3LDAA

Yeast rad51 h352y filament interface mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
319
structure length
293
Chain Sequence
GSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVNIMAYSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of Rad51 recombinase from the structure and properties of a filament interface mutant.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD51
total genus 99
structure length 293
sequence length 319
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ldaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ldaA02
2IMWP 1KDRA 4TLEA 2WWHA 4NYIR 2AQ4A 1FNMA 4JL6A 3NG1A 4Q1CA 1KNQA 1IN7A 1N2CE 3A4LA 621PA 5HMLA 1LY1A 5HNKA 2BCGY 4R2HA 1BKDR 5HR5A 1E2NA 3UXMA 2ANCA 4RQ7A 4HAZA 4AG5A 5BOLA 1PUJA 1X86B 1G19A 4KBGA 2WTFA 3GJXC 821PA 2HCJB 2ZRDA 2F3TA 2VBCA 4PHDA 4Q18A 4KAXA 5KFJA 1KKMA 3LK9A 5IK2D 3X1YA 2ZJOA 1Z29A 2ZRKA 5M04A 1N6OA 3NBZC 3TSZA 3QBTA 4MKIA 1RE0A 3H8JA 1AS3A 2JIZD 2WPDD 3RS2A 5FBVB 1FUUA 2GAOA 2IEYA 2CHVA 2E9SA 2V7QA 4UKDA 1V9PA 3ZD8A 4B2PA 4BZPA 5J2KA 4WZ6A 3EPKA 5FUVA 5D3MB 3CB4A 5DLFA 3KQLA 3SU8A 1IM2A 221PA 5EXTA 4CF7A 2RGNC 4D4JA 5FOTA 4DWIA 4US1R 2ZE7A 2DYKA 4FMBB 5KG5A 1KO7A 3LBNA 3C23A 3DKPA 4BXOB 3A4MA 2ZRGA 4OHXA 4QGAA 1DG1G 1CUKA 4LCBA 4ARZA 4XWAA 3UG7A 3TAHA 2G1JA 3UANA 1E1RA 3AVPA 1XPOA 4GC6A 1IOZA 3F0TA 3NH6A 4AI6A 1SKRA 1KYIA 1N6HA 3KTQA 2CE2X 2QMUA 4YDHB 4ED7A 3AF2A 4Q48A 5G3ZA 5P21A 1TNDA 1NL3A 7ICJA 3LXXA 2B7CA 4IQWA 1DOAA 1UBFA 3G6XA 2KSQA 3RRYA 4FXPA 5J4VA 3DL0A 1U49A 2ZSBA 4JBYA 4URUR 3VAAA 1JXMA 4RD3A 3SZRA 2CCJA 2KN7A 3PW5A 721PA 4B32A 3CWQA 3IPYA 1RVDA 5DN6D 4CEJB 3C5FA 3I5YA 3QKRA 3FHOA 1Q3HA 3C14C 1ZU4A 4DIEA 3ZVLA 1WCV1 1E79D 2QMOA 5DGAA 5C4GB 1JB1A 4ECTA 1G64A 4TQSA 2ODWA 1P2SA 3NBYC 3X1ZA 4DCTA 1UBCA 2F55A 3R8CA 4WZAE 3KQUA 3PXGA 1HA3A 1MO6A 1TTTA 2WJHA 5F2EA 1D9ZA 3IM1A 1EK0A 8ICXA 4QKQA 1TK5A 4HLUA 3KKOA 1JAIA 2GVDC 4DOCA 1T8UA 2Y8EA 3RANA 4XSGA 2RGDA 3TARA 1P6XA 1XWIA 3QG1A 4HZUA 2GCOB 3MSXA 4M2YA 3TNFA 5FI0B 3TSWA 3BB1A 1NVVR 3SHWA 5HTKA 2R65A 2GF9A 2DWOA 1ZQHA 4F5NA 4IR1A 4NYJQ 2HEIA 1KSGA 3LBHA 5D49A 1VCMA 5J2CA 4RCYA 5DQHA 1FPMA 1KSPA 4XUSA 1F2TB 1Y63A 3EPGA 2PMDA 4P4UA 2OLJA 5JHGB 1W44A 3KQHA 3BOSA 3KJHA 4B9NA 1Z6XA 2WIAA 1N0UA 5C1BA 1NF3A 3BE4A 7ICTA 5KUTA 1XTJA 2Z83A 4KV9A 4ERNA 1W4CA 1VYVA 3EA0A 4R71A 3O47A 1OPXA 2W8KA 5KPJA 1KKLA 2O8BB 5D46A 2LWIA 3CNNA 3PITA 4Q44A 4QNMA 4TUQA 4OI2A 5EE5B 3R8FA 4GDFA 3VX3A 4HAWA 4MEXA 5FUYA 3IEVA 4A9AA 1MQ2A 1PVOA 4DSOA 1LS6A 4UQOA 2ONKA 3K09A 3KX2A 3EARA 4NMMA 2C2DA 1II0A 4CGZA 1CXZA 4UB2A 4K4HA 1LF5A 2CLSA 2CK3A 1QHYA 3U3KA 1AKEA 1ZIPA 4FW9A 2GCNA 1OKKA 4I2HA 2W6ID 4M9QA 3VR4A 3SV4A 4NY8A 5KG4A 3AKDA 5DG9A 9ICSA 2FNAA 2ZUDA 521PA 4TMWA 3BGWA 8ICHA 1WF3A 1D8TA 2QEQA 3DMNA 2HVIA 4I1SA 4P32A 2MSCB 2FMSA 1XJ0A 2QMEA 3EC1A 3MFHA 3G6YA 2OCAA 4A0FA 4DCNA 1JXLA 2CJWA 3MFYA 4POAA 2VSXA 4BLQA 4KCGA 1W5SA 2EFGA 4WW0A 3EZ5A 3GEHA 2J0UA 4IVQA 3WNDA 3UMRA 2ATLA 2HV8A 2PX0A 2XX3A 4LV8B 2ZIAA 2V9PA 5IIIA 1MKYA 4RZRA 4R9UC 4C8MA 1F6BA 1FTNA 3IBYA 7ICSA 2C95A 4QZFA 2R2AA 4HEJA 4OHZA 2ZI4A 3BFVA 4WXPA 9ICKA 2Q9CA 4C0QC 1E9EA 4DT1B 1MQ3A 3RVBA 1ZQGA 4YMUA 5BPCA 1TF2A 1JIHA 2ATXA 2W6JA 4MKGA 1XCPA 1NBME 1ODFA 2PZFA 1EWQA 2HT6A 3QXXA 1IXRA 2C28A 4A1FA 2JASA 5EE3A 1D9FA 4M9HA 2PT5A 2VO1A 4HATA 3UIEA 2JLYA 1XXHB 3KKPA 1W47A 4YMNA 2MUTB 1G3QA 4OI4A 1JR3A 1EGAA 5H8WA 1ZQAA 2GTPA 4DC9A 4WIAA 5KOYA 3TFSA 3QIAA 8ICCA 1GNPA 4NLGA 2RB4A 4HLDA 4MRNA 2XXAB 4DSUA 4CEIB 1OH5A 3PW2A 2ZI3A 4PANA 3HPRA 4YXMA 4LBYA 4ARZB 2WWFA 4EPVA 4QBFA 3WYGA 4MF2A 1SGWA 3T5HA 2ZRJA 4DQIA 4AIIA 5KT6A 4KLJA 1DGSA 4DL5A 3W34A 4KLNA 3PX0A 3SHFA 3BD9A 5EOZA 2QPTA 3SJCA 3OEEA 2WVJA 4ZIRA 3EW9A 3A6PC 4JL5A 5EP3A 1Y3AA 1BYUA 3THYA 4I81A 1ZNYA 4R2IA 2ISOA 3MGCA 2CVHA 3KTAA 4I2BA 2C8VA 3AB3A 3CONA 3NTUA 4CT5A 1NK8A 4UAYA 1U9IA 1YZTA 4P33A 1G8HA 4D4KA 1HUOA 1NOMA 1JAHA 2ERXA 4EUNA 4HLUC 3UQ0A 3AVYA 3NXSA 4NM2A 4MEYA 1KIMA 2C78A 4M9LA 4JKYA 1Y88A 3RABA 3P20A 1S9HA 3SNHA 4L9WA 4KLEA 1D2EA 2KFNA 3U4QA 4PAQA 2AU0A 5DKWA 3D8BA 3GDXA 2JLQA 3MRSA 4V0MA 2FMPA 4EQ6A 1EFRD 1AROP 4CEIA 1TU3A 5DB7A 2MSEB 2F1RA 2NG1A 5FR1A 5F9FA 1E9DA 4C8LA 2R6CA 4TT3D 1E1QD 4AKEA 2FSGA 4BWJA 5J0WA 3DM5A 2ZEJA 1NKCA 3I92A 3BK7A 5DO9A 3CBQA 1YZKA 4G5SA 4CVNA 1M74A 3ECCA 4GI7A 3KDSE 4DS5A 3U3OA 2LYHA 1T3HA 4A2QA 2G83A 2EU8A 1BYIA 2QE7A 4LJ8A 4MUBA 3A1VA 4B3GA 1GVNB 1G8GA 2HUPA 4LC1A 1Z6AA 3DOFA 2L0XA 1A2BA 3WP1B 2QN6A 3BERA 4IXNA 4IOMA 1ZQWA 4M9ZA 3GLIE 4YG2A 1OH8A 1ZQYA 2PT7A 4KBFA 2YWEA 2H92A 2ZRCA 3M6AA 3X1WA 3CX6A 2IYLD 3MWJA 4KFRA 1E9RA 2JGNA 4X8MA 1QF9A 1GAJA 3TIFA 5C2JB 1SL1A 3P4XA 4PFSA 1UBEA 5BYJA 3MMPA 4AURA 3IPXA 1KDPA 3QXCA 2OZEA 3UMFA 1JMSA 4GNKA 4AYWA 2BQ3A 4M9JA 3BQ2A 1W2GA 1U90A 4MYCA 2ZREA 2OAP1 4FBTA 3JPRA 3GIMA 2NTYC 3VMFA 3CUEF 2E1RA 3E1SA 4M04A 5FPKA 2C9CA 4JLNA 4B76A 1N3BA 4ACBA 1Z22A 2AWOA 5DI3B 1OV4A 5HHIA 2H1LA 5KNCA 4EYIB 3ZZTA 2W8LA 4LVSA 3TVDA 1QLNA 3OJSA 2K5UA 3KXKA 1XO1A 4MFCA 5KTYA 3R9IA 4QHTA 2G3YA 3ZVNA 1NK6A 4B9TA 4M0AA 1R8SA 1J8YF 4JV0A 2J45A 2W0MA 3QXHA 4PPFA 4TMVA 3K0AA 2WIBA 4L9SA 2J6UA 2VLIA 4HDQB 3VNUA 4UNSA 4ECQA 2JZBB 5L9XA 3FMPB 5G41A 1EWRA 5B30A 5J0UA 2JEGA 3HW8A 1F2TA 5DDYA 3LFUA 2WV9A 5EP1A 4V0KA 5KFLA 1XEFA 4UAWA 4ESHA 3F5FA 3CW2A 1K5DA 4I2GA 2OSBA 1ZM4A 5FOVA 4I2AA 1X9MA 1ZM7A 5J0YA 2YC2C 4IQVA 4JLKA 3V6JA 5B57C 1TEXA 1Z07A 2J7KA 4BWYA 4PQFA 1ZQXA 8ICLA 1NKTA 1Q12A 1JX4A 4XD7A 5KFUA 1G18A 1NG1A 4A82A 2RGEA 3WRYC 3W3AA 2IHMA 1RRPA 2YVUA 1S1CA 3AP3A 1EX7A 2J7PD 4K46A 4E5UA 2HT1A 3SYLA 8ICUA 1NJXA 2AFHE 3NEJA 4N1AA 4PPXA 2YV5A 2KE5A 1S10A 4RD6A 2P66A 9ICVA 2R8GA 7ICVA 5D3MA 1KOFA 5DISB 3RS7A 2GZAA 4A8JC 3C5CA 2WWYA 4PO8A 1JPJA 1ZQJA 1DAFA 1IN8A 1DAGA 3IO3A 2GDJA 8ICOA 1P4SA 5AJYA 1L2TA 4MGYR 8ICQA 3QUSA 1WBBA 4M8NE 1L8QA 1E79A 1NIPA 1R0YA 2RCNA 2ZYUX 3NEYA 4TSFD 5CJPA 3SFZA 4EJSB 1NSTA 4B9SA 1XEXB 2F6RA 3PW7A 3VR3A 3WP0A 3T06B 5FH9A 3JZAA 3UWOA 3A8TA 4HDOB 4DSLA 2FSFA 1EX6A 2J9RA 4GXKA 1X9SA 2FFBA 3PX6A 4AG6A 7ICRA 4JLVA 4IJMA 5BN4A 5LB2A 2B6HA 1ZJNA 1XMSA 4GT1A 3P32A 4UNRA 2M9NA 2VH5R 2FPMA 1G41A 2H8KA 1W4BA 2QY9A 3IO5A 4FCTA 4DL4A 3MD0A 3IHWA 3TR5A 4QFMA 3B13B 2WSSA 1KI9A 3U7FB 4QBHA 4S2EA 2NPFA 1N48A 4KLHA 4OQXA 5TXGA 1DOQA 2QRNA 1GUAA 3VKHA 3EA5A 5C5JA 2JAQA 3WHLA 2AL7A 1QTMA 2IK8A 3AKYA 4M22A 4RQ1A 2XZLA 2IYRA 4TUSA 4C8NA 3V6KA 4HLQB 5J2HA 1HT2E 1KSFX 3AQ4A 2CCKA 2KWIA 4LWZA 2OAQ1 2FPKA 3Q5DA 3IKJA 1Z6YA 3QZ7A 1X8LA 1YZGA 3KXLA 4LJ9A 4PXAA 2GXUA 2AHOA 1ZYUA 4KTQA 3M8SA 4KVAA 3PMNA 1L3SA 5KFOA 4KITB 1NN5A 1S1MA 2FFAA 4C2UA 4E09A 4EBDA 5DB9A 2QAGB 3GFTA 3CRW1 1Q44A 4EJSC 3CR7A 3QEJA 3OE7D 4Q02A 3TW4A 3AKCA 5AUNB 1R0WA 1GRNA 4QGFA 3TFRA 5J0SA 1QRAA 2D7DA 2DPJA 1DG3A 3OIVA 5CDFE 4DQPA 1W48A 1RYSA 2TMKA 4RU9A 2NRXA 1XMIA 2WKQA 1U9LA 1VMAA 2Q6TA 3LWMA 4PGXA 4BDPA 2C9OA 4QZGA 1RPLA 4QWBA 1JI0A 5BYKA 4N0DA 3MWLA 4F91B 1ZU5A 2MMCA 5GJVC 9ICIA 4HDCA 4ZDJA 2ZM5A 1MT0A 5K8TA 1KDOA 3CH4B 1Q3TA 5TMPA 1NN1A 2V4ZA 3TQFA 4IOKA 2IXGA 4I29A 5F98A 4D0LB 4XJXA 4QZ9A 4FCWA 1U94A 1T8TA 2PBRA 8ICPA 2JLUA 3U5ZB 1QG4A 3REGA 4Q4AB 2PL3A 5B58C 4Q5IA 4Q4HB 7ICFA 1RC8A 1Z0JA 3R9WA 5L1KA 3LH5A 1GL7A 1P61B 1G7SA 2IXEA 2F7SA 1DVRA 2UZIR 2ZUCA 4O5EA 1DADA 2F9MA 5TARA 5C18A 4MKFA 3U4QB 2MAXA 3EX7C 2C03A 5FBLB 1KFSA 3RB4A 5TV2A 2NZJA 2GJKA 4R63A 5KFQA 1J99A 3FVQA 3PENA 4I1VA 4M21A 2ZXUA 3MR5A 4ECSA 3LXRA 3AVWA 1GP2A 1T6NA 2C77A 1XSNA 1IXSB 1CP2A 3IUYA 2H7VA 1G7CA 5CIQA 4YONB 3RS3A 3ZJYA 1LB1B 2O0JA 5JRJA 4KYIB 1UFQA 3HU3A 5CYOA 3K0CC 3SJBA 1UEJA 5GJBA 2N1BA 1E4YA 3MFIA 1FOEB 1AJEA 4Q9KA 1COWA 1OF1A 4UB5A 4MKHA 2LKCA 4KO8A 3VU9B 4DDVA 4NU0A 5BN5A 3MWYW 4DVGA 1UAAA 3OJUA 3M9NB 2VL7A 4Q4LA 4TT3A 3IIKA 5KDDA 5KT3A 1VG0B 4I2DA 3Q8MA 2QM8A 3PR4A 4TQUS 5FL7D 2VEDA 3LLUA 3FTQA 3UG6A 4DJTA 3KFXA 3GLFE 1ZQQA 1KMHB 2GBLA 5CLLA 5FTJA 5J2EA 2AQ0A 4PAMA 3TRFA 2ZRIA 1ZQSA 4PHAA 4Q1BA 2QRZA 2WHXA 1P2UA 3A1WA 2KBFA 5A5GA 2VA8A 4J9RA 3THXB 2WWIA 2XXAA 3T5LA 3C21A 2ZPTX 5TZVA 1DTSA 1QHHB 1B0UA 3I3SR 5GADl 3LV8A 4FS2A 3REFA 1VG9B 1MC8A 5IT5A 2HF9A 3TAPA 2AGQA 3B1YA 4NLNA 1RYFA 5LPNA 1E32A 3KFVA 5JBQA 5J29A 4F5PA 1P3JA 1FTSA 1AS0A 4F8RA 2PZEA 2KTQA 3Q7QA 4KSCA 4DLVA 2FE4A 5CB8A 1AN0A 1W0JD 3A1UA 2J0SA 4DLGA 1YRAA 1KO4A 2IYUA 3DOEA 4CEJA 4XA5A 5FOXA 2AKAB 3LDAA 2ASEA 1D9XA 4OI0A 1CF4A 5AJZA 1R5NA 3O8DA 1TAUA 5BWMA 3V4RA 4IOJA 3KJEA 2QTHA 2P2LA 2X1VA 4B48A 2WZQA 2XITA 4XVUA 3K70D 4BPBA 1S4QA 3QOFA 2WSMA 1GL9B 3M9MB 1G1MA 1S3GA 5FR2A 3T61A 1KI1A 4C0BA 1HQCA 3L0IB 5KFEA 2DBYA 5CK5A 4J9QA 3BS4A 3EASA 4IDQA 4CEHA 2ORVA 3ZQJA 1ZQEA 1ZD9A 4GOJA 4CYMA 3TMKA 1X1RA 5KSYA 4PGQA 1W4AA 3QG5A 3AU6A 4F2SA 4HB0A 4MUAA 4B73A 3TUJC 3CR8A 2QA5A 2CNWA 5F9LA 2ZU6A 4PZYA 1VKJA 1KHTA 1OIWA 1C1YA 3EZ6A 4DL6A 3K0FA 3PJRA 3PO5A 4DSJA 3A1TA 5SZIA 1KK3A 1ZRHA 2VP9A 4Q47A 4HB4A 4DSFA 1XEWY 1WQ1R 1S3SA 4Z8XA 3JVVA 4IVPA 2RHMA 3JPTA 4A0RA 1CRPA 1HEIA 4NBSA 3LW7A 4ED2A 1YKSA 4RSGA 3HT3A 3B1VA 1NJFA 5CWRA 2PI4A 5JEEA 3ICQB 3B5JA 2ZJ2A 1KMHA 4GFDA 4ZCLA 2XAUA 3THVA 1XTKA 1JJ7A 1FX0B 1NIJA 1OFIA 2QBYB 3JPQA 4UNPA 1JALA 2XY6A 3KKMA 3RNLA 1TU4A 4C7OA 3L0SA 1W0KA 1J2JA 1ZQPA 3MUFA 5BOMA 4LC0A 1RRFA 5DHFA 1T5LA 3NC1C 4Q4JB 1OFTA 5KFHA 1CKEA 2BR0A 3GJ6A 5KTQA 2V8OA 2WKPA 2HHXA 2O8CA 2IS6A 4LY6A 3K0CA 2ZR0A 3UPQA 9ICNA 1HE1C 3K9NA 4E07A 3UXOA 2HYIC 1LS1A 4G3IA 4QZHA 5KFYA 3PR5B 3DPUA 5KFSA 1CIPA 1FNNA 2CLCX 5ELXA 2GJAA 3CPHA 2GXQA 5JLJA 5KFCA 3QPVA 1G9XA 4GMDA 3AV0B 4TQ9A 1B43A 4JLDA 2PFQA 4EBCA 1E2JA 4KU4A 5IINA 1DS6A 4PQRA 5D3QA 2DB3A 4II7A 1SQ5A 1XS9D 1NVVQ 3DEFA 4AD8A 2BBSA 2FGKA 2VA3A 2IT1A 4F5RA 2IX3A 3LX5A 5EWGA 3JPNA 3W9YA 1NI3A 2XCPA 1L5UA 2D4HA 2OO7A 3MGIA 2VF8A 4DOAA 1Z3IX 3BC1A 4RY2A 3HPOA 4G01B 3SI7A 4RZ2A 4B3XA 2GESA 3FWYA 3H4BA 2ECKA 1N5JA 3Q8QB 4MRRA 1GKIA 1AGRA 1CBUA 1Z0FA 5AUPB 4BECA 1S77D 5AUQA 2JEOA 1PJRA 2OG2A 4I1OA 3UKDA 1PLLA 1SVOA 4EIWA 1JBKA 5F9HA 4F5OA 2ZSEA 1A2KC 4P4PA 1RRCA 4QW8A 1T3NA 5DHAA 3BB4A 5J0XA 4DFMA 2LCFA 1CEEA 5J0PA 2OLKA 1SL0A 1X8KA 2BVNA 1M7HA 4MF8A 1KO8A 2BDPA 2DFLA 2GJ8A 4OI1A 1T0HB 1OXSC 2NO1A 4PHHA 3HP1A 1PV4A 5EP4A 4LDJA 2IA5A 3AU2A 4W7SA 4B6FA 2HHVA 4HZUB 5DSZA 5IIMA 4ECYA 8ICVA 2B8WA 4Q1FA 4Q9IA 2VANA 1EFRA 2KBEA 2ZS8A 4YXJA 3V00A 5DB6A 2N42A 2NRTA 4YR0A 4OHVA 1GRRA 4LJYA 4BFVA 5TDHA 3H4DA 4Q01A 4RFSA 3NVAA 4RQ8A 3BFXA 3F8TA 4LI0A 3OSNA 3WRXC 1NK7A 2Z43A 3FB4A 1KSHA 1U45A 4P2HA 1J7KA 3QXJA 3KB2A 3GFKB 3T15A 2O8BA 1N6RA 5B64A 3K8YA 1TEVA 2GJSA 4G0NA 2WJVA 1I4TD 4A2WA 3QPUA 4LHYA 3U3MA 2RGAA 1RZ3A 1SL2A 1S2MA 4TZ6A 1UPTA 1BS1A 4J9LA 1KI6B 4IXMA 1NKSA 4JV1A 2UVVA 1Q1EA 5A0FA 3VNVA 4B9UA 1N6IA 4HUQB 3E2EA 2BGWA 4D4MA 3EYZA 5K8LA 4JWMA 3SYKA 4LBWA 1DELA 4TL9A 3GFPA 2F43A 5KT2A 1ONBA 4TTRA 1XP8A 4EJSA 1VYTA 4LHWA 3LX8A 4TTPA 1UBGA 5KFPA 4NYJR 3K70C 1ZQCA 5EUQB 3PEUA 3HWTA 1JR3D 4P4MA 3UK6A 1JJVA 3C15C 3GQBA 5JHHB 2OILA 4MDEA 3K0FB 4QNRA 2CMKA 2IL1A 4GZMA 4JIMA 4I27A 3H1TA 1ETUA 5JRZA 1IHUA 3BH7A 4JYBA 2A5DA 5FOWA 1W1WA 4A8JA 4CDGA 2KB0A 1E2FA 3CPEA 2HHWA 4NKRA 2IWRA 3ZIAA 1E98A 5E3HA 3THWB 3GV7B 2PFNA 1JECA 1QSYA 1C7YA 4ASUA 5KFFA 1G5RA 1ZC4A 4KFSA 4Q8EA 4DO9A 3MG9A 3RJEA 4V0NA 2A1JA 2RGNA 1IY0A 1CR2A 4PO9A 4PQYA 5KFAA 3SV3A 2PEYA 3AVVA 3QEAZ 1A76A 1JN3A 3Q8LA 5EQTA 3SOPA 4O3OA 2CCGA 1ZQLA 1KY2A 5IIKA 4RQ4A 1UM8A 3Q7PA 3RSOA 4RUAA 2ZJYA 3EIEA 3T1TA 4LZGA 2REBA 1SVIA 1HQYE 3RDPA 2ZRHA 4ECWA 2RGCA 4Q43A 121PA 2JZBA 4G5OA 3QZ8A 4NLZA 1LV7A 1ZQFA 2H17A 3AGPA 4MYHA 1KY3A 1GOTA 4XOIA 4M0LA 1P60A 3WNCA 1W2HA 4KI0A 4PZZA 5JUMA 1QHXA 1XBTA 4O9MA 2V1XA 5K8UA 4ZDKA 1HUQA 1RIFA 1I4LD 1XTIA 2ZROA 4B2LA 4HYYA 1DAMA 3QKTA 5DE3A 4DZZA 4DCVA 3QXSA 2WAYA 4U5XA 1UADA 1N56A 1I2MA 1AQUA 1JEDA 2FLLA 1XTQA 2ZRAA 3EAQA 5KPDA 1OB5A 1E2DA 2Q3MA 3N5CA 2Z4SA 4ZCIA 5IK2A 1NLZA 2YWHA 4LZZA 4C0KA 1VCNA 3K4GA 1UKEA 2EYQA 4YR2A 2A3RA 1GKUB 2ZSDA 2HHQA 3J81k 2A5FA 4ED6A 2AGOA 3CF6R 3GLGB 3ASZA 3CNOA 3HWSA 1XMVA 4QZDA 1FZQA 2EVWX 2P67A 3T1VA 3TKLA 1E99A 2JJ8A 1TF7A 2BQRA 3OSPA 1IXZA 3I32A 3PW0A 1R7RA 5CR0A 1YR7A 1RYHA 1N6NA 1NK0A 2R9VA 3VR6A 2G0NA 4MDFA 5JJLA 1CRQA 4DEZA 2R62A 3T12A 1ZD8A 5JFGA 2IUSA 3ZS8A 1EFTA 4JLPA 2V6JA 3LQRA 4KN4A 4MGZR 5CIWA 1T3LA 2WKRA 3AF4A 3NIBA 4O5CA 4UJ3A 3HU2A 5AJWA 2CXXA 3PG5A 2NO6A 4ACAA 1U0HC 1SULA 5JSZA 4F4YA 1A1VA 3BDPA 3C5HA 2FMQA 1XFAA 5F9NA 2QENA 4XH9B 4F7WA 1RFLA 4M4SA 4ECXA 2KZMA 5LB4A 1Q22A 5B2ZA 2VHQA 4G5GA 2VIIA 5KG2A 2C2RA 1IJFA 2J6SA 4DQRA 1E2MA 3UATA 3I61A 2JLZA 2HJVA 1S0NA 2RGBA 3H86A 2D2FA 4YDSA 2BKEA 2EWVA 5SZHB 2RHDA 2C2EA 5KU1A 1P72A 3QKSA 4R8UB 4Z8YA 3ZIAD 2FLNA 4UB4A 1OYYA 1RJ9B 1W46A 4JYCA 5KSZA 1B22A 3MBYA 3GD7A 5DBCA 3NDPA 3I1FA 2QAJA 1N6LA 2ZRBA 3EG5A 2WMNB 3CO5A 3EZFA 2VHJA 3L82B 9ICXA 5CJ2A 1Z00A 1KO1A 2IBMA 4L8GA 4YD2A 5KSPA 1E9FA 4TMXA 3JPOA 3RAXA 5LBIA 5CLQA 1T91A 4YMTA 2GJ9A 3FHTA 2O5VA 4I4LA 3ZD6A 4TUPA 3B1ZA 4RD0A 5JJIA 2IEZA 3ZD9A 2PI5A 5DI9A 2W9MA 1ELOA 2ZITA 2BMEA 1HY3A 2NO0A 2NPIA 2HLDD 4LZDA 5KG6A 2BCQA 2PFOA 1KDTA 2ZI6A 4DB4A 1W7AA 1JQLB 3PUWA 4JKIA 4KLZA 4PSKA 1RKBA 2JDIA 4BFWA 4Q9LA 5ANRB 1NVWQ 2GCOA 3T1QA 4EPYA 4OK6A 2ORIA 1IN4A 2Q3HA 4U00A 2OCPA 1S0MA 1F2UA 4RQ5A 4LYJA 2BPFA 1OT3A 2Q21A 1DO0A 4P4SA 2NO7A 3PV0A 4ED0A 3AP2A 2IF0A 4KLDA 1S97A 1XB2A 1OKKD 2W6IA 4EYHB 4WBSA 4G5QA 2OM2A 3AUYA 3CX8A 4Q8FA 2W9CB 2O8FB 2JA1A 1S9DA 4BLTA 5HZHA 5DIFA 3U61B 2PCLA 4IEIA 1SXJB 1E0KA 2YJTD 3FHCB 5EXXA 3KHLA 1H8HD 8OHMA 2XY5A 3IHLA 4TQRA 2ORWA 4BLSA 4QWDA 4ELTA 1GRQA 3B2EA 4O2LA 2ZJBA 3RJFA 1UDXA 1NK4A 1XXHA 1KI2A 3ZDQA 5KG1A 2F1IA 4GC7A 4RT2A 3I5XA 4IVRA 1NNEA 2JLXA 4Y0AA 3U3JA 4D6PA 1H8ED 4JBXA 2OBMA 4Q9HA 5CB1A 1KAGA 2BHNA 1XCGB 1D2NA 3SC3A 1COOA 1EXMA 5DQGA 3B8HA 4TMTA 4I2CA 4R98A 5CDFA 3WYFA 1KSJA 2HHUA 1CTQA 2J0VA 5F3WB 2YKGA 2JLWA 3QVVA 3MR6A 2OBLA 3PV8A 5HKKA 2WOJA 2W9CA 3E2IA 1U47A 5TB5A 1N25A 1QHIA 3HU1A 4GMXA 1GNQA 4PC2A 1FFHA 3K9LA 5E7IA 4EPXA 3GV5B 2Y1IA 3M0EA 3BAFA 3QNUA 3NDBB 3SI8A 1NN0A 3L43A 2QQ0A 4A6PA 5CITA 4OL0A 3K75D 4Z6DA 4B9MA 3K53A 2GKSA 3A1SA 4DOBA 1TL7C 4HLCA 2P6RA 5CJ7A 1W36D 3RH4A 3V6HA 1K5GA 3BXZA 4BWMA 4B3FX 2C99A 3QI2A 1SVSA 4YR3A 4NPHA 4KJZA 4AYTA 2GBLC 1CR4A 5KT5A 2C04A 5IHPA 2BBTA 4F4CA 2BPGA 8ICIA 3RJJA 4P0TA 4QM6A 2H57A 4MRVA 4RPXA 4PPGA 2IYQA 3CNLA 3F3YA 5AR1A 3H84A 3OIYA 5DN6A 1NG9A 4HB2A 1OH7A 4ED8A 3QENA 1FW6A 5DQIA 3ETLA 3M9OB 3UXPA 1L4UA 2FFHA 3NC0C 2PFPA 4TN1A 4A0HA 4M1SA 4CIDA 3R9XA 3ZDBA 9ICRA 2NRWA 1YQTA 2BJWA 3IDQA 3U7GA 2IS4A 3HR8A 2C96A 4AKIA 3MR2A 3PX4A 5EE9A 3GILA 1E9BA 4KLLA 5DLGA 5IIOA 2AD5A 2OCYC 3GJ0A 4QC2A 4I1UA 4KVGA 4QJ5A 4R7ZA 3WBJA 4ABYA 4FMDF 5IF9A 1QSLA 5L3QA 1KJZA 1SKQA 4QWCA 1PZNA 4ILEA 2OBNA 1NVXQ 3OIUA 4YQWA 5BW8A 3PR1A 5IRCD 2JATA 3I73A 1A5TA 4OK3A 2QORA 3L0OA 4DQSA 5DI3A 4RUCA 5L3SA 3RJKA 4C4PA 4OQFA 4URWR 4UBCA 4PHPA 4MFFA 1CEZA 5J40A 1D6JA 3V7LA 4GLXA 4LJ5A 3FYHA 5E95A 5HMMA 3I4LA 4B3CA 2EFHB 1ESMA 4QL3A 2YNMA 3U60B 2WTUA 3H8SA 4Q9JA 3U44A 1XWLA 5IDVA 2ZRLA 5KFMA 4I2IA 1OIVA 4PSAA 1IQPA 1E2PA 1HUZA 3FKSD 3GJ8A 3VR2A 5D4BA 4TL7A 2XGQA 5SZJA 3BJYA 1NN3A 1LTQA 1TUIA 3FMOB 2UVRA 3K09C 3L8YA 5H68A 3OGUA 2ZRPA 3T35A 1OXXK 3ND9A 4AY2A 3WHKA 2BJVA 3KL4A 1G291 3CF0A 1XD2A 2XCAA 2R8IA 2YOHA 2Z4RA 3B82A 2A9KA 4QZ8A 4X5VA 2QSYA 4C0JA 2IBKA 4KXFB 2DFTA 3IEUA 2QSZA 4K4GA 4OYHA 4ELVA 2R6DA 4QW9A 3V9PA 4TYQA 1UDWA 2FLPA 4PAOA 4RCZA 8ICFA 4DL7A 1R10A 9ICQA 2BEJA 4WAUA 3RHFA 3SDZA 5HKKD 2AK2A 4D26A 3GV8B 5J2JA 2OCBA 3RH5A 5JECA 2F9LA 3ZGXA 3DDCA 3PUVA 3GIIA 4QJ4A 1G4UR 3GCGA 4P4SB 1XF9A 3ZDCA 4HAYA 4DCSA 2FPLA 3QJYA 1VG8A 2B7BA 3W6OA 5J0QA 4DF4A 4BEBA 3SR0A 4UXIA 4PPNA 4FBUA 3E5HA 5EJEA 2FGJA 1U2RA 1E0JA 1ZNWA 4UJ5A 5E7MA 3I72A 3RLFA 4B2IA 1ZQUA 1BVSA 4UNNA 4DL2A 4FMDB 4OBEA 2R6GA 2BOVA 2DHRA 2XEXA 4KLQA 1U98A 1IM4A 4YC7A 4B43A 3H8WA 1E1RD 1Z28A 2GWHA 4RQ2A 3MJHA 2FV8A 3TVTA 4DSKA 8ICBA 1EFUA 2FZ4A 4BFSA 4QOSA 2XO7A 4QZAA 2BBWA 2XB4A 3QBVA 3WY9A 4ZKDA 3LD9A 3QF7A 5L3VA 3EZ2A 1MRNA 2QE7D 4F4WA 2ODEA 1QHGA 4OJKA 1KTVA 5L1LA 2V55B 3FMFA 2ZSAA 1CJTC 2BBOA 5FTNA 5AWFC 3NHBA 2QU8A 1JPNA 4HAXA 3FMIA 4LHVA 4CRWB 3THYB 5KFRA 2NO9A 3ND8A 5JWRA 7ICMA 4A8JB 2V3CC 4DLUA 3V72A 2VSFA 4MYTA 3VKWA 4URYR 5KFBA 4EPRA 1OW3B 2CNWD 4GSYA 4IHQA 1G6OA 2C9YA 7ICKA 4ON9A 4DWJA 4MFAA 2ATVA 1ESNA 1GSIA 3WNBA 4WZBE 4ZV4A 4YXWA 3GIKA 1IN5A 2Z5FA 1OHHD 3RRHA 4KHZA 2ZJAA 3HX0A 3K70B 2O8DB 1ZP6A 1VIAA 4C8OA 3CZQA 2ZE8A 2EWWA 2BCVA 1NBMA 3LA6A 4W9MC 4AKHA 4LSGA 1KNXA 4YLGA 3ZLJA 2IUUA 3RB0A 3NBFA 1XCMA 3M1IA 3OFNA 2ZTSA 2MUTA 3CF2A 1NMYA 4MA4A 4OKSA 3SS8A 3ADCA 3R20A 4NZYA 3FGNA 2VQSA 4JLMA 2H18A 1TQ4A 3OHAA 4IDHA 1T9HA 2QAGA 3O8CA 3MLEA 1SHKA 2IC5A 4V0ME 5GVSA 3LVRE 4IQTA 2GZHA 3TR0A 1N5KA 1BH2A 4X8LA 3R7WB 1N6KA 2OUKA 4V0LA 4BRWA 4C0LA 1R8QA 3SN6A 2QTVB 4M9GA 4RD2A 1S9FA 5HZKA 4RQ6A 3C1ZA 1P7CA 3Q5EA 2A1JB 3MR3A 3RR8A 2J0UB 4IDPA 3W5IA 3EZ7A 3Q3JB 5FOSA 3GLGA 2XJ4A 2AXNA 3CH5A 1U0JA 2CJWB 4MQBA 4TLBA 1MRSA 4ASUD 3FKSA 3Q8PB 4JUZA 5J0TA 7ICLA 4HI0E 1OB2A 1TADA 5DG8A 2ZVPX 2BMDA 5JI3E 1KFDA 1LW7A 1XMJA 3CRVA 1NJWA 4JWNA 1E2KA 1PLJA 2X8AA 4US2R 3FOZA 2NGRA 5EWFA 4PTLA 1Z8FA 2EFCB 2FA9A 3TSOA 2QP3A 4DHEA 2VSOA 4PHFA 3EPIA 3C2LA 4M1MA 2KZZA 4F4JA 8ICAA 4A2PA 2XJ9A 3WMEA 3GLHE 4LK2A 3ZZ0A 2JJ2D 2IA6A 2XZPA 1M6NA 5J4YA 4B3BA 4Q7LA 5G53C 2OEPA 4AK9A 5FPTA 4YMWA 2XSZA 4RNNA 1T8EA 3HPQA 3BH6A 1XD2B 4J9NA 1YR8A 4M9XA 5J2BA 4DFKA 4M2LA 4NCHA 1OHHA 2QGNA 2RKOA 3KKNA 3LBIA 3CX7A 2ASDA 1Z3EB 3IILA 4ECUA 4DEYA 4HUTA 4TLCA 9ICTA 2GXAA 2DPIA 3A58B 5FPHA 3GLIA 1JNYA 6Q21A 2AX4A 3ICEA 2A2ZA 4UB3A 1TQDA 2V6IA 2PLFA 9ICCA 1Z63A 3RJGA 2OXRA 4O25A 1P62B 1XZQA 1ZW6A 3M4YA 3KHRA 3T5DA 3U44B 3JVUA 3UQ2A 2ASLA 2PJZA 2ZYTX 1UT5A 2V9WA 4L5BA 4JJZA 4UB1A 1XSPA 4O3PA 5L8VA 4QBIA 3ADBA 4DKXA 1X1SA 4IQUA 2QZ4A 1G7TA 1QDEA 1FUKA 2W2VA 2I1QA 3GJ5A 2HHTA 2KI5A 1XD9A 3AF0A 2J46A 5J2AA 1RYRA 2R8KA 4Q4HA 4NM1A 3IQWA 4DLTA 1ZQVA 4DRZA 4ELUA 4IDNA 4BZQA 1XX6A 2OFXA 1W5TA 1F60A 4BQSA 4BFUA 4TWZA 5K8IA 3RAPR 3D31A 2IYZA 5FL7A 4O0IA 3I8SA 3MDAA 3RWMB 3SQXA 1KI6A 2P6NA 3B78A 5H1YA 3TLXA 1LNZA 421PA 1DBSA 1VIYA 2FDCA 2KZ3A 8ICEA 4EZ9A 1SVKA 4QZEA 2JEFA 2ZE6A 3AUXA 3LAWA 1D5CA 4LGMA 4Q7JB 2JJ2A 4B34A 5KNDA 1G3UA 2WJYA 1ZQNA 1TQ6A 1R6BX 2I1VB 4GOKA 4JLAA 4DLWA 3HDTA 2W9BA 8ICSA 1MR3F 4EAQA 3KUCA 1CR1A 2ODBA 2YOFA 4UQGA 2V1UA 3GJ3A 2BKUA 3GLGE 3WBKA 1XRJA 4DQQA 1NY6A 1G4AE 2W00A 1Z2CA 4L4UA 4NYMR 3SE0A 2FH5B 2H16A 3NH9A 5AJVB 3Q85A 4FI3C 3GIJA 1H65A 1SVLA 3LW8A 5GJCA 3T1OA 1CU1A 4O3SA 3G5UA 1ZM2A 2ZYWX 3VHLB 5CA7A 3OF5A 3PUXA 2G77B 2XTNA 5KO2A 3NGDA 9ICHA 1XTSA 3OEHA 4KMUA 1ZUHA 3ISCA 4C8KA 2GZDA 3HJNA 5EP2A 4LYFA 2I9GA 1FP6A 4Z1MD 1BPBA 3TUIC 1HJPA 4C30A 4TYYA 3HYRA 2B21A 1UA1A 1DAKA 4BE7B 1UJ2A 1MV5A 3N2IA 4ZO4A 4QZIA 2WAXA 1NJZA 3EC2A 1DE0A 4X8HA 5DBAA 2B8TA 5L3SB 1QHSA 3TANA 1E96A 1SXJC 3Q72A 4IRKA 4RVCA 1OFUX 2IUTA 5CHGA 1ZQDA 4DCUA 4QGGA 1P2TA 5J0OA 2VTKA 1F48A 3QF4B 2G9NA 4PGYA 1IJEA 1ZJMA 1XDBA 1DAEA 2HJGA 3KB1A 1E3MA 1X3SA 3T3FA 2IYXA 3L0PA 3QQ5A 1CR0A 2WPDA 2XC9A 3OFND 2FFQA 4TURA 5HE8A 4JS0A 1DO2A 4KFTA 4BLOA 3ZH9B 1T5IA 4LJ7A 2C22A 3SJAA 1AK2A 5DYIA 2GVZC 2QROA 5JWHA 1FX0A 5HPYB 1ZM3A 3PQCA 1P73A 3I62A 1BPXA 3GMTA 2Q9BA 3H0KA 1II9A 3N2EA 4TLAA 4DBLC 1TK0A 5KFGA 2JEJA 1G21E 2JJ1D 1DAHA 3RAQA 2GF0A 3KKQA 4JVLA 4KFUA 1SVMA 9ICWA 5IIJA 3CWZA 2O8FA 1M7BA 1KJYA 1NKEA 3TBKA 2WJIA 1SKYB 4Q1AA 4XIGS 1XZPA 3SBEA 2IYWA 4I2JA 2GXSA 2X77A 1NVUQ 2BQUA 4Z6EA 2LKDA 3B9QA 7ICUA 3T34A 4ITRC 1VHLA 3QSYA 3EWAA 4PSVA 3TJZA 4R66A 3K9GA 1ZCBA 2IS2A 2ZR7A 2R8HA 5HCNA 3IIMA 2DWPA 2PX3A 4G5RA 5EXPA 4F4KA 8ICTA 1LFDB 4NH0A 4RKEA 2C5LA 3VR5A 4D2IA 5KHOC 1N5IA 1H8HA 1ZCAA 4E22A 4Q4JA 3OEHD 3PUYA 1Z2AA 1L4YA 3K0EA 5BQ5A 4ZIRB 2IWHA 1XU4A 4FS1A 1MH1A 1Z0DA 3N70A 4TYPA 4C7OB 1Q20A 2RAPA 3PVXA 2CHQA 1A82A 3C7KA 3RB6A 4P4OA 1AQYA 4H9GA 2DY1A 3A4NA 4J9MA 8ICZA 4XTCS 5UKDA 5KFTA 3KJIA 1NRJB 8ICJA 3Q8XB 3R7WA 2O0KA 3TW8B 3ZDDA 1OSNA 4LJAA 3C8UA 2HF8A 3U7EB 1AM4D 1KTQA 4DLXA 1TUEA 1HYQA 3FPAA 4EKDA 1XEWX 3L8ZA 3G6VA 1WP9A 4AYXA 5G40A 4I28A 3LO5A 2X19A 4KLFA 1IAQA 1YJ5A 5FTMA 3ADDA 4XVQA 2YWFA 1F3OA 2PH1A 5JMTA 2CE7A 1H8EA 4Q19A 4RFVA 4RKFA 1Q0UA 1ZBDA 4ZKEA 1TQ2A 3ZZUA 3B7GA 1K1QA 7ICQA 1T3SA 1W49A 3JPSA 2PLRA 3O8RA 2J5XA 1KGDA 9ICGA 1KK0A 1V43A 1ZM9A 1EFCA 2D62A 2QPOA 4MITA 2O8DA 1W0KD 4D80A 1L7VC 4A0GA 4CT4B 1Z6TA 4B44A 4MYUA 4A15A 3K0SA 5FFMA 3W3ZB 2W2TA 3ZDEA 1S96A 4E03A 3JPPA 1QG2A 4LPSA 4J9KA 1E2LA 2DR3A 1ANKA 3WMFA 4C2TA 8ICMA 2OFOA 3RC3A 1E94E 1NK5A 3PEYA 1TFRA 3RRGA 4J9OA 5FI1B 4TZ0A 1US8A 2RDJA 4GL2A 3RS4A 1XXHE 4GRAA 4IRCA 1VHTA 4EEYA 1J70A 4H1UA 4YVZA 5E4FA 4LHZA 4D4LA 3V7KA 4DSTA 2IYSA 4EBEA 4L15A 1YE8A 2NRVA 5IILA 2JLSA 4CZ2A 1MO3A 4EDHA 4RPYA 2QP4A 3AM1A 4TMZA 2V7QD 5KDLA 3N4MB 2RDIA 4LBZA 2UVWA 2A30A 3KHHA 1ZYQA 3KJGA 2QP9X 2PZGA 4C3ZA 2XB2A 1DPFA 1DAIA 1P9NA 1QHHA 4BFYA 1XSLA 3GPLA 4ECVA 1NJGA 4DDWA 4QJ3A 5J2FA 3AVUA 2ODNA 1G6HA 2XSZD 1XC9A 1SXJD 5A4JA 2QI9C 1KFTA 1SKWA 4I99A 2ALZA 2WM9B 4FMCF 4WVFA 3ZD7A 9ICAA 4H1VA 4B75A 5HHHA 2DCUA 4ESVA 1ZC3A 1YRBA 4U02A 2ZR9A 4DSIA 3G82C 3DO6A 4EFMA 3B0YA 3QE0A 1W4RA 4R8UA 1RXWA 1BPZA 4TL6A 1Z0IA 4RD4A 3S1AA 2R6AA 4O0MA 2CLDX 2H5XA 2JEIA 1N6PA 1P9WA 1ZNZA 5EZ6B 1P75A 2XNDD 2F1HA 3GFOA 3VU9A 2BHRA 4LUCA 3ORYA 4O5KA 2J3EA 4PHTA 5KG0A 1XD8A 4LX0A 2R8RA 1JEEA 3ZVRA 2ZJ5A 4KN7A 3PY8A 2JLVA 2XOKA 4LPKA 4FWIB 1CLUA 4I2EA 3RBDA 4YP3A 3GLHA 4JV2A 4B3DA 3SQWA 2QQEA 3WXMA 1AZSC 4F93B 3TH5A 8ICWA 1X6VA 3B60A 4GZLA 2BM0A 1D9DA 5FUXA 4DFJA 4LHXA 1LVGA 1SVWA 2BIFA 4AC9A 1GKYA 3EIQA 3H2YA 2WOOA 4BRUA 1S8FA 3EPLA 3AVQA 5KFIA 1ZETA 2HXSA 3BJIC 3KTAB 5DGBA 1X2IA 4O3MA 5JEDA 1WCNA 4ED1A 3V7JA 4HZIA 4F4XA 2QUZA 3MDCA 2BC9A 4OJQA 3DVLA 1AGPA 3QF4A 3VFDA 4A92A 4ZH4A 5J4LA 1OYWA 4M47A 2NIPA 2GWSA 3ISDA 3PUZA 4M9SA 1L3UA 1KJWA 1WXQA 2WICA 4W5JA 2NMVA 4P4TA 1ZQRA 4JK1A 1GL6A 2KFZA 2W6JD 1O87A 4JSTA 1L3TA 1M1YE 4Q00A 4JBWA 2ZS7A 2Q0ZX 1Z83A 1Z6GA 4O2RA 1XPUA 1CJUC 3QKRB 2J0QA 4J9SA 1SKYE 4RD1A 4R64A 3NBXX 5C46F 4IRUB 3Q8KA 5JCPA 1OH6A 4NCNA 2Q3FA 3LVQE 4QG7A 1UKZA 1R0ZA 4F5QA 3PO4A 1Z5ZA 1U8AA 1BPYA 2ZRMA 4K4IA 2CL0X 4I2FA 1E0SA 1E9AA 4DSNA 5BXQC 2HYDA 2ZJZA 1Q1ZA 4CCHA 7ICGA 3P4YA 5FOUA 2FOLA 5J4KA 2ZTCA 5KG7A 1P2VA 2E87A 3Q8SB 3NKVA 4D82A 1AZTA 2W2XA 1PUIA 2VP4A 4FCVA 5G3YA 4DT1A 3GLFB 4Z54A 4DL3A 1A4RA 1TMKA 4RZXA 4NONA 3K1JA 1TF5A 2C2HA 2YOGA 1EXNA 1G7RA 3TUZC 3U7HB 2O8EB 4B33A 1GDDA 3OEED 1UT8A 2VHUA 1WB9A 4JJKA 2VP5A 1UKVY 4PX9A 3M8RA 3T5GA 2ZI7A 1RPZA 5L1JA 1II8B 2ZVQX 2AJQA 3MABA 4RT3A 2ISPA 5KFXA 2CEAA 5EZ5A 1KZGB 4MRPA 1EESA 4URZR 5DNYB 5DBBA 1YZLA 1GITA 3DZ8A 2UZ3A 1NK9A 2RMKA 3OE7A 1GTVA 2AWNA 7ICPA 2BCJQ 4QWAA 3FKQA 4NCJA 2VPPA 3U2QA 1Z47A 2IYYA 4IR9A 1QHNA 3G0HA 3QE9Y 1UA0A 3B85A 5JZVA 1BPEA 3TI0A 4QHYA 3ISBA 2EQBA 3TK1A 3QY0A 2F3RA 3ZYCA 1SXJE 4M1WA 2HXYA 3HR7A 4ZPXA 2IF2A 3K9HA 3LWNA 4JZKA 1EG7A 4DDUA 4GP6A 4NHOA 4HUQA 4JLBA 4P3YA 1TV9A 3I8XA 4NDZA 4RNOA 4WOPA 3ZS9A 2GCPA 2VRWA 1OIXA 1Z00B 4YQFA 1VECA 2REOA 1KO5A 4XRHA 1CS4C 3VKGA 3UWKA 5J4HA 5CK4A 4BLPA 3X1XA 2VF7A 8ICYA 1KAOA 1U8ZA 3FFBA 2BCSA 1PLKA 3AVOA 3A36A 4N0EA 2J1LA 3GQCA 4O3QA 4NLKA 2J7PA 3QKSB 2PCJA 2YZ2A 2I4IA 5AUOB 1R5OA 4RQ3A 2BCRA 3RR7A 1O3YA 4IEEA 3U3RA 3ADKA 2OT3B 3W8NA 3EPHA 1KI3A 1OFHA 5TY0A 4D0NA 1E2IA 2YYZA 4FIDA 4HAVA 2D74A 3W6PA 1A77A 1KI4A 2FG5A 4TTQA 1G3MA 4IFEA 2OV2A 2VP2A 4ECZA 1XJQA 1FL9A 3DKVA 5KFWA 3IBGA 9ICEA 2ZRNA 4TSFA 4URXR 1S0VA 2ZUBA 3EWSA 3EZ9A 4TMKA 5EUMA 1GZSA 3L2OB 3LY5A 4E0DA 3QKUA 5GJWC 4LYHA 4Q1EA 5KDOA 2P0EA 3PEVA 3C2KA 2AR7A 1Q1BA 3TAUA 2QT0A 1II8A 3H7IA 3GJ4A 2D3WA 3SBDA 5KYKA 1OXVA 2A7QA 5FBWB 2GRJA 4B74A 3CRRA 4M9NA 2IHNA 1J90A 1OJLA 1YR6A 3K0AB 4LOAA 2W9BB 8ICGA 5L3RA 1RW4A 1QBKC 2QBYA 4OHYA 4Q7MB 4HYKA 5EE0A 1U48A 5KT7A 5DB8A 1OE0A 2IHBA 2ZTDA 4YD1A 2P65A 4OK5A 4BEJA 2IYVA 1WA5A 2GETA 2UVQA 1XPRA 3IIJA 1TAQA 2OHFA 4IKEA 1YZQA 4JLOA 2GK7A 4F38A 3VR1A 1E2HA 3JZMA 1BIFA 4CW7A 2MSDB 1JR6A 1XJCA 5DLQC 1GG2A 2BMFA 3AVTA 4BFTA 3RSLA 2YWGA 1IXRC 7ICOA 2J41A 4M1YA 3SEAA 3SJZA 4DSEA 4Z6FA 4EQ6B 2ZRFA 3AP1A 1E9CA 1TVAA 3D7MA 3FDIA 2A5JA 5DYGA 3ZQ6A 5CM8B 3KQKA 1RZTA 5JSZB 3TQCA 1ZQMA 4F92B 2NRZA 2REXB 4HB3A 2J59A 1HE8B 4JVNA 2FEOA 4F2RA 4PHGA 2W58A 2Q9AA 2UKDA 2IYTA 1U8YA 2XTMA 4QHSA 4QWEA 2Q0HA 4PR0A 3VX4A 2QAGC 1GILA 2CL7X 3BH0A 4M6WB 1W0JA 3B6EA 4DLEA 3SZ2A 4FD2A 4URVR 4DS4A 4GOXA 3ONWA 4J9PA 3N97B 2BCUA 3IHQB 1RXVA 4OHWA 1CULC 2X2FA 4DLZA 2FX3A 2XGPA 1W36C 1MABB 3RRMA 4N3NA 4GXIA 1FP7A 2AFIE 2GEVA 2QPAA 4JVMA 4C0SA 3CRQA 4Q45A 9ICBA 3THOA 4D0GA 1JQJC 3GLHB 4LYAA 2FU5C 2GHIA 2G1KA 3B9PA 1UKYA 1KLNA 4TYWA 3KXIA 2WWGA 4Z1MA 5J2IA 1ZINA 4FMCB 4K81B 3UXNA 4PH5A 5EXSA 3GLIB 1ZVQA 3CLVA 9ICPA 4G3XA 5FL3A 2ZJ8A 1N5LA 4G1UC 2ASJA 4ZDIA 4ECRA 2PEZA 1TAGA 1AA9A 1K6MA 2RGXA 4JSYA 4NYIQ 2XNDA 3WMGA 1G5PA 2FMXA 4KLUA 1J8MF 5JJKA 5EE1A 4WXRA 5CM9C 2ERYA 2P3SA 4RNMA 3IQXA 4DIDA 4NE2A 1I4DD 2CK3D 3P26A 4TQAA 4BGDA 3UPUA 3NWJA 4GP7A 4M6WA 2JIZA 2WBLC 1CJKC 2H5EA 2NZ8A 4NTZA 2BPCA 2WMOB 4NXZA 4LRWA 3OESA 3A37A 1MSWD 2AN9A 3VQTA 4LBVA 1U4BA 1T4GA 1NMZA 4ZDWA 4ZCMA 5J0RA 2JLRA 1BOFA 1NBMD 3LQQA 5KFZA 2GILA 3OZXA 4YMMA 4B35A 2FEMA 4MRSA 1Z06A 4BFZA 3THWA 3RRNA 4X8OA 5J2DA 4DB2A 5DDMA 1LF0A 1G3RA 1GIAA 3RWOA 4R65A 4B6EA 1NJYA 2F1JA 2DWQA 4PC6A 5J2GA 4KODA 4Q03A 3RS0A 2XNSA 2GNOA 4M1KA 2WJGA 4YMVA 1AS2A 1IBRA 2D06A 1VTKA 1NSFA 2WWWA 3TAQA 9ICOA 2GA8A 2ZSFA 3C16C 1A7JA 3DMDA 1D2MA 4V03A 2IW3A 3PVSA 3THXA 1OXUA 4F50A 4MGKR 3LRPA 1ZAKA 5KG3A 1MO5A 2F43B 2VP6A 2O8EA 4JT2A 1G8YA 2CHGA 1QSSA 5JI2E 4TYNA 1NKBA 5BN3A 5C4MA 4PHEA 8ICKA 4UXHA 4BLRA 5AJXA 2HDNB 3ZDAA 4O3NA 4GXJA 2ZS9A 4KLGA 1S0UA 4BASA 4DEXA 2YINC 2AK3A 1R5BA 3MGHA 2P6UA 2FZLA 7ICIA 1VCIA 2RH5A 2QT1A 3UMSA 3KHGA 2HCBA 1C9KA 3P27A 5LD2C 3PCRB 3FE2A 4RZ3A 4ED3A 4O3RA 2QM7A 2AGPA 3AVXA 3TE6A 5JS7A 5KFNA 1UEIA 3QEBZ 3CM0A 4Q21A 1S76D 3GEIA 4M1OA 1ZQTA 1E2GA 4TLDA 2DPXA 4UNQA 3PEWA 3PMLA 4IDOA 5J47A 1TKDA 3BQTA 1XTRA 3BBPA 3QEOA 2ZQ5A 2BMJA 2R44A 3RJIA 2AD1A 3AEZA 1F5NA 2BDTA 3DHWC 5J5CA 1E9SA 2DFNA 4NL4H 1AKYA 5CB6A 3BQ0A 1EFHA 2XGJA 3LNCA 4EPTA 3W5JA 1Q57A 1NP6A 1R2QA 1Z0AA 4EZ6A 7ICNA 2BEKA 2ZE5A 4QGHA 1U81A 2DFKB 4UXJA 4RFSB 5HP4A 2PJRA 4GPTA 4FO6A 2FWRA 4LV5B 4V0OA 4QM7A 1LV5A 4YMOA 3AUOA 3AF1A 4NCIA 2GEDA 4BXOA 1HT1E 1WRBA 3OHMA 1G17A 1WCLA 5KFVA 4IOLA 4DDTA 4QZBA 3RH6A 1HH4A 3SFVA 1G5TA 1KDHA 3RRZA 5HCIA 3IGFA 2N46A 3OAAD 4W5WA 1IY2A 3BQ1A 1BGXT 4XWKA 5CYPA 2O8CB 1KMQA 3VHXA 2IHYA 1QVAA 3MAAC 3KZ1E 1HURA 1Z08A 4UAZA 3C2MA 2GK6A 4A4DA 4Z51A 1W36B 1YVDA 3KQNA 2Y1JA 4ZI3A 3CZPA 1M2OB 5CP2A 2CL6X 1ZQBA 1IONA 2ZANA 1N0VC 1CJMA 1X8JA 4DF8A 2XOKD 3W8RA 4JLJA 2QNRA 1WDTA 1KI7A 1OLOA 2A5YB 1E0AA 2ANBA 2Z6VA 2MMGA 2R6FA 4Z6CA 2HVHA 1V5WA 4XSHA 2FSIA 3OIWA 3U6BA 4PC3A 3CRMA 5SZKB 4KLOA 4NCKA 1XEXA 4PPQA 1YZNA 4BUJA 3LLMA 1TK8A 3EPJA 2FN4A 8ICNA 2BWJA 4KSBA 2VHCA 1E1QA 1ZUIA 9ICFA 1NLYA 2J6TA 1VYUA 4HAUA 1E4VA 3DZDA 4JL8A 4YFKA 9ICJA 1RRGA 2WSSD 3HYTA 4B47A 4KYUA 3AF3A 1FMJA 1SXJA 3RC8A 4KLMA 1YHNA 4OQLA 2P5SA 5FBRB 1Q1QA 1D8LA 2PMKA 2O52A 3X1DA 2O0HA 2QMHA 3U6KA 4IRDA 3O8BA 4XQ8A 4JVSB 1DEKA 3MWKA 2IXFA 1H38A 1GWNA 3BORA 3MCAA 2J87A 4JMPA 5FPSA 3RBEA 4LV6A 1JXOA 2OWOA 4P31A 3AKEA 2W0SA 4WA7A 2EYUA 3ASYA 3Q8RB 3V4FA 1ZQIA 1MOZA 1XNJA 3PFIA 2XY7A 1WMSA 2BV3A 4NYMQ 5L3QB 3GLFA 5FPYA 3ZVMA 3EXAA 2OESA 4YCXA 1G8PA 4JT4A 5L1IA 4A36A 4DXAA 3C41J 1S0OA 2QGZA 3TGPA 2R8JA 3QPWA 5KFDA 3P1JA 5GVRA 4XTRA 4QZCA 5JWOA 1JR3E 4D25A 1M34E 2QG6A 4KLSA 2FSHA 2ONJA 3OAAA 3WYAA 5E7JA 4IW3B 2ZI9A 3T5KA 4M53A 4B9LA 3W90A 3LWLA 1BMFD 1SZPA 2W83A 3EIHA 1U99A 3C5GA 2NQ2C 2ZYVX 1Q21A 4FWTA 3PNCA 5FTLA 2ZTEA 3SYZA 1T0JB 2VYFA 2ZAOA 2D7CA 2JCSA 3CIOA 1LB2B 4US0R 4XVRA 9ICUA 5FBQB 5FUWA 2W9AA 1G16A 1NMXA 3HP6A 2NOAA 1IY1A 4RQ0A 1FMLA 3OHBA 4RJLA 5LD2B 4KLTA 2BM1A 3C4JA 4Q7KA 1BO6A 4RPZA 2ZAMA 4AKGA 1HTWA 3RJHA 1ZQZA 2V4QA 2EFEB 1MABA 2YHSA 3GJ7A 2RGGA 3PW4A 4RZUA 1B23P 1SHZA 4PC7A 1CJVC 1G20E 2A5GA 2AKYA 3GEEA 5HE9A 2AXPA 4FN5A 4LJ4A 4B9VA 1F2UB 2Z0MA 2GAAA 3PIRA 3E70C 1G8FA 4PC1A 1JXEA 1K8RA 2G0TA 2CBZA 2JDID 4CEHB 1WBDA 1IN6A 4QRHA 4M1TA 4BFXA 4BZXA 5DGXA 1E2QA 7ICHA 3T5JA 3B0XA 3FDSA 2WWXA 3C1YA 2WJJA 1ZQOA 3CPJB 4A6XA 4TL8A 4YN4A 1QZXA 3X2SA 5LDDC 2CDNA 3AH8A 1E2EA 2FJUA 1I2DA 2OFWA 4Q1DA 4YMSA 5DH9A 2C98A 2G6BA 5H70A 4XD7D 5KFKA 4GBMA 4C0AC 4PO1A 1K1SA 9ICMA 5EWEA 3CKLA 1N0WA 2A78A 1C4OA 4D81A 1GNRA 1TPZA 5FTKA 5JCZA 1GM5A 3H40A 3RS5A 3TQ1A 1ZQKA 5KSOA 2ZI5A 4Q4AA 4MGIR 4F4IA 3RB3A 2V4RA 2X2EA 4Y0VA 4S35A 4K8OA 3S1AB 3BIFA 1E69A 2G88A 3FFAA 2P5TB 5KNBA 2PXIA 4DLYA 1P5ZB 1RJ9A 4W5HA 2QTFA 1KK2A 3MJRA 1FQKA 1KZ7B 3DM9B 5DG7A 2JJ1A 2VA2A 3D3QA 4J0QA 4EFLA 4EPWA 7ICEA 2ZU0C 5JS8A 4F3OA 1Z0KA 1VDZA 1FQJA 3BFKA 4AWXA 4XWOA 2IS1A 1X9WA 1YR9A 2HLDA 1VPLA 1ZNXA 4B71A 4U7DA 2SHKA 1YZUA 1M8PA 1R0XA 2B92A 2FF7A 3GP8A 3SYNA 1TX4B 5AK0A 1NLFA 1ZUNB 2YC4C 4V02A 1AIPA 3BB3A 4LJ6A 1U9IC 4QBGB 1GFIA 1T7PA 4UBBA 1NY5A 1COWD 4Q66C 1R4AA 4HSEA 3AGQA 1P9RA 4KLIA 2EW1A 3W6NA 1SKSA 2VP0A 4DLSA 1KEJA 9ICLA 3BRWD 2UVUA 4NP6A 1MO4A 4DUGD 4EFNA 1OXTA 1QVRA 1ZMXA 1U0LA 2GEUA 1KI8A 4DFPA 3B1WA 5TVKA 2HHSA 4MH0R 5KT4A 1G3IA 8ICRA 1US8B 2VHTA 2HW3A 1ZJ6A 1D8YA 1ZD1A 1VCOA 2I3BA 2XTZA 4OQMA 3VTKA 4OQNA 4C0HA 4F4ZA 1BMFA 1M7GA 2V54A 2ZETA 3RYTC 4ZI2A 3KUDA 4C9BA 4FINA 1HV8A 3RTVA 1E6CA 1VG1A 1WE2A 3D6TB 2OXCA 3NHAA 4YXWD 2D2EA 4IFBA 4QXAA 1KK1A 2KJQA 1ZIOA 1KRPA 3QVUA 3Q9LA 4DLRA 2XZOA 2CVFA 1L3VA 1BPDA 1YU9A 1UF9A 2EFDB 2OE2A 3B1XA 3BWDD 4L16A 4PZLA 2QL6A 4DUGA 3H4MA 1DARA
chains in the Genus database with same CATH superfamily
5HWSA 4FTWA 4AMVA 4Z3OA 2AQ4A 3CY6A 2ZBFA 3NG1A 4W82A 1KNQA 3EVCA 4CIBA 2ZJ3A 1U0GA 2XVTA 2VUUA 3A4LA 5HMLA 3EZXA 4MIYA 5HNKA 4BNNA 1T9ZA 1FY2A 3DBVO 4R2HA 2NZXA 1EE1A 3HZOA 4IIYA 1KAHA 5I9MA 4BMVA 4HAZA 3REQB 4AG5A 4F4DA 2BH2A 3T5PA 4X6LA 1NBIA 4UTXA 5T8KA 1G19A 4AO6A 2VDOB 5FX2A 4D0SA 3VCBA 2P79A 1KKXA 1QRTA 1PVQA 3JASB 1R0LA 821PA 3KDAA 4R05A 2QZ9A 1KS9A 2F3TA 1KS2A 5GQSA 5C52B 2F9FA 4LE2A 4KQEA 3X1YA 1XTTA 5AVQA 1Z29A 1UDRA 2E3JA 4UARA 1J2YA 3HCDA 3GU3A 4BYGA 1PQUA 3O8OA 4Y9RA 3NBZC 4JQSA 1RE0A 3H8JA 2W6OA 2JIZD 4H4CA 1GGKA 3RS2A 5FBVB 1FUUA 2GAOA 3A9WA 2CHVA 3S6JA 2V7QA 4KQJA 4TROA 4B2PA 2FOIA 4UBMA 3WGQA 1M8JA 5K3AA 4DY6A 1MTZA 3ELWA 4MA5A 4RLHA 2D5AA 1C0KA 1Q19A 1XXLA 1RYDA 221PA 5EXTA 2P2GA 4BGEA 4D4JA 2AOVA 5ILGA 3WGMA 5EQFA 2ZE7A 4B9AA 1YDEA 4IWNA 1G5QA 5A4IS 1NBAA 1MA7A 1HDRA 1XDZA 2B3DA 2VSYA 3LBNA 3PF8A 4BXOB 3C6QA 3A4MA 2GX6A 4KZPA 4M55A 4OHXA 2NU9B 2MYPA 2YHUA 5BUZA 1ZJYA 2JIBA 3DCYA 1BHO1 4L85A 3ZY3A 1F8YA 5JSHA 2VQFB 3UG7A 5JH7B 2ZCJA 1XPOA 2YWXA 4HDRB 1D0IA 1THTA 5TPWA 1JLHA 2EQYA 1FFGA 1ZVJA 4RLSA 5BVGB 3VSEA 1SQ0A 2HR1A 2BGJA 1SCAA 1BKYA 1WUHS 3AF2A 4RNCA 4EMTA 4I5IA 4ZU6X 4ZQCB 1H66A 4JYZA 5LIPA 3UZUA 4AZ0B 4IQWA 3G6XA 3MT8A 4FXPA 4QRIA 3DL0A 1U49A 2WD9A 1ULAA 4RIIA 3Q1KA 4WCFA 1JXMA 2OV8A 2CCJA 1P7ZA 2KN7A 1G21A 2HDOA 3PW5A 3WFJA 5LMUB 3FZYA 4ER6A 4MQUA 3GP3A 3REQA 3DAGA 1IK4A 4CEJB 3C5FA 3I5YA 1E61A 3QKRA 4BCCA 2X86A 4COOA 3C14C 3LOQA 3WWDA 1YS1X 2E8PA 2W2QA 2QMOA 3KFLA 2OXIA 5DGAA 3U80A 5FO0A 5C4GB 5IVPA 3PNBA 3ER8A 2FKNA 1FRNA 1O4WA 3NBYC 3EF3A 4RZQA 1BS2A 3RNOA 3B2NA 3CXUA 2JHFA 3R8CA 3X1ZA 3KB8A 2YJ6A 4AT1A 4EI9A 3PXGA 1JFFA 4IGAA 4EA6A 4KVZA 4G67A 1RC1A 4MHOA 1S5PA 1UINA 1C4XA 4GR5A 3EZGA 3IR5A 1X7YA 2V4MA 1MOPA 2A33A 2Q3LA 3BIWA 2ZATA 4UREA 4LG1A 2FXVA 2PJUA 3RANA 4XSGA 3ROXA 2QF7A 2H51A 1PL0A 1F44A 3RIMA 5TT1A 5AKGA 1M1YB 3DNPA 4NENB 2XMBA 3H5RA 1NVVR 2W6MA 2DWOA 3BQMB 4NBVA 2P9BA 4F3CA 4HO1X 4IYRA 2HEIA 3LBHA 3T7AA 2DG2A 4PAGA 4AX4A 5J2CA 2B6NA 2V4UA 1B8UA 4NCBA 4UFOA 1F2TB 1Y63A 3EPGA 2HRBA 1TJNA 3A4IA 1W44A 1WETA 5A71A 1W88A 3KQHA 4OGWA 1X9HA 4Y2VA 4B9NA 3OSUA 4RXMA 1Z6XA 1SQGA 2F62A 1W581 3DUFA 4RMNA 4BVHA 4Y6LA 4F84A 3N2NA 5C1BA 7ICTA 3B7WA 4KV9A 4PCAA 3SS9X 1W4CA 3DF9A 3BE5A 3EQ2A 2W8KA 3O47A 4D3XA 5KQMA 4DQDA 3CNNA 3ANSA 4Q44A 4GDFA 3L01A 3D81A 3VX3A 4HAWA 3OZVA 3JQEA 5TEWA 4DSOA 1LS6A 1WW3A 3DBOB 1SU4A 4NMMA 2IXBA 1H2HA 1FMFA 1H3FA 2I2XB 4UB2A 3KE8A 4MCIA 2PFKA 1GNTA 2CLSA 4GLOA 4MUNA 3RVPA 4E88A 1XVUA 2KSOB 4D57A 3HZHA 4FW9A 5DCYA 1KQNA 2GCNA 5LNK6 2PANA 2H59A 3WZ2A 4NY8A 1H2FA 3T7CA 4C01A 4C7XA 4BQIA 2C31A 1UZNA 3BGWA 3LKVA 2QEQA 3GT0A 1D8TA 3AXTA 3OQHA 3B6ZA 1T5TA 4I1SA 4KXWA 2H0RA 2FP4A 3MFHA 1Z5PA 2QMEA 3UNXA 4IGKA 3JCZA 3UVEA 4RDHA 5ICCA 1LTKA 1PR0A 3PT9A 3I6QA 1JKMA 1XL1A 2C7GA 2NLOA 3NRCA 3ND6A 1U1FA 3EZ5A 3GEHA 4NBWA 3K0BA 2PV0A 2ATLA 2HV8A 1ID8A 2C29D 4BKUA 4R9UC 3ONNA 4RZRA 1SB9A 1F6BA 4ZVPA 3T4UA 4BP8A 2ZB4A 4HEJA 2ZI4A 3BS7A 2Q9CA 4DT1B 2Z8XA 3ID6C 4DQXA 5JXWA 1M6VB 2FRVA 1UPFA 1JVNA 3IVAA 4IIVA 4H27A 1JIHA 4Q9NA 3T38A 1KZ9A 2H2DA 1FTGA 3CUKA 1NBME 2OYRA 2C7RA 2PZFA 6REQB 2HT6A 1C9DB 1IXRA 5IT9A 3O26A 5EE3A 1D9FA 2ATCA 5K0GA 2NU6A 3KKPA 4GIBA 1W47A 1G3QA 1W96A 5HRCA 5EJ6A 2RK6A 1PVDA 5H8WA 3ZBQA 4DC9A 1SCQA 3CV3A 4WIAA 1Y81A 2Y1FA 2C7BA 4WGGA 2XXAB 3HQ4O 1SUCA 1EQUA 3PW2A 3ROKA 3BE6A 3GRAA 4PANA 3HPRA 1L4GA 5I9LA 4LBYA 4REQB 1DP4A 4ARZB 1FDIA 1I51A 1LQTA 1LXCA 2H4HA 4IS7A 4EPVA 4MF2A 1IRIA 1SGWA 1DWQA 1H5UA 2IDZA 1MG5A 2WDZA 4HDAA 4DQIA 1AUPA 1PSDA 1T2CA 1XEAA 4AUKA 2AZXA 4OOFA 3G89A 5H9VA 2UXDB 3DDSA 4YRGA 5K20A 4DL5A 5AQEA 2ZUTA 1XZMA 4O63O 5JUWA 1X9XA 3SHFA 1WUIS 2ZIFA 3GVXA 4WQMA 2E3TA 4G1FA 3SJCA 3RG2A 3EW9A 4FONA 4OGGA 3VTZA 1SKBA 7REQB 2CRXA 1BYUA 1K7XB 5BSMA 3QUAA 2QARA 1VLZA 4B17A 5SY6A 4CKWB 5KJCA 4R2IA 5IT0A 3KTAA 3R3SA 2WM8A 4B0PA 4HVCA 2JFXA 4UAYA 1YZTA 3H11A 4P33A 1VL2A 2O8VA 4D4KA 1JAHA 2ERXA 3I1IA 3M4NA 3M9XA 1TZMA 3PWKA 2C42A 1UBRS 3KLBA 4I4CA 4QXMA 2RH8A 2ZYAA 5KTOA 2BFAA 5C0OE 3DE0X 1YQGA 4AJHA 1A0PA 4BCBA 3L79A 1S9HA 4HDSB 2EERA 1CF2O 1D2EA 2HXGA 2RCYA 2KFNA 1AKQA 2PUJA 4PAQA 4XX1A 5BOSB 3WGIA 2DXIA 2VHEA 2YXLA 1XQYA 4A5SA 4CCYB 3BS5A 1EFRD 1AROP 3IMCA 1TU3A 4OJYA 1U0OC 3L04A 5JNLA 5DWDA 4YMIA 5FYQA 4BVLA 5HQTA 4HG2A 3FNEA 5C8DA 3UWOA 3WS7A 4A73A 3VZSA 1U6JA 2BGNA 3DMHA 4KGXA 5E4TA 5KNBD 3KR2A 2CB0A 3G0GA 4KXXA 3TADC 1GQRA 1UDCA 4MJ7A 3JQRA 1YZKA 5JRDS 4CVNA 3ZWXA 1FRQA 3ECCA 4GI7A 4MI9A 3PKJA 3U3OA 1T3HA 1YAJA 1XAHA 3U1BA 2AN5A 2D7JA 2EU8A 4CTJA 3IPAA 5JBIA 4WN9A 3A1VA 1ADYA 4XLTA 3M9WA 2J9ZB 1GVNB 2Y6UA 2GFHA 4D9KA 3P0IA 2OGWA 5JALA 1TVEA 3TO5A 3TZKA 2L0XA 1NJ6A 1A2BA 3TOXA 3VA7A 3TNLA 4IOMA 2ISSD 4YG2A 4HNVA 1XCJA 3OP4A 4RTJA 2PT7A 4FZNA 1VBNA 2QRVA 4OQYA 4ENRA 3HSSA 2YHIB 1RQXA 1E3JA 2VSQA 1Y37A 3CX6A 1E9RA 5LXTF 4IMRA 1I5OA 4OUKX 1ZIXA 5C2JB 3P4XA 1A4IA 1UBEA 4PFSA 1K3FA 5BYJA 4AURA 4H59A 3OJEA 3NP9A 3CLSD 2OZEA 3UMFA 4UMEA 5A9TA 5LA6F 4OMCA 1JMSA 2Y92A 4AYWA 1I2AA 4WY8A 1Q6ZA 3C8ZA 2MWMA 1BRMA 5K2OA 1K3TA 1VP3A 3OOWA 4BCDA 2ZREA 4KPUA 2OAP1 4BO0A 4EB0A 4QT0A 4YDQA 1EX1A 3NCTA 4O4LF 1HEYA 4DIOA 2C9CA 5I8WA 1EGVB 2YN4A 3P4UA 3D02A 4RJIA 1Z22A 1GAWA 5DI3B 2VHWA 3HDQA 5HHIA 5KNCA 1Z1BA 2QLTA 2VNKA 3ZZTA 3W5VA 3M4XA 4AJJA 2WK1A 4J94A 5C37A 2K5UA 3KXKA 5JANA 1NURA 3KZOA 3OZTA 4GVLA 2RIRA 4WOBA 5U1PA 3U39A 1JSCA 1M0WA 2G3YA 3ZVNA 2QDXA 2VK8A 2W0MA 2BFEA 3DOHA 1JHZA 3QXHA 4FFRA 4JCCA 5LQUA 2DTEA 4ZJUA 1NR7A 2H4XA 4R31A 5DGHA 1BVYF 2Y1WA 2D5LA 4GXRA 1J2EA 4MUYA 2DKZA 2WWRA 3VNUA 2JZBB 3FMPB 4JC5A 1WUKS 1EWRA 3BF7A 4ZTBA 1XU7A 3HCFA 5G41A 1UKBA 1F2TA 1VB3A 5FRDA 4M46A 2WV9A 5EP1A 1N34B 2DR2A 4HEQA 1XEFA 3FPLA 4X1IB 4MQ4A 1DTWA 4KREA 1K5DA 2FXIA 2QUHA 2Q27A 2B61A 1T5SA 1KQ3A 3I9MA 3OOEA 5YASA 4DY4A 4CL2A 1PJ8A 3MJFA 3WAJA 4YRTA 4V39A 5ESXA 3TWOA 4AZ3A 4BWYA 3TL3A 1ZQXA 8ICLA 1Q12A 2DLNA 3DAFA 4EX7A 3GXOA 4A82A 4YMLA 1P0CA 2O7NA 3W3AA 2IHMA 1RRPA 1XN4A 4WWHA 5JDCC 2V5AA 4K2AA 1X13A 1EM8A 4OO1J 2BZ1A 3K6SB 1U31A 4YQZA 3KETA 2YUTA 4YECA 1N63A 3LQFA 4A8EA 1DKRA 2BEUA 1SZCA 3C5CA 4Y1RA 2ZIZA 1YFKA 3N86A 1IBLB 4JI4B 3C3EA 4BQQA 2O5CA 3V97A 2Q4TA 3GO4A 3C8DA 2AC4A 2GDJA 3IO3A 4N8SA 4YRKA 1FMCA 3PGA1 4MGYR 1FXWF 3ACBA 8ICQA 2AFRA 4WZAB 1WBBA 4M8NE 5KAMA 4M0KA 5DTJA 2KHZA 2ZYUX 4TSFD 3QELB 5CJPA 2O8EA 2F6RA 3RYFB 4PO3X 3VR3A 2GZ2A 3WP0A 3I6ZA 3JZAA 4CF6A 4I50B 3H1AA 3O4RA 4AN0A 1X9SA 1C50A 3PX6A 4UQLA 4Y9SA 1USGA 1BW9A 4QEKA 2NN3C 7ICRA 1N1DA 5K3BA 3VAYA 4EMSA 1ZQ9A 4EJFA 4BMPB 5LB2A 4B3RB 2B6HA 1XMSA 1JHRA 2M9NA 2NO4A 1PEAA 5BR8B 2FPMA 2H8KA 3BZKA 2D3TA 5ALPA 2E6UX 2EQAA 4A27A 5HZMA 4FCTA 5THQA 3TR5A 3IHWA 4KVFA 1VIMA 4QFMA 4DPMA 1YOBA 1YJAA 3MMSA 3GZNA 5DLYA 4ZANA 3L7KA 3TX2A 4N48A 4OQXA 4CI0B 3L0BA 4EJ6A 1V45E 1P29A 3EA5A 3WHLA 2GERA 2PBLA 5KMGA 2AL7A 1QTMA 5F2KA 3JSXA 1WZ2A 1XAJA 3ZJVA 3JYQA 2IYRA 4KN5A 2FTKE 1KVUA 3V6KA 1LWOA 4P82A 4PGMA 1SUDA 1SQ6A 3SM3A 4C4SA 1MD9A 2YV3A 4CIAA 2FPKA 3VZBA 4J7UA 3NPMA 3SR4A 1YZGA 3L8HA 3CKKA 4F2HA 1DKMA 5T4HA 3D6UA 3UJ7A 2QD1A 1H1TA 2WP8J 3WRYA 5T5QA 1F7VA 2VBIA 4HPJB 2LCQA 2WAQC 4O4IA 3FOEC 2QAGB 1UJMA 3GFTA 2QQ5A 1R0KA 1VKOA 3OT1A 3R0VA 4ND5A 5CUQA 1U9ZA 3GLRA 3GK3A 4EJSC 1DG9A 4UDXX 4IIFA 3TW4A 3AKCA 3AEUB 4QGFA 3TYXA 1IBMB 3TFRA 1IL0A 3I2IA 2NXCA 2A0UA 4FHDA 2DPJA 3WLKX 3OIVA 4IJ5A 4DQPA 4J8PA 1RYSA 5MN5A 3MWDB 3LPDA 1JIUA 2XECA 3KD2A 2E2WA 1VMAA 3LWMA 2OHGA 3GJRA 2EKBA 1ZD2P 4N0DA 4EHJA 2XE7A 3MWLA 1ZR2A 4F91B 1ZU5A 5GJVC 9ICIA 1MB4A 5CA0A 1HGXA 4NQRA 1MT0A 1VIVA 5JRTA 2ATIA 4W5NA 1KDOA 4MI6A 2WFLB 3I9V6 4H35A 4WASA 3TQFA 4EY5A 1Q7BA 3FWPA 4Y6GB 4I29A 4H6VA 3TXYA 4ZAWA 5F98A 4D96A 4D0LB 4QZ9A 3WIOA 2QY6A 3HL4A 5I5EA 3KU4A 2PL3A 5AM0A 4B3SB 1W25A 2VAXA 4YMGA 7ICFA 2HA3A 4F46A 5L1KA 5HFAA 1ITZA 4WLFA 1TT5B 2PG3A 3TDNA 2QIPA 4MKFA 3U4QB 2MAXA 5BVHA 5DTIA 2QTAA 1UEXC 5FBLB 4WZBB 2NZJA 4JJFA 3V7FA 3VJLA 1SBZA 4R63A 5KFQA 1AKTA 1J99A 3AL0B 1RCTE 3FVQA 4M21A 3NC4A 3DLTA 3AVWA 4YT5A 4IL6U 1GP2A 3ZU3A 2C77A 3KKAA 3EY9A 4NLLA 2K7FA 1O5IA 2H7VA 2OV3A 1ZMTA 1U5AA 1A8SA 1GQ2A 1LB1B 3ZGNA 4BNDB 3EVBA 4FC6A 2X4IA 4UHCA 5CYOA 3K0CC 3OQIB 2EHDA 2IV7A 1E4YA 3H19A 3MFIA 1AJEA 3SC2B 1NXVA 4UB5A 3ZI4A 3EQ8A 1TIBA 2JGFA 5BN5A 3FUUA 1FSSA 1I24A 1WKBA 1QOPB 2JLAA 3JRXA 1BXRB 3NTVA 5BXYA 1CSEE 2BT4A 1YF3A 3M6ZA 1JHQA 2R79A 4Q4LA 5KT3A 1JIIA 4I2DA 1UKAA 2GM5A 3PR4A 4TQUS 1UL1X 1YE5A 4YJ3F 3FTQA 1U2ZA 5DBEX 4PZPA 2C84A 3GLFE 1TPYA 1KMHB 4Q24A 1MOQA 1N9GB 1IUNA 2VXCA 4WGFA 5CLLA 4YRLA 4PAMA 1LX7A 4JH0A 5FTJA 1ZQSA 3TRFA 1H05A 2V9CA 2VG8A 3E48A 5AVRA 3A1WA 4MW6A 1W76A 4D92A 2KBFA 3EEBA 4B3HA 4J9RA 1PJBA 2HN9A 2PN1A 2C82A 1A97A 3T5LA 3C21A 1JYSA 2WWIA 3BWVA 4BO1A 5TZVA 2B78A 2IYEA 5J58A 3RFFA 2PS1A 4CU5A 3LV8A 5LYJF 1Q46A 4E14A 2APJA 3WC4A 3JSAA 3AT1A 3RR2A 3TKYA 5IWAB 4UULA 4Q93A 2HF9A 5EIWA 3DNFA 1JHDA 4WKCA 5ERGB 1ECJA 5JXHA 5LPNA 1T8PA 3ZXSA 5L6MB 4K6FA 1FTSA 2PXAA 2QTCA 4HGNA 3VR6H 2FE4A 2J67A 1W87A 2XMPA 4Z9XA 1DFHA 4JI3B 2VWGA 4Z9FA 4DLGA 4MMXB 1NUTA 1G42A 2IYUA 5IKPA 2AKAB 3LDAA 1M2WA 2F3UA 2CMGA 2MDTA 1T36B 4LOIA 5AJZA 1PK3A 3L4KA 1TAUA 3V4RA 3EGCA 4E94A 2X1VA 3NU1A 3SVZA 1QXSA 1VFNA 1E59A 4P4NA 4CBVA 1ZH4A 4PX3A 4WESA 5FR2A 2G5GX 1KEKA 4C0BA 4PV7A 4C3UA 1H2EA 5KFEA 3KE9A 2AF4C 3BS4A 1XTUA 5AVZA 4CEHA 2E8NA 2ORVA 1ZQEA 1G60A 1ZD9A 2QLLA 2V74B 4WCVA 5B3KA 3TMKA 1X1RA 3BL5A 1VE9A 1QS0A 4Q3KA 3TUJC 4DSZA 3WK6A 1ONNA 1WSAA 3CR8A 3R6WA 3SSOA 2VDVE 4Z0TA 3VUFA 3DUWA 5JSQA 2ZU6A 4PQGA 4G4SP 2EOAA 3DEZA 3F7NA 3PJRA 3PO5A 5SZIA 3M6IA 3WKBA 1KK3A 2P4HX 1EUDB 4Q47A 4P83A 2I2DA 1WQ1R 4Z8XA 3E82A 1CRPA 1ODIA 3JPTA 1YT5A 2D8CA 4FOLA 2A9JA 3LW7A 1QYIA 4RSGA 1Z33A 3TEFA 4DM4A 3K71B 4UATA 5DM60 1R64A 3G1UA 3S81A 2F8SA 1NXOA 3ZWVA 3PX7A 4MVWA 2EWMA 5JNUA 1F6DA 1WYGA 2H1WA 2PT6A 3VDMA 4ZCLA 2CLHB 2HNKA 4G0ZA 4LY0A 2QTNA 2QBYB 3JPQA 3FHJA 1FYDA 5GMOA 5BW5A 3RNLA 1DKLA 3AV3A 4KIFA 3S3TA 3TNYA 4C7OA 1HE3A 1NUQA 3L0SA 2DFPA 2WJWA 2H3ZA 1W0KA 1ZQPA 2W2LD 2NVWA 5BOMA 1JDJA 3H2KA 5ALDA 3MUFA 4B5KA 3NC1C 4Q4JB 1A5SB 5JD4A 3C3CA 1OFTA 1OX5A 2VK4A 4M9RA 1UJ6A 2J9YB 1TW3A 5CX1A 5BRAA 3F74A 3H3JA 4RF4A 1BWQA 4EHDA 1E3TA 4R40A 5TSDA 3K0CA 1UMDB 9ICNA 1U9YA 3H4TA 3UXYA 4UPEA 3S2FA 1OPRA 4QZHA 2EAUA 4QASA 1G55A 4FZVA 1CIPA 3PD7A 1FNNA 1R6VA 3FAHA 1E6KA 2D6FC 1G0OA 2FX2A 2GJAA 2CLKB 4BAZA 5BMVF 1NVAA 3EWIA 1G9XA 3BTOA 4TQ9A 1DSSG 1B43A 5IUKC 1YS7A 5JNVA 5JS6A 2B35A 2XI4A 3FGOA 1GFZA 4HN2A 4HC4A 3EBLA 1VMIA 1Y7HA 3SZLA 5KTTA 4TZ0A 2BBSA 1OLXB 2EZ8A 2IX3A 4U6SA 4YYZA 5M5BA 4IGEA 1T2VA 2F4VB 5FF9A 3DOIA 5K6AC 1IQ0A 3M6FA 4RY2A 9ATCA 2RKWA 4D46A 5JC8A 3FWYA 3H4BA 2C5FA 2ECKA 1GKIA 2P41A 3HA2A 3UKOA 1KU0A 3A2NA 2WTMA 3OJWA 5A02A 5CB4A 2R5NA 1LQ2A 4X3OA 5BR4A 3MBKA 2AZTA 1L5VA 2ZZNA 3O73A 5F9HA 3L92A 3ZOKA 3HLKA 3PGXA 3HGTA 4P4PA 1IATA 4K1LA 1RRCA 4QW8A 1T3NA 1WR8A 1SCJA 3LQ1A 1HRDA 4I1YA 4LRSB 2DECA 5E2BA 3SHOA 5J0PA 1SD1A 2BKXA 1SL0A 1X8KA 2HGZA 2NT3A 3HBMA 3E3LA 3INYA 4KQWA 2GJ8A 1LPNA 2QX7A 2V96A 3ZJUA 4DMFA 4BN4A 2JGLA 1ONPA 2AG1A 3N7PD 4DCPA 2GN4A 2HIMA 2IA5A 1OOEA 5G0SA 2QMYA 2Q41A 3EDQA 5DSZA 8ICVA 1RADA 4Q1FA 2XWBF 2I2BA 3V1NA 2JIPA 2VPTA 3FOWA 4PHCA 4WXYB 4CMCA 5DB6A 1QU3A 2NRTA 3IAXA 4S12A 4YR0A 4OHVA 4D9CA 2W2PA 5A4AA 5CDSA 2PQ2A 1C9EA 4BFVA 1IFXA 4MS3B 4DF3A 1HMPA 2W6NA 2O9JA 3NRBA 4I46A 5E2IA 2C07A 4JAVC 4LI0A 3OSNA 1P0PA 4AW9A 5I01A 2Z58A 1NK7A 3TQHA 2Z43A 3ZX4A 1QIIA 1DX4A 4ATNA 4ZT2A 4P2HA 2IGBA 2KS6A 1UXGA 3DAYA 3EEFA