3LDAA

Yeast rad51 h352y filament interface mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
319
structure length
293
Chain Sequence
b'GSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVNIMAYSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD51
publication title Insights into the mechanism of Rad51 recombinase from the structure and properties of a filament interface mutant.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 99
structure length 293
sequence length 319
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ldaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ldaA02
3TK1A 5EWGA 1KMHA 3IBYA 4M4SA 3SYLA 1B23P 3L0PA 4DSLA 1KMHB 1T3SA 1U81A 4QHTA 4BXOA 4PANA 4QBFA 1ZM7A 5DNYB 1GKUB 4BXOB 3EWAA 1L8QA 1II0A 1EXMA 4AWXA 1XTIA 2WHXA 1G8FA 5LD2C 1Z28A 1UF9A 3AP3A 4AYWA 1A7JA 3K70C 4WXPA 3RLFA 1F2TA 2RGNC 3DMNA 4PGXA 1DS6A 1S97A 4L15A 1Z6YA 3UXNA 1F2TB 1W2GA 2WSMA 5GJCA 3K9GA 5CM8B 4YQFA 2A1JA 8ICNA 1PLJA 3MJRA 1KSJA 5H1YA 4PC6A 4C4PA 2E87A 5KFFA 2H5XA 2A1JB 3G6VA 4KLQA 1L2TA 2AN9A 2OAP1 3OJSA 4N0EA 4TWZA 2XOKD 1BS1A 1Y88A 4J9SA 1ZQDA 3TVDA 3K0FB 1VCOA 5CWRA 4C0KA 2QSZA 2B8TA 2OUKA 1WDTA 3IPYA 3SN6A 3FMIA 1A1VA 1N6OA 1JEDA 2Q3MA 3KJHA 3SDZA 2J9RA 3EZ7A 1U8ZA 8ICSA 1YZKA 1S0OA 2GWSA 4KI0A 3NHBA 3PUXA 4Q1EA 1RYFA 4X8MA 2ODEA 3PENA 4KLMA 5KG1A 1YZTA 3L8ZA 4KSBA 4O25A 5HZKA 1OB2A 4PHEA 3ZVNA 4CVNA 3VQTA 1US8A 2LYHA 4LZDA 5ANRB 4HLCA 4B48A 4WIAA 1US8B 1JR3D 1ONBA 4A0HA 3RAXA 1CEZA 2CNWA 4RKEA 4IVRA 4BFZA 4KU4A 1QSYA 2RKOA 2P5TB 1XU4A 4K4GA 3B0YA 2QSYA 2OBLA 2R6DA 4II7A 3EXAA 4I28A 1G4UR 4KLUA 1ZUNB 3HPRA 2WTFA 3M0EA 4KLHA 1AGPA 1VECA 3W34A 1DO0A 3PX6A 1FUKA 2Q6TA 3OF5A 4R2IA 4ECVA 3RANA 1KFDA 4MRPA 2GRJA 3Q3JB 2PEZA 3MR3A 1WQ1R 4RVCA 5EXPA 4A9AA 1KAOA 1NNEA 5J47A 3LLMA 1XEFA 3OIYA 1ZQJA 2EWVA 4OHWA 7ICUA 1W36C 3AVYA 1MR3F 1E94E 4U7DA 1N0WA 3N5CA 1VCNA 3AVXA 3U3OA 2BMFA 1NG1A 3GJ6A 2ZJ8A 1VDZA 2EU8A 3Q85A 3QY0A 4HLDA 4M9QA 5KFPA 3UWOA 4ASUA 3A4MA 3CLVA 2BQ3A 1HUZA 1MV5A 1M7HA 3JVVA 2ZRLA 3HR8A 5HTKA 3TNFA 1CUKA 4F50A 2O8DA 4AI6A 4F5PA 4DL5A 5IIIA 5IIJA 3OJUA 2HHVA 1WE2A 2ODBA 2FPKA 4R8UA 1M2OB 2ANCA 3QE0A 3VHLB 5GADl 1IN8A 2REOA 3B1ZA 3QI2A 4R8UB 4U5XA 4B2PA 4CF7A 3CO5A 3KHGA 3PX0A 1DAIA 2DFTA 2GJKA 1AM4D 3AVTA 3VTKA 3D3QA 1ETUA 1LF5A 1EFCA 2A30A 1JXLA 4Q8EA 5J2JA 1E32A 2J6SA 2G1JA 4GOXA 2F1JA 3B0XA 1E0JA 2KSQA 5J5CA 3HJNA 2SHKA 2QA5A 1UEIA 3W8RA 8ICUA 3AB3A 1FQJA 3MR5A 1GRNA 2IEYA 2NPFA 3CRVA 1WCV1 5BYKA 5JRZA 1XTKA 1MABA 2ZRBA 3CX8A 4JVMA 1NK6A 3EC1A 1NIPA 4GC7A 1D8TA 5F9NA 1MABB 2UZ3A 3H86A 2YWHA 4MRRA 3EC2A 2RGXA 4FMCB 3BS4A 4Q1AA 4NE2A 1ZM2A 5F9FA 2JJ1D 2GK6A 1ZQUA 1E2QA 2W9CA 2KWIA 5KFIA 5KO2A 1W5TA 4RCZA 3WRYC 2QTFA 5CB8A 4A15A 3MSXA 4I2EA 3LW8A 4NONA 4FXPA 4IVQA 3U3RA 2XGQA 3U3MA 3GJ3A 3SQXA 4LJ8A 2IYVA 2J7PA 1NK5A 4N3NA 5CJ2A 621PA 2IA6A 1XPOA 4EEYA 5HKKD 3TAPA 4RQ8A 3V72A 3AP2A 4LSGA 2QG6A 4GDFA 2IS6A 1AA9A 5JHGB 2ZETA 2NG1A 2JASA 5CA7A 1KO7A 3B1YA 4JYBA 3PO5A 2A3RA 4DIDA 4UKDA 1KJWA 2PEYA 2PZGA 4IDPA 3IGFA 2CHGA 3BIFA 5FL7D 1XJ0A 2WMNB 3SEAA 3WP0A 2PFPA 3OAAD 3WRXC 4PHPA 3G6XA 2J46A 3V7JA 2YOGA 4HAUA 3AGPA 5HMLA 4NP6A 5TB5A 1TADA 2FMPA 4DLRA 3O47A 2Q3HA 4DF8A 1CIPA 5DLFA 2RHDA 1QG2A 2E1RA 3C5CA 3MG9A 4HSEA 4FS1A 1FNNA 4YLGA 1KSPA 2REBA 4HLUC 3B5JA 4NYJQ 4P2HA 1TU3A 5J0WA 5JSZA 2BCUA 5TXGA 5KG0A 1H65A 1NMYA 2EYUA 4JJKA 5KDDA 3NBZC 5KT4A 5JSZB 5HE8A 4F93B 5DBCA 5DLGA 1ZQHA 4J9MA 2GZAA 5K8IA 3C2MA 1E2HA 3SYZA 4AYXA 1Z3IX 2XB4A 4I2BA 5J0UA 5C18A 2R8KA 4KN7A 2W00A 1XCGB 3AUYA 3EASA 2PJRA 8OHMA 4Q01A 3LA6A 1QZXA 3BXZA 3EIHA 4XJXA 1M34E 4JLPA 1P3JA 1QLNA 1NK7A 2YC4C 5DO9A 3VKWA 1XWIA 4DFJA 3EAQA 4B73A 1TEVA 4R98A 2O8FA 2W9BA 2ZU0C 3TFSA 3R7WA 4O5KA 1CKEA 4QZ9A 1NN0A 1UBFA 2H5EA 2O8FB 2W9BB 4DT1A 2AJQA 3NVAA 4EBCA 1G20E 4B3DA 3TI0A 4RQ4A 1MC8A 3CBQA 4HAZA 4DT1B 3OE7A 2GXAA 2FSHA 9ICLA 521PA 1AIPA 4DL6A 2UKDA 4C8LA 4OQXA 1T0JB 2GJ8A 2OAQ1 5LPNA 1YZNA 2QEQA 4XVQA 4FO6A 1RC8A 9ICMA 2A5DA 1OH7A 3B1WA 3H1TA 4W5JA 5J2IA 1E0SA 2ZIAA 4PFSA 5KNCA 2V55B 2FLNA 1BIFA 1KFTA 3BFKA 2ZI9A 4DFPA 4J9KA 2IYZA 1XEWX 2R44A 1TQ4A 1KTVA 1P2UA 4DWJA 4QHSA 3RRZA 3HYTA 4X8HA 4UJ5A 2WV9A 2P6NA 4I2FA 1HE1C 1N6RA 3UXPA 2CK3D 2RGGA 4JKYA 3EIQA 4Q4HB 3W8NA 2IHMA 3DEFA 4D25A 4RUAA 4B9NA 4NM2A 1VCIA 3QKSA 4TL8A 4U02A 3VX4A 5JRJA 4QBGB 4M04A 2J41A 3QKSB 3SYNA 3GEEA 3ZIAA 3RB0A 2ECKA 7ICTA 4M2YA 4DXAA 3N2IA 1E79D 3RWOA 1FOEB 1VIYA 3UKDA 3CH5A 3PEUA 4ELVA 2ZSEA 3A37A 1ZD1A 2CL6X 3C2KA 3A4LA 3JZMA 4HDOB 4HB0A 1SL2A 4KFUA 8ICZA 1UKVY 1NK0A 3GFPA 5HHHA 1T5LA 5DH9A 5KPDA 3AU2A 4GZLA 2OFWA 2IX3A 2QUZA 3B13B 3RB3A 2VP2A 4A8JA 3J81k 2YWEA 3RYTC 4QWAA 1E2PA 4JL5A 1MSWD 1ZUIA 1UDXA 1KRPA 1QRAA 3LD9A 4Z8YA 3KFVA 4KLOA 1J8MF 4BWYA 1D2NA 3LVRE 3RRHA 4DSIA 2WOOA 5CIWA 4D6PA 5FOTA 1QHNA 2J45A 2ZVQX 2ZXUA 3H40A 2O5VA 1E2IA 1E2FA 4BDPA 2PX0A 4F4ZA 2EQBA 1GKYA 4F92B 3MFHA 4PHDA 1ZW6A 2FMXA 5KFMA 2GCNA 4HZUA 3MR6A 4Z1MD 3PMLA 2DFLA 5DQHA 4HZUB 1YKSA 4LOAA 1E4VA 4KLIA 3K0AA 1DOAA 4O0IA 1M8PA 4GPTA 5L9XA 2GDJA 8ICGA 1DARA 5FUYA 5CHGA 4HAXA 2JEIA 1W1WA 4BFTA 5AUOB 2BQRA 3A1UA 1GTVA 4H1UA 4YMUA 2XY5A 221PA 4PQYA 1Z2CA 4ON9A 4XWOA 1EESA 3DVLA 2H17A 2ISOA 4ED0A 5F9LA 2CMKA 1KDRA 5J0XA 3MJHA 1N0VC 1Q20A 2PLRA 1KI9A 2WM9B 4KLFA 4EUNA 2PFNA 4XD7D 5KG5A 3B78A 3ZDAA 1XMIA 5DIFA 5DB8A 2C99A 3RS5A 4DSNA 1C7YA 3HP1A 1EFTA 4H1VA 4Q44A 4Z6EA 1SXJC 4M9HA 8ICLA 3PW4A 2OM2A 1MKYA 3H4MA 2WJIA 4ITRC 4PPQA 1UKZA 1T3LA 2QE7D 4ZKEA 4Q5IA 2W8LA 1JN3A 4DS5A 5HCIA 3SFVA 1VG8A 1JR3E 4W7SA 1AS2A 2BHRA 4D4JA 2YOHA 2WVJA 3SZRA 4DZZA 1W47A 4YDHB 3LBHA 4LHXA 4TLBA 2OT3B 2QM7A 3CKLA 5CJPA 3RSLA 4UNPA 2ZREA 3KDSE 1YZLA 3BB3A 4IRDA 2F43A 4KVAA 5FI0B 1V5WA 3KB2A 1H8ED 2ZE5A 1TQ2A 2F43B 2HHQA 2D3WA 4TSFA 1SVIA 5DN6A 5EE1A 4PPGA 4S35A 9ICJA 1IN6A 4YQWA 2RGDA 2P65A 2VTKA 3D31A 3LX8A 4BGDA 4BFXA 4A1FA 2XO7A 1U98A 4J9NA 2YC2C 3BFXA 3MCAA 4Q02A 2F3TA 4CRWB 8ICJA 3LAWA 4RZUA 4TL7A 2QQ0A 1XXHA 4UNQA 1QSSA 4F4JA 4JYCA 3W6OA 2LCFA 3QIAA 1XXHB 121PA 4DL7A 3AH8A 5BN5A 3QG5A 2BKEA 2FJUA 3EZ2A 1L3VA 1BYIA 4BRWA 1SGWA 4IJMA 1BPYA 5KFOA 1TUEA 2A7QA 3KB1A 5KYKA 5J2DA 1UDWA 4PGQA 2VHJA 3AKDA 2QENA 4B44A 1RRCA 2HHSA 3A58B 3BD9A 4M1MA 5KFLA 1NVUQ 4MGYR 4BEJA 5E3HA 4D80A 4DLWA 4AKIA 2VHQA 2ZE6A 4E5UA 4GT1A 1Q1EA 4NYMQ 2CBZA 3UANA 2WICA 2DPXA 3NG1A 1IN4A 4O2LA 4NU0A 2WWHA 1HV8A 4MDEA 2YOFA 4A8JC 1ZUHA 1ZQZA 4ESVA 5JI2E 1TF7A 3NH6A 4PSVA 1KZ7B 1E2NA 3R9WA 3FKQA 2KFZA 2ZAMA 3FYHA 4RD1A 2CE7A 1W36D 1UEJA 1IN7A 4Y0AA 1XSPA 4B71A 4ZH4A 4HYYA 2H92A 1EX7A 2QP4A 3G82C 2ASJA 5EXTA 4R71A 1U8YA 3NC0C 5JWOA 2F55A 2IUUA 1AQYA 3GIJA 5TZVA 3EPLA 1E69A 2C77A 2J0QA 5HZHA 4H9GA 1Q12A 1E6CA 1G3UA 4PC3A 2B8WA 5L3QA 5KPJA 5FOWA 1KNQA 4V0ME 3A1VA 3F0TA 4B6EA 1KI2A 5L3QB 1NRJB 4C0SA 1OLOA 3GIMA 4US0R 1BKDR 5CK4A 3PMNA 1VHTA 3A8TA 2PI4A 4F3OA 3CNLA 4LYAA 3EARA 4B2IA 4J9PA 4DHEA 3RAQA 4KVGA 2ZUDA 4DSUA 2BMJA 4K4HA 1SQ5A 2QORA 3K9HA 4QW9A 4UXJA 3PY8A 1I4TD 4PSAA 1DGSA 1D8LA 2Z43A 2PT7A 4TMWA 4URXR 1IQPA 1UM8A 4OBEA 2WWIA 2ERYA 4MKFA 4V0LA 4KODA 4QNRA 4RU9A 4E09A 3MDCA 3Q8XB 2I1QA 4KBGA 4O3QA 2KFNA 4BFYA 5A0FA 4C0BA 3ZVMA 1S8FA 4DLGA 4C0LA 4C2UA 4RT2A 4M9LA 2HEIA 5J2GA 4MFAA 5BN3A 4LJAA 1TTTA 4P4SA 2YJTD 4RZRA 4J9OA 3Q8SB 4I2CA 2J5XA 1VKJA 3MFYA 4MRVA 5KFHA 4MFFA 2R62A 4UB5A 1DVRA 4P4SB 5CIQA 5DI3A 4JLDA 4TMVA 1G6OA 5DI3B 1FNMA 5KFQA 3A1SA 1Z0KA 4PC7A 2ATVA 4KLGA 1OFIA 4CYMA 3HT3A 2UVUA 4Q66C 2AXPA 2VP6A 5J4VA 4XVRA 3PV8A 1IXRC 5HNKA 5IIMA 5M04A 3TKLA 2WKPA 1ZQPA 3Q8PB 2WWYA 2PXIA 4RPYA 4TMTA 5FFMA 4JWNA 4IQTA 3PW2A 2QPOA 4QZCA 3GJ5A 4HAVA 3MFIA 4NYIQ 1N6KA 2CLDX 1RE0A 4FWIB 2XTNA 4RFVA 4IFBA 1GNPA 3IQWA 4L16A 2P3SA 4PHAA 2W2VA 3BJIC 2MAXA 1KO1A 3AF4A 2JEOA 3LLUA 4URZR 4YG2A 3ADDA 3UMRA 4BRUA 4R65A 3QQ5A 3LWMA 1KJYA 4DL2A 4YMMA 1W4RA 4TYQA 2OESA 4FMDF 1XPUA 3RS4A 3GV5B 4AIIA 3T3FA 4M6WA 4DOBA 1GILA 3H84A 2ASEA 5DHAA 2NO1A 1N56A 2C78A 4M6WB 4XTRA 2D2EA 1A82A 4ED3A 3UQ2A 3VR6A 3ZQJA 4B9TA 1FTSA 4LC1A 1Z6TA 4DQPA 3HPQA 4O3NA 1YR9A 5FTKA 4DLZA 2R65A 3TQCA 4UBBA 3TANA 2RDJA 3A36A 4LUCA 4JZKA 4DQRA 1ZQKA 5KFYA 1NBMA 1P73A 5KSZA 4W9MC 4B74A 4TL9A 4QBIA 4LJ4A 4K46A 5J0OA 5AJVB 5HCNA 3HU2A 3PW5A 4IFEA 2FFQA 4ECUA 4IDHA 4DDUA 4C7OA 3EZFA 1ZQGA 4C7OB 3OFNA 4DFMA 3SFZA 1ESNA 3RJHA 2VANA 8ICFA 1YJ5A 2ZJZA 4WOPA 1QF9A 2FF7A 3RH4A 5A5GA 5KHOC 3H8JA 2IYXA 3CIOA 3P32A 1XO1A 3NC1C 2ZI4A 4B3CA 3K0CA 1CR1A 2YZ2A 4D4MA 3Q8QB 1K5GA 2C28A 1KMQA 4YD1A 1HUQA 1JAHA 1S76D 5J2KA 4PHHA 5CP2A 2QMUA 1S0NA 5J4KA 5CDFA 1X8LA 4TYPA 2AGQA 5FOSA 1J99A 3GLIE 1N6NA 1NJZA 1JNYA 2PBRA 3U6BA 4QM7A 1W0KD 3UG7A 1YR8A 3PEWA 3CX6A 4D26A 1EFHA 5DQIA 1J70A 2F3RA 3DKVA 1IN5A 4PZLA 5AUNB 4HDQB 2ZRHA 1ZD9A 1Z5ZA 5JS8A 1UBGA 4AURA 3MAAC 3K09A 2P2LA 5J0RA 5ELXA 1OH6A 3BBPA 1XS9D 4UAZA 3SV4A 3ZDDA 1C9KA 2X8AA 2VQSA 2XNDA 1L5UA 2XJ9A 4LV8B 1TK0A 4NCKA 4QJ3A 4UB4A 2G9NA 5DGAA 2BGWA 4DDTA 2X19A 2G0TA 1SHKA 2C9YA 3ZYCA 1G8YA 3C5FA 1SL0A 2AK3A 1MH1A 5DB6A 2ZRJA 4M1SA 4PO8A 3T15A 3NDBB 1DBSA 1N5IA 2ZPTX 1WF3A 5KOYA 4OJQA 5EE5B 4ED2A 3ADBA 2BPFA 1JPNA 2WOJA 1COOA 2PLFA 1DEKA 4GBMA 5DBBA 1U99A 4I2IA 1OKKA 2RB4A 4C3ZA 1SVOA 3CF0A 3ECCA 1RRGA 4L5BA 4P4UA 3SC3A 1ZQEA 3T35A 3ASZA 3RRGA 3EPKA 3AQ4A 4BFVA 2FGJA 1NVWQ 3QKUA 3PCRB 2OCPA 3JPSA 7ICQA 5E7MA 3UMSA 3CNOA 3EW9A 5DDYA 5BXQC 4LJ9A 5KT3A 4URVR 2IYQA 2BBTA 2EFEB 1D9FA 1ZQTA 2A5FA 3SU8A 2PMDA 4PH5A 2FPLA 5IIOA 2ZRMA 4A0FA 1RZTA 3BH7A 5D3QA 1WMSA 1MO3A 1R4AA 4M2LA 3DKPA 2BQUA 3PJRA 1GOTA 3WP1B 1E9CA 1G3MA 4MQBA 2BBOA 3BOSA 1RYSA 1XTRA 4QZGA 2FZ4A 2WWFA 1G19A 8ICYA 1BPDA 4EYIB 2ZEJA 3IEVA 1UBCA 3V6KA 1ZQSA 4Q00A 1E2LA 1LFDB 4TT3D 4D81A 2B7BA 1YZQA 4URYR 4WVFA 4BEBA 3D8BA 1JQLB 3CB4A 3D6TB 4P3YA 4LBWA 4DCSA 4IRCA 1W2HA 2GESA 3EYZA 4I2AA 2KZZA 1BH2A 1FTNA 4PC2A 1UA0A 2AR7A 2JJ2A 4DCTA 1DE0A 2WBLC 4PZYA 3X2SA 3NHAA 1XP8A 2FOLA 2WIBA 3AF1A 3PW7A 1HQYE 4PSKA 4Q7JB 3E2EA 2JLZA 5FTMA 1SXJD 3C16C 3OHAA 2XY7A 4QFMA 2A5YB 3TR5A 4DBLC 5JJLA 5D49A 1U0LA 3BQ0A 1SVSA 2BPCA 5KT6A 5AJYA 1OIXA 3U2QA 3K75D 3GLFE 2ZTEA 1LTQA 4ACAA 5DB9A 4YP3A 5E4FA 4TQAA 3T5DA 2ONKA 2J6TA 5J2EA 1G7TA 3KJGA 5IK2A 3T1QA 4IQUA 1YZUA 4RQ0A 1T3NA 1TX4B 3RVBA 4YXWD 4CEIA 2RHMA 3WNCA 1NK9A 1Q3HA 1C1YA 5AUQA 4CEIB 4ECQA 4OK5A 1CEEA 2R6AA 2MUTB 4JL6A 1O87A 1Q57A 1BMFA 4LGMA 3RABA 3ZJYA 1R0ZA 4B6FA 2BCVA 2CLSA 3R20A 3FE2A 4HAYA 4TYWA 5K8UA 4MEXA 1OE0A 1FMLA 3LY5A 1NVVR 4NY8A 2OE2A 4P4PA 3HYRA 1YRBA 2ONJA 2VH5R 1EXNA 3LBNA 1BVSA 1GG2A 2OBNA 2FZLA 1KI7A 1GM5A 2VL7A 5J2BA 1RVDA 3QNUA 4JS0A 2ZU6A 4PQFA 4DLYA 4D82A 3VKHA 3EPHA 3NIBA 2G88A 2VLIA 1VMAA 2ZANA 1AJEA 1UT5A 3RR7A 2C03A 5B64A 1TAGA 3TUJC 2GF9A 4F4KA 1J8YF 1QBKC 1XD8A 1NSFA 1JXOA 1GFIA 4LI0A 2RMKA 4B3GA 2QI9C 1E2KA 1OPXA 3TMKA 1CJTC 2DPJA 2P5SA 3K0FA 3IO5A 5L3SA 1WP9A 4QRHA 5L3SB 2GWHA 3Q72A 4MYHA 4M9NA 5DQGA 4M1TA 1GRQA 2A2ZA 2E9SA 4YR0A 2Z5FA 2JIZD 2F9MA 3CPJB 4QZDA 3WBJA 1RZ3A 4JKIA 1YQTA 2J0VA 4DB4A 2R6CA 2W9MA 2JLRA 4DF4A 3GD7A 3VR4A 1VCMA 2AFHE 5F2EA 2CDNA 5KFSA 4OI0A 5E95A 1KKMA 5FI1B 4NH0A 3TFRA 2WPDD 3CWQA 2AKAB 4JLJA 4DJTA 5KSPA 4RZ3A 1F3OA 2FDCA 4LVSA 2AD5A 1OSNA 1TPZA 3Q9LA 5JJIA 1XMSA 2IYRA 3IPXA 2QMEA 1KSHA 5DI9A 4RNMA 2IXEA 1NKCA 2YVUA 5FPHA 4EPYA 2W6IA 1G5PA 3RJFA 3ZH9B 3FFAA 2ODNA 1B22A 5BYJA 1FP7A 3R8FA 2DB3A 4JBYA 4Q7MB 2JDID 4NCIA 4ZCLA 3QPUA 2VP9A 4FW9A 4FD2A 4A6PA 5EJEA 3TQ1A 2HDNB 4RFSA 2C2EA 4IR9A 2GAAA 4M9ZA 2AWOA 4RFSB 4HEJA 1LB1B 1NY6A 4BLSA 2ZUBA 1IM2A 1T3HA 1OH8A 5JCZA 4TUQA 2IC5A 2O8DB 4UNSA 1JEEA 1ZNXA 1G17A 1CU1A 1LY1A 2UVQA 4NLZA 4ELTA 3EZ5A 3MRSA 4HB2A 2C98A 3SHWA 2BCQA 2RAPA 4LBVA 1T8UA 3REGA 3X1ZA 5KG4A 4V0NA 4XUSA 4EPWA 2I4IA 3OEEA 3P4YA 4OHXA 3VFDA 1IBRA 3DOFA 2V8OA 5EP4A 4KN4A 1G7SA 2GZHA 1RPZA 3A1TA 1Z29A 4WAUA 1T4GA 4IQVA 3FHTA 1ZQFA 2ZI7A 5FH9A 2XXAA 1P60A 4DC9A 2XXAB 4ARZA 5KFWA 1DAGA 3JPNA 2OHFA 4ARZB 2V7QA 1LV7A 4IEEA 4MF8A 3G6YA 4CEHA 3L0OA 4CEHB 4NKRA 1ZYQA 2IEZA 1XX6A 2IUSA 5KFNA 4HAWA 4IXNA 3GJ4A 4CCHA 2RGBA 3WHLA 4I2DA 2ZJ5A 3X1WA 3QOFA 4TTPA 4LHVA 4F4YA 1P6XA 4KXFB 3UK6A 4QGGA 3IM1A 3UG6A 4GI7A 4V0KA 2AU0A 2OEPA 2WKQA 3TSOA 3Q5DA 4A4DA 4DQIA 4MF2A 5EZ6B 1Q0UA 3N4MB 3HR7A 2NTYC 2QAGA 1RKBA 3IUYA 1ZU5A 4JLBA 1KSFX 4MA4A 2KE5A 3SOPA 4BASA 5D4BA 1IXZA 2ZJBA 8ICHA 2QAGB 4JLMA 5CLQA 1KSGA 4A0GA 1Z0DA 4MKGA 1T8TA 1U0HC 5CB6A 3PFIA 1R8QA 2HXYA 3QBTA 4F38A 3QZ8A 3RDPA 3SJAA 4BWJA 3V4RA 3TGPA 3UPUA 4Q4JA 4DLXA 3ZZUA 2P6RA 1P72A 4OQMA 4JVSB 2AKYA 4Q4JB 1ZQBA 5CB1A 2IYTA 1G64A 4LZZA 4GC6A 4MYTA 2IS1A 1XMJA 3ZD7A 2XZLA 2QPTA 4D0LB 2GHIA 1ODFA 4I29A 4JVNA 5TV2A 1HURA 1VYUA 2DR3A 3CR7A 3D7MA 9ICOA 5KFBA 4QZIA 1DADA 2BMEA 2WSSD 3KKOA 4RD0A 4WW0A 4ACBA 5HMMA 1F5NA 4JSYA 3AU6A 2JGNA 3E2IA 4AG5A 5L1KA 1JBKA 2A9KA 3I8XA 5FBWB 2JLYA 4NLNA 1MRNA 4DUGA 3GLGE 1KI3A 2QRZA 4GSYA 5J2AA 5J40A 3ORYA 5KFDA 2XCAA 8ICMA 1LS1A 2ORWA 1S0MA 3GV7B 3MWKA 5G41A 2RDIA 4J9QA 4CDGA 4YMVA 4TZ6A 5DISB 1M6NA 2C8VA 3OHMA 1ZQAA 4E0DA 4B75A 4QZ8A 4YD2A 4DL4A 4GZMA 4IHQA 821PA 2F6RA 5CITA 4Q9IA 5KG7A 4RY2A 4NCHA 1VHLA 4M1OA 2V1UA 1KO8A 3AM1A 3ISBA 3QPVA 4KLJA 2QZ4A 4QW8A 3WMGA 4FBTA 4XSGA 2XZOA 1CR0A 5IILA 4Q19A 3AVPA 3I5YA 2FE4A 4B47A 2O52A 3FKSA 1D9DA 3U6KA 1CXZA 3OESA 5DYIA 3EA5A 4GL2A 1GNRA 2J7KA 4FCWA 1W0JA 3GCGA 4G5QA 4ESHA 5L8VA 1NN5A 1E4YA 2OZEA 1WB9A 2BMDA 1OIWA 1OIVA 4TQUS 5BN4A 3WNBA 2R9VA 3DDCA 5H68A 4UXHA 4OHVA 4JMPA 5IIKA 1NJXA 1G6HA 1P2TA 1N2CE 4TQSA 2ZUCA 2FEMA 2ZR9A 1KDOA 4Q9LA 2AQ4A 3ZDEA 2QU8A 2WIAA 5EE9A 2C22A 1GL9B 4Q4HA 3EZ6A 4DS4A 4QWBA 3AEZA 4LJ7A 1KAGA 3KQLA 1KKLA 2D06A 2WWXA 3KXKA 2VYFA 1W4CA 1PZNA 2ISPA 5FOVA 5FBVB 1SXJE 2R2AA 3EPJA 4QKQA 5KTYA 4LHYA 1SKWA 4RUCA 1ZQIA 1ZJMA 1H8HD 1O3YA 4F2SA 3ADCA 2BPGA 4B43A 1HT1E 1TMKA 3KQKA 2GA8A 1QG4A 3SJCA 1NLFA 2AHOA 4ECYA 1BYUA 2C2RA 4DWIA 2NZJA 3B1XA 4LYJA 4XH9B 4Z51A 4QZHA 5FUWA 3B1VA 4M9XA 4YMSA 2HXSA 2CXXA 3EWSA 4MDFA 5HE9A 1Z0IA 3QENA 3SV3A 1TQDA 2VSXA 2W2XA 5FOXA 3TH5A 1CP2A 1DAFA 1AS3A 3EG5A 2FPMA 3X1XA 2YHSA 1E98A 1ZM3A 1LVGA 2BKUA 3F3YA 2GK7A 5FPTA 1G41A 2OSBA 4I2GA 4F7WA 4RQ5A 2C9OA 1NKEA 3WXMA 1DPFA 5AR1A 3RWMB 3LO5A 1V43A 5TY0A 3FOZA 3VR5A 4WZBE 3V4FA 1CR2A 3B82A 1HJPA 5SZIA 3RSOA 4O3PA 2J59A 3NDPA 4KV9A 2PZFA 3RR8A 3EZ9A 4UB3A 3HWSA 3MGCA 2FMSA 9ICBA 1XBTA 3QXHA 4NHOA 2HLDA 5J4HA 2ZRNA 4IKEA 2BCGY 4FMCF 1VYVA 2IS2A 1E2EA 3EX7C 4NCJA 4GNKA 3NXSA 2XOKA 1ZQLA 3W9YA 2CCKA 4F5OA 1EG7A 4YCXA 1E1QD 1HQCA 3DMDA 1E9FA 1CTQA 2H1LA 2R6GA 2Z6VA 4EPXA 1TU4A 2ZJYA 3WYGA 1RFLA 3AKEA 3LRPA 5KT2A 2FA9A 1KTQA 5L1JA 1OXUA 2IUTA 4ECXA 1Z22A 2XGJA 1XCPA 4Q43A 4JLVA 3QXCA 4W5WA 1IY2A 3BQ1A 1R5NA 1U2RA 4LY6A 4ZDWA 4HLQB 3MABA 3TAUA 3EPGA 4WA7A 4LPKA 5J2FA 3NWJA 4BPBA 3BQTA 1MOZA 2DFNA 4EIWA 1XC9A 5KFKA 1U9IA 3BK7A 2IT1A 1JR3A 4Q48A 2Q3FA 2QTHA 3CNNA 5BQ5A 1E9BA 1N6PA 2NO0A 4JK1A 2VBCA 1P7CA 2ZRKA 2G83A 3EPIA 1Z0FA 3FHOA 3LV8A 4NPHA 1G16A 4OJKA 5EP1A 5K8LA 2AD1A 3ZDQA 3TQFA 5FR2A 9ICTA 2VF8A 3I5XA 5F98A 2FLLA 2GILA 721PA 3RJKA 2Z4SA 2O8BA 4Q9KA 1ZJ6A 3IILA 3RS3A 1NKSA 2ZRIA 4LJ6A 4V0OA 4E03A 2O8BB 4UNRA 4RPXA 3VX3A 4I99A 5KNDA 3BORA 4ZKDA 3NGDA 3RAPR 1NY5A 1P75A 4KHZA 3LDAA 2O8CA 9ICKA 5FTJA 4X8LA 1K5DA 5EUMA 1E3MA 3W3ZB 3WY9A 2O8CB 2QP9X 5J2CA 1E9EA 5FPYA 4EYHB 3B9PA 3K70D 5DGBA 1T5IA 2QAJA 4LPSA 1SKQA 4WXRA 3BH6A 4C8OA 3THXA 3MWLA 3ZZTA 1S1MA 1COWD 4I1OA 5C46F 1XPRA 3O8CA 2F7SA 3THXB 3TAQA 2UVRA 3N97B 2N1BA 1ZNWA 1DG3A 4TLEA 1T9HA 1U47A 3GJ0A 2XEXA 4FCTA 3PEVA 4JV1A 1HA3A 1OXXK 4PQRA 4DQSA 1E2DA 3THWA 1CF4A 4PPXA 4JT4A 3SNHA 2QMHA 2ZYTX 2OFOA 3THWB 1T8EA 1F60A 1X2IA 1S9HA 3T12A 1OHHD 3LWNA 2O0KA 5DB7A 4P33A 4A92A 1AZTA 1IY0A 1KOFA 3RHFA 3WHKA 1N48A 1MQ3A 8ICCA 2CCGA 3AVOA 3MWJA 2J3EA 2MSDB 2OCAA 4XSHA 2JLQA 3ZD6A 1X9WA 1VIAA 1ZC3A 2EFDB 2HHXA 1T0HB 4Q9HA 4XVUA 3GILA 2ZI5A 1W44A 4B9UA 4JLAA 1PLLA 2IK8A 2ODWA 4QWEA 1RXWA 1AS0A 2GKSA 2AWNA 1I4DD 4RT3A 2JJ1A 2QMOA 5GJWC 5DKWA 7ICJA 2AK2A 3DM9B 1S9FA 4OQLA 1G3RA 1ZQMA 4MGKR 4Q7LA 4V03A 1W4BA 2KB0A 3U60B 4O0MA 1K1QA 1W7AA 2XGPA 1ZQYA 1K6MA 3CRW1 1FW6A 3HPOA 1KLNA 4ECZA 2F9LA 4V0MA 3MLEA 1Z06A 3HU1A 4IOLA 2IYYA 5HKKA 5IT5A 1NMXA 4I2HA 4ZDJA 2JJ2D 2HYDA 4S2EA 1Z08A 4BZPA 3JPRA 4P31A 3MR2A 1YE8A 4EJSA 2R8GA 5EOZA 4TUPA 3JPPA 4YXJA 1L7VC 4M53A 4UJ3A 4EJSB 2GVZC 3OAAA 2EFGA 2GXUA 4CGZA 2DY1A 3NBFA 1M74A 5J0PA 1ZD8A 1G8HA 4IRKA 8ICTA 4J0QA 4BUJA 4TLAA 1ELOA 4O5EA 4RD3A 5C4MA 1KHTA 1QVRA 2Q9CA 2W6JA 5E7JA 4DEYA 2B7CA 4EZ6A 3K4GA 4DLTA 5HPYB 4C2TA 3C15C 4UNNA 4IOMA 3VMFA 3G5UA 5BOMA 3ND9A 1OJLA 4Q18A 1UADA 4RJLA 3SYKA 2OXCA 2IF2A 5J4LA 2J6UA 1N5LA 1Q21A 2GZDA 2H16A 3P1JA 2XSZD 3VNVA 3BQ2A 3RTVA 2PZEA 3NBYC 3VR3A 4A6XA 4GP7A 4OI4A 4EKDA 4R2HA 4BE7B 3L82B 1P2VA 5JMTA 2UZIR 3ZD8A 7ICEA 4TLDA 3GEHA 1E1RA 4C9BA 4TLCA 4CT5A 2VP4A 1QHGA 2GAOA 4QZBA 3CZPA 4B9LA 4LK2A 4L8GA 1KYIA 4E07A 2NOAA 4YMOA 4EBEA 2IHYA 1II9A 1Z0JA 3Q8RB 4YMNA 2BM1A 2ATXA 4GMXA 3ETLA 1ZAKA 5EXSA 1P61B 4DSTA 1NG9A 4M9JA 2ALZA 4RNOA 5KTQA 4UB2A 4TN1A 2ZS9A 1ZQQA 4EFLA 4DQQA 1ZINA 5J4YA 1XTJA 3K0EA 3ISDA 3KUCA 3P4XA 4WBSA 1WXQA 1DAEA 3G0HA 3KHLA 3LQQA 1SVMA 4D4LA 4QM6A 4UAWA 4C8MA 1ZETA 1E9SA 4G0NA 4IW3B 4B2LA 4DCNA 1S77D 4CIDA 5SZJA 5DG9A 1GSIA 1XDBA 1Z0AA 2JCSA 2IYSA 2DBYA 2CK3A 5DE3A 4UQOA 4IRUB 2VA8A 1GVNB 4GOJA 4LBZA 1OYYA 4M8NE 3R9IA 2J1LA 1ZU4A 1TEXA 4KLEA 5CYPA 4RPZA 5DN6D 3U4QA 2ZI3A 4A2WA 3U4QB 2GBLA 4M47A 3C14C 2GJSA 1E79A 3BWDD 2VEDA 3AF3A 4NM1A 1JI0A 2FU5C 1LF0A 2BJVA 1JXMA 2CNWD 2BEKA 3LWLA 1ZQCA 2IA5A 4LX0A 2WMOB 1Q1ZA 4ED8A 3L0IB 2RGAA 3X1DA 1U90A 1S3SA 4C0JA 2QL6A 2XJ4A 4NCNA 1CJKC 4LJ5A 3KXIA 1SL1A 3A4NA 4LV6A 8ICXA 4B76A 3ZZ0A 3U7GA 1A4RA 3PW0A 3QJYA 2IL1A 1B0UA 1RJ9A 1ZQOA 2IYWA 2ZRCA 4XQ8A 3FPAA 4C0HA 4NDZA 3IIKA 1RJ9B 5KUTA 8ICPA 1DAKA 4TMKA 3WYAA 4NLKA 3AKCA 4D0GA 4E22A 3AKYA 1CJMA 5JJKA 5BPCA 3GLIA 1Z6AA 3ZDBA 1NJFA 1X1RA 4G5OA 7ICKA 4F4XA 4F4WA 4KLDA 3GLIB 2IMWP 4Q03A 4Q4AA 5DG7A 1W4AA 4ASUD 2JZBA 1KI8A 4Q4AB 3CPHA 4G5GA 2FSGA 1JB1A 2JZBB 5KG2A 1Z83A 3RRYA 1V9PA 1XSLA 4Z6FA 2V4RA 1EK0A 1PUIA 1R7RA 1ZMXA 1NJYA 2H7VA 1U8AA 1D5CA 4DOAA 1CRPA 3C4JA 1S9DA 2W9AA 4R9UC 4Z1MA 5EWFA 1TF2A 1W49A 4GOKA 2BM0A 3KZ1E 2AXNA 1E99A 1YVDA 3GLHE 2V1XA 1XJQA 4KJZA 2PH1A 3P26A 4ZPXA 3DZDA 2Q9BA 2V54A 2O0JA 3K8YA 4ZIRB 5JS7A 1XD9A 4U00A 3JPTA 1CJUC 3GP8A 5KFAA 1G7RA 3KKNA 4ED7A 1QTMA 1W5SA 4QGAA 1JIHA 2LWIA 2Q9AA 3HU3A 5FL3A 2P67A 3W5JA 4IQWA 3QXSA 9ICHA 4B34A 3PUVA 3PR4A 4QBHA 3MBYA 3KQHA 5AJXA 1S0VA 4UB1A 4XD7A 1L4UA 2JLWA 3OSNA 8ICBA 3TW4A 3JPOA 1N5JA 3BC1A 4C30A 3DOEA 4LRWA 4WZ6A 3I32A 1CRQA 1ZQWA 2HJVA 4LV5B 4MUAA 1Z3EB 1LV5A 2V9PA 3ZQ6A 3GJ7A 3VAAA 1ZRHA 2J87A 2X2FA 3N2EA 4OI1A 3M4YA 1DG1G 1T6NA 1OFTA 5KFVA 3IIJA 1N25A 2BJWA 4JL8A 2KI5A 4POAA 1NF3A 2R8JA 2ZITA 2J7PD 4HB4A 2ZI6A 4P32A 5FBLB 5LD2B 2W2TA 2IHBA 3MGIA 2RGNA 3K70B 4DLSA 5BW8A 1QHXA 2N42A 3X1YA 7ICPA 1H8EA 1HT2E 1NVXQ 5TMPA 3M9NB 1KFSA 1E2MA 5UKDA 4JLNA 3LH5A 1BPXA 2VHUA 1UPTA 1N6HA 2EYQA 3BFVA 3IHWA 4X8OA 4GLXA 4CW7A 1SKYE 2FSIA 2WJVA 5JEEA 2NO9A 4KCGA 1S4QA 3U7HB 2NRVA 1XB2A 5IDVA 4YXMA 4DLVA 2ZE8A 2C5LA 4G5RA 5H70A 4BFSA 5LB4A 5P21A 3PQCA 3KTAA 4BLQA 2BVNA 4KITB 1CR4A 1KO5A 7ICSA 1VG1A 2Q0HA 3K9LA 3KTAB 2JEJA 1ZYUA 1D8YA 3M6AA 5KFZA 3GLFA 3B85A 4GXKA 2HHTA 3GLFB 5KG3A 1G5TA 1ZQRA 3L43A 3LK9A 1RXVA 2BIFA 3QG1A 4N0DA 1TV9A 2LKCA 4CT4B 1WBBA 3M9OB 4GXIA 1OW3B 3NEJA 3SHFA 5JI3E 4RQ3A 9ICXA 1XZQA 3IIMA 1C4OA 4KFRA 4FCVA 4BLRA 1P2SA 3GDXA 1OYWA 1HTWA 1OF1A 5EZ5A 2L0XA 4B3XA 1GDDA 4OI2A 2R8IA 1JX4A 5G3YA 5KU1A 4FS2A 3B60A 3AUXA 4ZV4A 3LFUA 3JZAA 1XWLA 1KK3A 1BGXT 2KN7A 4OQFA 3ZLJA 3UQ0A 5B2ZA 2WJYA 1SVWA 3OEHA 3OE7D 4IDNA 4EDHA 1MRSA 1W36B 3K0CC 4D0NA 3GIKA 5EUQB 1XEXA 5DHFA 2MUTA 3OHBA 4F5RA 1XEXB 3SBEA 2ZS8A 1IONA 4ECTA 5CJ7A 3KXLA 1JJ7A 2OXRA 1OXSC 2V6JA 2FNAA 1JMSA 4M1YA 3T1OA 5EP2A 1Q3TA 4NYJR 2GF0A 2W58A 1IAQA 2RCNA 3AVQA 3CONA 3I92A 5AJZA 2JA1A 5AK0A 3SI7A 4F4IA 4ZDKA 2BBWA 3CZQA 4FN5A 2UVVA 2HVIA 5G40A 1Q44A 5G53C 4NZYA 1JECA 1P9WA 3F5FA 3IHLA 1KDHA 1VG9B 3K09C 4QGHA 1QHHB 1LB2B 4CZ2A 2ZRFA 4O3OA 3AV0B 3NBXX 1HYQA 3RNLA 3C5GA 3RJEA 1F2UA 1DAHA 4KSCA 2P66A 2WJGA 3ZIAD 1L4YA 1VPLA 5HR5A 3I61A 1F2UB 5B57C 3WBKA 1ZBDA 3RC3A 2X1VA 3QEJA 2NRZA 2Z4RA 2ZJ2A 3UXMA 5LDDC 2JATA 3QXXA 1CJVC 2XZPA 1G18A 3A1WA 1EWRA 4B3BA 4Q1FA 3W6PA 5H8WA 1RYHA 3U3KA 3MD0A 2OCYC 3NH9A 2FFHA 2ZSFA 5JZVA 4DFKA 4M0LA 5IRCD 3RRNA 3SQWA 2NIPA 2FWRA 5L1IA 1RPLA 2X2EA 2RH5A 3I1FA 1Z47A 5E7IA 4B32A 421PA 2EWWA 2ZE7A 5KFCA 1J2JA 4LC0A 3R8CA 4XOIA 1G4AE 3C23A 1TVAA 1EFUA 4LCBA 4A36A 4J9RA 1IXSB 1D9XA 2B92A 1UT8A 1KDTA 3ND8A 5CM9C 2HLDD 1SULA 4C8KA 2EFHB 1PUJA 3CF2A 4LJYA 4YN4A 1NSTA 2ZVPX 3ZVLA 8ICVA 3T1VA 3BGWA 2HVHA 7ICNA 9ICNA 4F2RA 4KYIB 4TTRA 2V9WA 2BR0A 4RQ6A 1AK2A 4L9WA 1P9RA 3AVUA 3DZ8A 4C0QC 5JFGA 3QSYA 4TQ9A 1ZM4A 1Z2AA 2KZ3A 4FBUA 4MYCA 4Q21A 4RD2A 2D62A 1I2MA 1NP6A 3RJIA 1G7CA 5L1LA 2HW3A 1GRRA 1YZGA 3F8TA 3KKPA 5FOUA 4TL6A 1AKEA 5C1BA 4ECWA 1JR6A 4PGYA 2PT5A 3ZS8A 1WRBA 4HLUA 1ZJNA 4PAMA 4FMBB 3RRMA 3PVSA 1T91A 5C4GB 3BERA 3GQCA 2H8KA 3H7IA 3FB4A 2G1KA 3WMEA 4KLLA 4GRAA 1W48A 4ZDIA 2CHVA 5FUXA 4MFCA 4YVZA 3TARA 4I4LA 4URWR 2ORIA 8ICOA 2ZTDA 1MO6A 3W3AA 2PI5A 3C21A 2ZQ5A 3Q8KA 1FFHA 2HHWA 4TYYA 2IXGA 3R9XA 2HT6A 4RQ7A 4Q9JA 3LW7A 3SJBA 2AQ0A 3ZD9A 3UATA 2ZYWX 1X3SA 4DSEA 1QHSA 4G5SA 1NN3A 5KSOA 3HX0A 2WZQA 3H0KA 7ICMA 3CRRA 3TLXA 4TZ0A 3RH5A 3THVA 5G3ZA 1L3TA 2BCJQ 4GXJA 1EGAA 4AC9A 3HW8A 3K0SA 2WKRA 3I4LA 4AKEA 4O3MA 1XZPA 2FGKA 3IQXA 3L0SA 3TE6A 1XF9A 4TSFD 3H4DA 4Z8XA 3BDPA 2AGPA 1KK2A 8ICAA 1G21E 9ICQA 1J7KA 2BWJA 1KNXA 3E1SA 4Q7KA 4YDSA 3BB4A 3PO4A 9ICGA 1TKDA 4K81B 1S3GA 2CE2X 1GP2A 2PMKA 3QXJA 3KL4A 1E0AA 1AN0A 1S2MA 3T34A 1P9NA 8ICIA 1W0KA 1QVAA 3SBDA 2I1VB 4RZ2A 2IWHA 1X8KA 3B2EA 3CRQA 1JAIA 3P27A 1RRPA 3C41J 5KFTA 3FMPB 1AQUA 1G291 1UJ2A 2FFAA 3FMFA 4EQ6A 3VNUA 4P4TA 1Z63A 3CR8A 2D7DA 4ELUA 4EQ6B 1EWQA 2VSFA 4PR0A 5EP3A 1KK1A 2A5GA 5JECA 3PIRA 3O8BA 2CJWA 9ICUA 4EZ9A 2GNOA 8ICQA 3E5HA 3W6NA 4GFDA 2CJWB 1WCNA 3QKTA 5JLJA 4JJZA 5L3VA 3GLGA 2VIIA 2GXQA 2PJZA 5FR1A 5SZHB 3GLGB 3TUIC 1BO6A 3FMOB 1SVKA 3VR1A 5KNBA 3KJIA 1B43A 2W9CB 4OYHA 4PTLA 5JEDA 4XTCS 1X9MA 4K4IA 1R5BA 3SR0A 3CUEF 5AWFC 4DLEA 7ICFA 1ZVQA 3TR0A 2ZJAA 4ZCIA 2C9CA 2QGNA 2VRWA 4KLTA 2WAYA 5JWHA 2GEDA 2P0EA 2JLUA 5KFRA 4B35A 2BC9A 4KMUA 1FUUA 2DHRA 2ZSAA 4I2JA 5CR0A 2WJHA 3H8WA 1NKTA 2ASDA 2NO7A 4DL3A 3OSPA 1U4BA 5AUPB 2WTUA 2HYIC 3IEUA 4ERNA 3QZ7A 3AGQA 3QF4A 2REXB 3AP1A 4DSKA 3QF4B 1RYRA 3TAHA 3ADKA 2ORVA 5C5JA 1RIFA 1R6BX 4A82A 4LBYA 5C2JB 1XD2A 4G1UC 1N6IA 4LYFA 3NKVA 4ABYA 5GJVC 9ICAA 1Q1BA 1XD2B 2W6JD 5JCPA 3JPQA 3H2YA 9ICPA 4BECA 4NTZA 1SHZA 4KBFA 4TT3A 2IF0A 5JHHB 4PX9A 4NLGA 6Q21A 3ZGXA 1NVVQ 4NYMR 1TFRA 1S10A 3ICQB 1F48A 2QRNA 2CHQA 3SJZA 4XWKA 2CL7X 2JLSA 2YWFA 1NIJA 1Y63A 2ZYUX 4LDJA 4RKFA 1JQJC 1S96A 1FX0A 2IW3A 1FX0B 4UXIA 2XC9A 4Q45A 2ZROA 4C8NA 1E1RD 1RW4A 1QDEA 1SXJA 2FMQA 3CF6R 4M21A 3Q7PA 4DIEA 3DL0A 1SXJB 3C1YA 3T5JA 1VG0B 3H4BA 1E9AA 1EFRA 7ICLA 4IEIA 9ICSA 3R7WB 1ESMA 4PC1A 3CW2A 1E9RA 3KKMA 4J9LA 2R8HA 1I2DA 1TNDA 5LBIA 4YXWA 3RS2A 3C2LA 3PUWA 4JLKA 2XB2A 1UBEA 1N5KA 3OIVA 1LS6A 2CLCX 2N46A 4TMXA 3PEYA 1Q22A 9ICWA 3T1TA 3MUFA 3KQNA 2PCLA 1RRFA 4DO9A 3IHQB 2NGRA 2YYZA 1SKSA 1CBUA 1YR6A 3ZS9A 2GJ9A 1VYTA 3FVQA 7ICGA 4FWTA 1R8SA 3B6EA 2OLJA 4I1UA 2W83A 3FHCB 1XMVA 2QAGC 2BBSA 5F3WB 2KBFA 2I3BA 4YR3A 5KFXA 3K1JA 4MUBA 2ERXA 3U3JA 4B33A 1A77A 1NI3A 1A2BA 3LX5A 1SZPA 1D2MA 1N0UA 1DO2A 2WWGA 5KDLA 4R7ZA 4KO8A 4XA5A 2NPIA 3OIUA 3ZDCA 3CPEA 4OK3A 2MSCB 3EIEA 2GTPA 1KEJA 1HE8B 2V6IA 4GMDA 4AYTA 4QWCA 4BLTA 5JUMA 2W0MA 4W5HA 1NBMD 4ILEA 3RH6A 4PPFA 4MKHA 5DBAA 2FLPA 3HDTA 2K5UA 2KTQA 2AFIE 4P4MA 2QTVB 3MWYW 2VO1A 4MGZR 3AVWA 4NYIR 1KY2A 4G3IA 5KFEA 4M1WA 5TARA 4Z6CA 2BHNA 1AKYA 1G5RA 4I1VA 2O8EA 1GZSA 2HHUA 1R5OA 3FGNA 3ASYA 3L2OB 4O3RA 2JIZA 4EPTA 1NLYA 4A8JB 4JUZA 4UQGA 4BZQA 1QSLA 4OL0A 2IBMA 2FX3A 3OFND 2O8EB 2Y1JA 1R0XA 1R0WA 4L9SA 1LNZA 1DOQA 8ICWA 2OFXA 4QJ5A 3PG5A 2HF9A 5TDHA 3C5HA 3LNCA 2ZAOA 3AUOA 4RZXA 3ZVRA 4TUSA 1WCLA 1QHIA 4RD6A 3SE0A 3OIWA 3PITA 2X77A 1GUAA 1UAAA 2NZ8A 4ZCMA 1D9ZA 2WPDA 1E96A 2HCJB 4Q1BA 2NO6A 4OKSA 2YKGA 4OHYA 1M1YE 3V6JA 7ICHA 3NTUA 4I1SA 3GFKB 2IBKA 1XEWY 4R66A 3BH0A 2XX3A 3GPLA 4JSTA 5LB2A 2C2HA 2HCBA 2QT1A 3K0AB 3LVQE 3LXXA 2VP5A 3DM5A 2JDIA 1A5TA 4MH0R 1E0KA 1CULC 1U45A 5KSYA 2FV8A 1T7PA 2XNDD 2QT0A 3IDQA 3M1IA 4BLPA 2OCBA 2VF7A 3REFA 2DCUA 4B9VA 3U44A 1XCMA 4DOCA 2D74A 1NLZA 3U44B 2YV5A 2OLKA 3RS7A 4DRZA 3Q8LA 1R2QA 2PL3A 1JPJA 5J2HA 2V3CC 1X8JA 4IOKA 1LW7A 2C96A 2DYKA 1KI1A 3TUZC 1NL3A 2XNSA 4LHWA 3TIFA 4DVGA 3I8SA 3TVTA 4DSJA 1OKKD 3K9NA 3KJEA 4UBCA 1NJGA 1OH5A 1NOMA 1ZQVA 4PAQA 2DWOA 4R64A 2QQEA 4FI3C 4JWMA 4IDQA 5B58C 2VHCA 4KAXA 4DLUA 4MYUA 1IXRA 4FMDB 1JALA 1A2KC 1GKIA 1NMZA 1OFHA 4V02A 5JWRA 2IXFA 1X1SA 3QPWA 3QEAZ 3KQUA 4AKHA 2YWGA 2C04A 2RGEA 4TTQA 4DEZA 4EBDA 2ANBA 4RQ1A 4K8OA 2OG2A 4Q8FA 3ONWA 3TSZA 3QEOA 1U48A 2HF8A 5HHIA 2MMGA 4HUTA 2ZS7A 4Z54A 2MSEB 2FFBA 2QROA 1FL9A 2ZR7A 4KYUA 2CEAA 4QNMA 4BZXA 3H8SA 4X5VA 3KX2A 5CLLA 3T5KA 4ZI2A 3B7GA 4IOJA 2EW1A 3LBIA 4MITA 2KBEA 4KFTA 4NMMA 4XWAA 1Y3AA 3Q5EA 4OHZA 2G0NA 1N3BA 4D2IA 2FG5A 2GCOA 3QVVA 1CS4C 2O0HA 4M22A 4YR2A 4PHTA 2GCOB 5JBQA 2WWWA 4EFMA 2IWRA 3QEBZ 1EX6A 4Y0VA 4PO1A 5DLQC 1E2JA 2GJAA 4R63A 2V4ZA 5FUVA 3RBDA 1TF5A 1YR7A 1BOFA 3I73A 3UWKA 5B30A 5KG6A 3FFBA 4QG7A 4O5CA 1XXHE 3PUYA 5FPKA 3FTQA 9ICRA 2FEOA 3U5ZB 4KLNA 5BOLA 4LYHA 3MGHA 4A2PA 4B9SA 4QC2A 1ZCAA 5FL7A 5KT7A 4ED1A 2R8RA 7ICRA 3Q8MA 4I27A 4IVPA 4ECSA 3JVUA 3M8SA 5EE0A 1W46A 4US1R 2KJQA 2WSSA 3RBEA 4QXAA 1R0YA 1L3UA 4QZFA 5FPSA 3UXOA 4BFWA 5IK2D 3OEHD 3GQBA 2GVDC 1KIMA 2CCJA 2ATLA 2CVHA 2I9GA 1D6JA 2CL0X 2JEGA 4HATA 1Z00A 4AY2A 2A78A 3GJXC 3Q7QA 4DCUA 3RC8A 3GMTA 1OXVA 1U9IC 1Z00B 1M7GA 1X86B 2W0SA 1P4SA 3S1AA 2NMVA 1TAQA 2FSFA 1BMFD 1E2GA 1Z6GA 5KDOA 1Q1QA 3S1AB 9ICEA 4DCVA 3C1ZA 1BPEA 2AL7A 4C0AC 1PVOA 2IS4A 5J0TA 3THOA 3GV8B 4JV2A 2PX3A 3HP6A 2P6UA 1U49A 1XTQA 4KFSA 1IM4A 2ZRGA 4PZZA 7ICIA 3QF7A 4FIDA 3C7KA 3UMFA 2EFCB 1XSNA 4KLZA 4QHYA 4GP6A 4F91B 2XITA 2HUPA 2J0SA 3BRWD 4F5NA 4AG6A 1MT0A 4MKIA 2F1RA 5FBRB 5DG8A 3KTQA 2BEJA 2ZR0A 3P20A 3UPQA 1GL6A 5FBQB 4D4KA 4RQ2A 3THYA 2ZSBA 2M9NA 1UKEA 2G6BA 3GFOA 3THYB 3GFTA 1H38A 3K53A 1I4LD 2Y8EA 4JT2A 4I81A 5DDMA 4WZAE 4N1AA 1OXTA 2BDTA 2IHNA 2FN4A 2B21A 9ICIA 5KFJA 3SZ2A 4PAOA 4AD8A 2ZTCA 3N70A 3V00A 3MDAA 1BPBA 4QGFA 2PFOA 1HEIA 2IYUA 2MMCA 3OZXA 4YMWA 5TVKA 3PNCA 4IXMA 4IDOA 2C2DA 3CRMA 2DPIA 1GNQA 3KUDA 2BCSA 4Q4LA 5IHPA 2G77B 4TQRA 4TMZA 3CWZA 2AX4A 1FP6A 3RB4A 4QJ4A 4ECRA 2VA3A 1NK8A 4YFKA 3SI8A 3DO6A 5EXXA 2NRWA 3U7FB 4QZEA 2JLVA 3TJZA 3WNDA 3C8UA 4EPVA 3TSWA 2ZJOA 4P0TA 4B9MA 5DYGA 4FINA 1H8HA 4YC7A 4DDWA 2ZRAA 4QWDA 4MRSA 4EFNA 4JLOA 2OO7A 1XRJA 1XTSA 4O2RA 5AJWA 1GIAA 1TAUA 4RNNA 1IOZA 1KI6A 2H18A 2Q21A 2QGZA 2ZRDA 3AF0A 3KFXA 4L4UA 5EQTA 1KI6B 3ICEA 2A5JA 4O9MA 3VHXA 3QKRA 3QUSA 4DB2A 2R6FA 5HP4A 2GEVA 3O8DA 3QKRB 5FTNA 5EWEA 2W6ID 4JV0A 3BE4A 4ZI3A 1UKYA 1G8GA 1ZC4A 3UIEA 4EPRA 1FQKA 3TW8B 4UAYA 9ICFA 3BB1A 2OBMA 3V7LA 4JVLA 1AZSC 1PV4A 2V4QA 1ANKA 3CX7A 3QBVA 3T5GA 4QOSA 1ZNZA 5GVRA 2KZMA 1KGDA 7ICVA 4HB3A 3U7EB 4OQNA 2GETA 1XJCA 4NL4H 3GLHA 1YU9A 4DSFA 3T61A 4HYKA 2DWPA 3GLHB 4TYNA 4AKGA 3O8RA 4EJSC 3FDSA 3HWTA 3GEIA 1U94A 4LHZA 2Z0MA 3I3SR 4F5QA 2ZRPA 4MEYA 3VKGA 1E1QA 2VHTA 1ZIOA 3OEED 2XCPA 4DDVA 4QZAA 4MRNA 5BWMA 3VU9A 4M0AA 3E70C 4DSOA 3PR5B 3VU9B 3M8RA 2BOVA 2NRTA 4ZIRA 5CK5A 5EE3A 1R10A 2ZM5A 5SZKB 2OWOA 3I62A 2J0UA 3PUZA 4TURA 5J29A 2VA2A 1NBME 4KLSA 3GIIA 4PHFA 5D3MA 2ZSDA 2J0UB 2PFQA 4BWMA 4US2R 2V7QD 1NN1A 2XTMA 5FTLA 5D3MB 4HI0E 2JJ8A 4RSGA 3EA0A 4PHGA 1IJFA 1GWNA 1TK5A 2BV3A 2XTZA 3I72A 4HUQA 2UVWA 1IJEA 3GJ8A 3V9PA 1HUOA 4AK9A 1J90A 2F1HA 1GL7A 4HUQB 2Z83A 3LQRA 1G8PA 1ZM9A 5CYOA 3FWYA 2QBYA 2QY9A 8ICRA 1XNJA 8ICKA 2ZTSA 4JBXA 3WMFA 1A76A 4F4CA 4NXZA 2QBYB 4RCYA 1IHUA 2BCRA 2C95A 1II8A 3QVUA 1QHYA 1K1SA 4DKXA 1DTSA 2D4HA 1Z07A 2QE7A 4M1KA 1II8B 1P62B 1ZQXA 2DFKB 1DELA 4G01B 7ICOA 3V6HA 2PCJA 1AROP 3IO3A 4LZGA 2QN6A 1IY1A 5CDFE 2B6HA 5F9HA 4M9SA 1OB5A 3RB6A 1BPZA 1SKYB 1G9XA 4LWZA 4Q47A 4URUR 2RGCA 3U61B 1UA1A 3BJYA 3T06B 3QE9Y 1X6VA 1COWA 1NKBA 1MQ2A 3VR2A 3PVXA 1PJRA 2WJJA 1NJWA 2XY6A 1G3IA 1SVLA 5J0YA 3DPUA 1TK8A 5DSZA 2WAXA 4DEXA 4EAQA 1MO4A 3B8HA 4HZIA 2G3YA 5IINA 1DAMA 2TMKA 8ICEA 1KZGB 1TQ6A 2IYLD 1U9LA 4ED6A 9ICVA 4BLOA 3TRFA 3LXRA 1JJVA 1AGRA 1FZQA 1KDPA 1ZQNA 1OHHA 1YHNA 3MMPA 4JIMA 1ZP6A 3IBGA 1D2EA 4KTQA 1N6LA 1S1CA 2QP3A 2GXSA 1WBDA 2JEFA 3L8YA 2EVWX 3ISCA 5KFGA 1OT3A 4DUGD 2GBLC 2BDPA 4CEJA 3KHRA 1VTKA 4QL3A 4M9GA 5A4JA 1CLUA 2D7CA 4CEJB 3V7KA 1WA5A 1FPMA 3DHWC 5KT5A 2ASLA 1TUIA 4Q1DA 4XIGS 4HDCA 4F8RA 2HV8A 3SS8A 4XRHA 2YINC 3TBKA 1GAJA 2GEUA 3RJGA 1OFUX 2NQ2C 3RS0A 1NK4A 1E9DA 2LKDA 2Q0ZX 4A0RA 2Y1IA 4G3XA 3WYFA 4YMTA 5K8TA 4B3FX 2NRXA 2H57A 1L3SA 4RD4A 4ZO4A 4P4OA 1Z8FA 1KK0A 1Z6XA 2XAUA 3FKSD 4Q1CA 3W5IA 3B9QA 1P5ZB 2CVFA 1XFAA 3KHHA 1W0JD 2YNMA 1PLKA 3BAFA 2OILA 3NEYA 1G1MA 1G3QA 2AGOA 2JLXA 3AVVA 2VSOA 4JBWA 5GJBA 1F6BA 5D46A 1HH4A 3CH4B 2DWQA 5KFUA 1S0UA 5L3RA 1FMJA 3M9MB 1KJZA 1KY3A 2OV2A 3PX4A 4YONB 3A6PC 1K8RA 4OK6A 4MGIR 5J0QA 1U0JA 5J0SA 3T5LA 1ZIPA 4PPNA 5GVSA 3AF2A 1UFQA 4O3SA 1KI4A 2HJGA 1GITA 2QM8A 2F1IA 2VPPA 3KKQA 4Z6DA 1ZNYA 3FDIA 2QPAA 5DGXA 1EFRD 1JXEA 5IF9A 1ZCBA 9ICCA 3PV0A 4BQSA 3W90A 3OGUA 1QHHA 1YRAA 1SKRA 3PR1A 4PO9A 3IKJA 2W8KA 1TL7C 3PXGA 2GCPA 4PXAA 1X9SA 4BFUA 4A2QA 2HT1A 2ZYVX 1M7BA 3CM0A 3T5HA 2XSZA 1MO5A 2FH5B 2VP0A 1HY3A 2JAQA 4NBSA 1OV4A 3RJJA 2D2FA 4IR1A 2QNRA 1KO4A
chains in the Genus database with same CATH superfamily
1KMHA 1BVUA 2XUGA 1S2LA 1OX4B 4PANA 4KQKA 3EUB2 3R9KA 4MB0A 1II0A 5AMXA 1YJAA 3PD7A 5JJCA 1R12A 2DF8A 4OGKA 2FSPA 4IO1A 4U2EA 1VCOA 1QAMA 2B8TA 2QSZA 3HBNA 1A1VA 4PG4A 4DV0B 3KO8A 4ZO6A 1U8ZA 8ICSA 4R8MA 3W8EA 1YZTA 3L8ZA 4D98A 4CVNA 5ANRB 4IVRA 2PR7A 5I4KA 3IKVA 3KYCB 4KLUA 4QUGA 3IBSA 1GFWA 2OBFA 1KVTA 1PV1A 1W36C 2HA4A 3K0BA 2F76X 3GW8A 3ZHQA 2O8DA 4AI6A 4F5PA 1M2OA 4YK7A 1DAIA 2RE8A 1EFCA 1JXLA 3O4IA 2VSYA 1NRXA 1MABA 1NK6A 4GC7A 2DFDA 3UB4A 2QAIA 4NE2A 3BREA 4A15A 3WRYC 2I3AA 1W1UA 4G1VA 1T36A 2DKXA 4LZOA 4JYBA 3M6XA 4PZAA 2A3RA 1TVMA 2PZGA 1FJXA 4EYSA 3NHSA 3FDXA 3IERA 5FBZA 2KK0A 3BHMA 2G25A 4XB1A 2EYUA 1XNQB 2YN2A 1DX4A 4I08A 3RV4A 3ZGZA 1MW9X 3GY0A 2O7RA 1M34E 4HWGA 4QZ9A 4J16A 2W9BB 3I2IA 3TI0A 4J94A 3RQIA 1T0JB 3BIOA 2AVDA 2EQAA 3DG9A 1GPKA 1Y6RA 2NZWA 4CL3A 3RRZA 2WV9A 2QOEA 5DTMA 2IHMA 1SEPA 4TL8A 3E3OA 3ZIAA 2J41A 2P79A 1W88A 4UOEA 2NV2B 1NW3A 4S24A 3SJ7A 2X14A 1UOPA 3AU2A 3IXMA 4FPXA 5THQA 1E2PA 2N1RA 2H2AA 1MSWD 3LD9A 5CIWA 2ZVQX 1C0EA 3C7AA 1DCMA 1V96A 4Z1MD 5IZCA 1TJ3A 1KYTA 4Y2VA 1OTXA 3C7TA 1SXIA 2Y0PA 4ED0A 2YJ5A 3PGA1 1JEOA 1ZLXA 3K9WA 5EZYB 3ZDAA 1HETA 2C7BA 2NVOA 4AJNA 3LOQA 1WD7A 3C3EA 2H2DA 1CEQA 1H2YA 4B7XA 3FCOA 5AKZA 4GQBA 1VE5A 3CS3A 4NK4A 1QQ6A 4S35A 5A2QA 1U63A 4B46A 1P5JA 2F3TA 2ZWIA 5KB3A 3LAWA 5GONB 5IJ0A 2RARA 5AK5A 3N0RA 3AH8A 2H0AA 2O50A 3OCUA 2A7QA 3AKDA 3A58B 1NVUQ 2ZE6A 5EIBC 2VDJA 4DYHA 1ZVMA 4IMPA 1TF7A 2C5HA 2ZTHA 4AO6A 3BWYA 1JZQA 1ABBA 2G36A 2H92A 2ASJA 4Y1FA 4V0SA 4I5FA 3SP1A 4CM8B 3FD8A 4H9GA 4PC3A 2B8WA 3UXEA 4EYGA 1XYYA 3A8TA 1Q3KA 3CR3C 2O1SA 4Z0PA 3TG8A 3PY8A 1DIRA 1I4TD 3V1MA 2Z6AA 2CZCA 3EXHA 1XU9A 3GG2A 3AERB 5E7QA 5LP6C 2R62A 4P4SB 5CIQA 4YRJA 5TRTA 1A27A 4TTVA 5BVGB 5J4VA 5ILGA 5HNKA 1UFRA 1PCXA 3CZMA 4UTVA 2E3JA 3OQ6A 1DIOB 1NNUA 4PINA 3DF7A 1KO1A 3GH1A 1X39A 1XRPA 1B6TA 2VQDA 3C3KA 1IEXA 2JAPA 3PQFA 4MS4A 4O4HA 3HPQA 2XVAA 2ECPA 3JZFA 4AF6A 2PO5A 5EKSA 1Y7HA 2VT7A 4K46A 2XNHA 4C20A 3H7AA 2OM6A 4YREA 2FFQA 1Z12A 4C7OA 4YO8A 5HKOA 2DLCX 1JKJA 5DHQA 2WAAA 4G4SO 4QLAA 2C28A 4WCDA 1KMQA 5B37A 1V4VA 4BQPA 1J99A 5LZ2A 1N6NA 1LK0A 2ATCA 4IGEA 1G98A 1Z5ZA 2P9YA 2X8AA 2FQYA 2BGWA 4AW9A 2ZB2A 4PO8A 1UBSB 4B4VA 1T3QA 3IAUA 2ZCUA 2HAEA 3QLUA 2DFVA 3HI6A 4L5CA 3OY7A 3F6CA 1ZQTA 4L95C 1D4ZA 2WILA 3BGSA 2NYUA 2Q6LA 5C5IA 5KNLA 3TZEA 4URYR 5JCOA 1YJ8A 4PC2A 1QGAA 3SIXA 1FLNA 3GJSA 3GP3A 4K3VA 5JY6A 1N78A 2OY0A 1LTQA 4GYWA 1G7TA 1RLTA 2RIPA 2VRBA 3KP1A 1VL5A 3R20A 4Y2JA 4PGMA 2C9BA 1GG2A 5DW3A 5J2BA 1HNXB 1N5OX 3ZUGA 1KQNA 4DLYA 4M8IA 1FW8A 5HFNA 4S0ZA 3SKYA 2W6QA 5EQDA 3FNGA 1MX5A 2QI9C 4YP5A 3EIUA 3Q72A 2EP7A 2DEUA 1A5AB 4NCXA 2ZUWA 4G0YA 4BQEA 4DANA 1OYVA 5KFSA 3HWX1 5E95A 4G84A 1TPZA 5DI9A 5ALPA 3INTA 4Q4CA 1H4VB 4GGPA 4JBYA 1YA4A 4EMBA 3N59A 1K92A 4MUEA 1J5EB 1OYOA 2M6KA 2C98A 2ZVJA 3E7DA 3OM1A 2I4IA 2G8NA 4G0QA 4LFAB 4IQVA 4W1RA 4DC9A 2B1JA 3JQ8A 4JEIA 2ACKA 3ZNNA 2IUSA 4DR4B 1YAJA 2YHIB 2W37A 5I4CA 3H5TA 5K6AA 4BQSA 3GK3A 2PGNA 1KSFX 1I4EB 1P0PA 2FW1A 5IXJA 1OVMA 5AVSA 3C43A 3BXFA 3PKJA 3TD9A 1H1LA 3FZYA 4MIEA 4FBLA 4JC0A 4A6DA 5DYNA 3IEXA 4QZIA 3EA4A 4IQGA 5BR1A 4JSYA 1JBKA 4TV8A 4FHEA 2YXPX 3MWKA 1GLVA 1M6NA 3D5EA 2C8VA 2HRBA 4N6GA 4B75A 2F6RA 5KG7A 3QHAA 2AZMA 5A9SB 4ZOHC 3W2HA 1G9SA 4GX5A 1F12A 3LRTA 5ECDA 1AQLA 4GL2A 2WQ6A 3LLSA 3WFZA 3WNBA 2R9VA 4OHVA 5TC4A 2G0AA 3LYUA 1UFOA 3T4XA 3V2UA 2C22A 1SQ0A 2VYFA 3IUBA 4MI3A 4F96A 2D0IA 4HAIA 3QU5A 2IXTA 1YRHA 3U62A 1O3YA 2DZDA 4JMUA 3L4SO 1GPYA 5HE9A 1KAHA 3JAWB 1CP2A 2IHUA 4DPMA 2ATEA 5I45A 2BGTA 3GDWA 3V5NA 2CC2A 4TMYA 1R0KA 2JKVA 5L4NA 3FW1A 4ZGWA 5JWRA 2FMSA 2HA3A 1H4TA 3DH0A 4GNKA 4UC0A 1E1QD 2R6GA 2O2CA 1RFLA 3AKEA 3NP7A 3DDOA 4QG3A 4UAUA 2AE2A 4WCFA 2H2WA 1ZRSA 2QN3A 1SXPA 5IFKA 5JO9A 5ESXA 3LV8A 4WFKA 1XNSA 4OH1A 5K4LA 4G4GA 4UPEA 1SCIA 3RAPR 1AQNA 4K5QA 1UPAA 1K5DA 2VHYA 2XUKA 3THXA 5H9VA 3RASA 3IV6A 4QXQA 3FPEA 4QSHA 3BVPA 1FLVA 4W5QA 2H3ZA 1MORA 3RHFA 3GA5A 3LHDA 3N2KB 2CCGA 3URKA 4ZZ3A 1L7MA 3MCWA 3DQPA 3OF3A 5B6JA 1R64A 1UOQA 2JZNA 5DGTA 7ICJA 1KFEB 1G3RA 4V03A 1GCAA 1LDMA 2XGPA 4W9NA 1Y6FA 4O3FA 1J0CA 3MTQA 2HYDA 2R8GA 4M53A 4YXJA 1XWWA 1E61A 3PCTA 1S2DA 3PDUA 2J4DA 4KIJA 3DW3X 4DLTA 4FYWA 4DIOA 5KCZA 1P6UA 1N5LA 4ZFNA 3DZCA 4YIKA 1I36A 5F5NA 3PWSA 4TLDA 3M9XA 1EE2A 3VI3B 1T2EA 2GAOA 1LI7A 5ITWA 4EBEA 1II9A 2FPPA 1U0TA 2VJ4A 4DSTA 5F2NA 5HQ3A 3IUJA 1IHDA 2TMYA 4EFLA 4L7VA 5F64A 3BL5A 1WXQA 5IVPA 4O4LB 4TZKA 4UQOA 4NCAA 4GOJA 1OYYA 1UBKS 1G59A 2KP7A 2VEDA 3OJCA 1NJ6A 4LXXA 4WCVA 4M9UA 2DF4B 5LA6A 4LV6A 2IYWA 2G17A 2I76A 4USAA 3ZZMA 2V4MA 4WJZA 3FYCA 4F4WA 4EL0A 5KWEA 4G5GA 1EJ0A 5KG2A 2HI0A 3WNQA 1V9PA 1EK0A 5ITSA 3F8WA 1U8AA 1A4XA 2I2XB 1GZ3A 4UEJA 3WGYA 3DZDA 2XWSA 4C88A 3MPUA 3A6DA 2ZJ6A 3RUAA 4GWKA 4F3CA 3PUVA 3TW4A 1N5JA 3IEIA 4UB6U 3Q0IA 4TT8A 3VAAA 2J87A 3MUOA 2Q1WA 4WLOA 3TW0A 3NT2A 3AR7A 2C57A 9LDTA 4RXMA 5BW8A 2X6QA 1SJ9A 1YBFA 1QFSA 2F44A 4HTFA 4JLNA 3LH5A 3BFVA 3TRIA 5IDVA 4PW0A 4KH1A 4CMBA 2CFTA 3PNVA 3PQCA 1VG1A 3AMVA 3K9LA 4PFQA 4I5EA 4UM5A 1G5TA 3BK2A 1SQFA 1SCNE 4E2ZA 1A69A 4FCVA 1EVKA 1DQYA 2QYOA 2M2IA 2FRDA 5FLYA 4EVSA 2M98A 2VEOA 2PNFA 2WJYA 1MRSA 2YFHA 4D0NA 3GIKA 1G8KA 4FOOA 3F5QA 1NXPA 3O0FA 2M32A 4R2LA 1IAQA 5BSTA 1RG6A 1R6XA 3P9KA 4C4SA 2FMHA 1KDHA 1K7FB 3O8LA 4IH9A 1SNYA 3DEHA 3V1NA 3PQ5A 3RC3A 2H7YA 3VPHA 1DJNA 2AFHA 4FEYA 2NIPA 2FWRA 2VN8A 2EWWA 5DBEX 3OCYA 3VPFA 1TVAA 5AKKA 2C4HA 2BY4A 1LX6A 4KXMA 1P18A 1CK4A 5CYGA 2NNLD 4TTRA 1USWA 2Q2VA 1KR2A 2RJOA 1P4AA 1O0BA 5L1LA 4GC5A 3THSA 5TVGA 1Z4PX 4PGYA 1UMBB 3S8YA 5DK4A 4YEDA 2A1TR 2AV6A 7ICMA 3TLXA 2CB9A 2ESRA 2QX7A 5LLTA 2YYAA 1XZPA 4CU5A 4YJDA 3L0SA 4X63A 1F0YA 1KNXA 3CSUA 2QL9A 4H6XA 2JGMA 4JX8A 2YXDA 5DT9A 3EHEA 2K2QB 1UJ2A 3CR8A 4ELUA 3ZLUA 4IJ6A 2IZOA 1VBFA 4RULA 4TUYA 3CLRC 5FR1A 4Z6KA 4MCIA 4D79A 3KJIA 3SMVA 2HHJA 3ETJA 5G4KB 3UEOA 2ZSAA 3FAHA 4D5GA 2YMPA 3IEUA 2GVNA 2IHJA 2EHJA 3PE6A 4G1UC 1J9ZA 4PG6A 1XDGA 4KBFA 2X8JB 3LGXA 4XWKA 3SJZA 2JLSA 1NIJA 5EPOA 1G4HA 1JQJC 2F90A 5HS6A 3CUVA 2AKEA 4R8SA 4B6RA 3H4BA 1TM2A 1RM0A 3DEYX 1EKXA 5HKBA 2Z6QA 2J9XB 2LYBA 4C14A 2ZUEA 5I4BA 4MAFA 1Z8HA 5FI3A 2Q2WA 5I7VA 1AMUA 7ABPA 2OLJA 3ZTWA 3FHCB 5AI8A 3DL4A 1K2VN 2WWGA 5BNIA 5KDLA 4G4JA 4KO8A 2MSCB 4IPTA 1P5HA 3HGTA 5ALWA 2VG8A 1RCFA 1WDWB 3OZTA 4M1WA 1ZGJA 3ROGA 4Z6CA 4IH4A 3L2OB 3TM5A 3WL7A 5J47A 2XLCA 1YT5A 4JB0A 4W6ZA 2WTNA 5TQ2A 2JFWA 1TO1E 1PGPA 4JC8A 2X77A 3RYHA 3KVYA 1AQIA 1QF6A 5ALLA 1EBBA 1E0KA 4AY3A 4FZ5A 2C0CA 4DRZA 5J2HA 1S89A 4J9UE 4UCFA 4MWOA 2I3GA 3U09A 2WW8A 1K5HA 1ZSNA 3FX2A 2LIVA 4FI3C 2IXDA 5T8KC 1XZFA 1DV2A 4BEWA 3KQUA 5I51A 4K8OA 3S40A 1U48A 1FIUA 2DUJA 4ZI2A 4MITA 5A1JA 3S2EA 2SECE 1RZRD 4BC1A 1BAPA 3RTAA 2HF7A 3CUWA 4XJTA 3CISA 4B9SA 1A8SA 4IVPA 1NM5A 2CBXA 2IRWA 4UARA 5EE0A 3GMTA 1WVIA 3H83A 4JUDX 1E2GA 1NT4A 1Q1QA 4D6YA 2FCRA 3HP6A 2P6UA 1FDVA 3ZWCA 2ZRGA 3O21A 5F35A 1CF2O 2EFCB 4UHCA 2PMZF 4F91B 2XITA 3TD2A 4DV1B 2O6LA 3FGZA 3P20A 5FBQB 1AUPA 1LNSA 4H0FA 2JH9A 5EXEA 3HDQA 2PDAA 3GRYA 1OXTA 2JBAB 2DP4E 5CVDA 2ZTCA 2KSOA 3C3JA 3WB0A 2GT1A 3AHIA 4GE3A 4D8UA 5J59A 3UV7A 4DHWA 1RQPA 2BR4A 2QGZA 5JXHA 3JQAB 3ICEA 4PSUA 1T1RA 1GUFA 4GWLA 1ZNZA 2VJDA 5GVRA 3I5UA 5L6MB 4NL4H 3GLHA 3MHPA 3BK1A 5ES3A 4GVPA 2W2MA 2ZRPA 1FU4A 2XCPA 2H0RA 4QUBA 3DFZA 1XNRB 4ZV7A 2WA2A 3R3HA 2GUWA 4L78A 4KLSA 3Q87B 1P33A 2WIDA 3R6GA 4X92A 1W6RA 3P2KA 4DSAA 4XUEA 4MARA 2VDQB 4WN3A 4XQ0A 3FWYA 1XJ5A 1DTSA 4Z0TA 2QE7A 2VQFB 1P62B 2DFKB 2PCJA 2HU2A 1Z3CA 4Z1OA 5CG2A 2D0PB 2OBBA 4G0OA 2PAAA 1NKBA 2WJJA 2B1RA 5JROA 2TMKA 2HLHA 2Q45A 3TRFA 4ALNA 1AGRA 1OHHA 4I9FA 4D9GA 2BDPA 3EFOB 2ZR8A 3FNRA 2JARA 1GZ7A 3TBKA 2YINC 1JKFA 2YV3A 1E2BA 4N5DA 1G3QA 1THTA 1HH4A 2J5BA 2PNJA 3ICWA 1SG9A 4OK6A 2GBPA 3AF2A 4OFBA 2XD4A 1EFRD 1F2VA 3MRXA 4QPPA 7MHTA 2AJBA 2BMVA 1X9SA 3MT7A 5LQKA 5EWGA 1Z0SA 1GGJA 1YOVB 1L5YA 5DNYB 5LMCA 1A4IA 3EXFB 1FFBA 3RJZA 5DWDA 1XTIA 5I9BA 2P5UA 2P1ZA 2Q28A 3UXNA 4NBWA 2A1JA 3HR4A 1BE1A 3TVDA 3HCDA 2WTAA 4KXLA 3VH1A 4GKKB 1JEDA 3BYZA 4DOMA 1YZKA 3EBPA 3BKWA 2ODEA 2NSHA 4LE2A 5H83A 3AINA 1US8A 3H6KA 3ELBA 1UBTS 3EEQA 1Z1BA 5SICE 4CMEA 1Q0PA 4YHBA 2RKOA 2WYUA 3L41A 4MIKA 4HNAB 1G0OA 2Q6TA 3LNTA 3KLOA 1K5OA 2ILTA 4RS4A 2VPZA 3LSTA 1VA4A 2AEJA 3AVXA 3O6VA 2EU8A 3LO8A 2QD4A 3HR8A 1B3RA 4O1IA 1GA4A 1GNLA 1DUIA 4R8UA 2ANCA 4GVXA 4HQFA 4ZT3A 3WYEA 4Q0MA 2QUBA 1VLQA 4H6PA 4KI7A 1UQRA 2R48A 5LJLA 4N7BA 1FQJA 5EYPB 5JRZA 1ZVVA 2ZRBA 1P2DA 3OQIB 2YWHA 1ILEA 2OOSA 2VATA 3G02A 1VKHA 1ZQUA 1T6ZA 4TV9A 5KO2A 4ZYTA 3LW8A 4K6FA 4FXPA 5L3ZA 4YAIA 4LJ8A 1G6Q1 3ZI7A 3IODA 4NR0A 2EAUA 4F4DA 1YUMA 1KJWA 3LX4A 1XI2A 3T3OA 2VH2A 3T4UA 3TYXA 4ZJPA 2RHDA 2Y76A 2W3SA 3T3GA 3BXEA 1ZGCA 3UKOA 5LOVF 3TMAA 5JSZA 3W1VA 1U2PA 3C2MA 16PKA 3WLLA 3JAKB 1CDDA 4ID9A 2B98A 1OZFA 3S2GA 2ID7A 1QLNA 5DO9A 4R98A 4ZVPA 4FYMA 5JPDA 3NVAA 5IDQA 2WJ6A 9ICLA 3B36A 1WW8A 2GJ8A 1SD2A 2B99A 4J49A 5J2IA 1HDGO 5BN4B 3IKMB 2KQUA 4J9KA 4J3JA 1K68A 2FPGA 1IAVA 4JDPA 2P6NA 3P94A 2BEUA 3W8NA 1IBSA 1ZICA 2QMZA 4M2YA 4C2AA 4GLJA 1SL2A 2ZSKA 4RF4A 5CBPB 2PWYA 3AUSA 4A8JA 3C98A 4WLUA 1H3FA 1M1YA 4RA9B 2I33A 2HPVA 1D2NA 3KVRA 3FCSB 1W5FA 1Y9EA 2DQSA 1D2HA 1GKYA 1Y1RA 4O8CA 3MR6A 2NX2A 2P3OA 4G2NA 1MW8X 3LVWA 4NC9A 4O0IA 5BW5A 4AN4A 2J6BA 3DCYA 2HJWA 4ALJA 1BDJA 3O4HA 4BCDA 2C20A 4OHOA 4L0DA 1TQHA 3PW4A 3IAS1 1NFQA 1MP0A 1JN3A 1AS2A 2A35A 3ZGOA 2YY6A 1UOOA 1OGYA 1QTQA 1C7JA 2EIHA 3D31A 3LUDA 4JB2A 4M1EA 3BFXA 2WLTA 1A97A 2B5WA 4TL7A 2RHWA 5BN5A 3QG5A 4C6HA 4I4NA 4IJMA 1D4AA 2W3RA 1BPYA 4KPFC 4BEJA 3R5KA 4MJXA 1JHVA 1Q1EA 3AY6A 1AF7A 1EXVA 3OQ1A 2IIPA 3UJCA 3HM2A 3CEJA 4Y0AA 4HVCA 1XA4A 3G82C 2I6QA 5L7TA 2ZJ7A 1E69A 1ZX1A 2K4HA 1G3UA 4EHBA 4AJLA 4DNXA 1GEGA 5HA5A 5C4IA 2H5IA 3GLKA 4E22A 4DSUA 4NNOA 5EHNA 2EZUA 1D8LA 2PL5A 1LDBA 2O0LA 2XH8A 3GPDG 1GQSA 3ZVMA 5MN6A 4WBXC 3DTNA 1ZJYA 4MFAA 4J9OA 4CKEA 5KFHA 3HT3A 2AXPA 1IXRC 3V4ZA 1PW7A 3Q8PB 3SM9A 4TMTA 3G2MA 3UCFA 3GJ5A 2G9QA 1X92A 4IFBA 5FA6A 3A1CA 2P1DA 3U3ZA 3UGQA 4DL2A 3LGSA 4DYVA 2J3HA 1AA6A 4NAUA 1NI4A 3N53A 4K6KA 2EX0A 2IDMA 3ZQJA 4GW3A 4QPNA 1KP9A 4MUYA 2KMDA 1NBMA 2AMVA 5DBIA 4TKUB 4QBIA 3IIEA 2HBKA 4L57A 3RPEA 4DFMA 2WJZB 1NZFA 4YCJA 1QF9A 3CIOA 3RT7A 2QM3A 1IJKA 4B8WA 5CDFA 2WUDA 1X94A 1NJZA 2HRCA 5DQIA 2R11A 4HDQB 3COVA 4PEVA 1AHPA 1L5UA 4TLMB 5DGAA 3WGOA 2AK3A 2MTBA 1FYXA 3T9AA 4OJQA 3PR2B 1T4BA 3REQB 1HDYA 1FDUA 3RRGA 3CCFA 1FYWA 1AXGA 2CMFA 5KT3A 2WFLB 2X0FA 5I9NA 2A5FA 4ZCQA 1NPYA 5IIOA 4LRXA 1U3WA 3VHQA 2BQUA 3WP1B 1VYHA 1FX1A 1IBLB 4G81A 3L7DA 5MHTA 1JQLB 3DP9A 3NHAA 3PL1A 2JLZA 5FTMA 1SXJD 3D2LA 3BQ0A 5KT6A 1MPXA 4LZLA 2ZTEA 2J6TA 5IK2A 3WNCA 5AUQA 3L7BA 1BMFA 1IYZA 5K8UA 2OE2A 2VH5R 1GYQA 4JQZA 4JJEA 4KTVE 4JS0A 4W8HA 2C03A 4YNBA 2WB2A 2QRJA 2OGTA 2IITA 2PIDA 3A0RB 5DTJA 4MYHA 3HGQA 4O2AA 5KBYA 4OY3A 2MYUA 1WSDA 3GD7A 1F6WA 1KKMA 3LWDA 2DRIA 2G1UA 3KZKA 3PTAA 4RNMA 5AM2A 3DLTA 3TZHA 3WL6A 1TMYA 4EB8A 4N41A 1ITZA 5HRCA 1MA0A 4RK7A 2UVQA 4HKTA 2R8ZA 3SHWA 4MRMB 2Y66A 4XUSA 3BMQB 4K0RA 2AZXA 3VNSA 3A1TA 2ZI7A 2KG5A 2VYVD 4MWDA 3PFFA 4QECA 2G6TA 3LT1A 3R3JA 4P9NA 4CCHA 1ORRA 1B73A 4TTPA 2WA1A 3UK6A 3UG6A 2QQ5A 4O1HA 1T4DA 3PDIB 2WAOA 2NTYC 1RKBA 1TU0A 2YY7A 4MKGA 5CB6A 3H75A 2GGSA 3TCXB 3AETB 2H4XA 4JVSB 4E15A 3L9XA 2DR3A 4OM8A 5JC1A 3ZU4A 4KAAA 3DEEA 2CZGA 1IL0A 4LRQA 1JFSA 2FKAA 2Z8YA 4J8PA 4GZMA 3AM1A 4WHMA 3ISBA 4XIIA 4OTZA 4AIRA 5I8WA 3L8FA 1AUQA 1LVUA 2AXQA 4XEHA 3OESA 3EQ6A 2FMTA 5AOCA 4RQMA