The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
99
|
sequence length |
319
|
structure length |
293
|
Chain Sequence |
GSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVNIMAYSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Insights into the mechanism of Rad51 recombinase from the structure and properties of a filament interface mutant.
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Saccharomyces cerevisiae
|
molecule keywords |
DNA repair protein RAD51
|
total genus |
99
|
structure length |
293
|
sequence length |
319
|
ec nomenclature | |
pdb deposition date | 2010-01-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08423 | Rad51 | Rad51 |
A | PF14520 | HHH_5 | Helix-hairpin-helix domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | 5' to 3' exonuclease, C-terminal subdomain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |