3LDAA

Yeast rad51 h352y filament interface mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
319
structure length
293
Chain Sequence
b'GSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVNIMAYSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD51
molecule tags Dna binding protein
source organism Saccharomyces cerevisiae
publication title Insights into the mechanism of Rad51 recombinase from the structure and properties of a filament interface mutant.
pubmed doi rcsb
total genus 99
structure length 293
sequence length 319
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ldaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ldaA02
3MR3A 1N56A 1E2LA 1FX0A 5KFUA 3JPPA 1G7SA 2BM0A 3UXMA 4ERNA 2ZRGA 4PAOA 3RB4A 1JMSA 1E9FA 2IYLD 7ICUA 3TAUA 3VU9B 3PW5A 4IDQA 3CNOA 1T3NA 4BLSA 1Q21A 3BBPA 1VYUA 1N6LA 4DF4A 1U8YA 5CLLA 4O3OA 3H2YA 1KMHA 4LK2A 4J9LA 3CRW1 1SKYB 4E07A 4KYIB 2CHGA 2GCNA 4AY2A 2D2FA 1H38A 1WF3A 1JAIA 2HHVA 4ACAA 3T5JA 3P1JA 3CRVA 1NG1A 1PLKA 2XSZD 3ZDEA 1JR3E 2LYHA 3U7HB 4IDOA 3H4DA 2MUTB 4QNMA 2CJWA 1Q44A 5L3QA 3NG1A 4M1TA 3MGCA 5IT5A 4KLJA 4DCSA 4F92B 4OYHA 4LC0A 4Q7KA 4RJLA 3AP1A 3GFOA 3U61B 5A4JA 3GLHE 1UBCA 3R7WA 2JIZD 3G6YA 1W0KA 1E79D 3B8HA 4RQ4A 3UIEA 4NH0A 1OB5A 3MFHA 4RQ6A 4IR1A 2ZI6A 1TUEA 3IO5A 5DLGA 3KHLA 1VPLA 1KI6B 4I1OA 1RYRA 2IT1A 1Z22A 2GBLC 1G7TA 2XJ4A 1X8KA 5EE1A 4BRUA 4QZCA 4ARZB 4NYJR 2IHMA 4WW0A 4MKIA 2HYIC 1VCMA 3ADBA 3UXPA 3B2EA 2C8VA 5EWFA 1E6CA 5J0PA 2HXYA 1RZ3A 4U00A 5E7IA 5FL7D 3THYA 2MSCB 3REGA 3T5KA 4DLZA 4CEHB 1QDEA 3GFPA 4C3ZA 1S10A 1AM4D 1P62B 4I1UA 1R0WA 1HE1C 3GMTA 4IOJA 2JLYA 5SZKB 4GBMA 3K0EA 1RRFA 3N2EA 4UJ3A 5FL7A 4PHFA 1XBTA 1PUJA 1U2RA 2GJSA 4GL2A 3SYNA 1OB2A 3QF4A 4NYIR 1AN0A 1XXHE 4F4ZA 4TURA 1COWA 3RJGA 4BQSA 4EDHA 1LV5A 4C8OA 3D8BA 2EW1A 1S2MA 2MMGA 4O5KA 2ZE6A 4AC9A 5AUNB 4YN4A 3G6VA 4J9MA 3CRMA 2TMKA 1U94A 5B58C 2G3YA 4TYNA 3VU9A 2IHYA 4NLGA 1PZNA 4JKIA 4TL9A 4D82A 2JLSA 2OHFA 4DS4A 3QEAZ 5HMLA 1GFIA 1V43A 1X1SA 1E9CA 1Z6YA 2V6IA 4ED2A 5P21A 2O8CA 3CRRA 1X8JA 1GNQA 4QW9A 3B1YA 4DLTA 1GDDA 3DPUA 3EASA 2P5TB 1HA3A 1D9FA 3MD0A 3EIHA 2BVNA 2JLRA 1KHTA 2ZQ5A 4NP6A 4PHTA 3ZS9A 3QE9Y 3PEWA 1AQYA 1EX7A 3HU1A 1LTQA 3LW8A 1T0JB 2JAQA 4U5XA 1DS6A 3RJKA 2PZGA 5HHIA 5L9XA 5KFXA 1T8EA 2Q0ZX 3V72A 2ZJ2A 3CX7A 5EE5B 1VTKA 5HZHA 4J0QA 4URUR 4OHXA 4AURA 3ZVNA 3PVXA 1JR3A 4M2LA 4OHYA 2ZR0A 3ZYCA 3TQFA 4F8RA 2CE2X 2CLDX 1Z0JA 4OK3A 4Q21A 3TSZA 4DLSA 5KOYA 4Q9IA 2ZYWX 4WXPA 3WRYC 5BN5A 3SQXA 4JT2A 2HCJB 2PEYA 2CL0X 2OCYC 4GDFA 2XGPA 5KFJA 3RR8A 2BWJA 3M9MB 1U47A 4KLUA 3KUCA 1RFLA 4JWMA 2BQ3A 4MGKR 3M9NB 4TSFD 2QAJA 5A5GA 1Z3IX 3RS3A 4IRKA 1W0KD 4TQRA 3EYZA 1Z63A 4GOXA 2KTQA 3GQCA 2OWOA 4KODA 1L5UA 1ZQBA 3PEVA 1HQCA 2XC9A 2Y1JA 5KFEA 4EJSA 3RH4A 4QZBA 4EFLA 2CHQA 4Z6EA 4DLEA 4JK1A 4QGAA 2E9SA 3QXCA 4LJ7A 4RZ3A 2VHUA 1NVWQ 3F5FA 1DPFA 3Q5EA 3S1AB 3BDPA 5JCPA 4NM1A 2BGWA 2KJQA 4JV1A 4N1AA 4P4TA 4OQXA 3KQLA 1YZQA 2J87A 2ZRNA 3QF4B 1OH8A 3EZ5A 4Q7LA 4TWZA 3QEBZ 1E2GA 2FFBA 4ZI2A 3GP8A 4O9MA 4GNKA 1XWIA 4DOBA 2UZ3A 1ZETA 3WBKA 1ZUIA 4P2HA 2JIZA 1X9MA 1CJTC 2AKYA 2OXCA 4TLCA 3I61A 2F3TA 2R8IA 4DLRA 2ASJA 3T35A 3BFVA 1ESMA 3QE0A 3DVLA 8OHMA 4BE7B 4JJKA 4DFPA 4K4IA 1L7VC 2BIFA 4DOCA 1VG1A 4GI7A 4WIAA 2CE7A 4BXOB 4TYPA 5JI3E 2W0SA 3CO5A 3UQ0A 1CBUA 1E2KA 3EPJA 2FDCA 3E2EA 1BOFA 4LGMA 3GEIA 4LDJA 3KKPA 2LCFA 2ZSFA 3DMNA 4MA4A 5JWRA 4PPNA 1OH5A 2QUZA 1N6HA 1LB2B 8ICQA 4MYTA 3E1SA 1ZQEA 3MFIA 4AK9A 3CF2A 5L8VA 4F5QA 1QHHB 3KJGA 4I99A 3SU8A 1ZW6A 3IHLA 5FOSA 3K0AA 4KBFA 4MRSA 4AKHA 3MWKA 1KKMA 2BHRA 2ISOA 2ALZA 4PO8A 1DAEA 7ICJA 3JPNA 4M8NE 4YMUA 2AWNA 3ZDCA 3KHHA 8ICCA 2R44A 2VQSA 2RDIA 2XAUA 4N3NA 1VIYA 4PQFA 4Q1BA 4DB2A 2JLWA 4W5HA 3PEYA 2FSHA 1TKDA 1SKYE 1ZMXA 1UM8A 3SJBA 2HF8A 4YQWA 4B6FA 3BE4A 4JLDA 1XX6A 4KLSA 3EAQA 5BQ5A 2H17A 3REFA 4LY6A 2AJQA 3KFVA 9ICXA 3J81k 4F5PA 3A1VA 4KLGA 1MO3A 1ZINA 2ORIA 2YWEA 4IEIA 3SBEA 4U7DA 3U3JA 5FBLB 5KFFA 3GIIA 3KTAB 1N2CE 4JVSB 5JFGA 4HYYA 1LVGA 2JDIA 4HLDA 5GADl 4I2DA 1ZVQA 2IYRA 4RCZA 1GUAA 5KPJA 3K0FA 1G8GA 3HWTA 1K6MA 4PTLA 3AP2A 3PW4A 2DCUA 4U02A 1K1SA 1OH7A 7ICGA 3O8CA 1TQ6A 5FTKA 4C0AC 5JRJA 5K8UA 4HUQA 1S9FA 1ZQTA 3H4BA 2GKSA 2H7VA 5JHGB 1FX0B 1ZM3A 2AK2A 5E4FA 5DDMA 1XJCA 2ZI9A 4DCNA 1RJ9B 4EQ6B 8ICEA 4B33A 4B2PA 5KT7A 5L3SA 2ZTEA 1KO1A 3X1WA 4MEYA 4O3PA 1OXSC 3EZ2A 2XGJA 2F7SA 2G9NA 4NU0A 5B30A 2FGJA 4I1SA 1P2SA 2R8GA 3SNHA 1HT2E 1Z6GA 3RS5A 2EVWX 1AGPA 1HQYE 5HP4A 2ATVA 2BMEA 2RCNA 3IPXA 4OL0A 3PY8A 1S8FA 1UF9A 2VTKA 2QPAA 2QTHA 4OQNA 3RWMB 4D80A 3MBYA 1UBFA 1KNQA 1AGRA 5IIIA 1G3MA 2OCBA 3ZD8A 2WJIA 8ICRA 3ZDQA 3GD7A 4C0HA 2E1RA 1S3GA 5ANRB 4G3IA 2IYZA 2FOLA 5HTKA 3QBVA 5AJVB 2GCPA 1DAIA 4TQ9A 1VCOA 2PJRA 3Q8KA 3TW4A 2FPLA 2QE7D 4LYFA 2GJAA 5IF9A 4QG7A 2VA3A 4ASUD 1OHHD 3CRQA 4PPFA 3RRGA 3AF0A 3HYRA 2G6BA 3IEVA 1E1RA 4DF8A 2PJZA 4RU9A 3OHMA 2FJUA 1IXZA 2VPPA 5DLFA 3PIRA 3V9PA 1YZNA 2IWRA 5DDYA 3K0SA 3RWOA 4UAZA 1VDZA 3AF2A 3QXJA 3U44A 1G41A 1S97A 3KJEA 4LCBA 4OQLA 2FLNA 2ZI7A 3C41J 8ICSA 2CK3D 2REOA 1SHKA 5IK2D 5JRZA 5JECA 3ICEA 3U44B 1X1RA 1O3YA 3TVTA 3QVVA 3M9OB 3EIQA 4PHEA 3IILA 1GITA 2OBNA 3SEAA 2RGGA 2AXPA 5KFYA 3Q3JB 3A58B 2OG2A 4YXJA 3QG1A 4KSCA 5BOMA 5CYOA 3UPUA 3LBIA 4O2LA 1ZUNB 1SVSA 4OBEA 4FMDF 2FGKA 5J47A 4FBUA 2HCBA 4KU4A 2ONJA 3I5YA 2DY1A 4ECWA 3WHKA 5TZVA 3KTAA 4NXZA 3FMPB 2J6TA 4RD4A 3BFKA 3OE7D 3U3MA 5HZKA 1G21E 5J0XA 4GOJA 4RQ7A 4QKQA 2BCVA 1G7CA 1T7PA 1G7RA 1OPXA 2WMOB 3BK7A 4EKDA 1L4UA 4ZDJA 1GRNA 1HTWA 3M0EA 5IIOA 1TMKA 2F9MA 2NOAA 2A2ZA 2A5FA 4AKEA 2QAGC 1DAKA 2C2RA 5KFCA 1MKYA 4A8JB 4ED1A 2IK8A 1XTSA 2P5SA 3LWLA 1WCV1 2VHTA 4UB1A 1GZSA 1R5OA 1RJ9A 3B0YA 4EQ6A 4L8GA 4LHYA 4I2HA 4US2R 1TQDA 1P3JA 2PX3A 2HHXA 3HU2A 2JCSA 2QMOA 4GLXA 3RTVA 3E70C 4NYMR 4D25A 4C7OA 1KDOA 1IN8A 4RT3A 2R6AA 4MRPA 4M0LA 2IUUA 1ZJNA 5FUXA 4Z54A 2VP0A 1U9LA 1Z29A 3VKWA 4V0LA 4M9HA 2X19A 4Y0AA 4LHXA 2FMSA 4RZUA 5K8IA 3Q8XB 3C5FA 4NLNA 2KN7A 1ZU5A 3FB4A 4M47A 1F2UB 4TLBA 1I4LD 1FP6A 4MFAA 1HUOA 4I27A 4JLBA 1GP2A 2QBYA 8ICHA 1GSIA 3ASZA 1T3SA 1RE0A 2ZRKA 4TZ0A 5KFSA 5DB7A 4V02A 2NRVA 1UBEA 221PA 4P4SA 2ECKA 2AFHE 2J45A 3UANA 5DB9A 1XTQA 3EPIA 3F8TA 4TMTA 1NNEA 4C2UA 4NYMQ 2HV8A 1NK0A 2IXEA 4PR0A 2DHRA 3B1XA 3LAWA 4OHVA 5C4MA 1E0JA 2VHJA 3SYLA 1BIFA 1KMHB 3M1IA 4YMVA 1IAQA 2IEYA 2ZRMA 5FTJA 4DT1A 1M2OB 1ZM9A 1ZQZA 1YR7A 3EC2A 4DWIA 3MGHA 2GJ8A 1A7JA 3MDCA 1ZQXA 3W34A 3ZZ0A 4DEXA 1FNNA 4Q4AB 5FPKA 3THXA 2X8AA 3AKYA 2FMPA 3K4GA 1WP9A 4Q7JB 1MOZA 1F2UA 3QENA 4KLDA 4GZMA 3VAAA 3V4RA 2C78A 3CX6A 3QKSB 1T3LA 1BO6A 1QBKC 2AKAB 2GF0A 3K09C 4NHOA 4PGQA 2QM7A 1ZM4A 2JLZA 3UXOA 3UG7A 5JEEA 2DB3A 5KFWA 1ZD1A 3GV5B 1RXWA 3T34A 3WP0A 1YZKA 3QEOA 2FMXA 2F9LA 2PZFA 2ODBA 1TADA 2UKDA 4QZ9A 3MCAA 4A0FA 3RAPR 1RPLA 1E2PA 4DSNA 2XY6A 1S76D 4QFMA 1NRJB 4KLIA 1FMJA 1SVWA 4DLVA 3N5CA 1K8RA 1XTIA 2J6SA 1G9XA 5SZHB 4BFYA 5CHGA 4IW3B 3ZIAD 1U99A 3ND9A 3V6HA 4P3YA 2UVQA 4HB4A 4UB5A 3VR6A 1JALA 1WE2A 3GJ0A 2MSDB 1F2TA 4HDCA 1W0JA 4L4UA 1EFHA 4QWDA 3THVA 1AIPA 4I2JA 2GVZC 1DARA 3ZQJA 2ZTCA 3HX0A 5EUQB 4B3CA 1JPNA 1UBGA 3FKQA 4RD3A 1IXSB 3L8ZA 8ICFA 5D3MA 4M1KA 4WAUA 4IDNA 5KFTA 1VHLA 5LD2B 1WXQA 3IUYA 3JPRA 5CK4A 1ZYUA 3KXKA 1BYUA 1T0HB 2ATLA 1ZQSA 1XD2B 1YQTA 3K09A 2VBCA 1Z0IA 5GJBA 3THOA 1G3RA 2NG1A 5KTQA 9ICLA 5EXSA 4A0HA 1Z83A 4R7ZA 1R8QA 1S9HA 3P26A 9ICIA 4IDHA 2C96A 1XTKA 2BCJQ 2EFDB 3NH9A 4GFDA 5SZJA 1FUUA 2XITA 1Q3TA 3VX4A 4X8LA 3ZVMA 3IHWA 2C2HA 4Q43A 4EUNA 1NJZA 2BCGY 1NVUQ 3JVVA 3SN6A 4G5OA 1TF5A 4P0TA 4G3XA 1IN6A 3EZ6A 3NEYA 1H8HD 3OSPA 4Q9JA 1G4UR 4TMKA 3HU3A 4KLTA 3TIFA 3KUDA 4P4PA 2NPFA 1AS3A 1OIWA 3UKDA 4J9NA 5F9HA 4K4HA 1E2EA 1EFRD 1G5RA 1G19A 4HSEA 3SZ2A 1QHYA 3PUVA 1A77A 1FP7A 4LZDA 3THXB 1BGXT 3CWZA 2GXQA 2RHDA 2NGRA 4TQUS 4C9BA 2ZE7A 1WQ1R 4XVQA 3V00A 4FO6A 4UAYA 5J4LA 1UEIA 1XCMA 4TL7A 2RGEA 3G82C 3PV8A 2Z6VA 3EXAA 5G3ZA 4GOKA 2F1IA 1U8AA 3SFVA 3VR5A 2OXRA 3HPOA 1KDTA 3JZAA 4PXAA 3AM1A 4HLQB 3RANA 5KNCA 2QM8A 3RRHA 4LJ4A 1G3IA 1BPEA 5J2DA 3KJIA 1GOTA 4F4JA 2QY9A 2FN4A 4R64A 5KFOA 3UATA 2AGPA 2DFLA 2CLSA 2IXFA 2VSXA 4LYAA 4R98A 4LI0A 5KFZA 1OFHA 2OLJA 2WKQA 3SI7A 4UKDA 2Q3MA 3X1XA 1DG3A 5J29A 1S0VA 1QHGA 5KG7A 2W8KA 2YWGA 1CJUC 3EZ9A 4HUQB 3GJXC 1ZQWA 2QAGA 2VP2A 4QJ4A 4JVNA 1UKYA 3PO5A 1QLNA 8ICJA 1DELA 1ZCBA 2A3RA 1XEFA 3BB3A 1JEDA 4YR0A 4KFUA 5AJWA 1X9WA 3RAQA 4F4KA 4O5EA 4QGHA 2KSQA 3LO5A 2FE4A 2WKRA 1E9AA 2V6JA 4JLNA 4ESHA 9ICBA 2NRTA 2JLQA 4YMMA 1TK5A 1U0HC 2FU5C 4CEJB 1YRAA 2G77B 1KDPA 3QJYA 3ZD7A 2XNDD 1YZUA 2CCJA 2K5UA 4OQMA 4AG6A 4GC7A 3TUZC 2F55A 2GHIA 3CR7A 4B3XA 2BKEA 4EPVA 4DDUA 4B9SA 4QZEA 4BECA 3AVVA 4RD1A 4XVUA 9ICNA 1LY1A 2VP4A 3KXLA 1G8PA 3LWNA 1NKTA 4IDPA 2G1KA 4MYUA 4ECYA 2FSIA 2R6CA 3GIMA 4TN1A 3GLGA 4E09A 2G83A 2ZIAA 1ZP6A 4DC9A 4QC2A 1GKIA 4UNSA 4D0LB 2ZVQX 5J2HA 1NY6A 1UDWA 2XCPA 5DYIA 1Z08A 4ZCIA 2EFHB 3N70A 2PL3A 1IXRC 3VR1A 1Z6AA 2Y8EA 4V0OA 4ZH4A 4E03A 1DO2A 2A30A 2QSZA 1JXMA 5HKKD 4S35A 2WIAA 2ZS8A 2O8BB 4US1R 5C1BA 3OSNA 3DO6A 4CEJA 4DLWA 4B9TA 3NHBA 1W36C 4KLQA 1MO6A 2R8HA 2Q0HA 4BEJA 1IY0A 4OQFA 4ECZA 7ICSA 3QIAA 3TK1A 2WJVA 4X5VA 2GCOA 2WHXA 1VYTA 2REBA 3M8SA 3MWYW 1KDHA 3OIVA 4BPBA 3NDBB 2ZJ8A 1C7YA 1W44A 5D46A 2WJHA 1SVMA 4JSTA 4B74A 5EJEA 2OT3B 2JJ1A 3PW0A 1MQ2A 3OEHD 4OKSA 1HJPA 1ZQIA 4B35A 4Q8EA 2B8TA 2W9BA 5DB6A 4LVSA 5D3QA 2IYVA 3W90A 3RSOA 4GXIA 1XMIA 2OESA 3SJAA 7ICIA 4JSYA 3ASYA 4AG5A 5KFAA 3PJRA 1RIFA 1RVDA 1S0OA 1RYFA 3VR2A 4JT4A 2C5LA 4BZQA 2GZHA 3Q8SB 2CXXA 3RJFA 3QXXA 5FOTA 1UKVY 2DFKB 1AKYA 1I2DA 2IF0A 3DMDA 4X8HA 1CKEA 2BEJA 2HT6A 3CKLA 4ZDIA 1IN4A 2OM2A 3L8YA 1YKSA 5GVRA 4A2PA 4ELUA 3B1ZA 4QWAA 2DPIA 5L1JA 1F48A 3PX4A 1TAUA 2O8FB 4GP6A 2VP5A 2C28A 2GVDC 1XB2A 4DSJA 2IS4A 2R2AA 4ZDKA 4KTQA 3PW2A 4Q66C 3RC3A 2ZRIA 1Z0FA 2E87A 4LZGA 1ZU4A 1OXVA 7ICHA 2KB0A 3PO4A 2BBOA 4DSOA 1FTSA 5BYKA 3RYTC 4EZ9A 4CEHA 5B57C 2RGNC 1NBMA 1NF3A 4IRDA 1J99A 3RBDA 4P4MA 1HYQA 1BVSA 4R66A 3U60B 4B32A 4Z1MD 1W4CA 1J8MF 3FPAA 1RYHA 3RRZA 1ZQAA 4QZIA 4JYBA 3AVTA 3DHWC 1FFHA 2CJWB 4UXJA 3EPHA 3SYKA 3ZD6A 3ZDAA 4FD2A 4KLFA 4TSFA 4D2IA 1TAQA 3ZIAA 3PW7A 1NSFA 2WWWA 2Z83A 2HHWA 1CU1A 4QWEA 2AU0A 3U3RA 1ZYQA 7ICTA 1Q22A 2IL1A 3K9LA 1ZJ6A 5G3YA 4LHWA 3MR5A 5K8TA 1P5ZB 2GJKA 1EFRA 1T91A 5J2BA 2VYFA 3N97B 2PMKA 3VMFA 2CBZA 1QHHA 1ZQKA 4HI0E 1W36B 4MYHA 3P4XA 1QSLA 4MFCA 5J0QA 1VG0B 4A9AA 4D26A 1FPMA 4YFKA 4PAMA 4ACBA 3JPQA 1OH6A 2A5JA 5EWEA 3FKSD 4RNOA 1AZSC 5ELXA 3HT3A 3LA6A 4DHEA 4RQ3A 4AI6A 1OHHA 2WOOA 4DIEA 3H7IA 2C9OA 4WXRA 1KMQA 1NMYA 4Q18A 1HH4A 4A0GA 2H8KA 2PLFA 3GJ8A 9ICEA 2C95A 1CR4A 4BGDA 4DZZA 3U3KA 1C9KA 3B5JA 3TLXA 3TR5A 4BDPA 8ICLA 4EPRA 2QPOA 3TANA 2B6HA 4Q47A 4UNQA 3OIYA 2R62A 2FLPA 3I1FA 3AKDA 1OIXA 4A92A 5JJKA 4I28A 1T8TA 2QBYB 2W58A 9ICWA 2VH5R 5BYJA 4O2RA 4DQIA 4B3BA 1E94E 3O8RA 2GEUA 5GJWC 3BOSA 4MGIR 4CF7A 4KFTA 5E95A 1XPRA 4L15A 4G1UC 2HLDA 1FL9A 1Z8FA 5EZ6B 1SVOA 2KFZA 7ICQA 5FTNA 2RAPA 4B3GA 2GXAA 1SKQA 2C22A 1A4RA 5L1IA 1KI1A 1M34E 3EWAA 2I3BA 1MO4A 4MRRA 5EXXA 4FMDB 4IXMA 3TQCA 2D06A 3RHFA 3AVXA 3FHOA 1IN7A 2IYTA 2Q3FA 2RMKA 3RJIA 5TV2A 4KLNA 2ZTDA 1U0LA 2GTPA 2O5VA 2RH5A 8ICZA 1KO8A 2WSSD 3NXSA 4EJSB 4NBSA 2WTUA 8ICKA 4KVGA 3EPLA 1JX4A 1CXZA 3SYZA 4HAZA 4URZR 3WY9A 1Z06A 4FXPA 4JLAA 4IJMA 1DAFA 2KI5A 2NO1A 2X2FA 3I72A 4I29A 3DM5A 2ZETA 3NTUA 1TEVA 2V9WA 4Q4HA 2J1LA 2FF7A 3C5HA 3Q8PB 2R8RA 5JLJA 4XVRA 3AEZA 4Q8FA 5KNDA 2LKDA 4DL2A 8ICIA 2W6IA 4YXWA 4DQSA 1J70A 2FMQA 1CR2A 5E7JA 4KI0A 421PA 3DOFA 2H5EA 8ICUA 1OKKD 2ORWA 2W83A 3P32A 4MH0R 5JEDA 3RVBA 2J7PA 3GJ3A 2Q9BA 2HUPA 3OGUA 3NBZC 4ECXA 4GC6A 3R9XA 2DR3A 5J0WA 4Q4JA 4Z8YA 4FS2A 2CLCX 5F9LA 2ZJZA 1R8SA 1UKZA 3RS4A 1AK2A 4JLJA 4R8UB 1OKKA 4JBWA 1G3QA 1ZBDA 4M21A 1TK8A 4Q02A 5DSZA 2ZYTX 1GTVA 4GP7A 4H1VA 5CK5A 3JVUA 1S1CA 3WMEA 4DUGD 1T6NA 4C8LA 4ZI3A 5J4YA 3TH5A 4WOPA 3W9YA 2WVJA 5EOZA 3ADDA 5IIMA 3EIEA 4QBIA 3OF5A 3KKNA 5KG1A 4B71A 3TMKA 2KBFA 4EPYA 1P60A 5IIKA 4LBYA 1DAGA 2ODEA 1R7RA 4IFBA 5F2EA 1FZQA 5IINA 2G0TA 5CIWA 2KZZA 4ED7A 1KK3A 2YHSA 3VQTA 5EZ5A 5CDFE 1A1VA 3ETLA 1GVNB 3QOFA 3QSYA 5KSYA 2GCOB 3GLHB 3RJHA 1ZQUA 4O3NA 1EX6A 2LWIA 3U7EB 1BS1A 3A36A 4DL6A 4DSLA 1Z5ZA 5JJLA 4ITRC 3EA0A 4YR2A 1E2NA 1M7GA 1P2UA 1PLJA 3CF0A 4QW8A 4DQPA 3M4YA 5JBQA 2FFQA 4Q00A 1W46A 1NY5A 4IVRA 3KQHA 2J0UA 4W9MC 3AU6A 2AN9A 3BC1A 3C1ZA 5EP1A 3UK6A 5C18A 5KYKA 3GLIE 3GLIA 3SFZA 4E5UA 1G8FA 2XOKA 2W9AA 2ZITA 5CB6A 3H8SA 5DQIA 3TKLA 2BCUA 3TBKA 1KAOA 1Z07A 2A78A 3RJJA 2QU8A 4XWOA 5KPDA 4URYR 4IR9A 1TVAA 9ICGA 3CH5A 1LFDB 3CH4B 1FW6A 1D6JA 2ATXA 3AH8A 4NZYA 4PC1A 2C77A 2AX4A 2HJVA 4DBLC 9ICJA 3FMFA 4LV5B 2VANA 3CONA 4Q1EA 4AYXA 4NMMA 4O0MA 4WZ6A 1R10A 1RKBA 1KI7A 3MWLA 2ZSEA 1NK8A 2XZOA 121PA 5KG6A 2PFNA 4QBFA 2WV9A 1NVVQ 3PQCA 2H5XA 1WDTA 2CNWA 4LJ6A 4BLOA 2DFTA 5FBQB 5JJIA 1G8HA 4PGXA 1CRQA 2QGZA 4EZ6A 4Q7MB 4NCNA 2ZPTX 3BB4A 3K9NA 2QGNA 3C7KA 5LB2A 4IQVA 5FUWA 4DSKA 4FCWA 4PC2A 1IBRA 3IBGA 3PXGA 2IS1A 2HW3A 4MKFA 3D7MA 4QM7A 3QUSA 3VNUA 1GRRA 3C1YA 3QKTA 1YZGA 1ZM7A 2HVHA 3GFTA 3W8RA 3WNDA 3U7FB 1SXJC 3ORYA 2Z4RA 2QQEA 1WBBA 5FI0B 1EXMA 2D4HA 2I4IA 1NLFA 4MFFA 3CW2A 4JKYA 4NYIQ 4B73A 4KFRA 1SVLA 2EYQA 5DG8A 2GBLA 2MSEB 5DQGA 4DQRA 4ECUA 1D2NA 1E0AA 4I2FA 1N6RA 3SJZA 2NMVA 5DB8A 3HWSA 4CT5A 1COOA 7ICPA 521PA 1EFTA 3K75D 2A9KA 2QL6A 2ZYVX 4OI4A 2ISPA 3G6XA 4CW7A 3LLMA 3AVUA 1AS2A 2B21A 4IQTA 1WCNA 1W49A 4HAYA 3W6NA 3IHQB 4EPWA 1Z2AA 4HLCA 4MRNA 4NY8A 2BBTA 1VIAA 1RW4A 5LBIA 4XD7D 4BASA 1D9ZA 1XZPA 2JDID 5H8WA 4ED8A 1GAJA 1Q57A 4O5CA 1ODFA 3F0TA 2ZRDA 4RVCA 5BN3A 2BPFA 2ZI5A 3WP1B 4MKHA 2ZI4A 5DIFA 1IJEA 1GIAA 3NC1C 4GSYA 4JBYA 2JLUA 4Q5IA 1UKEA 2O0KA 3Q8MA 4XSGA 4FBTA 2J41A 4B6EA 4RZXA 3O8DA 3T61A 4BWMA 1X9SA 5KG4A 4YLGA 4F2SA 3IIKA 4D4JA 5DNYB 1D8YA 1KFDA 1X3SA 2ZJ5A 3OJSA 4DEZA 4F4XA 2PT7A 4RPYA 3LXXA 4KLOA 3HJNA 4C30A 3RB0A 2EQBA 3OAAD 2ZREA 3E2IA 5CP2A 2XJ9A 2W2TA 1OXTA 1NK6A 1HY3A 3MJHA 4A6PA 4EIWA 2YINC 5F98A 4HLUC 4DWJA 1A76A 3AVOA 9ICOA 4FIDA 3RS0A 2SHKA 2VLIA 4YG2A 2FLLA 1GL6A 1BKDR 2O0HA 3QG5A 4LHZA 2YC4C 2C2DA 2ZJOA 2QP4A 3CZQA 4WZAE 2WWGA 2WOJA 4KAXA 4MF2A 3L0OA 2FPMA 4G5QA 3TRFA 4B9LA 4NLZA 1UAAA 2WAYA 3I92A 1SKSA 4KLZA 3PMLA 4M9GA 1R5NA 2ZAMA 3C5GA 4Z51A 1WB9A 2ZROA 1WCLA 3T5LA 4FI3C 4P31A 2ZM5A 4F5RA 2AQ4A 2ZSBA 5KFBA 2C2EA 3QPVA 4C0KA 1SKRA 4ZO4A 4KLMA 5JS7A 2R8JA 2ASEA 3BS4A 3GDXA 2IHNA 3R8FA 5BN4A 1OYYA 3Q7QA 4HAWA 4ED3A 4P32A 3GLGE 1QTMA 2DPJA 1S9DA 4IOKA 4RZRA 4TUQA 4TQAA 1E2QA 1U48A 3SC3A 3PEUA 3PVSA 3VKHA 3AV0B 1H8ED 4L5BA 4KMUA 1QG2A 5DLQC 3UMRA 2JJ2A 4XUSA 1P61B 2HT1A 9ICPA 1DOAA 4NLKA 2OBMA 2VF7A 3TAHA 5KFVA 4IVQA 3AF3A 5DHAA 3EX7C 2J6UA 1D2MA 9ICQA 2XZPA 2KE5A 2F43A 5L1LA 3D6TB 4RFVA 3KFXA 2OFXA 1CTQA 3OHBA 1SHZA 2FFAA 4R63A 1G5TA 2VHCA 4BWJA 3LRPA 2REXB 3CR8A 5H70A 3IM1A 5AK0A 4R71A 4MDEA 1UDXA 2IYWA 3GJ5A 8ICWA 3IEUA 2F1JA 4J9SA 4EAQA 1P9RA 3SZRA 4DCTA 4YD2A 3Q7PA 3M8RA 3EC1A 3PNCA 2QORA 1G64A 2XTNA 4HB0A 3IQWA 4RNNA 1N6IA 1QHNA 2DPXA 1NKBA 3V7JA 2XTMA 3H84A 1TX4B 1LB1B 2Q9AA 3CF6R 3FDIA 3KKOA 4UBCA 4YC7A 2NO7A 2Q9CA 5DI9A 3BWDD 3H1TA 3V6JA 1G4AE 2WICA 1CULC 4A8JA 3CB4A 4GMXA 1KLNA 2JASA 1NOMA 3KKQA 3PCRB 3ZS8A 4B9NA 1XC9A 4F4WA 1E0KA 2J0UB 4DDVA 4KLHA 4GXJA 5EWGA 3I5XA 3KKMA 1IXRA 4HAVA 1EFUA 3MRSA 3T12A 1WBDA 2BPCA 2ZANA 4F4CA 1NG9A 4JLVA 2GWHA 3BIFA 2FSGA 4LZZA 2AGOA 4K81B 4B76A 1X2IA 1HEIA 5F9NA 4C4PA 1OF1A 3H86A 1NJGA 1XFAA 1L4YA 3EARA 4JL8A 4QHYA 2QROA 2PCLA 2WBLC 2ASLA 4DSEA 5CB8A 3AUXA 1SQ5A 3KQKA 2OUKA 1NK7A 3G5UA 1EFCA 4B75A 1KAGA 1Z0AA 1N48A 1OYWA 5BXQC 2ZS9A 3LQRA 1K1QA 4QZGA 1GG2A 2ZU6A 9ICCA 4HDOB 4JIMA 3DKPA 1KJZA 4N0DA 1XXHB 2QRNA 3PUXA 3SI8A 5KFMA 1U4BA 3GEHA 1XS9D 1XCGB 4PSVA 3ONWA 4X8OA 2AL7A 3EW9A 2CEAA 1NMXA 5J2KA 2IS6A 1XD9A 2F1RA 3L0IB 2B8WA 4TQSA 3A4NA 1XCPA 1ZQQA 4NCHA 5FPHA 4EEYA 8ICYA 1JNYA 5TY0A 2IS2A 2ZUCA 3SQWA 3PR4A 1ZQMA 2HJGA 4NL4H 1Q3HA 2XNSA 4G5SA 4B43A 3THWB 1S0NA 2IEZA 2J5XA 1CJKC 1W0JD 5FH9A 1NK5A 1CJMA 4OHZA 3FFBA 3V4FA 5DG9A 1U81A 2RGXA 1R5BA 2RHMA 4OI2A 1W36D 1N25A 2ZRLA 4M1WA 4XOIA 2XTZA 4QJ3A 2XB2A 4I2AA 2JZBB 3V6KA 1ZQLA 2PLRA 2GEDA 2Q21A 2J9RA 3FWYA 4FCTA 2CHVA 3QKSA 1W7AA 1G1MA 2IX3A 2BQUA 4I2BA 5L3SB 2GA8A 2WIBA 5KFKA 8ICVA 3BQ1A 4F5NA 1XXHA 5D49A 2GK7A 2RGAA 3ZZUA 1SL1A 3THYB 3GQBA 3KHGA 1UJ2A 3AVPA 4FMCB 1GRQA 5CDFA 1QG4A 3T06B 4BRWA 2FZ4A 3GLFE 1DGSA 2P2LA 3B13B 1AS0A 3K0AB 4P4UA 1F2TB 3VHXA 4A2WA 4EFNA 1DAHA 4D6PA 5EE3A 1OSNA 4YMWA 1KOFA 2FEOA 4I2CA 2UVUA 1IY1A 2I1VB 5JSZB 4I81A 1E1RD 2VIIA 3RH6A 2JA1A 1NN1A 3FVQA 5GJVC 1D9XA 4W5WA 1KK0A 3ZGXA 4UQGA 3KB2A 5J4KA 1YRBA 3GJ7A 1ZJMA 8ICBA 1NJYA 1B23P 2D7CA 1ZD9A 5DI3A 3RAXA 1OE0A 3B6EA 3BRWD 3V7KA 3UPQA 1PJRA 3TQ1A 1KI3A 1OFIA 5KG3A 4IQWA 3DKVA 2V54A 3H4MA 3K53A 3MSXA 5KFPA 3OAAA 1HT1E 3X1DA 4JV0A 5FPYA 1A5TA 1ZC3A 2VSOA 4DCVA 4EPTA 1EK0A 5KT6A 1BPXA 4WZBE 5IHPA 4I2EA 2GETA 1OV4A 2BMFA 1RRGA 1NKEA 5EP3A 3JPOA 4RQ5A 3B0XA 3QZ7A 1KI2A 2BJWA 4IOLA 5AWFC 5LPNA 1H8EA 1MRNA 5J40A 1E9EA 4PFSA 3U2QA 1KY2A 4X8MA 3KXIA 3Q9LA 2FX3A 1EXNA 1J90A 4C8KA 5TB5A 1SVKA 1I4DD 4L9WA 2V1UA 1MC8A 5KHOC 1D8LA 1L3UA 1JQLB 1XMVA 4RQ0A 9ICHA 2CCKA 3U4QB 2YJTD 8ICNA 4BLTA 1VMAA 2O0JA 2VEDA 4ZKEA 3GLFA 4HYKA 4BFSA 1JI0A 1KO4A 1NI3A 4KO8A 3RBEA 2ZRJA 4CT4B 3L2OB 1MQ3A 2ERXA 4S2EA 4O0IA 1N6NA 3Q8QB 2A1JA 2UVWA 4A4DA 4MGZR 2EWVA 1XO1A 4LWZA 4PAQA 4TL8A 3SS8A 5KFGA 4DDTA 2OBLA 2ZRAA 5KSPA 3ZZTA 2ZXUA 5L1KA 1N0WA 3OFND 4PZLA 5FBVB 2A1JB 3EZ7A 4W5JA 3K0CA 4H1UA 4O3MA 3RJEA 1FUKA 1XDBA 3IIMA 1MRSA 2ORVA 2JEGA 2VL7A 1NKCA 1DEKA 4M2YA 3LK9A 4P4OA 3TARA 2G0NA 8ICPA 2QMHA 3LQQA 4QBGB 4D0NA 1T4GA 2OO7A 4KN7A 3TUIC 4D0GA 3FHTA 3QKRA 1KO5A 2P6RA 2J46A 4MUBA 4G5RA 2O8FA 2QP3A 1W48A 4KSBA 1LF5A 5J0OA 3SV4A 3EPGA 1JB1A 5KT3A 4IXNA 3RRNA 4PSKA 2GDJA 3ECCA 5HPYB 4Z6CA 5KT4A 1US8A 5TXGA 3VR3A 3CWQA 3NBYC 4MRVA 4TTRA 4BEBA 4P33A 3PFIA 5JWHA 4GXKA 4M4SA 2HHUA 1DE0A 3ZDBA 2DWOA 4Q01A 3W5JA 2B7CA 1E1QD 2WKPA 3B7GA 3RB6A 2FV8A 1JIHA 3PENA 4UB4A 2G88A 4F91B 1XU4A 3Q72A 1DADA 3C16C 4MYCA 1EWQA 5CIQA 1BMFA 5CR0A 1OJLA 1C1YA 1XMJA 2Z5FA 2AR7A 5FUVA 4UQOA 2IUSA 1E3MA 3ZLJA 6Q21A 4J9KA 2XCAA 2Y1IA 9ICAA 2A7QA 4M1MA 3T5HA 5DH9A 5IK2A 2N42A 5DN6D 4FW9A 3Q8LA 4TYWA 1XP8A 4TYYA 3FYHA 5TDHA 1E98A 4ZDWA 2QEQA 3TFRA 5EXPA 2YYZA 3QPWA 1E9DA 2FFHA 1KI4A 3O47A 3AUOA 2AHOA 4QBHA 1MO5A 3QQ5A 4AYTA 1LW7A 5KSOA 4XTCS 2BBWA 3UXNA 2QAGB 4JWNA 4OHWA 4PHPA 3MGIA 1VCNA 3MR6A 3AVQA 3KL4A 4J9QA 3L0SA 1XWLA 4RCYA 5AUPB 1LV7A 4DRZA 4Q1CA 3B9PA 4R8UA 1E69A 2V7QD 4Q03A 3LBNA 2YOFA 1BYIA 1I4TD 3SV3A 3GFKB 4KYUA 2CL6X 4JBXA 4Q4AA 3TUJC 4YVZA 3W3AA 4HZUA 3QEJA 3OESA 4AKGA 5C46F 5CB1A 4M53A 1CEEA 1YR9A 1SZPA 1UT5A 1KI6A 3LVQE 3BH7A 2QRZA 3ISDA 8ICXA 4GRAA 4QJ5A 2ZRHA 3K0FB 1BPDA 3K8YA 4C2TA 1G16A 2CNWD 4P4SB 1U45A 4PO9A 4TTPA 1Z47A 2H1LA 4ARZA 4C0QC 2D62A 2YKGA 1N5KA 3AVYA 4M9LA 1N0VC 2R65A 5KSZA 2EFEB 4CCHA 1WA5A 4I1VA 3I62A 5HE9A 4Z1MA 4NYJQ 1KK2A 1VG9B 2C99A 1KJYA 3WNCA 2W6JD 1II0A 4CRWB 2V1XA 4BZXA 2JEFA 2IA5A 3VTKA 3KTQA 2CCGA 5GVSA 3GV7B 4JJZA 1QRAA 4LJ8A 2V8OA 3T5DA 2PX0A 1NJFA 4LYHA 4IKEA 4HAUA 4G5GA 2FPKA 1R6BX 3NBFA 4B3FX 3ZJYA 3A8TA 3WMFA 3ICQB 3QVUA 3QI2A 3A4MA 4PZYA 2QENA 2NZJA 4G01B 3LH5A 4PHHA 3RRMA 3G0HA 1UT8A 2W00A 3A1SA 4HUTA 1PV4A 2VO1A 3UWKA 3OZXA 2H18A 3IDQA 2QN6A 3W6PA 4XTRA 2IXGA 4V0ME 4ASUA 1ELOA 2EWWA 3ADCA 4DOAA 1KRPA 4TTQA 1L2TA 4I4LA 2V4QA 1II8A 2NQ2C 1H8HA 1Y3AA 3PX6A 3B9QA 5BPCA 3D3QA 3GJ6A 4OJKA 1TTTA 2ZYUX 2ZI3A 3NBXX 3TW8B 2KFNA 2BCQA 2W8LA 1XZQA 1CUKA 4RPZA 4HAXA 1VHTA 4PC7A 5GJCA 4DFKA 1XSNA 5HCIA 2WMNB 4QWBA 4TMXA 3BQ0A 1X86B 3LBHA 4JS0A 1ZNZA 4FWIB 5J2AA 1KSJA 5D3MB 1NMZA 2MAXA 3BH6A 3LXRA 3T15A 1MABB 1NN3A 2X2EA 1XRJA 4TYQA 4C0BA 1JEEA 4UNNA 2QTFA 4M1SA 5KU1A 1ZQHA 4XRHA 4EBEA 1FOEB 2WJJA 3CLVA 2P0EA 2YC2C 4NKRA 1FTNA 3X1ZA 1TK0A 1NJXA 1ZQFA 3HP1A 3LDAA 1KSGA 5DGBA 4DL7A 2QT1A 3B60A 2XXAA 4KITB 4XWKA 2CVFA 2XOKD 2VHQA 2A5GA 4C7OB 1II8B 2EFGA 9ICSA 3LV8A 4R65A 3TI0A 1BH2A 4OI0A 2R6DA 3AKCA 1GKUB 1HUQA 3CM0A 4M1YA 3NGDA 2OFWA 1UEJA 3DM9B 4PO1A 3THWA 2PBRA 1KKLA 4LUCA 1HE8B 3WXMA 4EJSC 1MR3F 7ICOA 2XB4A 1Q1ZA 2ZRPA 1Z00B 3R7WB 4J9RA 1XD8A 2BBSA 2O8DB 5UKDA 1JXEA 7ICKA 4QRHA 4RPXA 2DFNA 2GK6A 3BGWA 3AGPA 2NIPA 5KG0A 2J59A 2GWSA 2CMKA 3C21A 1F5NA 2H57A 2ODWA 4KVAA 1IM2A 3BFXA 2QPTA 2IWHA 2JEIA 3LD9A 4ON9A 4A2QA 4XQ8A 9ICMA 4WBSA 1NBMD 2GAOA 5FTLA 1XJ0A 3SBDA 2XY5A 2RDJA 1ZQOA 4TMZA 2HEIA 2OILA 4FINA 1TU4A 4D81A 2OAP1 3L0PA 1W4RA 4V03A 2I1QA 2HHTA 1F3OA 3ZVRA 1E2JA 1S1MA 3HYTA 3DDCA 3KHRA 1W47A 2WSSA 2Q3HA 1BPBA 3JZMA 4UJ5A 5DBCA 4QZAA 2UVRA 4M22A 5JCZA 3AVWA 2O8EB 5LB4A 4BFTA 3GPLA 3KZ1E 3LX5A 3WYAA 4TT3A 1GM5A 3LX8A 1Y63A 4G0NA 1KTVA 4HB3A 9ICFA 3NVAA 2PI5A 721PA 4RD6A 5HKKA 4IEEA 5EE9A 3UMSA 4MITA 5KG5A 3IIJA 4HZUB 4PANA 2MUTA 4QXAA 4FCVA 2ZE5A 1KTQA 4JMPA 5H1YA 4DSIA 1AZTA 9ICVA 3RLFA 4DO9A 2ANBA 5FL3A 2BJVA 5J2CA 3T1TA 2QE7A 3Q8RB 1LS6A 1HV8A 3AB3A 3X2SA 4KLEA 4RUCA 2KZMA 3QKRB 1UFQA 4HDQB 2QT0A 4OK5A 1XEXA 2W2XA 1N6KA 1XTJA 3AKEA 3WYFA 4F50A 3VFDA 2RB4A 2YVUA 1SXJA 1IQPA 3LW7A 2O8BA 4LX0A 2YWHA 3K70D 1ZNXA 3UWOA 4AWXA 1ZQNA 4Q1FA 4QGFA 3A1TA 2XY7A 3N4MB 1KI9A 3MMPA 4B2IA 1B22A 1ZQGA 1G291 2JLVA 3CUEF 1BPZA 1XD2A 2HF9A 4LBZA 4URXR 4ELTA 3R9IA 1KFSA 1JXLA 2VSFA 2XGQA 3NEJA 1GNRA 3EA5A 4YCXA 7ICRA 4F38A 4FMBB 2BOVA 4PHGA 1R0YA 4US0R 1V5WA 3U7GA 5J2FA 3CZPA 1AKEA 4DSFA 2IA6A 1QSYA 4PPGA 2ZUDA 1II9A 1MH1A 2QA5A 4MF8A 4JVMA 4M6WB 5DYGA 1X8LA 4RKEA 1Z0KA 5DI3B 3KDSE 4CZ2A 5M04A 1T9HA 4JL6A 2BKUA 4CEIA 2OZEA 4TLEA 3UMFA 1ZRHA 2JJ8A 4LRWA 4ECSA 3SOPA 1ZUHA 5D4BA 5FUYA 3FMIA 3FHCB 2YOGA 4ZIRB 1J7KA 5J0UA 1UA1A 4CEIB 3C2MA 1L3TA 2WWHA 2HVIA 3E5HA 2RGCA 4Z8XA 5E7MA 1U49A 4YXWD 4BZPA 3H0KA 7ICLA 5J0SA 5AUOB 2ZJYA 1JXOA 5J4VA 1W1WA 3BXZA 2C9CA 4Q9HA 5DO9A 1NLYA 5KNBA 2W6JA 4MDFA 2NTYC 4TLAA 1DG1G 3T1OA 4DLGA 1RRPA 4PSAA 3H40A 1JAHA 4NONA 4D4LA 4DL4A 2FA9A 5KO2A 1GL7A 4LC1A 3AP3A 1E4YA 1JR6A 1N6OA 3MJRA 5B2ZA 2QMUA 2P66A 1GILA 3PUYA 3GLHA 2OEPA 4JYCA 4KBGA 5FR1A 3RS2A 5LD2C 2WZQA 5J4HA 4F3OA 1AQUA 1S4QA 3BAFA 2RKOA 1KZ7B 5KDOA 2ZUBA 2ZSDA 4Q48A 1Q1QA 2JLXA 3OHAA 1YJ5A 5E3HA 4V0NA 2BM1A 3PITA 1QVAA 3BQ2A 4NTZA 1COWD 2AXNA 1TQ2A 3PX0A 3R9WA 2QZ4A 5J0RA 1U0JA 2RGBA 3A4LA 1XSPA 3I73A 3GLIB 7ICVA 4ESVA 5FPTA 2ODNA 1NK9A 5AJXA 2NO6A 3AU2A 1NKSA 1ZCAA 3PR5B 3JPSA 2HHSA 3H8WA 3K9GA 4LJ5A 3M6AA 1M6NA 1KEJA 4IQUA 2YNMA 2WAXA 4LV8B 4KLLA 1KJWA 1TU3A 2OLKA 4H9GA 1DOQA 5KFRA 4DFJA 2DBYA 2LKCA 2NO0A 4XSHA 1QZXA 4D4KA 3U5ZB 1XTRA 2YZ2A 1OLOA 2NZ8A 5TMPA 4GT1A 2ZS7A 3HPRA 3BH0A 3CNNA 2W9BB 5KT5A 2XZLA 2P3SA 5EUMA 1A2KC 2FNAA 1LNZA 1Q1BA 1FMLA 1LS1A 3LLUA 2ZAOA 1VG8A 3TGPA 1W2GA 1YZLA 1SVIA 4IFEA 1XPUA 3BD9A 4GPTA 4AD8A 5G40A 4A15A 5AR1A 3IBYA 5J0YA 2V3CC 1ZQVA 3WHLA 2GXSA 1K5GA 3MLEA 4L9SA 2N1BA 4RQ1A 1R0ZA 2P65A 3CPHA 2WPDD 4YQFA 1G6HA 4GZLA 1U9IA 1R4AA 4FN5A 1ZNWA 3UQ2A 1ETUA 2X1VA 4J9PA 1NP6A 1UADA 4Q4LA 3U3OA 2YOHA 5F3WB 1TF7A 4RT2A 1R0XA 4UB2A 1NN0A 1WMSA 1D2EA 3HW8A 4AIIA 4BFVA 2O8DA 2XNDA 1TFRA 3O8BA 3X1YA 2Z0MA 3QXHA 4POAA 1XNJA 1NIJA 2VA2A 3OEED 4N0EA 2D7DA 1S77D 4O3RA 1N5IA 5SZIA 3QY0A 3K70B 4M9JA 2XSZA 2GNOA 3VNVA 1CP2A 1OFTA 2AK3A 3DOEA 4ZV4A 2C04A 4QHTA 1IONA 4DVGA 4PC3A 9ICTA 3L43A 4ECRA 1KGDA 1VYVA 1E96A 1YR8A 3Q85A 2QSYA 3C8UA 3A1UA 4E0DA 1M7HA 4TMVA 2ZU0C 4QGGA 3WBJA 4IHQA 1EG7A 4KCGA 5FOWA 4URWR 3BQTA 2BDTA 2NRXA 3MR2A 1IHUA 2AD1A 1DO0A 4MGYR 3K70C 1ZQDA 2A5YB 4PHDA 3IPYA 4QL3A 4I2GA 5L3VA 3A6PC 3FE2A 2ZR7A 4II7A 1RPZA 3MABA 1XPOA 1L8QA 1BPYA 2EU8A 3RR7A 5J2GA 2QMEA 4XWAA 2IYYA 1U8ZA 8ICTA 1UA0A 1NIPA 1G8YA 4RY2A 1JJVA 1M8PA 1Q12A 1E32A 5HMMA 2DWQA 2R9VA 2ASDA 1JQJC 4DS5A 1TQ4A 1VKJA 2C9YA 1IM4A 4B9VA 2J3EA 4IOMA 3BJIC 2J0SA 5JUMA 3CBQA 4NM2A 2PT5A 5J2JA 1XEXB 1P2VA 1E2IA 4LBVA 3PG5A 2PCJA 1G17A 4M9SA 4Q9LA 3NC0C 5FBWB 5CWRA 4YONB 4YXMA 3JPTA 5IRCD 3ND8A 4LJ9A 3RB3A 1ESNA 5JWOA 5KTYA 4B3DA 3RC8A 5DN6A 3NDPA 7ICMA 2KBEA 4F2RA 2PFPA 4CDGA 4RQ2A 7ICNA 1E2HA 3MG9A 2ONKA 1NVVR 3DZ8A 4MKGA 1M74A 2HDNB 4C0SA 3MUFA 1YHNA 1T5IA 2PMDA 1CRPA 5DKWA 4BFWA 1EESA 5IIJA 1A82A 4EBDA 1JR3D 5J0TA 4K8OA 2BDPA 4BFXA 1D9DA 4PHAA 1D5CA 1U98A 2V55B 2O8EA 1ZC4A 621PA 1AROP 3GLGB 4JV2A 3W5IA 5KFNA 2VP6A 5EQTA 3RABA 4YMTA 4YMNA 1S0MA 4V0KA 3R20A 1H65A 2JJ1D 3OEHA 1I2MA 3T5GA 1AJEA 2R6GA 2XO7A 4M6WA 2F3RA 4PQYA 5HCNA 9ICUA 3CX8A 3OIUA 1KZGB 1TEXA 2IYXA 2JGNA 4RFSA 4PZZA 2FH5B 2JATA 2AGQA 5CJ7A 4UNRA 1ZM2A 3P4YA 2IYSA 1OFUX 5FOUA 2GZAA 2D3WA 2IYUA 2ZJBA 3QF7A 4CGZA 2J0VA 1KFTA 1KNXA 3T1VA 1P9NA 3MWJA 2PEZA 1IJFA 4RSGA 1ZQJA 2IC5A 1V9PA 2WJGA 4YR3A 5AJZA 4BFZA 1MV5A 2ZRFA 4O3SA 5L3QB 3CPEA 4M9QA 4W7SA 1MSWD 2UZIR 4B9MA 5J5CA 1E0SA 1P4SA 1XJQA 2GAAA 4D4MA 1KYIA 4FMCF 4LPKA 8ICMA 1DBSA 1G5PA 1MT0A 2ERYA 4TL6A 1OXUA 2D74A 4F4YA 3TR0A 4IVPA 4DIDA 1KSPA 4PPXA 1QHXA 3BORA 4R9UC 4XH9B 4ILEA 2VA8A 4C0LA 2GXUA 4DXAA 1CIPA 1E99A 1JJ7A 1S3SA 2V9PA 1NBME 4K46A 4A82A 5CLQA 5KFDA 1E4VA 4MQBA 2FSFA 5FI1B 2OSBA 2MMCA 3WYGA 3ZH9B 5C4GB 1RC8A 1IOZA 4BLPA 2AWOA 2ZEJA 1J2JA 2O52A 1Q1EA 2FG5A 2IHBA 2QNRA 5EP2A 1FQJA 1MABA 2PFQA 1K5DA 1KDRA 2H92A 4JVLA 2GEVA 2AD5A 3WMGA 4KN4A 3GIKA 3ZQ6A 5BW8A 1W4AA 1RRCA 1KSHA 1GKYA 2JZBA 4QWCA 3DZDA 3OE7A 5LDDC 4BLQA 3RRYA 3HDTA 1N6PA 5KFHA 1P72A 4LHVA 2IYQA 4ZIRA 2P6UA 1U9IC 4RFSB 5JZVA 3S1AA 4DLUA 1L3SA 2CK3A 1BMFD 2EYUA 4ZPXA 5DBBA 4RD2A 2DWPA 1YVDA 9ICKA 1WRBA 1Z2CA 2IF2A 2NO9A 3CNLA 3HPQA 5JHHB 3FFAA 4UXHA 3W3ZB 3OJUA 3C2LA 1SL2A 2JEOA 4NE2A 1TF2A 3QKUA 1NL3A 2OAQ1 2V4RA 5L3RA 4BFUA 5HNKA 1ZQRA 4TLDA 2WWFA 1ZQPA 1Y88A 2GILA 5DGXA 1P2TA 3HR7A 4BXOA 5KFIA 3IKJA 2G1JA 2F1HA 2X77A 2F6RA 5EP4A 3TSWA 4CVNA 3DL0A 3GILA 1P9WA 3VX3A 4YMSA 8ICOA 1TPZA 2OCAA 4M9ZA 5CA7A 2QQ0A 3K0CC 4JZKA 4ED0A 7ICEA 4HLUA 4TT3D 5A0FA 4NCKA 5FOXA 5CJPA 4RKFA 2WPDA 4ECVA 1TNDA 4RUAA 4M9XA 5J2IA 4M1OA 4R2IA 5HE8A 3VR4A 1HURA 3FMOB 3GCGA 4IRUB 1RXVA 1E9SA 5KG2A 2IUTA 4EPXA 4B9UA 4MEXA 3AF1A 4M04A 1N5JA 4KHZA 3W6OA 1TV9A 3I8SA 1T8UA 2QTVB 4HB2A 3TSOA 1QVRA 3OEEA 1CJVC 3ISBA 2KWIA 3CPJB 1XSLA 2PI4A 2ZRBA 1Z28A 1JN3A 3ISCA 3I4LA 2VF8A 4LBWA 4DUGA 4A36A 3PMNA 3FOZA 2BCRA 5FBRB 4DKXA 2W9CA 1SXJD 2M9NA 7ICFA 1IY2A 4QZDA 5DISB 4EYHB 4PQRA 2BQRA 3AUYA 3NH6A 4XJXA 5TVKA 4HATA 5JMTA 1Z0DA 2BHNA 1TAGA 4ECQA 3GEEA 3LNCA 3MDAA 1VECA 2ZRCA 2C98A 2J7PD 3EG5A 4AKIA 4UB3A 2W0MA 2PFOA 3GJ4A 2PH1A 1KK1A 4Q9KA 2HXSA 5HR5A 2GESA 1ZQYA 4J9OA 3TFSA 2BCSA 3KQNA 4Z6FA 1D8TA 4LOAA 3EPKA 2ANCA 2P67A 2Z43A 4DT1B 2HYDA 1ANKA 4QZFA 1N0UA 3I32A 3N2IA 2NRWA 5AJYA 5F9FA 1SKWA 4M0AA 3BJYA 1P73A 2WWXA 3D31A 4LYJA 5DE3A 3EWSA 5AUQA 4B48A 2XXAB 5DQHA 5KDLA 2I9GA 4I2IA 2GRJA 4A8JC 1W5TA 3ZVLA 3Q5DA 4RD0A 4EBCA 3C23A 1G18A 1UPTA 4QNRA 3TNFA 2B7BA 1O87A 3H8JA 2N46A 2W9CB 3HP6A 1N3BA 3A37A 1GWNA 4LPSA 4MUAA 1HUZA 5CYPA 5IDVA 3IO3A 4LSGA 3NIBA 4ABYA 3TAPA 2BEKA 4Q1AA 2BV3A 1IN5A 1CS4C 3MFYA 3LVRE 2BMJA 2IMWP 1AA9A 1E2FA 3WNBA 4TZ6A 4QZ8A 1W4BA 4UNPA 1YR6A 1M1YE 3QZ8A 3AQ4A 1U90A 1JPJA 4NPHA 3AGQA 1ZIOA 4JLPA 3RDPA 3NHAA 4C8NA 3NWJA 1SULA 3OFNA 4Q4HB 2GF9A 3QXSA 1ZAKA 1DTSA 4DCUA 4LJAA 4DLYA 1G3UA 2JEJA 5B64A 2WWYA 2BR0A 1OW3B 3RNLA 2V4ZA 3L82B 4TUPA 4YDSA 4JUZA 2IBKA 4DFMA 2RGDA 1R2QA 4C0JA 4ZCLA 1RZTA 1QHSA 4BWYA 2ZVPX 2RGNA 8ICGA 3P20A 2VP9A 1W5SA 1NVXQ 2EFCB 1RYSA 2A5DA 4KV9A 1XEWX 3VKGA 5DG7A 3TAQA 2FEMA 3VHLB 2CVHA 2GZDA 4Q19A 5H68A 2XEXA 5FR2A 2R6FA 2R8KA 4ECTA 3ZDDA 3GIJA 2CDNA 4RNMA 4UAWA 2DYKA 2WWIA 4TMWA 5TARA 4F7WA 1ZIPA 1JBKA 3TE6A 4Z6DA 4Q4JB 4FS1A 4QOSA 4A6XA 1PLLA 3ZD9A 2GJ9A 3QBTA 1FQKA 4QHSA 1SL0A 3SR0A 1CR0A 5KT2A 3V7LA 1TL7C 4NCIA 4IRCA 4ELVA 4CIDA 2OFOA 2QI9C 4E22A 1SXJE 4B47A 1XEWY 5KFLA 2PXIA 1NN5A 4NDZA 3U6BA 3B82A 821PA 1Z6XA 2ZE8A 2WM9B 4ZKDA 2ZR9A 3LFUA 2NRZA 4LJYA 4EYIB 4DL5A 2FWRA 2F43B 2HHQA 2PZEA 3PR1A 3TJZA 4V0MA 5DBAA 3IQXA 1L3VA 1KI8A 5G53C 2BMDA 1EGAA 4PH5A 2WJYA 1S96A 3BB1A 9ICRA 1FNMA 3FDSA 3WRXC 5JI2E 4M9NA 1M7BA 4OJQA 1US8B 4QZHA 3A1WA 4KFSA 4DL3A 4B44A 4URVR 1J8YF 1CEZA 1SGWA 1ZD8A 1F60A 4O3QA 1S0UA 4DEYA 2OV2A 5JSZA 2KZ3A 1QSSA 2YV5A 1P75A 4JL5A 2FZLA 4XD7A 4UBBA 4GMDA 3T1QA 4EFMA 3SDZA 3PUWA 4R2HA 1DAMA 3C2KA 2H16A 2QP9X 4YMOA 4DJTA 5JS8A 1T5LA 5EXTA 5HHHA 4LV6A 1CLUA 1YZTA 3W8NA 1X6VA 3KJHA 4OK6A 4RQ8A 2WSMA 4PPQA 1G6OA 4A0RA 1E2MA 3K9HA 1QF9A 2ZJAA 4PX9A 1E79A 4XIGS 4XA5A 4L16A 3P27A 2ZTSA 1N5LA 4AYWA 4ZCMA 2AQ0A 2IBMA 2BPGA 3FGNA 3PUZA 2XX3A 4B34A 4FWTA 5C5JA 4DQQA 2Q6TA 3SJCA 1T3HA 5EE0A 3TVDA 1XF9A 3CIOA 3HR8A 4BLRA 3KB1A 4CYMA 1KSFX 4DSUA 1NJWA 5J2EA 1W2HA 3EZFA 1Q20A 4ED6A 3LWMA 1VCIA 3SHWA 2IW3A 1B43A 4F93B 1GNPA 2J7KA 2OE2A 3AF4A 4Y0VA 5KDDA 3C4JA 3GLFB 5FPSA 1E9BA 4QM6A 3RSLA 1PVOA 1E9RA 1F6BA 1QHIA 3QPUA 1CF4A 4Q45A 1G20E 1YU9A 4F4IA 3ADKA 1NK4A 2OCPA 1JECA 4KJZA 4BUJA 3OIWA 4YP3A 3MAAC 1C4OA 3DEFA 4RZ2A 2V7QA 3IGFA 5BWMA 4C8MA 1A2BA 4YD1A 3K1JA 5FFMA 5CJ2A 5CITA 1Q0UA 5KUTA 5BOLA 1EWRA 5C2JB 3C15C 2YWFA 3RS7A 2J0QA 4B2LA 1NSTA 1PUIA 4O25A 2C03A 3U6KA 3LY5A 1P7CA 2WTFA 5CM9C 1B0UA 1P6XA 1Z00A 3GV8B 3RH5A 2QG6A 4DLXA 4DB4A 2O8CB 1KO7A 1OXXK 4Q44A 1OIVA 4JLMA 4Q1DA 1Z3EB 2W6ID 4DSTA 1ZQCA 3QNUA 5DHFA 3PV0A 3R8CA 1TUIA 4TUSA 3C5CA 8ICAA 5G41A 3FKSA 2AFIE 4K4GA 1SXJB 2CL7X 2B92A 4KXFB 4PC6A 3B78A 4A1FA 3KQUA 3SHFA 4F5OA 4UXIA 4HZIA 1Z6TA 3F3YA 2JJ2D 4PGYA 5KFQA 2VRWA 3U4QA 1XMSA 3B1VA 4WVFA 3UG6A 2Z4SA 3B85A 1E1QA 2NPIA 2P6NA 3BERA 1GL9B 1ONBA 3B1WA 4JLKA 4NCJA 1NLZA 4JLOA 1OT3A 1ZNYA 5K8LA 2UVVA 2ZSAA 3NKVA 4YDHB 2L0XA 4HEJA 4DDWA 2D2EA 5CM8B 2BC9A 3C14C 1E2DA 3KX2A 4OI1A 3FTQA 5FTMA 5FOVA 2W9MA 1DVRA 3I3SR 3T3FA 2HLDD 2W2VA 5DGAA 4WA7A 1YE8A 3I8XA 3SE0A 1CR1A 5IILA 1KY3A 1LF0A 1KIMA
chains in the Genus database with same CATH superfamily
1KL7A 1FX0A 3BD8A 3GRPA 5KFUA 4NIMA 4OXYA 2UZ0A 2ZRGA 5DYYA 1E1YA 3O5AA 3IJ5A 4NRDA 1VI5A 1RNLA 1KYTA 1XJ5A 4HNTA 2I4MA 4MEAA 5BQXA 1SXPA 1FYDA 1JHPA 3VU9B 1BCRA 4I19A 2A1IA 3CNOA 3I0ZA 3AR8A 4ENSA 1Q21A 4KRFA 1VYUA 3IT1A 1N6LA 1T8WA 2FWAA 4O3OA 3KZNA 1RM5A 5DCLA 5IAAA 3CRW1 1SKYB 2QJRA 3HJHA 1EINA 5K6TA 3H0LB 1H38A 5CU7A 4EKNB 2WMDA 1Y42X 2GAIA 2BUCA 3SC6A 4YMLA 1LK7A 1MXHA 3VPGA 4AY5A 4FYIA 4D92A 3ZBTA 1LQTA 3NT2A 3YASA 1QLWA 1QB7A 2JFBA 1C8KA 1ZD3A 16PKA 2UZ1A 4IDOA 5BSMA 1KQNA 4D6YA 5LKAA 2XLBA 3NG1A 3T7RA 2BN4A 4N6NA 5JJCA 3COPA 1B6SA 4JXZA 1PHPA 4F92B 1BHQ1 1BROA 2BLNA 4Q7KA 5ED4A 3GFOA 4X1KA 3T7CA 4ZQFA 3C28A 5A4JA 1OBCA 4A1OA 4XE5A 4CMIB 3UMGA 2NU8A 1NQXA 3C48A 1PI3A 2Q8NA 3HKCA 4RA6B 4HWSA 3R6TA 3MFHA 3P0HA 2XRMA 4IR1A 3IO5A 1P4GA 1TUEA 5ICCA 4H1WA 3KHLA 2JAPA 4D6XA 4U3JB 1RQXA 3ETJA 3H11B 1KI6B 3RYHB 3FDFA 2GSWA 1RYRA 2IY7A 2X8LA 3W9BA 1IVSA 3G5MA 1YULA 2GBLC 4O63O 1G7TA 2WFLB 3ER8A 5EE1A 3L8DA 4WBXC 1H4TA 2H54A 2LBOA 1J8VA 1KDVA 4IDCA 2V03A 2ZYHA 4WW0A 3H87A 5BNFA 1H2AS 1IEVA 2YWJA 3FHJA 3AF6A 1KU6A 1R9MA 4QTZA 1E6CA 1RZ3A 5FL7D 4I2NA 3REGA 5AVJA 1S10A 4RF2A 4BQNA 4TS1A 3TGLA 3IUJA 3G3EA 1F3LA 1OLSA 2D1RA 3KOXA 4L8WB 3K0EA 3CVJA 3BSWA 1O6CA 3LHFA 5IMBA 3AF5A 4N3CA 1PUJA 1DKOA 1M73E 1X77A 2I6GA 3DYIA 3N2GA 4WN9B 1SCKA 3SYNA 3IAEA 4NYIR 2JW5A 2P91A 3ESXA 4TURA 3AINA 2L82A 4BQSA 2ZIXB 3NCHA 1WCXA 2D2IA 4RHTA 4RLHA 3FPSA 4RBNA 2JIBA 3LFHA 1V1RA 4WASA 1Z2DA 5COBA 3D8BA 3DMTC 3LVVA 1XL1A 3WMRA 5M3BA 4YN4A 1IPHA 1LSUA 2WM8A 3HDYA 5CT9A 2C94A 5EMLA 3TW6A 8ATCA 3WB2A 5B58C 3H1PA 3G13A 4IYRA 4NLGA 1AE1A 4WT7A 1TMGE 1YJCA 4LMAA 5DXFA 3CQ9A 3MEQA 5GWXA 2JLSA 5AM2A 1LBTA 3MCTA 1SKAA 5K0NA 4U7CA 2HDWA 4PZCA 3ICCA 5F12A 5P21A 1QG0A 4ZYXA 2O8CA 3AQEA 2XNKA 5KKCA 4CMHA 3CRRA 1X8JA 3OUUA 4HXYA 4OMFG 4QW9A 4DLTA 5I7VA 2OYCA 1D9FA 2ES6A 3MD0A 3EIHA 3L84A 4YIKA 4FYYA 5L4SA 1K89A 3QE9Y 4KWEA 3HU1A 4TWJA 1SC4A 2GMWA 4WQMA 3PEWA 1DTEA 2NSYA 1R0SA 4I2VA 4N5HX 3CX7A 3BSSA 1NMQA 3EGCA 5EE5B 1NZBA 1LCIA 2IITA 5DOVA 3K5IA 2W4QA 3K2EA 4GECA 4E5VA 3ZVNA 4ICAA 1BXGA 4DN6A 3PVXA 2ADFA 2G7MC 1F1BA 4M98A 1JR3A 4AF7A 4QU5A 3ZJTA 5AHXA 1U0RA 3MXTA 2PWPA 3OTIA 3QYFA 1QNLA 1JB9A 1UR5A 2VJCA 3TSZA 1IZYA 4DPKA 4UDOA 3LO8A 4Q9IA 2ZYWX 5BN5A 5KOJB 4JT2A 5B3LA 3MNFA 4JI3B 2CL0X 2B1GA 4CKWA 3RR8A 1SCIA 2BWJA 3M9MB 1U47A 1N1EA 3IUSA 2FMHA 4GX5A 3FWNA 3WLKX 5IM4A 4RFLA 1MGPA 1LJUA 5E2AA 1L5MA 3VSAA 1DKLA 1WCYA 1AXGA 5CFZA 3C1TA 2KTQA 2HLPA 3CUKA 4JJGA 4P38A 2XC9A 4EJSA 5KFEA 4IIFA 3RH4A 3OD1A 2KVCA 1WB5A 4WX2B 4EFLA 5E9AA 4XUDA 4Z6EA 1O97C 1HRDA 1RCFA 1YQGA 3P0EA 5LXTF 5EKDA 2FMUA 3QXCA 4C04A 2VHUA 1NVWQ 2OC9A 4MV0A 3TTTA 4DUPA 2WB2A 2YUTA 3ZY6A 2QW8A 1HMYA 4NMLA 3TS1A 4JV1A 4N1AA 4U6QA 5ISMA 3MOSA 2HH9A 3LK7A 3LMKA 5ITSA 1P4AA 4BKPA 2EDCA 4G9EA 5DIZA 3SX0A 5EHZA 4WV3A 3ZE7A 4AN0A 2EIXA 1R4NB 2FFBA 5KL8B 2PPLA 4QDZA 1XWIA 2R6HA 4DVJA 3I0NA 3I61A 3BTOA 1DRVA 1H05A 1SUFA 2ZVJA 1P6QA 3LT2A 1D4AA 1W29A 4WKNA 3BFVA 2NQTA 4FB5A 1ESMA 1JFTA 3AIKA 4I1RA 4Y2YA 4K4IA 3K0HA 1VG1A 4IHJB 4UVGA 4W99A 2CE7A 3WV5A 2FEAA 1ADYA 4BO5A 4X65B 1EVEA 3UQ0A 1QJCA 1Y9AA 4AY3A 3B3JA 3EPJA 1SVUA 2WTAA 4EY3A 3NKLA 5C3MA 3UANA 2J8ZA 4LDJA 2ZSFA 3VJRA 2NZUG 3F6RA 4Q0MA 3DO8A 3IRUA 2CXOA 2PH3A 3OSUA 4QBKA 5L8VA 1AKTA 3C1OA 3E1SA 4JUIA 3AESA 4F5QA 1QHHB 4JR2A 5AOBA 5HBRA 5IEBA 1ZW6A 4Q3KA 5FORA 1W93A 2D8AA 4CM9D 4EKYA 3N8GA 1QNFA 1BFUA 4JYPA 3RC2A 7ICJA 2KJ8A 3ZDCA 3KHHA 3QEKA 2R44A 4N3NA 4PQFA 4ZVKA 3VM6A 3KTFA 3ZK7A 1PWZA 1WDMA 1SUEA 1Z56C 4W5HA 3PEYA 2VYCA 1ZMXA 4BNKA 2IH2A 4AJ2A 1OPRA 4KWHA 3S7ZA 4PG7A 4E11A 1HK7A 4JLDA 3R5TA 1RWXA 4DMFA 3FM9A 1KE2A 4KLSA 4EGQA 1YQQA 1DDGA 1GKLA 2H17A 3R0XA 3VPCA 2AJQA 1U28A 3LLCA 4IBOA 3ULKA 3A1VA 2YWEA 4GPZA 4HSGA 1FVHA 4GZ3A 4MUEA 3SBEA 4YYZA 1V11A 5A5FA 4S04A 3HYLA 5KFFA 3KTAB 4JVSB 4MQ4A 3LY7A 4C29A 4F9TA 3U4GA 4HYYA 5GADl 1B8VA 3D8NA 3LWBA 5DXAA 2W2KA 3F5DA 1GUAA 3TL3A 1L1QA 4RLSA 1G8GA 3IP7A 4B3MB 1YACA 1IVNA 3HCAA 4U02A 4EF5A 5K0ZA 1K1SA 3PNOA 2XAAA 1OH7A 1VPDA 2C83A 3R09A 4H15A 4YH1A 1F7VA 3O8CA 1I5RA 2FXVA 5FTKA 4C0AC 3WFZA 4HUQA 1ZQTA 1KJQA 4ZP1A 5DVZA 2H7VA 5BN1A 1RT9A 3GLKA 4R8SA 4EGAA 4F8EA 3NAQA 1C4KA 3KBOA 4TQGA 3ZK9A 1ESEA 5KT7A 1GFSA 3I12A 4MQFA 5AXAA 4D99A 4B3SB 5JADA 2WYUA 2Z8YM 1UZAA 3OPNA 4I1SA 2R8GA 1I3MA 1THZA 4QTUB 1R0KA 1AGPA 2ATVA 2BMEA 2OY0A 4FB4A 4LXYA 3IR7A 2G40A 4NZMA 2VTKA 3SBXA 3IE0A 2QPAA 2QTHA 4M87A 2GKOA 3KHTA 4OQNA 3AEQB 5AK5A 4QU9A 5KHAA 1UBFA 3RWMB 4AY4A 4D80A 4G25A 4D41A 2D6FA 5IIIA 1SUPA 1Z5GA 2OCBA 2ZQYA 4DAOA 3GD7A 5JD6A 2UZ4A 2E1RA 2XDQB 1Y7TA 2V3VA 2XRFA 3OQIB 5ANRB 3EIXA 3IP6A 1NURA 3DE0X 5HTKA 1Z6ZA 3QBVA 2RKBA 1DAIA 3ZG6A 2RIRA 2R6ZA 2O2IA 1VCOA 3T0FA 2PUCA 1Q7EA 2FPLA 5IF9A 2GJAA 5IMSA 5GV8A 4OP3A 3WYBA 1HZZA 1NPDA 4PPFA 2OECA 3AF0A 3N7TA 3AI1A 2HJHA 1E1RA 1DIGA 2BSAA 1IZ9A 2Q29A 2NSJA 3AONB 4TGLA 4NOJA 1DXSA 5GINE 1IN1A 1IXZA 3FCAA 3V9PA 1HORA 3NBQA 2GUGA 3RWOA 2H4WA 3N3AC 4C1BA 2FRDC 3U44A 3ZDRA 2WP0A 3KJEA 4LCBA 5HF5A 4OQLA 3VVCA 2RBEA 5CA1A 2AI3A 1JHDA 1Q11A 3BE5A 8ICSA 2REOA 1SHKA 3SK0A 1OMOA 2ET6A 4KXLA 4D97A 2K87A 1ZK4A 3C98A 4RYDA 4TN5A 4C7XA 3U44B 3H8MA 1TZMA 1QRUA 4RTPA 4PHEA 4L9AA 3R9XB 2BMWA 5LA6A 5WRFA 3RD5A 4ZREA 3NR2A 4R16A 1ZL2A 3RFAA 2VRCA 4F8YA 3ZLTA 4BVAA 5ITWA 4EJ6A 3H2ZA 1AKMA 1YCFA 5DDIP 3SXPA 5J47A 1DRGA 3AMVA 1NYRA 2ONJA 2H06A 4B9AA 4ECWA 3S70A 3WHKA 1TEZA 5TZVA 4K9OA 3V1LA 5HK9A 3U3MA 5KTMA 5INTA 1FJXA 1JJAA 1C7JA 1CUDA 3UGKA 4KMRA 1G7CA 5KWJA 4HG2A 1G7RA 1OPXA 1WVIA 1YMQA 2VJMA 1ZSYA 3BK7A 4NNOA 3ZGOA 1HBJA 5EQJB 3OF2A 1TMKA 2HF7A 3RG2A 4NSNA 2A2ZA 1X42A 1B6GA 1DAKA 2AW5A 3PGLA 1MKYA 5CFMA 3PQDA 4ED1A 1EM6A 2OXEA 1TQ8A 3FIUA 5EQDA 1L7EA 5I4KA 2VHTA 4UB1A 1J00A 1BKSB 2G1AA 1A5BB 1FXSA 4LDNA 4EQ6A 1L5YA 4MPJA 4US2R 1TQDA 3C4VA 3GOHA 3KSAC 2PX3A 2HHXA 2DWUA 5FFNA 4NYMR 4GLXA 3RTVA 5ALYA 3ZWCA 3S1SA 2QDKA 3TW0A 4EY4A 4YS6A 1EXDA 5E9WA 1AVTA 1FVFA 1VI2A 1ZJNA 1GSHA 2J3KA 4RO0A 3U3ZA 4Z54A 3IV9A 2Q3DA 3KDAA 4FNAA 4V0LA 4X63A 4Y0AA 5DMXA 5AXCA 3UY4A 4Y7CA 3AOEA 2LHTA 4RZUA 3ES9A 1JKJA 4UARA 4DFDA 1USGA 3QNWA 4X66B 4H1HA 4D96A 5L4NA 2R1ZA 3M81A 2FVXA 1GP2A 2WTMA 1TJ5A 8ICHA 2A7XA 3NRCA 1NJ1A 1JYEA 3ASZA 4LXXA 2QBYA 1T3SA 2CW5A 4BMNA 3EN0A 3TADC 5KFSA 4V02A 2NRVA 5FLEX 5PNTA 4C4AA 1CRWG 3KV1A 2J45A 4BIIA 1KARA 4O2BA 1JE1A 3EPIA 1ENOA 1DCFA 1YS7A 4TMTA 1TLTA 4ZRMA 4OB6A 3JALA 2DHRA 2YWXA 4OHVA 3MGGA 3K4HA 3TGWA 2A57A 1V41E 5LYJA 1Z4IA 4BC0A 3SYLA 1MU0A 1KMHB 2W2OA 4J0DA 4B7UA 2X3UA 1M67A 3WGMA 4B80A 2F00A 3H9QA 1N7IA 3MT9A 2IEYA 5GV7A 1L5QA 1M2OB 1ZM9A 4ALNA 3C4QA 4DA8A 5LVAA 1E1MA 2ETXA 2GZ3A 2GJ8A 3A9WA 3RVPA 5KI6A 3R7DA 4E5MA 2NXEA 4GKBA 1ZQXA 4RK5A 3GPDG 2BEUB 2PNJA 3RU2A 5JNRA 5MN5A 3HGQA 1YI8A 4OFBA 4YCAA 2FMPA 3ZGZA 4M0DA 3QENA 3KQVA 2FSVA 2NXJA 1T94A 2AKAB 3HFGA 1R6UA 3K09C 1FRFS 2Q4RA 1BXKA 2YJNA 4PGQA 2QLNA 5EWMB 3BGOS 4NWIA 1ZM4A 5CAEA 3MK31 2DB3A 2ZXIA 3GV5B 5A1JA 1X7XB 1WNFA 2PZFA 3ZW9A 1TADA 1W0CA 2UKDA 4OHFA 3UJPA 5LNK1 3BICA 2NAPA 4A0FA 1ZJWA 3TOZA 3KZOA 4MW0A 1SQ6A 1VLQA 1ABEA 2XY6A 1Q1AA 1RYNA 4JNCA 4QFMA 4DSNA 3FTEA 2OCKA 4KLIA 1PVVA 2Z09A 3ZDXB 3I23A 3KSDO 4MCAA 1TA0A 6AT1A 4DLVA 2GYVA 3N5CA 4FHDA 3B7WA 3DBRB 3H75A 4MV5A 4RDHA 4KI7A 1NRWA 1WHTB 4Z9AA 4ZYVA 1QX3A 5JCJD 2HIGA 2WVHA 3AOEC 3CMMA 4EG6A 5CA1B 2EF0A 1SXHA 2UVQA 1WE2A 2XQGA 4M0EA 5AW9A 1DIBA 5E1DA 1OA0A 3DEIA 3GELA 2QRVB 4LRXA 3EFOB 4K6MA 4WNYA 3ZDZB 3THVA 2FZWA 5LN1A 4MSUA 2ZTCA 3HX0A 3SFTA 4AZTA 3Q4GA 5EUQB 5HOQA 1W30A 1YCHA 1FLVA 1STOA 3FKQA 1NBIA 3RFXA 4LY9A 4OREX 8ICFA 3OX2A 5D1NA 4M1KA 1U3GA 1FFAA 2QW1A 3QX7A 4DJAA 3IUYA 2RH9B 1HNNA 4ZRDA 5DM1A 3OETA 3VSCA 1M6VB 4JC4A 3SVLA 2H07A 4ZT3A 1XD2B 2ATLA 1ZQSA 1YQTA 3K09A 3ABOB 2P2CA 3HCFA 2ZB4A 5KTQA 5EXSA 1FTGA 3WICA 1J33A 4YR9A 4QG3A 3P26A 1GR1A 3KU1A 4IDHA 2J9ZB 2QNBA 2C96A 4OAOA 1XTKA 1GPNA 2EFDB 4IV5A 4GFDA 4HGRA 3V1NA 5ICMA 1Q3TA 5JQGA 5ESRA 3NNSA 2OWEA 2XTAA 4X8LA 3VPDA 3ZVMA 4OD0A 1QR2A 5LU8A 4Z7JA 4G5OA 3D1VA 4XWYA 4DNOA 1GA6A 1ZRSA 3JQGB 3EA4A 4TVBA 3M6FA 4UBMA 2E6UX 3NW9A 4W1QA 3OSPA 1IY8A 3OMLA 4TMKA 1U7DA 1PEAA 4KLTA 2FZVA 2X9VA 4W1RA 3KUDA 5EHIA 4DIOA 2NPFA 1R0RE 1OIWA 4K4HA 1G19A 2IEAA 3DT8A 5LQCA 1GQQA 1A77A 2FX5A 4LZDA 1GGMA 1SUDA 1PQWA 3TX2A 1JJFA 4IIJF 4ZXFA 4F4FA 2RHDA 4TQUS 5BR1A 2EXXA 3PB3A 2ZE7A 3C6MA 2V0CA 1NE2A 4UAYA 5TMEA 5J4LA 1V3UA 3WBBA 4CCYB 1UEIA 1XCMA 4MB2A 4DZTA 4RJIA 4ZZIA 4FKBA 4G6ZA 1VHDA 1U8AA 1M0TA 1L5SA 3AT1A 1TZCA 4H4EA 1KY5A 3DLIA 4YMIA 3U4CA 3VR5A 3ZGLA 5KIAA 4QSMA 3RANA 3UAOA 3FUVA 3AY7A 4LJ4A 4NE9A 5L3ZA 3ZUPA 2C31A 1BPEA 4CL0A 4D9NA 1PVDA 4L0MA 4E51A 4YP1A 3GCDA 5IVPA 1LU9A 4Y2VA 3VJMA 2BKAA 3WHIA 4R64A 3OE1A 2WUEA 1VKNA 3A6EA 5KAMA 1JYSA 5KFZA 2EZ8A 5B4UA 2WKQA 2Q3MA 1XVUA 1UPBA 2FPWA 2PQMA 3OJCA 1KEEA 2DFPA 3IODA 3CTPA 3L77A 4RVSA 4HUQB 3GJXC 4Y9SA 2G82A 2VP2A 3MWGA 2GRAA 3KJNA 2X15A 4L5AA 4EHKA 1QLNA 2A3RA 3S40A 1XEFA 3OCUA 2CRXA 1H9AA 4KFUA 4P5EA 1URJA 5AJWA 4F4KA 1O1YA 4ESHA 2KSQA 3LO5A 3G7NA 4J29A 4ZI7F 4JLNA 4PRYA 2VPZA 1Q19A 2BR5A 2JLQA 5B1YA 5CA1F 4KE7A 2Y0SC 2JK1A 3QJYA 3PP8A 3SENA 5IZCC 2HRDA 2ZIFA 2XNDD 2GQ0A 1BE8A 2F55A 1DC7A 2R8XA 4GRIA 1SAYA 1WSWA 1S2LA 3KLBA 3LUAA 4OF4A 4EPVA 1FFVA 5H81A 4QD3A 1IWPB 3SAGA 3LWNA 4IDPA 5LIRA 2Y4OA 3UAGA 1ML4A 1M6VA 3O2JA 2RK6A 3LQ2A 5IVHA 3RSFA 2MU2A 2OYRA 2HY7A 2OK7A 4UNSA 4ARIA 1PGNA 1J56A 3RK0A 1EK2A 3HFSA 3T9DA 1QM5A 3BHJA 3JATB 3N70A 1ESZA 2KPOA 7GPBA 8MHTA 3E9RA 4WFJA 1UQVA 4FW8A 1JEQA 4P5DA 4E03A 3KQWA 5ICFA 3B3GA 4DSOA 2YQ4A 2WIAA 2R00C 2ZS8A 4JODA 3E4DA 3S2SA 3DO6A 5JS2A 3K6RA 1W36C 1MO6A 2O6LA 1BWRA 2OG1A 1YNSA 2SKDA 4ECZA 4MLCA 7ICSA 1QK3A 2L2QA 1KOLA 2WJVA 4DIUA 5TQJA 3D2AA 4QXMA 4HUTA 1VYTA 2R1VA 2FN9A 5B4VA 3M8SA 2V6GA 1BXRA 1U4NA 3OIVA 4CG3A 4B0OA 4BPBA 1TRHA 3GVXA 3LUCA 3W2HA 3P71T 4YP7A 4MHVA 5F3XB 4B74A 5EJEA 2OT3B 1ZAYA 1MQ2A 2IH4A 4QPCA 5GZ6A 2XDYA 1SGGA 3CLUD 1NV8A 1EUDB 3DTYA 1U8FO 3QHAA 4QTXA 3PJGA 3ROPA 4RSHA 5D3QA 4GLFA 2IZ7A 5BT9A 1XMIA 4AG5A 2TSYB 2A9VA 5IJXA 1B42A 1RIFA 4BLQA 1XXLA 2NTEA 3WI7A 5H7XA 1K8ZB 1QE5A 4BNWA 2DFKB 1GYRA 3HCPA 3SZ3A 2R97A 2VH2A 4MB0A 2G9ZA 4DV0B 2Q3LA 4ZGBA 5GVRA 2Z98A 4ELUA 1G2PA 3FVVA 4QWAA 4Z4IA 2H08A 1XKLA 3K1AB 1FRQA 1DKRA 3VNSA 3PX4A 3E5NA 4GP6A 2GVDC 1LVHA 2IS4A 4I6GA 4Z0PA 2ZB8A 3A6GA 4JP2A 2X58A 3WTBA 4EF6A 5MFZA 1CYEA 1PT6A 1XUOA 2ZRIA 4EI7A 3CZ5A 3WMXA 5IH3A 4DYDA 1M5RA 4TYWA 3H2BA 4CEHA 5DEOA 1XNSA 4GZ6A 5T4BA 3L8FA 1LRJA 2W2QA 3GFSA 4P1ZA 1RC1A 1P0CA 2Y1GA 1BVSA 4R66A 1L6IA 4ZT6A 5ARDA 1A96A 2EDAA 1PR0A 2WNSA 3OPVA 4ZZ2A 3RU9A 1N57A 4Z1MD 2VDWB 5C5IA 1W4CA 3U60B 1RYHA 4IFTA 3RRZA 1G9TA 1ZQAA 1A9YA 3BF7A 1YS9A 1B8UA 5ECYA 1FFHA 5CR9A 1KEWA 3TXYA 2AEJA 2D8MA 3K32A 1XQVA 4D2IA 3ZIAA 2BF4A 1JLLA 2HHWA 2AQKA 3T7KA 3SKYA 4PG6A 3HE3A 3I1IA 2JFYA 4DJFC 2F67A 3K9LA 5B55A 3E7DA 1RXCA 3HJEA 1NOIA 5K8TA 1T91A 1Y6JA 3L46A 3OY7A 5EYPB 2PMKA 3VMFA 5T57A 2ZIVA 1QHHA 2CBZA 1W36B 4P9NA 1QSLA 3LM8A 2H4HA 1VG0B 4A9AA 4DMUB 4ZARA 2QRUA 4XX0A 5C1DA 5LQAA 4PAMA 3JPQA 1HQKA 1NNUA 2A5JA 1BQ3A 1KBOA 2NV6A 3FKSD 1AZSC 3PT9A 1W1UA 4U7DA 5ELXA 2C8JA 2HTEA 3EHEA 3NHYA 1C8LA 2QZJA 4L8FA 3VOTA 2WDZA 1PZGA 1W59A 3UAWA 4YT5A 5FA6A 4WXRA 4BNFA 4JI7B 5AM5A 2XGJA 4GYKA 3WQSB 1GPBA 1UP7A 1NUQA 4YRSA 4BGDA 2XUQA 3PXAA 1C9KA 2YHIA 1QO7A 2I71A 8ICLA 1XYYA 4O4HF 1GZHB 2B6HA 2QPOA 4KQHA 2C4NA 2IXAA 1KBQA 1MN8A 1XMXA 4MW2A 2R62A 5C35A 3I1FA 3P94A 1SPXA 5JJKA 2OR3A 1HL7A 4IZOA 1PR2A 2W58A 2ZTMA 3BRQA