A 1IBGL 3ULVD 5IROC 3L5XL 3DURB 4QOKE 4LEXH 5F9WB 4HKXA 2HT2D 4Y4FB 3LH2L 3X3GL 5FDWB 3MBEB 4Z18A 5J12B 5C8JB 3HNSH 5CSZA 3LD8C 3F58H 2DB8A 4LRIC 5KVGH 1YDPB 2R0ZL 4B7LA 4BYHA 1YPZB 2VDLH 3VXME 4LHUD 2GSIB 5HYQA 3QP3A 4N1CA 2PXYC 5H35B 4APQB 1B6DA 1R6VA 2HP4A 5F3BB 4HIXL 1UB6A 1U8NB 2H9GB 3GJFK 5F9OL 5SWSE 5EU3A 5E8EB 1NL0H 1A6TA 4NUGL 5DJYB 3TCLA 1BOGA 2X89D 4LBEB 1P1ZA 3BRFA 1XMWA 1H3UA 3MLRL 3BUTA 1GAFH 4J8RA 1PX4A 3D6GA 4LSQL 1UZ6E 4OLYH 3CMOH 3DYMA 2OP4L 4P9HH 5C0ND 1E4WL 2QR0B 3TFKD 5TF1L 4UDTB 3MUHL 4U1HA 4P2OC 2YWZA 3WL9B 3TJHC 5DQDH 1HSBB 4TUOB 2D3VA 1H8OA 4OCYH 1Q9LB 3H7BA 4KXZI 4IRZL 1IKNA 3VFSA 2DS4A 3LN5A 4Z7WE 3H9HB 1SJXA 1PJ9A 1BD2D 4HHAB 3FB6B 4ZOBA 2Z93B 3WXWL 3C5ZB 4ENEC 4WI8A 5E95B 3MOAH 4KROC 3UBXI 3FOMB 4PJBA 4MJIE 5C0RL 1A1NA 2BC4A 2CO6B 4WFEE 4JDTL 4XP5H 2EDLA 3KXFA 5T1DH 4OLVH 3PJSA 5I1DA 3O9WA 2WBWB 4K3JL 3MLYL 1MFCH 3UO1L 43C9A 5IHZA 3QPXH 3GSOB 4R7DA 4S1DD 4KMLB 4JQXA 4PV8B 4EQ3A 1AFVH 2I9TA 1MI5E 4LLYB 4YUEL 1TCRB 3QIUA 4F57H 4BH8A 2XZCL 3U4EA 1T5WB 3QCUH 4FZ8H 4W6WB 3PWJA 3HZKA 2DRUA 5GS3A 3W11C 4Y4KC 1D5IL 1HXYB 4MAYB 4S1QL 5J6GB 5BQ7A 4NJAH 4H20H 3EW3B 1OP9A 5TPWH 5KVDH 1UB5A 4C58B 1LO4L 1CFSA 2B39A 1YMMA 1J0HA 3CNKA 3VXUE 1CBVL 1D6EB 2C7UB 3R4DA 4N1HB 2BOBA 2F53A 4UT6H 4JCMA 1JGDA 4XH2B 3VGEA 1LO3H 4E41E 2O93L 1QVOA 3UBXA 4NYLB 1MRCL 5ISZB 2GCYA 1AQDB 5HDBF 4LGSB 4QY8A 4RZCA 4Y1AE 3G5XB 5C6PB 2BFVL 2IQAA 5GZND 4CU8A 2X4PB 3UZVB 5CJXC 2AEPH 4QF1A 3CFCL 4KHXH 4OF3A 4DGVH 4LCWB 2NR6C 5GGRY 5CBEA 4HULB 4UTAH 3FFDA 1E4JA 1FLRL 1RZGB 1V3LA 3UDWA 1BM3L 2D0HA 5CP7A 1DUYA 3ABZA 4CUCA 1DTUA 2IMMA 3S3JA 1JYXA 4K8RD 4YWGL 1U91B 2VUYA 4M7JH 5T5FL 4G6FB 1CD9B 1PX3A 1KIQB 3O4OC 3TJEH 4L4VE 1AGCA 3BKJL 4BH7A 1HOCB 3QCVL 3VFMB 4PTUB 1IC5H 3KPRA 3FZUC 4GXVH 3SKMB 1PD6A 4R97C 3AMKA 4RQQB 4NQDA 3CSYA 5DD5H 4OD1L 2X4SA 4NN5C 2ZJSH 1DVFC 4W68A 1QR4A 2NX5E 4LPCA 1TFHA 3IF1A 4LEOA 1FFQA 1IGTA 3HE7B 2QJDA 4R3SA 5FOJA 4TSBH 3UTTB 1U8HA 1WT5C 1DQQA 3U0TA 3HC3H 4V1DB 4ZQKA 1FO0H 1N6VA 2X4RA 5GGTL 1R3KB 2OL3L 4TOYH 2FLRT 1Z2KA 2PW1B 3IU4L 1ACYH 5FYJL 3QWQB 1A6PA 1LDPL 1UM6L 1ZHNB 1CGVA 3SGDI 2R4RL 3HHRB 5MP6L 2EE6A 1WZLA 2VLJA 1I1FB 2XACC 1XGUB 5E6IB 4DOHE 1T1WB 1JYVA 4ODHL 4OLEA 2K3TA 4WV1B 5IEKA 1A5FL 2DQTH 2AEWA 1GYAA 4KZDL 2AW2A 5L7XL 3MRKB 1FFOA 2R69L 4NUJA 3ARDC 2FR4B 1HHIA 3ARGC 3W5NA 3AY4A 2HVJA 4L3AA 4N8VA 4F3FB 2VAAB 4IBLT 4JHWH 3TV3L 4EIZC 4GMTL 4XVSL 3BW9A 4QRTB 4X4XA 1NFDF 1G9EA 5CIPB 3TBYB 2EYTA 1QBLH 3SE4C 2M1KA 1L7IH 5FYJE 2UWEA 5C0AA 4MWFA 5I8EA 3LRSA 3KPSB 3ECBA 4O02H 5J6HA 3P9WB 2OR9H 4Z5RA 4BZ2L 3L5WB 4KUCF 1ZSDB 4PJFA 4IOIB 4UAOC 4LU5L 4R6UA 2Y7QA 2ENYA 5EBMB 4JO3H 1OB1B 2AK4B 4MA7H 4F7TB 2AK1L 4R8WH 2Z91A 4R26H 2VLRE 1JI2A 2XN9E 4LPXA 5HPMB 4MGXA 5IQ9A 1C08B 1CGSL 1V7MH 3WE6B 2IH3A 3RPKA 4J3WA 4H26B 4NQCA 5ALCH 3KG5A 2VDQL 2EEAA 2IANE 3NPZB 5KAQF 4PG9B 4J6RH 1A7PL 4P3CL 3T77A 4P9ML 3S36L 4PJ5B 3MV11 4JCLA 5B21A 4HKBA 5EIQA 2FGWL 3MRDB 4NO2A 1DQJB 3VW3L 2XNAA 4M4PA 4MD4A 4ELKB 4XHQA 3LEVH 3JSSA 1QSVA 2F5BL 4X6DF 5MEQB 5DQJB 4HUWA 4RCAA 1EZVY 1KNOA 5C07A 1Z9LA 2A77H 4OKVB 1J1PL 1S7UB 4G7VL 3X12B 3VFNA 2NYYD 2X4TA 4GKOA 5SWZD 1QSFE 4JFFB 5TF0A 2AV1B 4BSJA 5IB2B 5TQ0L 1ETZA 5JUEH 2HAZA 2QADB 35C8L 3L3IB 3O6FC 4H5SB 3ZMRA 1XGTA 1JMZA 4NSKB 3G6JE 4KQ4H 5ESVB 2P47B 3IDJB 4OCRL 1NBZA 4NQXA 3MRJB 5KS9B 1QSEA 3BH8A 1DQML 1IM3B 1GVIA 3TVMC 3VWJD 5BZWA 4UOJA 2DQHH 2C3VB 5FEBA 4KI1A 4Z0BL 1KF9B 5JZ7D 1XZ0B 1JRHI 5A40E 1YPZE 4K3GA 1TZHB 4PJ8C 4GRLC 4A6YA 1U3HA 5CINH 5J9PA 4KRLB 1A6ZA 2XWTB 3CFKB 2V5RA 1ULVA 4HWBA 1FNHA 1DANT 2KZWA 2E3VA 2FATL 4JG0H 3P30L 5L6YL 4RGND 5KW9H 1RJZA 4YBHA 3WIIH 1A0QH 2N7AA 3CX2A 2ED9A 3T0XA 4HJJH 3S35L 3ZKNC 2HG5A 3EOBA 1UZ6F 3HLAA 1C7SA 3L1OL 4ZMAT 5HD8D 4KY1H 5L8JB 1OF2A 3EO0A 3HB3D 1EHAA 1RURL 2C1PA 4O2FB 5DVOA 3NZHH 1YEEL 5IJVB 2ZCKL 1KB5H 4NJ9H 3DRTA 3RZCB 3HAEG 1SJHB 3LRHA 5E6ZA 5I9QC 4Z7WF 2CGRL 1JNHA 3HG1E 2B1AL 3BT2L 1RK0B 1ZLVH 1BQSA 4U05A 3ARBD 4NQEA 5MEPB 1GIGL 2D03H 1XF5A 1WWBX 2AABL 1K4CA 4JVWA 3WDJA 5FM5O 5JOPD 3M17A 2HT3D 3BXNA 1QRKA 5A2IH 5JQ6H 1T04B 1E27A 2I60H 4XZUB 1T66D 1DEDA 2V7HB 3MRLA 4IM8A 3BQUC 1QFPA 2IFFL 3V79C 3LZFL 3WFBL 5D7IA 2CXKA 4G80A 5B3NA 2P43B 1G7MB 4CU7A 4WW2A 1AKJA 1K3ZA 5DMKA 1JPGA 2EDKA 5FYJU 4FS0A 4EOWL 5JR1H 3CFEB 3U79A 3H9YA 3IDXH 3FCTA 4AT6A 3ILQD 4OF7A 1VPOH 1A6UH 1PG7L 1BJMA 2YA2A 2MQ3A 2VDPL 3TBSB 2BVTA 5ANMB 4DKEL 4BK5A 3RP1A 3TESA 3KYAA 3PNWB 3PWUB 3BD4A 1AXIB 1ND0B 5IW1A 3U36A 3ULSA 4ONHB 3D1MC 1G7IB 4YBQD 3D85B 4PRHB 4KKLC 4LKCB 5F9DC 2YD1A 3I2CL 1NGZA 4P4KD 3T0EC 5B39A 3TIEB 1A3LH 4ZTPH 3FQXB 2NY5C 4Z7UE 4ZODA 3KYMA 1DN2A 4BSVA 4NQVB 3SDDD 4LSPL 2N56A 5EH1A 5IOPA 4XT1C 3LCYA 5AEAA 3MO1B 1ZGLM 1RIUL 5DHYB 4RWYH 2A6KB 2R2CA 5C09E 1B4JL 1FCGA 3C6SB 3NFPA 3QJHB 4YEEA 2UYLB 1UKQA 3EDJA 1H3VA 2NXYC 3C9NA 2J8UE 4G6JH 4Y5YC 1LE5A 2H41A 4JVUA 1C5CH 2XQBL 4UNUA 1F6AA 1NGYA 3BZDA 4JJ5A 4LHUB 5DHVB 1CD1A 3V52L 3FO9A 1T7WA 4NNYB 3LH2H 3O4LD 2DTSA 2YN3A 5GJTH 1YUHA 3MXWL 3BGMB 3MJ8B 2IPKB 5FV2A 2XWBA 1G7QB 3EO1B 5J0BA 5I76B 1RULH 4WNQB 5FO9B 3K1KC 2JKXA 3EHBD 4NT6A 4PJCE 4X4ZA 5E2WL 4NP4H 4WDIA 2NW3A 1DN0A 4C55A 5I73B 3GMQA 1A3RL 3OZ9H 5IFHH 1OGAA 4XRCA 3FRPG 1D5ZA 1T0NB 1NSNH 2W91A 3LS4H 3IFNL 4CMMB 1QBMH 3SDXB 4DZ8B 4KQ3L 1IC7L 3DX6B 2AJSH 4HMCA 3FTGB 3IFLL 5EOQH 3BKML 5D7LA 4X7SL 1T89A 3L3HB 3RVTC 1TZGH 4JB9L 2EDTA 2PCPB 2V2WA 1RY7B 1BD2B 4Q0XL 1S9XA 3FHAA 1JBJA 4M7LH 2NY2C 1QA9A 4P3WA 5E8NB 1Y6KR 3RDTA 3C08L 3MV7A 2FBJH 3F7PC 3B8SA 4I3RH 1M6OB 2GJ6E 3OJ2C 4KVNH 1KTDA 5DK2A 4DGYL 5DJ6B 5GJSH 3P2TA 3GNMH 4I0PC 1BIIB 4YLQT 2AQ3A 1CIDA 1Q94B 5F9AC 2V2XA 2HRPL 1TPXB 5E8DH 4U1IA 4MJ6B 1PFCA 3H0TB 1A3QA 1IC4L 3UYRL 3T0WA 5LWYH 3OPZL 4O51B 1ORQB 1YNKL 3OHXB 5BV7B 1KJ3H 1CDUA 5DC4B 1AGEA 4K3JH 4UV4H 2E6PA 4I18B 3VXTA 4D0BA 3TBWB 1CS6A 3FMGL 1S9YB 4NDMB 4P5KA 2GTWB 2ARJQ 3O3EB 2OJZL 4Q6IB 1R24A 3SPVB 1ZLWH 3TT1L 5HY9B 1F8TL 2WBJD 3GO1L 4NZUH 3LQAH 3GMRB 1NUNB 1ZWIB 3CVHA 4OZFA 2AI0L 4UB0L 3TN0D 1XCTA 4ZOEA 1TQCB 4ETQA 5C0BD 3DOSA 3K8MA 4HDIB 3QUYA 4YGAB 3O45B 3I75B 4LCCA 2X70A 1X5AA 3ULUD 2DMKA 4ODTL 5GRJH 1UWEL 3QUXA 4YO0A 2ZUVA 4K94C 4PGCB 3MV8D 5I1IL 4JM4H 5DJ0A 5I0DA 2X4OA 4WEMB 2BVPB 2W65A 1UCTA 2R56L 2C26A 2MQCA 4N90E 4PJ5E 1MEXL 4Q97A 2KH2B 3IDMB 1AP2B 3BKYH 3CDYA 3VFWB 2Z8WC 1RUPL 1MOEA 4JRXA 3N1PC 5CKGA 4POYA 4LHUG 3VXOA 2Q7YA 1H15A 3IXAA 1PLGL 1CFNB 3IJSB 2XKNB 5T5FH 3Q1SL 3L5JA 4FQ2H 3LKSA 1F3JB 1N4XH 1DE4A 4JFPB 2DQCL 4JFXB 1B2WL 3BH9A 3BMVA 1UM5L 4JFFE 3DX9B 4PLJC 5T5NG 4K9EL 3OL2A 1AR2A 3G6JF 4TUJB 3GK8L 3GRWA 4MJ2A 3WFDL 1KCKA 5FA3B 2EXYC 4XVTL 1I8MB 4UTBL 2YHGA 4YE4L 1MIML 2DL9A 1U8PA 5CUSL 3MLUL 1JVKA 5HDOA 2QQQA 3FB8B 1Y18A 1U36A 2OM5A 2VDRH 1I85A 3LKPA 3REVB 5C1MB 2YR3A 1KJMA 4WVRA 4U6HA 1K6QL 4Q74A 5B4MD 4HS8L 5JPMB 4JN2A 5MEOA 1BQUA 5TE4H 4KU1A 4X98A 1SY6A 4UDUA 2E27L 4KPHL 3I6KA 3STLB 2E6JA 2J4WL 5FYJH 4MX7B 4YNYB 1D6VH 2CDFA 2XIDA 3C2AL 1FN4B 2XWJB 3KWWB 2B2XH 5HHPB 5TE6L 2R0LH 2FO4B 3BMWA 3HMXA 3IRZA 4FTVA 4D3CL 3LEYL 1BAFH 5HI5C 5MP6H 3BP5B 3MRNA 4OZFH 4KK6C 1QHOA 2D9CA 1B0RA 2V7NB 4OZGE 1PQZB 4ODHH 5FOBA 3FQUB 4LSUL 5AZ2L 4OZIE 3BPNC 3HZVA 1EO8H 1RJYB 3EYUL 4I2XA 3B83A 4UT9H 4UU9A 1MIEH 3RBGA 3RWCB 2A0LC 3W0WA 1MHEA 3P9MB 4RMRA 3ZL4L 1C5DA 4PJXB 1ZHLB 1X5HA 4OIIL 4JKWA 4LASL 4MS8C 5I8OH 1XF4B 3LKQB 3GI8L 2G5BA 5GS0C 2W9DH 4GMTH 2PYED 5D9SB 5IROA 5E0QA 4NQSA 5TGBA 4JJHA 4IMKA 1ED3A 4F7MB 3W9DB 1EDQA 3BIBX 3MGAA 3WIFB 5I16A 4ODWB 3FN0L 2AGJH 4LRIA 4FP8H 4XNYH 1A4KB 3QNYA 4YDVA 1G0XA 2X7LA 2PXYA 1T6WA 3TC9A 2NY1C 4LLWA 1YY9C 5IHUL 3IKCA 4LP4A 3U30B 3DXAE 4TTDC 2W1NA 3QG7H 4OGXL 3PGFH 4NNXB 3ULVL 1VACB 3NN8A 1CFTA 4AENA 3CDCA 4HV8A 5T3ZD 3QCTH 4ZUVA 3GRWH 2ZUQB 4JFZL 3KPNA 4CAGA 3Q2CA 1E6JL 3SO5A 4M7LT 2AV7B 5JXEC 1CE1L 3ET9F 4H88H 1Z0NA 2PTTB 1AHWB 1U92B 3JVGA 4HWZB 4J4PD 3S36H 1Q72H 5JXAL 2WQ8A 2WIIB 4OFVA 1LP9B 4JAMB 1CLZH 3I84A 3L9RA 4Z7UF 5SWZB 4H0HB 5AWNH 1SBSL 4NWTH 5DD6B 1INDH 1QHPA 4U6YA 2LE9A 1NEZA 2IQ9L 3L3OA 4Q9BA 4QRRA 4QRPA 2OR8A 4XPBL 5E2TL 3SCMC 2DAVA 3IFOB 4QGTA 4JPKL 3EKCA 4X6CE 4JPVL 2ADIA 1SY6H 2W60B 3VJ6B 3RVWD 5JW4N 3ULVE 3V4PL 4PUBH 3E0GA 2QKIA 3D2UD 3HMXH 3OXRA 2J8UF 5TQ0H 3V0AC 1NH6A 3OKMB 2XG5A 3BHBB 5E8PA 3VWJB 1OAXH 2UY6A 2Y5TB 3K81A 4XWOD 5JORB 4PS4L 3M07A 2ZUWA 1L6ZA 1JGVL 4RAVB 4DKAA 3DGGB 5T1LD 1J11A 3ARPA 4B50A 3D0LA 4NKQB 1M7IB 4L5FL 4EDWL 5CEZD 1P4IH 4IOFD 2FD6H 2ARJB 3GMNA 2IAMC 1EPFA 3QDJD 43CAB 1OM3L 4XCEB 1MPAH 3QO1A 1OCWH 5DDHB 3ZKMC 4RGNB 5EORL 1Z5LB 3MTRA 4PJCF 3I85A 2I5YL 4NHCL 5DRZA 4Z0BH 4NM8H 4KTEL 5FV1L 1KEMH 5DMJB 3DO7B 2YEZA 4U1MA 5H2BA 3SE9L 1RZIA 5GS2D 3RTQC 4R4ND 1NCDL 4U7KA 1YEKL 5D6DC 3QRFM 4L8DA 5D2LA 4MVBD 5C92A 2JCCA 3P30H 4KFZC 4L4TA 5DJCA 1KCSL 2YUXA 4Z7VE 4IIQB 3QXDB 4PGEB 3S35H 2Q86B 4MXVE 5GZOD 1LO5A 4M5YL 1EBPA 4NRXA 4PP1D 5EBLA 5DMIL 5E99L 2PO6C 1EEYA 5LAXA 4LSRL 4P5TC 4QXGL 4HK0B 5DD1L 5EO9A 3ARBB 2XQYG 1RZJL 2HWZH 3TO4D 3E6FA 1P9MC 5GSRB 1A9BA 1WBXB 3GKWL 1TNNA 2HLAB 1AO7D 1X44A 4R2GC 4FQXD 5CCKL 4EJ1C 1UXSB 2A6IA 5KJRL 2APVA 3G6DL 1NBYB 1OAUL 3L95A 2IBZX 4GW5A 3NABL 2OJEB 3X11B 1OQXA 1W72B 4PTTB 1NDMA 2F19H 4JZOA 4MQTB 4BFBD 5D1QD 1GIGH 4CDGC 4HLJA 5E70A 3VFTA 2R1WB 2W0FB 4GRWB 1Z0MA 5SWQA 4TNWF 2MCG1 4PRIE 5F1IB 1T2QH 2BSED 4YDLB 4I0CC 4GW1B 5IMKA 3BN9C 1DVFA 2IFFH 1L9NA 5SX4H 3FO1B 3GJFB 5F9WC 4U1NB 4FABH 4Y4FC 3MBEC 3TBVB 4MNHA 5J12C 4YIQA 1OLZA 4X4YA 1DBAH 1Q9KB 2L7JA 3T0AA 5IVZA 1WT5A 3VG9B 5B38A 3OAYK 2AP2A 3MA7B 1P6FA 2DQGL 3MMEA 4XBPA 3IDGB 1N6QL 1ZHKB 2QQLL 5E2UL 5IBLD 2AKRA 5E94A 4APQC 2C4XA 2VKXA 4F7PB 4P4KB 5I19L 1VADA 2MHAA 2AQ2A 1R5IB 4I4WA 1MAML 4DKEH 3SJVE 3DNKA 1WIPA 3MRIA 1EMTH 1FL5A 1NCBL 5HXMA 1M05B 1I3VA 4KVCH 3LSOB 3GSNH 3FAXA 3SDDB 4BK4A 3DYPA 3FQTB 4PPTA 1T6VN 4KMTL 3Q5OA 1EAPB 1KACB 2UZXB 4C57C 4YHKL 4ZYKB 1UVQB 2P1YA 4S1RH 1ZANL 4KK8D 3WD5L 2DYPA 4GKZB 1IGFH 4GQ9L 3D25A 4WHCA 4AM0A 5I15L 3ARDA 5ITFB 1NFIB 4AEIH 1BQLL 3ARGA 3DUSB 3DUUB 5EUOA 2MOVA 3MRMB 4L29B 4HIEA 1WAAA 3PQYD 5GS1B 1Q1JH 3L3GA 1YEHL 5H94A 5DD3L 2CLRA 1P53A 2R2HA 4XNXL 3OJMB 5DYOB 3O4LB 5FK9B 1ITCA 4PRBB 5GISH 5IB1A 2EDYA 3C5ZC 3ALXA 4F7EB 3GSXA 3QFJD 5BCAA 2F54A 1EFXD 3SE4A 2XQBH 1UC6A 3H42H 1BVLA 1GZQA 1OD9A 2F9BT 5ILTL 3ZYZA 4XHJD 4ONOA 4LHJB 5LVEA 3RGVD 12E8H 1RMFL 5ETUA 3J7HA 5IGXL 5IESH 4P2QA 3CFJB 3RWEA 4A2MA 1CVSC 1GOFA 4WUUD 5AAWA 3PHQB 5E2WH 4PBVC 4WHTA 2GITB 3LQZB 4MAYC 1N0XL 1BF8A 3LPGA 3KHOA 2AJZA 4O4YH 1JTTA 3WV0A 1HKLH 5FFLA 3G04A 4LKXA 1IC7H 5EC2B 3D0VA 2BRRL 3ZDYF 1V05A 1KENL 5HGHB 2I9LB 1NUFA 4QWWC 3RNKA 3G5VB 3BIAX 4DVBB 4NIKB 4EI5D 4JY6A 4M43L 3CZFA 2A6DB 2NY7L 3QHFH 4DAGL 3NIGE 1EHLL 1KJ2L 1FZOB 3KPLB 3UROR 1DEEA 4X5LA 3WS6C 4CVZA 4OZHA 4PJIE 3T8XA 5DUBB 4OZGF 4OB5L 1KC5H 3PABA 5DVMA 4OZIF 3GMMA 4F58L 4F7CA 4LCYB 1BX2B 5CD3A 2AXGA 4G9FE 3UTQB 3ZSTA 4NO0A 2P24A 1ES0A 4KJQC 2F8VA 5IK3A 1OARL 3EDKA 3MA9L 4G5ZH 3ZTNL 3K4AA 3QI9D 4ODUA 1EXUA 2DL2A 4PJXE 3V5DA 1FE8L 2V9QA 4ODBD 3O6FA 3WUWA 4K2UL 3UYRH 2R0KH 4RFNB 3UTSA 3KDMB 3PGCA 5BZDB 1JZ8A 4NBXB 1CZ8H 3HI5L 1OSPH 2GSGA 3G6AA 4KC3B 2WBJB 4ONGL 3RY6C 2QSCL 3VD4A 4YR6B 3CD4A 4N9GB 2ERJB 4M3JA 5T3XL 5J8OA 1U93B 3VXRA 5D2NA 3TN0B 4Z78A 2ENSA 2J12B 3TVMA 4P2RA 3QHTC 5C0BB 2BVYA 1G6RA 4LLUB 4PD4K 5DC0A 2H8PA 2O61B 4X80L 1NBQA 2OJZH 1OD7A 4KMQA 5DT1H 5HYJD 4Y89A 5KSBF 4JO1H 5D5MB 3S5LA 2EDBA 3QWOB 1A6AB 4PJ8A 3QULB 3GO1H 4GRLA 4PGBA 3HR5B 4KGLA 2CPCA 1F4YH 3MV8B 4U1JA 4UB0H 3RWFA 3LV3B 4RGOL 3IDNB 3UBXG 3HE7C 4BSWB 3EO9H 5A2JH 4YDIL 4N0FA 4Z77B 1FC1A 2F8XC 3F8UB 2YRLA 1SEBB 5CGMA 1EEUA 4DK3A 3MXVH 2AJUL 5A43C 2ZG3A 1U8OB 5I1IH 5K33A 1HEZB 4TULL 4MNQD 2H2SC 3MRBA 3QXTA 4ORZC 5ENWB 5AG8A 4TRPH 1HH6B 5FO7A 2R56H 1FZJA 5D72H 1JWUA 4NQUA 5T3XE 2CQVA 4YDJB 3MUY1 1F58L 1LP9E 5E6IC 4NCC2 5SWZE 1VEMA 5IB4B 1FFPB 3IFPB 4X6CF 2RB8A 3JV6A 5F7NC 4WV1C 3VXNB 4LOUD 3FQNA 3STZA 3PIQB 1AY1L 5LXGH 3ULVF 5DRNB 1PDKA 3HUJB 5DO2C 2VXQL 1HNGA 4W70A 4I3GA 3UJIL 4PR5A 2G9HB 3D87B 1DZBA 4Y19D 1AJ7L 3BQUA 3GK8H 4RRPA 1ORSA 2J88H 1RSFA 2Q87A 5FM8A 2HJFB 1H3GA 4C56A 4OTXH 5GRWA 4QTIL 4XVTH 5C08D 4UTBH 4D94A 5DSCB 4NHUA 4F33B 1H8SA 5C2BH 1I3GH 4MZ2A 5IKCA 5ADOH 4JFED 4FXKB 3T2QA 1A6VL 1ZV5A 4YXHL 4X6EA 2BHUA 5DVLA 3ROOB 4MDJB 1P7QD 3QUMA 5ABDE 4PJGB 3BZEA 2VDOL 3KS0H 3IYLW 4HJGA 2HTKC 5D7JA 4RGNE 3B9AA 2ZCHL 2WP3T 1FH5H 2B0SH 3MV9A 1W72L 1M71B 1P7KB 4N8CL 4LSDA 3DVGB 1NJ9A 3LEXB 5TDPB 1KJVA 4QHNA 2OSLB 3U4BL 4JHZA 2VWEC 2Z92B 5EO0B 4PREB 4Z7VF 1MLBB 1HQ4B 4NO3A 2RQ8A 1LK2B 3PWNA 2J8OA 4ZUUB 4MXVF 1SYVA 5F1KC 1D5BA 3T0EA 3FJTA 4FQPA 1NLDH 1W0WB 5IIEB 3OGCA 4P46D 2R2EA 1JWMB 1XGRB 3HMWH 4YPJA 1P4BL 1KFAL 4UILL 3LKRA 4HUUB 3MCLL 4GG6E 2B1HL 2PYEB 3GFUA 3QPQD 3MOBL 5JOPE 2DQIL 5MI0B 3P73B 1RJLA 4KZEL 3D39D 2PW2B 2GTZA 4L8CA 5I1EH 4U1KB 5GSVA 3GI8H 3D69A 2CDGB 4Y5YA 3FB7A 1A1OB 5FUZL 5E4IA 3CUPA 1BFVL 2A9ML 4Z76B 1DBKL 3AS2A 4HFUL 1FYTE 1VGKB 2LU4A 2QADC 3EUUA 1UQSA 1FFNA 4OLWH 2VZ1A 5I1GL 1LK3H 3ARYA 4JG1H 5ERWA 3MODH 1T21A 5EUKA 4N0YH 1EO7A 5GGSA 5TDOB 4NOFA 3U2SA 1S5IL 1U9KA 3TWCH 4M1CD 1CR9L 2DLHA 2FECL 3OX8A 3VCLA 4XBEL 1DCLA 1RZ8B 4G9DA 1T03L 3OR7B 4LSSH 3TPUB 5C0FA 2BHZA 3UXFA 1LO2L 1D5MA 4OFPA 5F7HA 3JTTA 5DI8B 3IETB 2HFGH 1JHLH 1KLGB 4RWHA 1J8HD 4WENB 5CWSA 5C70A 4XP9H 4CN4A 3QEGH 5JOEA 1CE1H 3VRLE 1NGPL 2BNRA 3K0WA 1U8KA 4OI8A 4U1GB 4K9EC 5EU5B 4WO4D 3O11B 2F5AL 5CEXA 1T5XA 3CGTA 3U46A 3TGXA 4F2MA 1B4RA 2Q3AA 1CFQB 3QZWB 1SMAA 3D2UB 1JV5A 2HTLD 5F97E 2IQ9H 4HKJA 4HCRH 2D31A 1G7LB 3QO0B 5DEFB 1HHKB 3RZCC 3OG4B 2W9LA 4P23A 4L9LB 3MRCA 5T1LB 5F6HJ 3O41A 4EI6B 3VI3F 4RSVA 5BVPL 5IVNA 2VL5A 3V4PH 1IGJB 1A2YA 5I30L 3B5GA 3VH8A 4HIHB 3ZYJA 4L8BB 2J7LA 1HHGA 3QDJB 1INQA 1DJSA 1IVLA 3QB7C 5HHQA 4AIOA 4XC1L 4YFLF 1A7QH 2EO1A 3QNXA 1MRDH 3H3BC 1CE6A 5IBTH 4WTZG 5F7EL 1PBYA 3ILPB 2X09A 5HHXL 3RUGA 3SKOA 5F7DB 2BSSB 1CG9B 5IFAL 4O9HH 1IJ9A 2BMKA 2VTFA 1S7QB 2UUDH 4XNMB 1P84J 5IBUG 5FCUL 2HKFH 4L1DA 4PJEB 2PYFA 2O5YL 4OV5A 1T0PB 2NZIA 1G9MC 5E9DE 1NAMB 2XZAL 1A1MA 1KG0B 3C5JB 3EDFA 3IT8D 4PJ9D 1KBGH 3TO4B 3MNZB 4PLNC 3NFNB 1NC2A 1FORH 4HIIB 1DQDL 2BVUA 1SJEB 3UC0H 4YC2B 4JRYA 3O3UN 4MCZB 1YN6B 3BEWB 1AO7B 4FQXB 5FGCE 3GSRB 5MEND 3RWJB 4Y0GA 2XA8H 2EDEA 2BDNH 4ZFGH 3NIGF 5IMOA 3LKNA 3WKML 2H2PD 5D1QB 2E6QA 4PJIF 3S34L 1MREH 3F6IA 1UGNA 4YH6A 3DBXA 3MYJA 3ULUL 5ACZA 1N5YH 4KKBD 1NCAH 2Y4SA 4R0LB 1UZ8B 5I8CA 3B5TA 4YHYB 5ICYB 3AS3A 3NABH 4BQ6A 1BBDL 1PW3A 4XGZB 1HZHL 3HN3A 1IQWL 3ULVC 4MJIA 1XR8A 1MFNA 2HN7B 4U4BA 1FZKB 3FFCD 3C5SA 3GSWA 3NCYS 2HT2C 1OP5H 3LN4B 1YA5A 1LWRA 1KEGH 4I3SL 5FA4A 5D1XD 4TVPE 2R29L 4BA8A 4TSCH 4ZUTB 3RWHB 3KXFD 3SDCD 3RGHA 5LGJB 1HCFX 4QTHA 3UEZA 4DCQB 2Q76B 3CVIH 3OKOB 3QEHA 1H3PH 2ADFH 5D5ME 4AEFA 2VDKH 4JANA 2A1WH 1WC7B 4XAWL 3P9LA 4P5MA 4NFDA 4PY8I 1N6QH 2FJGA 4EBQL 3ARRA 3B8YA 2A38A 2X1QA 5ACMA 3MV8E 3EGSA 5I73C 3N85L 5FKAB 3QZWG 3WBDA 2XYCA 2R1YB 1SEQH 3RVUD 1TTFA 3PWPD 5I6XC 4R7NB 5C0NC 1SYSA 3TFKC 3RL2B 5LCVH 2JELL 3QEQD 3MJ9L 4MD5B 2BVOA 3B6SB 4PB9H 1YMMD 4ORGA 4RAUA 3DVNB 1FCCA 4K3HA 3HCVA 2H32H 1I9EA 1HE7A 3PQYB 4YHKH 1A64A 4P49A 3K2UL 1ZVSB 2FCBA 3WMSA 4ZFOA 3ARWA 4MYWB 4DUWA 3WN5B 3D18B 3QFJB 3V7AE 3T4YB 4XCCH 1EFXB 4NNPL 3VXSD 4DTGL 4K94H 1RZ7L 1I7UA 4NZRH 1PY9A 5C0EA 5DMGD 5I75C 5HHNB 1CXIA 2WINA 3RGVB 5EU6D 4ZS7L 2DQFA 1TPXC 3C8HA 3BYYA 1N0LA 1G1YA 4MDIA 4S1DC 3VG0L 2NLJB 4TUKH 3LPFA 4FQHB 2Y36H 1IAII 3L6FB 4WUUB 2BOCA 5ILTH 1FDLL 5EZJA 1LGVA 5BV7C 1I7ZB 2Q6WA 3BZ4A 2N1KA 3ES6A 5DQ9A 3HI1B 4BQ9A 1GPOH 5IMLB 3O3BA 1BFTA 1MUJB 4MD0A 1XF2A 4WFHE 4I18C 2WM0A 1LEKB 1MCLA 1U0QA 2OTUB 1RZJC 2ICWB 1FGVH 5CEYB 1HINH 4Q6IC 4FXGB 4ALAH 3GIVB 1JUFA 4CW1B 4LMQI 1EZVX 4NRZA 4PJGE 3RNQA 4JEGB 4EI5B 1U8MA 3VA2C 2YSSB 1MJ8L 1DUZB 2CMRH 3OJVC 4OCNC 1TQCC 4OF8A 1OGTB 4OLUL 5DUPH 5GZNC 4ZFFA 2ATPA 2CLZA 4LLQA 3G08A 3PV6A 3GSQB 3V0VB 5DTFB 5FKPA 3INUL 3DV6A 1GGIL 2JB6B 3AAZA 1UYWL 5JNYB 3A6BL 1CD8A 4DAGH 1KJ2H 4NBYB 5GXBB 3QI9B 4K8RC 1B0GA 5T3ZL 2YPLA 1JGEB 4GG6F 1TJHL 1EGJL 3SCMA 4F58H 3H9SA 4LP5A 4TPRH 4AIZA 4WEBL 1S8DB 3U4AA 3MYZA 3B3IB 3NVQA 1CT8A 2LABA 1ZHBA 3JV5A 4NKOA 4IDJL 2OK0L 4PJDE 4X8JB 4HKZA 2ORBL 2R9HD 5GGTA 3O8XD 4JDVB 1BVKB 3EYQD 2CDEB 5HYJB 4HFWA 2UZIH 3R0NA 4QHLA 4KJWD 1ZE3C 2Y25A 4M6NL 2ZSWA 3BYTA 4M7KH 5KG9B 1FAIL 1T0MA 2X5PA 2QQKL 5EIIB 2IAMA 2Y6SD 3KJ6H 1AGFB 3IB4A 2ESVE 4HXAL 1G1CA 3VFRB 4GKNA 4DGIL 3OBAA 5JHDD 2GYSA 5T3ZE 5K9JL 2EDRA 5CJ8A 4J2XA 3LHPH 2XN9A 1AIFA 1KXTB 2FYYB 1YECL 2V5SA 3RTQA 3TA3A 4MNQB 1IGYB 5D6DA 4JZNA 4Z95L 1F4AA 2CIIA 4NOBA 4KUCD 3ZSSA 2R39A 2DLFL 2AJUH 4JQIL 2GK0A 3IVKA 3AU1A 3QDMD 3OB0K 2PO6A 2J1KA 4P5TA 4XTRD 4C83B 5L2KD 3V6FB 2FEEI 4QT5A 3S8WA 1ZS8B 5BS0A 4G3YL 1P9MA 2DJSA 3N1MC 2ITCA 5AG9A 5BRZE 1F90H 2VLLB 1L7TH 3UJTL 1OT2A 2FX9L 1DR9A 2FH6A 3OKKA 5D6CA 1XH3B 3QIBD 1S7VA 1IM9D 1CICD 2PKDA 4Y19B 3TNMA 5ICXB 1UKSA 1U95B 3WHXA 2Y06H 5C08B 1KN4L 5DJXB 3OKEB 5DURD 3VDCA 4JFEB 4HT1L 4UT7L 3UJIH 3IXTA 5C07D 1JN6B 3EOTH 1JF1A 4FG6D 1P7QB 4I0PD 3Q3GB 2JTDA 1AJ7H 3RU8L 1VGEL 3A67L 4FFWD 3TIDB 2Z8VC 4G42B 3K4ZA 4Y4FA 5IVXB 1JPFB 3MBEA 5AZEH 2VABB 4JFHE 4MA1B 4OFDA 1FRGH 4QRSB 2X9XA 3L7EB 4OSUH 1YY8B 4U6TA 2Q8AL 3AS1A 1U8LB 1YDPA 3KPMB 2FWOB 1YPZA 2VAJA 4ZNCD 1QSED 2XZZA 2GSIA 4HXBL 4ZUSB 5H35A 4LAJH 4APQA 4QOKD 4L8SC 4AMKH 3U30C 2ZCHH 2FX7L 5EDXA 5F3BA 1EJOL 1U8NA 2H9GA 1HCVA 4YDKH 4P46B 5E8EA 1MWAA 5KOMC 1L0QA 2ICES 4HPOL 4X9HA 5DJYA 2DWEB 3BSZL 3W39B 4LBEA 2ZUQC 2J6EL 3F65A 2DM7A 3A6OA 1OP3K 4CVXA 4WCYL 5GRUH 1AO7E 1AHWC 4L9DA 1RAMA 3D39B 5FUOH 1NMAH 4F37F 2QR0A 3UJJH 3CLEL 4UDTA 4ONFH 1LEIA 4HZAA 3UMTA 5IJKC 3QFDA 4TUOA 5D4QA 1Q9LA 2NYYC 2DOCA 2WIMA 3MOBH 4KAQL 4AYFA 3CFBB 3H9HA 1JJUA 1MQKH 4HHAA 3TBTB 3FB6A 1WISA 3BP6A 3SDAA 2Z93A 3C5ZA 3EYOA 3KVQA 2IGFL 5CKAA 5K9OB 3LVEA 5EZLB 1QP1A 4FQLH 5MHSE 2DDQL 4WU7B 1VEPA 5C7XL 15C8H 3Q6FB 3S37H 4LSTH 5I1GH 2FX8L 1I1RA 3VWJC 1F4XH 4OIAA 1CLOL 2W0LA 1BOYA 4PJAE 3GSOA 2NXZD 4PV8A 2JJVA 1JI1A 2W9EH 4N5UA 2BSTB 5JZ7C 1T7YA 2XV6B 1FNSL 1MFDH 1T5WA 1S5IH 4WFED 1QKZL 4HF5L 4GXUM 1J8HB 1RHHB 1YZZA 1I3RB 1HXYA 2ZOLB 1V3JA 5CZVL 5C3TA 3SBWA 3G9VA 4RGNC 4WI9A 2IALA 4LK4A 4JO2L 3AGVA 4OCWH 1MI5D 4WO4B 4PJHB 2R8SH 2DQJL 5E7FA 5HD8C 4LPTA 1YQVH 1D6EA 1QRNE 3HB3C 4JN1L 2QQNL 3A0OA 4X0KB 3TYGL 1RU9L 2D7TL 4XH2A 5CBAB 4NYLA 5ISZA 1AQKH 1AQDA 1NEZG 3QHZH 1X5JA 1EVTC 4JO4H 1NQBA 4XPFH 4U3XA 4ZNEE 4IIQC 2DICA 3WS6A 3G5XA 4V2BA 1LE9B 2F5AH 2X4PA 4M93B 1FG2B 3MRPB 2HH0L 1U8JB 2GAZB 4LCWA 3PQYE 3ARBC 4E41D 3KYOB 1RZGA 2NTFA 4YZFE 1MWAH 4DN4L 3HC4L 2HT3C 4Y1AD 1RZKL 1U91A 1OAQL 2P7TB 1BZ9A 1T66C 2OXGA 1TETL 2ZPKH 5I0ZA 1F45A 1YJDH 4HQQL 1CCZA 3FRUB 4LQ1A 2HKHH 2F8OA 2B4CL 4XB8A 4I77L 4ZUWB 2J5LB 1HOCA 3VFMA 4HH8A 3PDGA 1JNNL 4HKXB 3ARZA 3BD3A 3SKMA 1VDGA 2P5WE 1MHHB 2YUVA 4RQQA 3VWKD 5HI3D 4WUUE 5HHOE 5I1JH 1MFAL 2D4FA 5I1AB 4YDLC 5E1AB 3BE1L 3ILQC 4AQ1B 4ODSH 4L4VD 1EERB 4LAQL 1NGWB 4XPHL 4PJ9B 4XP4L 5IFAH 2IPTL 4TNWK 4XI5D 3HE7A 4XCFH 5LGHL 1I9IH 1NGXB 1WUNT 3UTTA 2E9IA 4XC3H 3VG9C 2O5ZH 4H1LG 2LV4A 5MENB 2VLKE 2VN7A 4FNLL 3TCLB 4V1DA 4YBQC 1SHMA 3MLZL 2NX5D 1KIUA 4OCMC 4RNRB 4P4KC 1MCIA 1R3KA 1YNLH 3B2UD 4J8RB 1IARB 1UFUA 4XVJH 1RUKL 2PW1A 2YPVH 1KULA 4TVPH 1OGAD 3NA9H 3QDGE 3RWGB 4M1GH 2MPAH 1ZHNA 2YPKB 1X3DA 4NM4H 4K07A 2HLFD 4U1HB 3SDDC 3VI4E 1I1FA 2FJHB 3H7BB 3Q5YA 1J1XL 1BFOB 4OJFH 1T1WA 1Q9WB 5HGDB 2YKLH 3FFCB 4L4JA 2IH1B 1F4HA 4WV1A 1HI6A 1IAKB 4P48A 4AZ8A 1CK0L 3MRKA 4C4KT 2VKWA 3MV7D 5D1XB 4OFKA 5F7WC 2QBWA 2P48B 4PJDF 1HZHH 3CXHK 3GIZH 4KUZH 4RMTA 1A1NB 2BC4B 4F3FA 2VAAA 1J5OL 4D0CA 5GS1C 3E6HB 3KXFB 3SDCB 3PJSB 3T1FB 1FO0B 3TNNB 5I1DB 5D71L 4QRTA 2IADB 5IHZB 4AJ0A 2F58L 1YEFH 5CIPA 3TBYA 4XVUD 1IL1B 3K8KA 1A7NH 5I2IB 5B38G 5KVFH 3STBA 4LIQH 3MGTB 1S7XB 4ZSOE 3KPSA 1U3YA 3EHBC 4PRPD 3I9GL 3IJHB 4AG4H 3L5WA 1ZSDA 3T0VA 1ZVHA 5IV2B 5F96H 4IOIA 4WY7L 3B2VH 2RIKA 3PWPB 3FL7A 3QYCA 5EBMA 3K80A 2N7BA 3QEQB 1OB1A 2AK4A 4F7TA 2EE3A 5FYJD 1Z9MA 1ZLSH 1CFSB 4KHTL 5LJYH 4OKDA 1KXVC 1YMMB 4B7IA 4UINL 5HPMA 4Y2DD 1C08A 3WE6A 4YGVB 2H3NB 1UCBL 3LIZL 1EIBA 1UG9A 3LKOA 5EPMB 1SM3L 4FQQA 3W5MA 4V2CB 2X4NB 1WGOA 2FRGP 4PLOB 2KQMA 1V7NL 2E5EA 2XY1A 5GHWL 3MPCA 3S88L 1IFHH 3TEUA 1UEYA 1MJUL 5F1OB 2X4UB 2DIBA 3VXSB 1KLUB 1HXMB 5CSGA 3IAGC 4M62L 1PSKL 3RJQB 2IG2H 3T2OA 3MRDA 5EU6B 1NCCL 1PZ5B 1DQJA 2IAND 4GG8B 3AS0A 4YPGA 4ELKA 3BJLA 2DJ4A 5MEQA 5DQJA 4DK6A 5JW3L 1BF2A 4OQTL 3ISWA 4U6VL 5LQBL 4Y19E 2Y1VA 3X12A 2BCKB 5E4EB 2LTQB 2AV1A 4NFBA 1OT1A 3JBG7 5IB2A 4BKLB 5C08E 1UJTA 3VG0H 3L3IA 5EC1B 1IEAB 4RFNC 4JFEE 1UT9A 4NSKA 3WXVL 4ODVL 5ESVA 4I13B 3IDJA 4LNVA 7CGTA 2WBJC 1IT9L 3MRJA 5KS9A 3KLHD 1I1AA 5LGKA 1J12A 3NCFB 1QSFD 2ERJC 4LEXL 1R3JB 2JLLA 1IM3A 3TN0C 5IVXE 3IF1B 1OTSD 3BFOA 3AXLB 3HNSL 1I8KB 3F58L 3CJJA 5F21B 2C3VA 2HT4D 5KVGL 2GI7A 5CLWA 3U0TB 3ULUC 1JK8B 1ADQH 1XZ0A 2HFFB 2OTWB 1GL4B 2VDLL 2X4RB 4LNRB 3HAEH 1RK1B 5CIPH 1N64H 1MJ8H 4NC1E 2OQJB 2XG4A 4OLUH 4RBPK 2UY7A 4O5LH 3QRGH 4RISH 3W2DH 1NL0L 4LFHD 3MLWL 3V4VH 3R8QA 3DRQB 3INUH 1GAFL 3P0GB 1UYWH 4RIRB 1NCTA 4O2FA 1NCWH 4OLYL 3FRPA 4IRJD 5GGRB 3CMOL 3V0WH 5FGBC 1VFMA 5IEKB 1J10A 5HYEA 1EJ6A 3WUWG 3O6KH 4NUJB 3RZCA 1X9QA 3O8XB 4TSAH 5DQDL 3QQ9C 4G8GA 1V5JA 1YYMH 2OK0H 5MEPA 5FYLH 1WV7T 2VQUA 3IU3B 3JTSB 4GUPA 4X4XB 3RAJL 1A02N 1T04A 3MOAL 5JHDB 4LCIL 4AEHH 4XZUA 1NFDB 2V7HA 3HG1D 4G6AD 2V9RA 3OAZK 5J6HB 4JGJA 4XP5L 5T1DL 1HHJB 4PJAF 4OLVL 5H37G 1F13A 1FIGH 3WEXB 4HXAH 5F93C 4XPGL 1MFCL 1G7MA 2APXA 1J0ZA 5B4MC 2AEQH 4OLXH 2IBGA 3WNKA 4F57L 5JLZA 4LPVA 1KB5B 2DKMA 3CFEA 3U48A 3QCUL 4FZ8L 4LLDB 1J8HE 5IQ9B 5J3HD 2JJTC 3QDMB 2P5EE 5L2KB 3RBSA 3TBSA 5ANMA 4H20L 1VFBB 1FZMB 4C4KO 5TPWL 4M3KB 3B9KD 5EULV 3PNWA 4EEEA 1CGTA 2FIKB 2WQRA 3PWUA 3CH8A 1ND0A 2AERT 4ONHA 1G7IA 3UPAA 3S6CA 3QIBB 4UT6L 1IM9B 4PRHA 1CICB 1DBJH 1XGYH 5D8JH 4LKCA 2L7UA 3T4AB 1QNZL 3WKNA 4QKXB 3TIEA 4J3SA 3VE0B 2EZ0D 4HX1B 5DURB 1BQHG 2AEPL 2I25N 4KHXL 4YZFF 4DGVL 4NQVA 5C07B 5IMMB 4I0PB 3SO3B 3KPPB 4X6DB 4UTAL 1DLHB 3VFNB 3MO1A 4I9WE 5DHYA 2A6KA 5JOFA 1IGIH 5MI0C 3C6SA 4QRRD 1DBBL 3QJHA 2UYLA 4XP1L 5CZXD 3D48R 3KPQB 4M7JL 4KI5E 4UT7H 1BVZA 1U41A 2VDMH 3SGEH 1SMOA 3MRGA 3UYPA 1KPUB 3TJEL 1QSEB 3DECA 1VGEH 4LHUA 5DJDB 5DHVA 1IC5L 4QOKB 4NC0B 5C09D 4NNYA 4GXVL 3HZYB 2YA0A 1K2DB 1ZMYA 5T5NF 3MJ8A 5DD5L 2IPKA 1TENA 3F7VB 1G7QA 3EO1A 3DX8A 4S10A 2ZJSL 2X89A 4NRYB 5C0GB 5I76A 5FO9A 4JKMA 4OUOA 4NZTH 4R90H 4LLVA 4N0UA 3WFCL 5KOVC 4TSBL 1RJZB 3EFFB 4JFDD 4CMMA 1U3JA 3SDXA 4DZ8A 3DX6A 3MROB 1S9WB 3RVVD 3L3KB 3HC3L 1FO0L 3HLAB 4Y2OA 1PY4A 3KAAA 5IR1B 1AD9A 5J4MA 3L3HA 4C59B 1NFKA 3WO4B 1G84A 3GSUB 2PCPA 4WCYH 4HUVB 3QEUB 1QR1B 1BD2A 1KTLB 2W07A 3VI4F 2JIXD 4NGHH 4U1GC 3PHOB 5C9JB 5E8NA 5JA9A 3M1BB 3HRZA 4CMHB 2R2BA 3T08A 3RVWC 1G9MH 4BQ8A 1M6OA 1JNHB 1UH2A 3GEWB 1OP5K 4KAQH 1BIIA 4Z7WB 4JQVC 3GSVB 2DQTL 3M17B 4MJ6A 4XWOC 2NXZB 4L9LC 4JDZB 1VESA 4PY7B 2GJ6D 1CQKA 4PJBE 4JLRA 3V6ZB 1MCOH 5E6ID 4O51A 1CXKA 1ORQA 3MRRA 3KXFE 4JHWL 4IOFC 4O2EB 4BQBA 4HUNB 5D7IB 2BXZA 3GGWB 1CLOH 4I18A 3TBWA 4EUPG 1QBLL 4DQOL 1MI5B 1L7IL 2CR3A 1FNSH 1S9YA 4NDMA 2GTWA 3O3EA 1C7TA 4Q6IA 4S0SD 1QKZH 4HF5H 5HY9A 2CLVB 2OR9L 2EDNA 4MSWB 5CP3H 4R4NC 3OJDB 4KRMB 4D9LL 5KAQG 3FB5B 3ETBF 4MVBC 3E2HB 3GMRA 1ZWIA 1YQ2A 2M26A 1N5AB 3QSKB 4FXLA 4JO3L 5JW4R 1J0YA 5GZOC 4HDIA 4R8WL 3O45A 1YMME 3I75A 4QGYA 2Q7NA 4R26L 4PP1C 5IW1B 2XTLA 3MFFB 4J1UA 1BECA 2F53E 2OMBA 3S4SB 4E41B 3TO4C 4PGCA 1T1YB 3L3JB 5ALCL 4MLIA 4MHHI 3NCCB 5B39B 4YC2C 4PRDB 4Y1AB 4ODXB 4FQXC 4J6RL 2BVPA 2X2YA 5HDBE 5EOTB 4OAWA 2VZTA 3IDMA 1JFQH 1AP2A 5I8KH 5J13B 3VFWA 5JIPA 5D1QC 2C3WA 1BWMA 3UZQA 4DN4H 2VISB 3O3AB 3O2WH 4R0LC 3LEVL 4QHUB 2E7MA 1CFNA 2G75B 3IJSA 2XKNA 4MQ7A 1UXWB 4N90D 3VWKB 4YHYC 1HHHA 2ZG1A 2V2TB 3GM8A 1F3JA 1JWSA 4JFPA 1VA9A 2A77L 4L4VB 2PTVA 4JFXA 3BWUC 2X1WL 1CD1B 2XKUA 2VR4A 3DX9A 2LAGB 5JUEL 4TUJA 2QV2A 2R1XB 1MH5B 4PJ7A 2EYSB 5DLML 4NQDE 1I8MA 1Z6JT 4ZPVB 4KQ4L 6CGTA 2VZVA 4S2SB 3CK0L 5IBLC 2A6JB 3PXJA 4P59H 2NX5B 4HG4J 3HNVH 4OD3H 2FHCA 4XX1E 3FB8A 2NCMA 1OGAB 4E0RB 1S5HB 4J23A 2CKBA 2DJUA 5KTEH 5L2JB 5BV7H 1MJ7H 5ACLA 1W8NA 5JPMA 1TVBB 5CINL 1JMXA 2LVCA 3STLA 1VKXB 4JG0L 3ZT7A 4Q9QH 4YNYA 4KK8C 3X13A 5KW9L 2XWJA 4X7DC 2UVEA 3WIIL 2BNUB 1A0QL 2FO4A 3MV7B 4HJJL 3MLSH 5F1NB 1ZXQA 3BP5A 4HWUA 4KY1L 2VLJE 5J06A 3K4DA 2E7BA 2P46B 1JPSH 4DOHB 5F7LB 3NZHL 5GPRA 3FQUA 4ZS6D 1RJYA 1KB5L 5F7KC 4NJ9L 3WN5C 1FL3B 4U1IB 5E2VH 5J11B 1JNLL 3P9MA 3QJFB 4IOSD 1ZHLA 1G6VK 3T2NL 2BRQA 2EH8L 3RX5A 4XHJC 4PRPB 3SY0B 3RGVC 5IQ7L 2FL5B 2D03L 5D71H 3MR9A 5D9SA 1VENA 4F7MA 2OL3B 3W9DA 2COQA 5JQ6L 2I60L 2UWEE 5C0AE 1K5NB 4P5KB 3WIFA 4JFYA 4ODWA 4YBLB 4Y2DB 4DZBB 4PJFE 4WY7H 2VDNH 5DJZB 4ELMF 2ZWLT 1XCTB 3EYFA 3LB6D 4NNXA 1VACA 5JR1L 4HAGA 4UINH 4ELMA 1EV2E 4FQIH 4X4MA 3IDXL 1UACH 1RZKC 2MCPH 3GZKA 4OFYD 5AUMB 1A6UL 4EI5C 5L2KE 5FO8B 4NQCE 1CVRA 2AV7A 3DXAD 5DJ0B 2IANB 2VQ1A 2B4CC 1MCKA 4GAFB 2X4OB 2PTTA 4OGYH 2W65B 5TH2B 1AHWA 3ALWA 4HWZA 2DQUH 4FFVD 1P4LB 3U0WH 1DSFH 1I8IA 4QYOA 2W0PA 1MY5A 3VFVB 1H5BB 1LP9A 4JAMA 2CKBH 1T1XB 3DTXA 1J05A 2BNQA 3QI9C 5DD6A 4N9OB 3F6LA 4ZTPL 3D9AH 2ICEB 2VRAA 1AR1C 3IFOA 5J1TC 3FQWB 5K59F 1OTUD 2WLYA 5JW3H 2X1OA 2W60A 5C07E 4HWBL 3VJ6A 3LKSB 2MQ0A 1S78D 4F8QA 3U1SH 4NKDB 1QSFB 2SEBB 1V3KA 4KI5F 5EU7C 4RWYL 4Q7DA 3OKMA 3BHBA 3OKYA 4UZGA 1BIHA 1ZT7A 3VWJA 1TJGH 2Y5TA 1NANI 4OBSA 5JORA 5IEHB 3G6JB 5FIEA 1HDMA 4G6JL 4RAVA 2JF1A 3U7WL 4X99A 1C5CL 1QSEE 4OF5A 3QWRA 2VMFA 1KCUH 3E3QC 4MXQD 2ARJA 4JHBA 43CAA 1WZ1L 4XCEA 1KJMB 4X9IA 2HFEB 5GJTL 1KPVB 5K9KB 5DDHA 4JFOB 1LEGA 2NQCA 4P3DB 1CDJA 1WZKA 3NCYP 5AD0B 1YN7B 4G7YH 1RULL 4QRQA 3DO7A 4NP4L 3WNOA 1QEWB 5FGSA 4UDUB 4IRSC 1T3FB 3OZ9L 4IRJB 5IFHL 5D7JD 3H3PH 2KDGA 1NSNL 2KZ1B 3LS4L 1QBML 3DPBA 4IIQA 4R4FH 2AJSL 3S98A 4PGEA 2Q86A 3MLWH 3QUKA 5EOQL 3IDIB 4WWID 1MCWW 1WEJH 1TZGL 3A6CH 3ARBA 4LOUC 5GSRA 3R06B 2ATKB 1WBXA 4M7LL 1C5DB 2FBJL 2HLAA 5INCB 3CSGA 1GGCH 1UXSA 4I3RL 4NCC1 1LD9B 4LF3B 1NBYA 4KVNL 5CHNA 3HG1B 2XTJD 4XXCC 4GW4A 2OJEA 5GJSL 3X11A 3I3DA 3GNML 1W72A 4PTTA 5DFVD 4NQEE 3RAJH 5E8DL 1IGMH 4GBXD 4PJBF 2NPLX 5EB9A 1P6AB 1MCNA 2NY4D 2R1WA 2W0FA 4M02A 4LCIH 3VMOA 1YC8A 3SOBH 4WI2A 5LWYL 3MOQA 5F1IA 2XXMB 1KJ3L 4GW1A 3QNYB 4YDVB 2X7LB 3P4LA 4KV5F 4UV4L 3FO1A 5D7IE 3GJFA 4LLWB 4U1NA 4XPGH 4K7FB 3TBVA 4MA1C 2EIZB 4HBCH 3WHE1 1Q9KA 3B9KB 3KS0J 3OQ3B 4PRID 4QRUB 4G8IA 3NN8B 1CFTB 1KIPB 4M6OH 1T83C 4BM7A 3MA7A 4X83A 3DO3A 3IDGA 1ZHKA 3ARED 1IEBB 2X4QB 4NZUL 3LQAL 5D7SH 3MRFA 4F7PA 4P4KA 4NC1C 6FABH 1R5IA 4N1EA 5EG6C 4P46C 4AQOA 5J1SC 1URLA 1JPST 3LSOA 1NUDA 2CO7B 3VXPB 3SDDA 5GRJL 3FQTA 3DJ9A 5KZCD 4LPYA 3NTCH 3QPQC 4H8WH 1G9NH 1C16B 1EAPA 1QNZH 4PGDB 4U6YB 3SJVD 4JM4L 5IB3B 5GRXG 2CH8A 3R0MA 1UVQA 4QRRB 5EZOH 4GKZA 4Z7UB 2XFXB 3SGKC 1J9CT 4NKIH 4GAJH 5ITFA 5CJOH 2P8MB 3BKYL 1NFIA 3DUSA 2DD8L 3DUUA 3WFHA 3MRMA 4L29A 1FYHB 5I17B 3RRQA 5GS1A 5EWIH 1BMGA 4G6ML 5C09B 4Q6YA 1DBBH 4F37K 1CXEA 4XP1H 5DYOA 3O4LA 5FK9A 5E8PB 4PRBA 3O0RH 4ZXBD 2G5RA 2YK1L 4WFFD 4F7EA 1J0KA 1NANH 2J8UB 4N0CD 5DF0A 5HDLA 4FQ2L 1MLCB 3G5YB 2YN5A 1N4XL 4LFHG 4GSDH 3VFGH 4M1CC 1CTNA 1FBIH 3GSNB 5C0JB 3ARFA 4JE4B 4FQJL 4JFDB 4PG2C 4P9HC 3PHQA 3HNTH 4PJCB 2LAAA 2GITA 5H2BB 3GHBL 5JW4Q 4GRWH 2VDRL 3NCEB 3WFCH 1OGAE 2ADJA 4KRNA 3BP7B 2X1XR 5HJ3B 4DFHA 2JIXB 3V5KB 1R3IH 4NO5B 4MJ5B 4WO4C 5EC2A 3EFDH 4YHIB 4NKMB 1K85A 1JF6A 2EYRB 2IF7A 4OZ4A 3GJFH 4H0GA 5HGHA 3RIAF 2I9LA 4QXWA 5TE4L 2V5MA 1F00I 2ICCA 5LAXB 4D9QE 2HTLC 1EFQA 5FF6B 4QCIB 2A6DA 4KRPD 1D6VL 3SHSA 4HC1A 1FZOA 3MNWB 2B2XL 3N06B 3RZWA 1MNUH 2R0LL 3MV7E 1MCDA 5DUBA 1BAFL 4M93C 4HIJB 2GJ6B 4D9RE 1EEZA 4LCYA 4KXZH 1BX2A 1IZKA 4Z7QF 3UTQA 1QLRB 1D7FA 3RIFF 4AL8L 1DBML 1EO8L 1JIBA 1LO0H 3KPOB 4UT9L 1MIEL 1I3UA 4S11A 3QH3B 1KGCD 1UWGH 5F9JB 5I8OL 3EYVA 3KDMA 1EX0A 5BZDA 1CL7I 2WUCH 1E4XI 4G9FD 2YUWA 4PRPE 1NC4A 5GGVH 1IMHC 1MVUB 2W9DL 3RWIB 2J5LC 1X5YA 4YR6A 5FXCH 3TT3H 4N9GA 2UWEF 1E0OB 1U93A 4GLRI 5FYKL 3TN0A 3S37X 4PRAB 4DQOH 3S9DB 5C0BA 4PJFF 2O61A 1OW0C 4K23H 2AGJL 4Z0XB 1AGDB 4FP8L 1FLTX 4XNYL 3QWOA 1A6AA 3QULA 4D9LH 4FFYH 4PJ9C 3LV3A 3IDNA 2JK5B 1FL5B 3QG7L 3GB7B 4NBZB 3PGFL 1EVUA 1J0IA 5FUCE 1SEBA 2CIKB 3QCTL 2AAVA 2X05A 2ITDB 3GRWL 1R0AH 2DWDB 5C6TH 2H2PC 4X7TB 3MACL 1U8OA 3QUZD 4RFOH 1WBYB 2GUOA 4D8PA 4H88L 4KKBC 5FGBA 2E9JA 3J8F7 4O58H 5ENWA 1HH6A 5HHVH 4AH2B 1Q72L 3FOLA 5FYKE 2DQDH 4YDJA 2CXGA 2YUZA 2DM2A 4LRNL 4JRXE 3ARVA 2AXFA 1CLZL 1AI1H 1FFPA 4LVOB 5AWNL 3IFPA 2BSRB 4NWTL 1INDL 3VXNA 5E2JA 3JWDC 5IB1B 3PIQA 4LQFH 4TVSa 1KPRB 5T3XD 5DRNA 5D1XC 3HUJA 4CKVX 1MVFA 3OMZA 1KT2A 1SY6L 1F4WH 4OF6A 1Z9SA 1BVLB 4HC1H 4PUBL 1MHCA 1R5VB 2G9HA 3SDCC 1IC1A 4F80A 3ALPA 3PL6D 5F88B 3HMXL 1FJ1B 3TP4A 1R5WB 2VLME 2JJSC 2X9YA 2HJFA 5DLMH 4WTXA 1OAXL 5DSCA 3GBNH 4X9FA 4F33A 1Q0XH 3K8LA 5JTWA 3EOAB 3VFPB 1PGRB 4FXKA 3CK0H 3B43A 3WFEH 1BFSA 3ROOA 2DI9A 4MDJA 1YMHB 4TTGA 1P4IL 3BPLB 3WJJC 2FD6L 2AJZB 3RVUC 1MPAL 3ZKQD 1OCWL 4ZO7A 2R4SH 3NCJL 1P7KA 2MFNA 3X3FL 3TPKA 4NM8L 1KEML 3DVGA 4WTZA 3FT2B 2I27N 3LEXA 5TDPA 2P49B 1CFVH 2OSLA 2Z92A 5EO0A 4PREA 5CJ5A 1MLBA 1R3LB 3MV01 1HQ4A 1LK2A 4ZUUA 1WVZA 3AUVA 2GFBB 4TN9A 5F8RC 4XB7A 2RJMA 1QQDA 3SGDH 2GT9A 4MQSB 4FTVE 5IIEA 4BJLA 1CN4A 3SGJC 1XGRA 4F7CB 5DMGC 3V95A 5L9DH 4OZGB 2HWZL 4OZIB 4JKPH 2PYEA 5IK3B 4I2XE 1S7SB 2FB4H 2WNGA 2FZ3B 1JNLH 1EXUB 5DJ2B 3P73A 4ZG1A 2PW2A 3T2NH 2EIEA 1GC1H 2E7LA 3T65B 5KSVB 5J1AB 3U7YL 5JHLH 2EH8H 3PHSA 1CL7H 4NWUH 1ZT4B 2CDGA 3BUYB 3DMMA 5IQ7H 1N6UA 3MBXH 5IVOA 1A1OA 3I6LD 2F19L 4HPYH 5E4EC 2LTQC 1U6AH 5EU4B 4Z76A 4JFQB 3TYFB 1VGKA 1BPVA 4GLRH 5D2NB 1J86A 5A2LH 1ZGLB 2D0FA 5D7IF 1T2QL 4UNTA 3S5LB 4WW2F 3AB0B 5TDOA 2GW5A 1FYTD 3VGBA 4FABL 5KSBB 1H0DB 3DXAB 1RZ8A 3OR7A 1DBAL 5TE7H 1T7ZA 3MLTA 4J4PA 3BDYL 2OZ4A 5DI8A 3IETA 1KN2H 2CJUH 2RGSA 4WI7A 1KLGA 4RMQA 1MFEH 4JHAL 2DI7A 3V6OC 5JO5B 3TA3D 2B8OT 3BI9X 1EMTL 3MRBB 5FO7B 1CGYA 3HRPA 5EU5A 2HJLB 1WQVT 4KVCL 3WSQH 5B3JE 3GSNL 3O11A 1ZLUK 3WNMA 2X44D 2DQEH 4CJ0A 1CFQA 3QZWA 2VERN 3BEVB 3D2UA 3JV6B 2CUHA 5DGQA 4QRRE 4QRPE 1MAJA 4Q2ZA 4S1RL 1I4FB 2R9HC 5GRZA 4KTYA 1G7LA 3QO0A 1AD0B 4A6YH 4CNIB 4HEME 1IGFL 1SQ2N 3O8XC 4X6CB 3EYQC 3Q0HA 5FYKU 1JGLH 4L9LA 4HWBH 1CGXA 5T1LA 4AEIL 5JPNB 4EI6A 1KUMA 4KJWC 3UTPE 5EFIA 1IGJA 4PR5B 1Q1JL 3D3VA 3C09B 4CU6A 3CXDL 4L8BA 3QDJA 2Y6SC 5GISL 3BGAA 2EDOA 4NHUB 4PBXA 4Z7OF 3U7WH 3KYKH 5KN5B 2H45A 2WBKA 3UPRB 3H42L 4HWEH 5KSAD 4X6EB 3MZTA 5JW4M 3SKUD 1UWXK 1GH7A 2P45B 1RD6A 1C12B 1S7WB 12E8L 3ILPA 1WZ1H 2EDXA 4PY8J 5IESL 5F7DA 5D7JB 1CG9A 5DEGB 4JM2F 4JFDE 5KANI 4XNMA 4GO6B 1BJ8A 1JRHH 1NGQH 1WJ3A 4J12A 4U0QB 2VXSH 4PJEA 4QHNB 3QQ3A 4JM2A 2MSPA 3SQOL 2NY6D 2EICA 3RA7H 3MUJA 2XICA 4XTRC 5HTSA 4S1SH 5D2LE 4O4YL 1NAMA 2JCCE 1KG0A 1QLFB 3C5JA 1U8QB 4L4TE 1HKLL 1JCKA 3E8UH 3NFNA 3MCKB 4Z7VB 1QFWI 5I6XB 4HIIA 3BZFB 1SJEA 3MREA 4MCZA 1BJ1J 1YN6A 3BEWA 1AO7A 4GJTB 4FQXA 1XGQB 3GSRA 3TH2T 3RWJA 4EXKA 5D7KE 2XTJB 5M7QA 3QIBC 1CICC 5E9DD 5D1ZD 3DSFL 5D1QA 1F11B 1FSKB 2KPNA 4BZ1H 3QHFL 2VZSA 3I3BA 4UUJB 1S9VB 2OZ4H 3T09A 4GBXB 2FJFA 4PGJA 2NY4B 1L0YA 1RUAH 2BZDA 4R0LA 1UZ8A 4OCLC 1KC5L 1A14L 4E42B 3DV4B 4FG6C 5I75B 2DBLL 4XGZA 3SO3C 2O5XH 4U7SA 2HN7A 4FFWC 1FZKA 2DM4A 4G5ZL 1T22B 3HC0B 1RVFH 4D0DB 3MSPA 2ZCLH 5F7YC 3LN4A 2J6EA 1HH9B 3SDAD 2AJ3B 2R0KL 4PRIB 4LDOB 1X5XA 3JWOH 5TQ2H 1CZ8L 1OSPL 4YX2L 5I1KH 3AREB 4ZUTA 3RWHA 1AE6H 5EOCH 5LGJA 5I74B 4DCQA 3RHWF 4ZAKD 1HK6A 2EDDA 1IGCL 2Q76A 3DHMA 3CZJA 4DEPB 1D5XA 3RX7A 5BVJB 3V5HB 3OKOA 1D5MB 2VZOA 4JPWL 5CEZH 5DT1L 4TVPD 1QUNA 4JO1L 1WC7A 2APBA 5BMFL 4GMSH 3BD5A 5KZCB 4P2CG 1KIRA 1ODAA 1F4YL 4KK9D 2ZOKA 5FKAA 1CGUA 3SJVB 2P4AB 2R1YA 2Y5EA 3EO9L 2UVFA 3S96A 1TVHB 4R7NA 3TO2B 2AJVH 3RJDA 3WIHA 3RL2A 4ISVA 1FHGA 4NN7B 4MD5A 1CDGA 5F3HB 5BXFB 3B6SA 4BFIB 3DVNA 3MXVL 3WO4C 3PQYA 1W8OA 5B8CB 2ICWI 1ZVSA 3L3DA 1FAKT 4TRPL 5TJWK 1KCVH 5D72L 4ZXBB 4CMHC 2EE2A 3QFJA 3T4YA 1EFXA 3O41B 2FSEA 2XZQH 3CH1B 5EUOE 2DD8H 5HI4D 3T3PE 1WAAE 3DHJA 3RGVA 3VH8B 2GK2A 4G6MH 1KSRA 1CXLA 2IMNA 3I3EA 4HK3N 5KVEH 1U58B 5LXGL 1O7VA 2YK1H 2NXZC 3VXQB 2NLJA 2F54E 4FQHA 2D0GA 4TQEH 3L6FA 1XR9B 2YC1B 3QQ9D 1I7ZA 3QAZB 5IMLA 2J88L 1VFUA 4P2QE 5IFJB 4WW2C 3W81A 4FQJH 4OTXL 2H32B 1LEKA 5C2BL 1I3GL 3E1F1 2ICWA 5ADOL 4DN3H 4HMDA 5CEYA 4FXGA 4QHKI 3GIVA 1AGBB 3SE3C 3GHBH 3NPSB 1S7RA 3VFUB 3BPCB 3SDYH 4RX4D 4EI5A 3E2HC 1A1MB 4QHMA 3I6GB 2YSSA 4KRPB 4WFHD 1DUZA 1QFWH 1FH5L 2B0SL 2EEDA 4P99A 1NLBH 3OWEA 2FO1A 3ROLB 2EO9A 3GSQA 3WJLC 3AC0A 3LKNB 3V0VA 3ZDYE 2X41A 5DTFA 4Y16D 2CSPA 2JB6A 1G6RL 3C8DA 4M6MH 5JNYA 3T1WA 4J3TA 1HILB 1NLDL 4GKSB 3QI9A 1YEIL 2DBJA 4OZHE 4XP6H 5ACZB 1JGEA 2HA1A 1NAKH 4PJIB 5C0CA 3CVHH 4FMFA 3HMWL 1BGXH 4RDQG 4G9FB 5J13C 1FV1B 3FT3B 3CSPA 1S8DA 2FH8A 2G2RB 4XMPH 1YYLH 3B3IA 1WCBA 4JGMA 2WZPD 4AL8H 2EXWD 3C60D 4HD9A 1DBMH 4LVNB 4MAUL 3OV6A 2ZUXA 3WIHH 4FQ1L 4IMLB 5C0DB 4X8JA 4M8VA 4K3EH 3H8NA 3TZVD 3LQAC 5I1EL 3VWKC 4WJ5B 5HI3C 5E00B 3UTSE 1FNEB 4JDVA 1BVKA 2CDEA 5HYJA 4DVRH 2CRZA 4KJYB 4GRMB 3MLVH 2IC2A 2Z8SA 4QTHB 3VXRE 4OLWL 2Y07H 5D2NE 5FYKH 5KG9A 4XI5C 1CGWA 1LK3L 5EIIA 1ZGLP 4P2RE 4JG1L 1AGFA 1NBVH 3OF6D 3MODL 3VFRA 5IM7A 4GOSA 4E9LA 4N0YL 1KJ2B 4FZEH 2OX5A 4MCYB 1P84K 1XF1A 5DJ8B 3TWCL 5CJQH 3B2UC 5BOPA 3QUZB 5KSBE 2FYYA 4L8SB 4MNQA 1IGYA 1I7TB 5DR5H 1M7DB 2ESVD 4FMKA 4LSSL 5E8OB 3GUTB 2IPUK 2HMID 5DVNA 2HLFC 2BERA 3HE6D 4KKAC 4OM0L 5A2KH 2HFGL 1JHLL 5DJAB 1XCQB 3GBMH 4W6YB 3Q5TA 3MACH 4PBWD 4XP9L 3OXSA 3QEGL 4C83A 1YEGL 4QO1A 5FDYA 3V6FA 5B3JF 4ZFOB 4X8XA 4IS6A 4PRNA 3KLAB 3MNVA 2VLLA 1WCQA 4P2OA 3X14B 1YNTB 4LRNH 1OSZB 1FNFA 4J3UA 5E56A 1RHFA 1FVCB 1GSMA 1XH3A 4XXCA 3PL6B 3OKDA 4Y19A 3F7RA 3U6RB 5ICXA 2OS7A 4WHYG 1U95A 4HCRL 4Y88A 3HFML 5ADPH 5DK3A 5J11C 2CD0A 2VIRB 4XVUC 1EO5A 3QXWA 5BRZD 3BP4B 1B0WA 1PAMA 5DJXA 3MGOB 1C1EH 4MHHG 1QFUH 1N3NB 1MCRA 1KCRL 4M8QB 1I9RH 2QHLA 1JN6A 3K2MC 1P7QA 4X5XB 1N8ZA 5T1MB 5C9KA 4MD0B 3TIDA 1XF2B 4G42A 4C56E 2KUTA 4BFGA 5IVXA 2RFXA 3NCBB 3VD5A 1TVDA 2VABA 2YXMA 4KH2A 5DRXA 1A7QL 2WW8A 4RMVA 3ZT6A 1MRDL 1YY8A 4YBLC 2E8YA 3QXVA 1U8LA 5IBTL 4Y2DC 3KPMA 2FWOA 1I1AD 5BJTB 3JV0A 4Y4KA 3O6LH 4ZUSA 1JHKH 3PWLB 4HS3A 2F15A 4O9HL 1XIWD 4OQTA 3MV9E 4JFHD 3NCJH 3X3FH 2HJKB 2XI9A 1J87A 4ZFFB 2ATPB 5D2LF 2HKFL 4P46A 4UBDD 2JCCF 3NIDE 2WWKO 4WI4A 1QO3A 2DWEA 4HJ0D 3P4NB 1KBGL 1HWGB 4OGAD 1FORL 1B0GB 5DK0B 3UC0L 4HWNA 2IJ0C 4H1LA 1SJVA 3D39A 2VO5A 5HGBB 3I50H 3SGKA 1PG7W 4GS7B 3ZTJG 1F6FB 2XA8L 5CJXA 2BDNL 2XTJE 4ZFGL 4QEGA 1NCUA 1H5BC 3O81A 4GG6B 5EZIL 1TXKA 1I7RA 4UQ3B 2RCSH 1MREL 2QLVB 3BKCH 3CFBA 5CILL 1DQTA 3MQIA 1N5YL 1NMCB 1NCAL 3TBTA 1GRWA 4Z6AT 1KYOJ 5GIRB 3U7YH 3HPLA 3NFSH 4KK5D 5K9OA 4HFWB 2V17H 3V8CA 3KLHC 5EZLA 1OAZH 4G8GD 4WU7A 1RQ5A 1FYTB 3Q6FA 1PEZA 1OTSC 5J56B 4HGWB 1KEGL 1CFBA 4ZPTB 2HT4C 1I1CA 4JGUA 1MCFA 2BSTA 4TSCL 1QYGH 4HEPG 4XMKH 5MHSD 2QHRL 1AIFB 3MJ6A 1J8HA 1RHHA 5ID0B 1I8LC 1IAOB 2ZOLA 3TA3B 3F7QA 4O00A 3CVIL 1H3PL 4JKKA 5DA0B 2ADFL 1FFRA 4LVHB 1IAIM 3BDYH 2K9UA 2VDKL 4PJHA 2A1WL 2ED8A 4JY4B 3DVIA 4LPWA 4C54A 3NAAH 1I1YB 4JHAH 1NUGA 5C71A 4IRJC 8FABB 1X7QB 5CBAA 5ITBH 1SEQL 2BNRE 3BIKB 5FB8B 5LCVL 3B9VA 4PB9L 5AAMA 4RA3A 1ZT1B 1FG2A 1ZA3A 1QRND 5CD5D 3OKKB 1U8JA 5D6CB 2GAZA 4RFEB 3MFGB 1U8IB 3KYOA 3TNMB 1MRFH 1J7VR 1GZPB 5EUOF 1KTRL 3T3PF 2BX5A 4WFFE 1HQRB 1WAAF 5FECB 1MCPH 2C3GA 2P7TA 4XCCL 3P3YA 3RKDD 4K94L 4G6AC 5KSAB 4NZRL 1AC0A 1P5UA 3JXAA 3FRUA 1FL6B 4H1LH 3CXDH 4ZUWA 1UA6H 4LCUB 1GHFH 2FHBA 3VI3E 1OVZA 4IMKC 3TH4T 5DUMH 5I66B 5ICZA 4TUKL 1MHHA 2Y36L 2C3HA 4R96B 1G7JB 1OW0A 5J3HC 5E03A 5I1AA 5E1AA 2H26B 2NY6B 4P4RA 4ZO8A 1NGWA 1GPOL 3RUGE 3O2DA 4MMZC 2QL1A 4ZDHA 4PJ9A 2CUMA 3LN9A 4EDXB 2P5WD 5E5RB 3B9KC 1NGXA 5ESQB 4DW2H 2OMNA 1FGVL 4U6XB 1HINL 2VXUH 3N50A 1MWAB 3GJEB 1QBBA 5HHOD 4ALAL 5MENA 2EDHA 4OCSH 3SQOH 5D70H 4RA0C 3VDAA 4LARH 4Q58C 5E9DB 1JPTH 5D1ZB 4PYGA 4YHZH 4RNRA 4CVXB 2R15A 4WWKD 2CMRL 2J2ZA 1Q8MA 4JRYE 2EZ0C 3RWGA 3ZE0F 5DUPL 3JVGC 2VSCA 3WNNA 2YPKA 2AXHA 5FGCB 4POUB 3QT2A 3MLXH 2VLKD 1OPGH 1LEIB 1FQ9C 5FHBH 4HUXA 1RV6X 1INEH 4OZHF 3QFDB 3DSFH