3LDAA

Yeast rad51 h352y filament interface mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
319
structure length
293
Chain Sequence
GSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVNIMAYSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD51
publication title Insights into the mechanism of Rad51 recombinase from the structure and properties of a filament interface mutant.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 99
structure length 293
sequence length 319
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ldaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ldaA02
4P4MA 1P7CA 1L3VA 3KTAB 1LF5A 4HAZA 4M1TA 4DCSA 3MR3A 1X8LA 3GLFE 1HJPA 1C7YA 2NPIA 2VQSA 2PI4A 2ZI3A 3FB4A 3D31A 1TMKA 1W48A 4YLGA 4LYFA 4PPGA 2O0JA 4YR2A 2ATLA 3OE7A 3H1TA 3UG6A 3C4JA 3KFXA 5KT2A 3H4DA 1GL9B 1S0MA 2QZ4A 3HYRA 1SXJB 3NHAA 2EYUA 1N0VC 2DYKA 3FFBA 421PA 2ZSBA 3DMNA 4TT3A 2KZ3A 4CRWB 4MF8A 4G5SA 3GLFB 4C0KA 1GRNA 3D6TB 1ZIOA 3A1WA 4DSJA 2BR0A 2V4ZA 3BDPA 2G6BA 1Z0KA 4RNNA 1AK2A 1IN7A 2QPAA 1BPDA 1XD9A 1Z29A 5J0XA 3BFXA 5FOXA 3ASZA 4DLRA 5J2AA 4JSTA 5BN3A 2RGGA 1ZQNA 2Y1IA 2NPFA 1ZQUA 721PA 4URWR 4ED6A 2Z4RA 4BFZA 5DISB 2WKPA 3UATA 2BJVA 2KFNA 3HU1A 2BM0A 4RJLA 1X86B 5HMLA 2A1JA 4HEJA 4L5BA 5FOTA 4KSBA 4RD1A 3H0KA 1XZPA 5F98A 5J4LA 1LV5A 1YVDA 2A9KA 2J6SA 4NYIQ 3H2YA 1OT3A 3NBYC 4F5QA 4KLLA 4YMMA 3B1YA 1S9HA 2EU8A 1TPZA 2D4HA 1E1RA 4BFYA 2WJHA 4HATA 1KDTA 3QEJA 1VG0B 3HPRA 3IBYA 2HV8A 5KO2A 1NKSA 1NRJB 2QI9C 3OHAA 2P5SA 5LD2B 4A8JB 2W8KA 4ELVA 7ICOA 3BC1A 3RAPR 4TMKA 2PJRA 4YMNA 1IXRA 2BBOA 2HJVA 3N5CA 2D2FA 4KFUA 3G82C 4UQOA 1TQ4A 2WPDD 3MGHA 2WZQA 4EFLA 2IEYA 2NO6A 9ICVA 4CT5A 3TVDA 4DSKA 3EWSA 2VHTA 4Q43A 1NSFA 1N25A 3Q8KA 3MWJA 2FMQA 5L3VA 2WWWA 3C16C 5KFKA 4JV2A 3SJCA 821PA 2NTYC 1AQYA 4WIAA 2VP2A 3AF0A 3CWZA 3CRVA 2D7CA 4F4IA 4EPYA 4LUCA 2OCPA 4F5NA 1N5KA 1UBCA 2QGNA 3CF2A 4HYKA 5KSYA 3M6AA 2ZU6A 4ZI2A 2JLQA 3C23A 4L16A 4MGKR 4MRNA 3TJZA 2MMGA 2QBYA 3W3ZB 4NLZA 3M0EA 1E2KA 3BK7A 1XFAA 3VR3A 2FPKA 7ICFA 1DAEA 3C2LA 2C9CA 2QP3A 3WNBA 2OCAA 3MAAC 3THWB 1HE1C 3NTUA 1OIVA 2AGQA 3W3AA 4ARZB 2AFIE 4MGZR 1FQJA 4F92B 1KO7A 4O0MA 4OHVA 1EFHA 3RBEA 2RAPA 2VP0A 1RPZA 2GAAA 1T3SA 4HLQB 1G5PA 5CYOA 4IR1A 1ZJMA 2ZVPX 3MG9A 3WNCA 2UKDA 4RCZA 3Q9LA 3VFDA 3IIJA 3UWOA 2G88A 1HTWA 4IQTA 1SHZA 4RKEA 2OCBA 3AF2A 1VG8A 4NYJQ 2BCJQ 2KN7A 4GXJA 2WAXA 4FCTA 3SOPA 3UKDA 4RD6A 5KFRA 4JS0A 3HPOA 1JXMA 4ZKEA 5CB6A 3SQXA 4QZHA 2ONKA 5JHGB 1W36B 5KFJA 2WWFA 2R62A 4QL3A 5J2JA 3T35A 3WP0A 3V6JA 2C95A 2V1XA 4RQ7A 5J0UA 1GTVA 3SHFA 1G41A 4UB3A 1UBFA 2QAGC 3IEVA 2ZSAA 1N6IA 3EYZA 4JBYA 3V4RA 2P6UA 2QTHA 1K5GA 4E22A 4KO8A 1XCMA 3C7KA 3CBQA 5KG6A 1XO1A 3DDCA 3NGDA 3UK6A 2K5UA 3IBGA 2VLIA 4RD0A 4E03A 2QQEA 1XPOA 2DHRA 3CNNA 4IXMA 2G1KA 3TARA 2JDIA 1N0WA 4KMUA 2ORWA 5DLQC 3AP1A 3VR1A 2BV3A 4QGHA 2B7BA 3QKUA 3BFKA 3LFUA 4JYCA 1PV4A 2ASEA 2D7DA 1Z0IA 3AEZA 2JGNA 4YQWA 2MSCB 4XTCS 5K8TA 5M04A 1ZCAA 1I2DA 1R5BA 3SFZA 1VHTA 2ZRPA 2OLKA 3TQCA 1T8TA 2PT7A 3GJXC 2RDJA 1MQ3A 3TIFA 1R0ZA 5FUXA 1K5DA 3RVBA 3PW0A 1BO6A 1NJGA 5JBQA 3ZD8A 3QZ7A 1JAHA 3TFRA 1IXSB 1W2GA 4GP6A 2QPOA 4JBWA 4YMWA 3KHHA 1B22A 4URYR 4EPTA 4DDVA 4EZ6A 4RUCA 1E2MA 1UKYA 2HXSA 621PA 3KHLA 3RC8A 4TZ6A 4ZH4A 3EPGA 4CDGA 2CE2X 3P20A 2VIIA 4NLNA 5DYGA 3WYAA 3OEHD 2GA8A 4QNRA 3IQXA 1X2IA 2GCPA 2W6JD 1OH8A 3QEOA 1OKKA 2CE7A 5J2CA 1X8KA 2OSBA 2ZJOA 4Z51A 1RRFA 4C0QC 2KTQA 2O8BA 4FCWA 3T5JA 2CNWA 4PC2A 1QHXA 2C5LA 4RSGA 1G6HA 4EYIB 4MKIA 1FPMA 8ICCA 1LF0A 2OHFA 4EBDA 4PZZA 4BFXA 4MGYR 2JLRA 1BYUA 3SZRA 5CHGA 5JEDA 4N0EA 3NKVA 3UQ0A 5FBVB 4WAUA 2YWFA 4XVQA 3BB4A 2RGDA 5GADl 1NNEA 3GILA 2IS1A 2FEOA 2FZLA 3K09A 2YOHA 4EPRA 4I4LA 1P61B 3K8YA 3OF5A 4UJ5A 4NYIR 4W9MC 2YJTD 3QVUA 4JJZA 1R4AA 3KQLA 2V9WA 1E2LA 2X1VA 8ICFA 3DEFA 3ZZUA 3GJ6A 1GAJA 3KXKA 4WZBE 5KSZA 3A6PC 2F43A 4MKHA 4FXPA 3LWMA 4I2BA 2PLRA 3TAUA 5KFUA 4QXAA 4WBSA 1J8MF 1SVLA 1M74A 1QSSA 1X3SA 1EGAA 2CBZA 3L0OA 3MWYW 1QBKC 3OAAA 2ZI6A 4HLUA 3T06B 4ZDKA 1RRCA 4CEIB 1E94E 1ZAKA 2NO0A 3FE2A 2D2EA 4F4ZA 4L9WA 1IJEA 1E2EA 1P9WA 2ZJYA 2J0VA 3BB1A 4BZPA 3AVWA 4RQ5A 3GMTA 9ICPA 3B1ZA 4AYXA 2ZE6A 4P32A 3RWMB 1MH1A 4II7A 4FWIB 1RXVA 2V6JA 4YXJA 3WXMA 3GJ7A 4ED3A 2VEDA 3ZQ6A 1X8JA 3B6EA 3E2IA 5AR1A 4PXAA 1MSWD 1ZQYA 1PJRA 4Z6FA 4QWCA 3TUZC 4A8JC 2BDTA 2QPTA 4TT3D 2PT5A 5BOMA 5AJWA 2ZYTX 4LHXA 1N3BA 3ETLA 1E1QA 5IIJA 3ZD9A 1II0A 1NP6A 4RD3A 2C9YA 5J47A 4M1SA 1U90A 5AUQA 4B9SA 4QFMA 2DY1A 4YC7A 4PO1A 1IHUA 5KFIA 3DL0A 1F2TA 3EARA 2Y8EA 2YVUA 4XVUA 3I32A 3SI7A 1JI0A 4AG6A 4M0AA 2UVRA 4URUR 2R44A 3V7JA 5LB4A 4PO9A 4JZKA 5DBAA 3H4BA 4NYJR 2PFOA 3LQQA 4DXAA 5E7JA 1VYTA 5DQIA 2HHWA 1MRSA 1OPXA 1YZQA 1DAMA 2J46A 4MKGA 3VR6A 4DO9A 2W9CA 2PX3A 1KI7A 2VF7A 2BMEA 5JUMA 5CM8B 1N5LA 2YC4C 3MR5A 2GJ9A 5HMMA 1W5TA 4OJQA 2F9LA 4A82A 4LV5B 2F6RA 1E1RD 2ZREA 1DAGA 5KFMA 1AKYA 1NKBA 4ECSA 2C2EA 1KTQA 1AIPA 4CIDA 1Q20A 1QHSA 4MYUA 1ONBA 1ZQJA 4F4CA 3SHWA 3C2MA 4J9NA 5L3SA 2OXCA 4C0AC 4QBFA 1ZQZA 3B9PA 4C7OA 3ZD7A 5KSPA 1XB2A 3K0FA 2QORA 2NIPA 5KFYA 4TUQA 4FBUA 2MSEB 2QROA 4O3RA 2IL1A 1T7PA 9ICXA 1TU3A 2ZYVX 3BXZA 2F43B 2GF9A 2BQRA 5FOVA 3B60A 5KFVA 4X5VA 1YQTA 2J87A 1BYIA 1E4VA 4D82A 1RPLA 4I2JA 5AWFC 1E2HA 4QWAA 4YDSA 5J2HA 4IRUB 2LCFA 2ZE8A 3B82A 3UMSA 4QM6A 3PW5A 4TQ9A 3NH6A 2WOOA 3AUYA 4LJ6A 1YZGA 1V9PA 1GNQA 3I5XA 4PGYA 3M1IA 4M0LA 5EUQB 2J0QA 1FTNA 5KFFA 2QY9A 3QG1A 5FBQB 4BRWA 2HDNB 4XWOA 1XBTA 4AWXA 4RPZA 2C03A 5BYKA 2IYUA 2ZTCA 2F3TA 1I4TD 4NM1A 2VBCA 1ZBDA 4TYYA 3AU6A 3C2KA 1COOA 2AKYA 2WJIA 5DDMA 3K9HA 4FMDF 1T6NA 5J2BA 2D62A 4HLDA 4A1FA 5SZIA 3CNLA 4GOKA 5TVKA 1BPEA 1DO2A 4NM2A 4HB3A 2B21A 3PO5A 4DLYA 4BWJA 1S0VA 4F38A 5BOLA 2ZRFA 3OIWA 1M7GA 2R8GA 2CK3D 3K53A 4YFKA 1YU9A 2J7PA 5HZHA 2ZE7A 3GIIA 1OW3B 2UVQA 3F5FA 2VTKA 4DCVA 4TMWA 3FMPB 4EYHB 3HWSA 5FL7D 3FHCB 1ELOA 4MGIR 2GEUA 2DBYA 3RJFA 1F2TB 5FL3A 4HDOB 4KLJA 3SN6A 2I9GA 4PPFA 4YR0A 3P1JA 4JWMA 4ESVA 3C21A 1ZQIA 2UVWA 1KI8A 1VYUA 2RMKA 1ZM3A 2VYFA 5JJKA 1HYQA 4TZ0A 3QPVA 5J2FA 1S3GA 1F6BA 3GV7B 2W9CB 1L3TA 1N5IA 4Q02A 2IX3A 4YXMA 4EDHA 1TF2A 1PVOA 2WM9B 2UZ3A 2FGJA 2W8LA 1OF1A 1WCLA 1L4YA 2JDID 3TE6A 1NKCA 2XTZA 2JJ1D 3G0HA 4RT2A 1DOAA 4AC9A 8ICWA 3HJNA 3T1TA 3IQWA 4QJ5A 2VA8A 1TVAA 4IRCA 1KY3A 1OYYA 3AUXA 1T3NA 3EC2A 2XZLA 5KFNA 4F93B 4C4PA 1M8PA 2ZRLA 4MEXA 3BQ0A 1HEIA 2AD1A 2LKCA 2Z83A 3HU2A 4OHWA 1S76D 3GLGA 4C7OB 3Q85A 1U4BA 2NQ2C 2ISPA 3K0FB 4KFTA 3PEUA 1SVOA 1Z00A 1Z6AA 1DAKA 1P2VA 2DPJA 1H8HA 3NXSA 1P4SA 2Z6VA 4Y0VA 4KFSA 5DSZA 5AK0A 3PVSA 1H38A 3V6HA 2EFGA 4XTRA 5EZ5A 1KAOA 4Q1EA 1J7KA 1SKWA 1N6KA 3C1ZA 4P4PA 1Y88A 1AZSC 4RQ4A 3P27A 1KAGA 4B74A 3D7MA 4YMSA 2ZM5A 2H5XA 2XX3A 3UXMA 3GFPA 4A9AA 1NK4A 3DM5A 3PUZA 1CF4A 1W4CA 3ZLJA 4P31A 1JXEA 1JNYA 1ZJNA 4M2LA 4C8NA 5F9HA 3FKSA 2HHQA 3AGQA 4LBWA 1P2SA 2IYLD 4F7WA 1E4YA 1FP6A 4Q1FA 4OL0A 3U7GA 1KKMA 2GZAA 3Q8PB 3GV8B 1W46A 2CL6X 1W4RA 9ICEA 5DN6A 2F3RA 1NK8A 4DRZA 2ZS7A 4Q7KA 4V0MA 4V0NA 1G19A 1U0HC 1D2EA 1KDRA 3LDAA 2E87A 1D9FA 1JR3A 2ORVA 2XXAA 3M9NB 5KSOA 4DS5A 4KCGA 9ICIA 4KVAA 1TK0A 2BCQA 7ICHA 3GD7A 5J0OA 8ICSA 1S9FA 3PNCA 2R6DA 4B6EA 1H8ED 1FZQA 1DAHA 1GITA 1N2CE 3HT3A 2GWHA 1JMSA 3AH8A 3WY9A 4CYMA 1XEWY 4KLOA 4JT4A 3RNLA 4PH5A 3RB0A 1ZP6A 3ASYA 3OAAD 3EZ5A 2FV8A 3GFOA 2JLVA 3AF3A 5IK2A 4KLNA 3GJ5A 3KFVA 2OE2A 4GXKA 1UADA 3I1FA 4IQVA 1KNQA 4FMBB 4M8NE 1D8LA 3PQCA 1WBDA 2CHQA 4Z6DA 3RTVA 2R65A 2HLDA 1U9IA 3B0YA 3CM0A 4V0LA 4ESHA 1OB5A 4LSGA 2NRVA 5EE3A 4BLTA 1Z2CA 1MKYA 3REGA 5HCNA 2PXIA 1KGDA 5TARA 2GJ8A 3PMLA 1CJMA 1FX0B 4B32A 3RSLA 3KXIA 1LS6A 2OFOA 3CUEF 3KX2A 3PX6A 2C96A 3LQRA 2CCKA 4DDUA 4E09A 5J4YA 3VHLB 3QPWA 1IBRA 3K09C 3U3JA 1KLNA 1ZNWA 2AK2A 5CP2A 3FYHA 4YP3A 4DJTA 2HYIC 2BGWA 1AQUA 4TQRA 3FFAA 3ZDQA 5HR5A 2IYTA 2O52A 5KFWA 4C8KA 1MO5A 1NLFA 3EA5A 3SYNA 3GLGB 2O8BB 2M9NA 1UKZA 5EWEA 121PA 4DL6A 3SI8A 4KVGA 1G18A 1RRPA 4UNQA 4W7SA 2G0NA 2FA9A 2YWHA 4B48A 3KQNA 1R8SA 4TQAA 3B1VA 2GCOA 3RSOA 1W0KD 3KQHA 4HLUC 2XY6A 4OQNA 2AXPA 1I4LD 4ASUD 4V0ME 2LYHA 1QLNA 3NH9A 1M7HA 4Q01A 4W5HA 5DI3A 1WP9A 3VKHA 2HVIA 1XTJA 3P4XA 4KLEA 3P26A 3ZDEA 5DLGA 2BPCA 7ICIA 1CR2A 4TTQA 1E99A 4YCXA 1NK5A 3UXPA 2WAYA 4WVFA 4X8HA 3GPLA 1WB9A 4C9BA 4QG7A 4U02A 3RB3A 2IA6A 3S1AB 2ZQ5A 2GZHA 3VU9B 4TUPA 5KYKA 3EX7C 1R5OA 3T5DA 1G8HA 4EFMA 3KKNA 4QZBA 3VNVA 1ZW6A 1NY6A 2VPPA 3RS3A 2XXAB 2DFKB 1HURA 4PPQA 5KFXA 2J7KA 4J9KA 2KZMA 2GCNA 3WRYC 1GWNA 2YINC 3U61B 4MITA 3AV0B 1XC9A 2CDNA 3KKQA 3ZVNA 2W9AA 1G8PA 1OFHA 3MWKA 1TK5A 2FPLA 5KOYA 4F4XA 4ECUA 1Q22A 1R0XA 4TL9A 4GPTA 3ADCA 2ZUCA 4O3NA 2GVZC 1Z6GA 4KBFA 4F5OA 3OEED 2IYYA 3RDPA 4ASUA 2GEVA 3CPJB 4I27A 4DFPA 3RAXA 2HYDA 5CDFA 4Z8YA 3T12A 3QG5A 3WMGA 3K0SA 3IUYA 1UFQA 3NEJA 5KG1A 4EJSA 5KPJA 1NF3A 1Z0FA 1XDBA 4H9GA 3SJBA 4R7ZA 5G3ZA 4QHSA 1L8QA 3AVVA 4JLDA 1RYRA 2ATVA 2XITA 1Q1BA 4QZAA 5J40A 4E0DA 4E5UA 1U49A 4MYCA 4C8OA 3SR0A 3PEWA 5GJBA 4GDFA 1G3IA 2C2HA 2Z5FA 5FI1B 3NBZC 2PFPA 3U44A 1ZMXA 3PVXA 1R5NA 4C8MA 3THOA 5HHIA 1L3UA 4GFDA 1KMHA 1KZ7B 1KY2A 2PBRA 1BPYA 3LNCA 1P2UA 3OIVA 4UKDA 4UBBA 4PHAA 4DQIA 2OBNA 2W58A 3OFNA 4I2IA 2ATXA 2YOFA 2ZROA 2YC2C 3LW7A 1U0JA 2MMCA 2GBLC 3DZDA 4TYQA 3CX6A 2QP9X 4PHGA 4P4UA 3F0TA 2ZTDA 3MR6A 2QAGB 1WRBA 4O2LA 1TNDA 4QZGA 1HUZA 1PLJA 4GNKA 2XNDD 5K8UA 3RS0A 2FOLA 2QP4A 4D4JA 4DF4A 4EZ9A 3LLUA 2ZYUX 2ZI9A 1OSNA 2GCOB 4YONB 1U8ZA 2EFDB 2IBMA 5GVRA 5TY0A 3T1QA 4EQ6A 4ILEA 4QW8A 4K4IA 3AKEA 1QZXA 2ERYA 1KZGB 5DI3B 2J6UA 4B76A 2O8FB 3PFIA 2NGRA 4NCKA 3L8ZA 3K4GA 5L1LA 4DC9A 4DT1A 5EXSA 1B23P 4YN4A 3ZDAA 1W5SA 3NC1C 4CF7A 3BIFA 1RYHA 3ISBA 3RR8A 2VSXA 3EC1A 3LRPA 1IM4A 2HJGA 1OH5A 5FR1A 2JLZA 3SFVA 2JZBA 1XTSA 5KDOA 5P21A 5JHHB 5DGXA 3C8UA 1G8FA 4Z1MD 5KG5A 3VKGA 1XJCA 4PSAA 1XEFA 3R7WA 3PV8A 4DIDA 2W0SA 5CDFE 4OK3A 1TU4A 4I81A 4NP6A 4C0SA 1XEWX 4A2QA 3VAAA 1XCPA 3MCAA 2Y1JA 4QOSA 4KLQA 2DFTA 1CXZA 2WBLC 1M1YE 1H8HD 1M2OB 2W2VA 5KTYA 8ICUA 1G20E 3SDZA 4A15A 5B2ZA 2ZTSA 1E0SA 4RY2A 3KL4A 1II8A 3PXGA 4BECA 3ICEA 3Q5EA 1QF9A 2ZRMA 3GJ0A 1G291 4XWAA 5DHFA 4ECQA 4LHVA 4KODA 4M1KA 1C9KA 4EJSB 4FMDB 9ICMA 3ZZTA 1Q1QA 1CUKA 1Y63A 3AVTA 3FKSD 3M8SA 8ICHA 3GEIA 4PSKA 1G5TA 1U81A 1UEIA 3EA0A 3MFHA 7ICUA 1RVDA 2CLCX 2VHQA 1FL9A 1LB1B 5TXGA 2PEYA 4ECTA 2GILA 4L4UA 4OI1A 4EPXA 4BZXA 4C0LA 3OSPA 1BGXT 4ECRA 1QG2A 1SHKA 5CJ7A 2ZR7A 4LPKA 5DN6D 2HUPA 1D9ZA 4ECWA 2CLSA 3U44B 5KPDA 1A2KC 2JJ8A 1JR3D 4OQFA 5L1JA 4Q21A 3QXXA 4XH9B 4TLAA 7ICNA 1KMHB 3LV8A 3SJAA 1DADA 2CHGA 5FPYA 2RKOA 4BFWA 4C0BA 3SU8A 7ICQA 5JSZA 2FFQA 4MEYA 3L0PA 4GSYA 3UXOA 4RPYA 2QSYA 3V9PA 4O3QA 2BQ3A 1RFLA 2AD5A 3B9QA 3ZIAD 5DGAA 5BW8A 1M34E 2ZTEA 1E2DA 3V7KA 3BQTA 2VA2A 5IIMA 1Q21A 1V43A 1VKJA 2XY7A 2MUTA 3CRW1 4JBXA 3ZVRA 4B71A 1YJ5A 1KSJA 3SV3A 4I1OA 1IM2A 1QHYA 3TLXA 1KI9A 4C0HA 4DSUA 4YQFA 1KSPA 5LBIA 5IK2D 5CLQA 1CIPA 4TYWA 2F9MA 1UEJA 4EFNA 4EQ6B 2VP5A 3QI2A 3LXXA 3ZGXA 4BLQA 1M7BA 5HKKA 5IF9A 5KFAA 4I2HA 1WXQA 3GJ3A 1K1QA 4MDFA 2HLDD 4NPHA 2GZDA 4M1MA 4R2HA 4DCNA 4DT1B 1YZKA 3EIQA 4TLDA 1P60A 1RJ9A 1P75A 2R8RA 1E32A 4JWNA 4ZO4A 3WP1B 1VIAA 3MFYA 1QHGA 2JZBB 7ICTA 4FIDA 1TF7A 2Q3MA 3SNHA 1A7JA 4M6WA 1KO1A 4Q7MB 2IMWP 4WA7A 4XOIA 3SYLA 1FQKA 3TGPA 1G8YA 1Z83A 3K70D 3CW2A 3BJYA 9ICFA 2H5EA 2ZS8A 3A37A 4URVR 2BPGA 1E9AA 1TQ2A 3D3QA 1FOEB 5CLLA 4O5CA 2FEMA 2RCNA 5DG8A 1NG1A 4GZMA 4A6PA 3M8RA 5AJYA 4DLTA 4YD1A 5A5GA 1KI6A 1NK6A 2L0XA 3B1WA 2CJWA 1DPFA 5SZHB 2R8JA 2KI5A 4B9MA 3PV0A 4XVRA 3RS2A 3R8CA 1MV5A 4B3XA 2D74A 4KLGA 1II8B 2OFXA 2REBA 4M1WA 1OB2A 1E98A 3LX8A 4JLVA 3DKPA 3UMRA 3ZS9A 1RXWA 4RNOA 3OIYA 1YZNA 1IY0A 4F4KA 2FSFA 4JK1A 1W0JA 1J99A 2NRTA 4D25A 4DDTA 3GJ4A 5B58C 1KSHA 2ANCA 8ICGA 3LK9A 4KLSA 2VHUA 2EFEB 5HZKA 4M22A 2ZXUA 4ED8A 2JLXA 2BOVA 5IHPA 1E3MA 1U9IC 1XMSA 4BFVA 3VMFA 5KT3A 1ZC3A 3EG5A 2YV5A 4CEJA 4CW7A 4Q9IA 4YD2A 3KJEA 4Q4HA 3ICQB 4RFSA 4BLRA 4RQ3A 4Z54A 2CK3A 2H17A 5FTKA 3X1YA 1BPZA 2AQ0A 2Q3HA 4UAWA 5IT5A 1P5ZB 3K9GA 2RGNA 3CX8A 4QBGB 1VPLA 1ZRHA 4WZAE 1JN3A 5FL7A 4Q44A 2QENA 3RRMA 4R65A 2ZVQX 3I72A 4S35A 1JIHA 4HB2A 3K70C 5JSZB 4DFKA 4DIEA 1S8FA 1SQ5A 3E70C 4PC3A 3EPLA 4GOJA 2RDIA 3QEBZ 8ICTA 2PZGA 5DYIA 1TAQA 1OXVA 4Q1CA 1OIWA 3LAWA 3AVUA 4KTQA 4NY8A 2RHDA 2Q3FA 1S0NA 4KFRA 4PQYA 4B9VA 1RYFA 1W4AA 2W0MA 3ND9A 2A1JB 5KFHA 4V0OA 9ICHA 4N3NA 3RJJA 1YZUA 5SZJA 4AG5A 1E2QA 1G9XA 3AB3A 4IW3B 4Y0AA 5TDHA 2AR7A 3B1XA 4LC0A 4E07A 2XGPA 5FPSA 2VRWA 4RQ1A 2JJ1A 5HE8A 1KO5A 2B92A 4QGAA 1KYIA 5ELXA 5J29A 5CR0A 1G3MA 1KFTA 5IRCD 4H1VA 1CULC 2AWNA 4NL4H 2P6RA 8ICRA 2G1JA 2IYXA 5KG7A 3GFKB 2FX3A 1XJ0A 5JZVA 5DLFA 1RJ9B 2PI5A 4EPVA 3RH6A 3L0SA 4Q00A 2I3BA 4DQRA 4LWZA 1NBMD 4G3XA 4AKGA 3HX0A 1L5UA 3DVLA 3QBVA 4ZCMA 5JCPA 3EPHA 1EG7A 1D2MA 1DGSA 9ICAA 2W6IA 1XMJA 3PITA 4M6WB 4PAMA 4ECXA 2A30A 3EZ2A 3R9IA 3OFND 1A77A 3RR7A 4WZ6A 3ZDCA 3RHFA 2PMDA 4DEYA 1W4BA 1TF5A 4TMTA 4ZCLA 1P3JA 2BPFA 4DS4A 1OV4A 1EK0A 4YMTA 3FMIA 2KFZA 2IEZA 1U9LA 1KI6B 3B85A 2DFNA 2OESA 5BWMA 3F8TA 1JR6A 4PO8A 1WMSA 3FDSA 5J0RA 1XSPA 4K46A 3JPOA 1KJZA 2F1JA 5KG4A 1Z0DA 4K8OA 3E1SA 4D0NA 2EFHB 2YWGA 1VIYA 4GMDA 2QBYB 3PW2A 2F1HA 2GESA 4QHYA 2GXAA 4POAA 1A82A 2IHYA 3DO6A 4BPBA 4EJSC 1DEKA 5AJZA 1L2TA 1IOZA 4JV0A 4B6FA 521PA 3A1VA 3GIMA 1OFTA 1XSLA 1T5LA 1T8UA 1U99A 2EYQA 3CZPA 3NDPA 1ZUHA 4D0GA 1OH7A 2XCAA 4R2IA 3W5JA 1ZQMA 1S1MA 2XGQA 3VR5A 3QXHA 1GKIA 2H16A 2ZRHA 4M9SA 4O2RA 1QTMA 3CWQA 5EP1A 1UAAA 4UAYA 1JPNA 4LDJA 4CEJB 2J0UA 2FSHA 5J2GA 1I2MA 4JT2A 4URXR 1MRNA 1G7RA 4Q4HB 2W83A 3EZ7A 2AN9A 2KSQA 4RFSB 1XRJA 4PHDA 2X2EA 5DDYA 5D49A 4NKRA 1H8EA 5EP3A 2XB2A 1P6XA 2DPXA 1PUJA 3JPTA 1ZQBA 4OI4A 4G3IA 3C1YA 2HW3A 3W8NA 3GQBA 1HUQA 4J9QA 3KUDA 3LVQE 1IXZA 4KLDA 3N70A 1M6NA 5CITA 4Q4LA 4NONA 5J4VA 3MRSA 2O8CA 3VX4A 4ED0A 3LY5A 4OBEA 2VP9A 2FFAA 1U98A 5EXPA 1F60A 3PENA 2IC5A 1NK7A 1N6HA 3QUSA 5J0YA 1LTQA 1W44A 1OXUA 4DB2A 2OAP1 2EWVA 1XMIA 3BFVA 4FN5A 4TQUS 3VQTA 2JAQA 1S97A 2BCRA 2GF0A 5CIWA 3THYA 4O3SA 3EZFA 3CRMA 4MUBA 4PHTA 5JS8A 3LX5A 1BPXA 4DL3A 4ZDJA 3P32A 5KT7A 2O0HA 3J81k 3PEYA 1AGRA 1U0LA 2Q9AA 3EASA 4LJ8A 4P3YA 3CKLA 2RGCA 4TLEA 4CT4B 4P2HA 1ZQSA 1HQCA 2WSSA 2ZR0A 2JASA 3RRYA 2ZUDA 4BASA 2QQ0A 5JWOA 1JQJC 2AGOA 4B73A 2P2LA 2NO1A 2I4IA 3MD0A 3IKJA 3UXNA 3REFA 4F3OA 1X9SA 3DOEA 3ZJYA 1NKTA 2XJ9A 3MDCA 4RZUA 4ZKDA 1NVXQ 1W0KA 2O8DA 4M04A 1IN4A 1UDXA 3Q8LA 3THXA 1DARA 3ZDDA 2N46A 4PHFA 2BKEA 1EWQA 4DL7A 2X8AA 2HCJB 2ZITA 4Q9JA 4RQ8A 4I2EA 2YHSA 2QT0A 3TANA 2BHNA 3FGNA 4TYNA 3CO5A 2ECKA 3TRFA 3O8RA 4I2FA 3RANA 2IYWA 4OI0A 5HKKD 1B43A 3H4MA 5FPTA 3RB6A 8ICQA 4IVPA 4MYTA 3QSYA 2O8CB 1EFCA 1NN0A 3B13B 2R8KA 4O3PA 2F7SA 4UXJA 3MABA 4ED1A 4R63A 1GRQA 1BMFA 1ZQDA 2WWHA 4L8GA 3TW8B 1T8EA 2NRWA 3ZYCA 5FPKA 4X8OA 4KAXA 1UBEA 2J0UB 3TUIC 5HE9A 2HHVA 5EXXA 5CWRA 1CRQA 4BFUA 2GBLA 2HF8A 3LO5A 2C99A 2X77A 3K1JA 3TVTA 3FOZA 5DBCA 4PHEA 1ZQHA 3C5GA 1IN5A 3HP1A 4JLBA 2P67A 1G21E 1KK1A 2I1VB 4G5QA 5J4HA 3O8DA 4C8LA 2BBWA 4I1UA 2FFBA 4KLIA 5F2EA 2NG1A 1HUOA 3OEEA 1E6CA 2YNMA 4M21A 1N6NA 3M9OB 2BBSA 5BQ5A 4JUZA 1G4UR 4MYHA 3KKPA 5HTKA 2FG5A 3O8BA 5JJLA 1AZTA 4EBCA 2VA3A 5DO9A 2BCVA 4JV1A 9ICJA 2OCYC 1RYSA 9ICTA 4LX0A 4A92A 3LD9A 1ESNA 4NH0A 4KLMA 4UNSA 1NOMA 5HHHA 1W0JD 1F48A 4JLOA 1NN5A 1WBBA 1KI4A 4I2AA 4LYAA 4MRRA 1ZYUA 1JQLB 1C4OA 2HT6A 2FNAA 2OUKA 2QGZA 3V4FA 3BD9A 3OZXA 4QZ9A 2RHMA 3K0AA 3U5ZB 1NY5A 4ECZA 3RRHA 2ANBA 2B6HA 4R64A 4HZUA 8ICOA 3EXAA 4AD8A 4A0HA 3C5FA 2C22A 4GRAA 4B35A 4KSCA 1ZNZA 4LJ4A 1Z63A 4Q19A 4DSEA 3U6KA 3BQ2A 4NLKA 3SBEA 2A78A 3C15C 4DLVA 4US2R 2NRZA 3RS5A 5F9NA 2P66A 4W5JA 4JL6A 5FI0B 2VH5R 9ICSA 4ABYA 5KNCA 1U48A 3IM1A 3EPIA 1QSLA 1E9CA 1MABA 1X1SA 2C98A 1IQPA 2ZPTX 4KITB 2FMSA 1YE8A 4US0R 4OYHA 1VG1A 1XD2A 2XNDA 3N2EA 4IQWA 4RCYA 4QWDA 3RAQA 2H18A 3C5HA 1BOFA 2FGKA 2YKGA 1FNMA 2O8DB 2AXNA 2JIZD 3NBXX 2PMKA 4IRKA 4RZRA 2V8OA 2TMKA 2FLLA 1T9HA 5GJWC 5JECA 1TUEA 9ICBA 2XCPA 4IDPA 4W5WA 1QHNA 2CMKA 4M9QA 3I62A 2ZI5A 3QF7A 4XD7D 4NTZA 2Q9CA 5J0PA 2G9NA 3ZS8A 5D3QA 3SS8A 2HEIA 4IDQA 8OHMA 3U7HB 3THVA 4Z1MA 3QXCA 3AVOA 4C0JA 1SKYE 5L3SB 4O5KA 2VSFA 3QIAA 2ISOA 5JCZA 2QMOA 4M9GA 3RRNA 2XZPA 4DL5A 4AKHA 4YXWD 2W6ID 4Z6EA 2HCBA 3PUVA 5JFGA 1XTKA 1L4UA 2XB4A 1NJYA 2RGNC 2WMOB 3KDSE 3Q72A 4QRHA 5KDDA 4GC7A 1UKEA 3BRWD 4B3DA 4DF8A 2H92A 3U60B 2ZJ5A 4RQ0A 2ZAOA 5DKWA 3H86A 3TK1A 5B57C 4D0LB 3PW4A 2GJKA 5AJXA 2KJQA 4DOCA 4LY6A 3TW4A 3QY0A 4UBCA 1SKYB 3EWAA 4KN7A 2GHIA 2ZS9A 5J2DA 5IDVA 1EFTA 4DSNA 4MKFA 5SZKB 2C8VA 4Q7JB 2IF2A 3V72A 4KYUA 2XO7A 2WKQA 1SULA 4A2WA 4ITRC 5DIFA 2OBLA 5KTQA 5E95A 4NCIA 2QEQA 3DHWC 1JAIA 1Q44A 5KT4A 1GG2A 2W9MA 2OT3B 2WJGA 4D4LA 4BGDA 2QRNA 3B8HA 2BJWA 3L2OB 2P5TB 3R8FA 3MR2A 1KIMA 1O3YA 1ZM9A 2H1LA 4JYBA 1I4DD 3W6OA 4L9SA 3X1ZA 1IONA 1ZETA 1ZQVA 4DSIA 2JLSA 4LJ9A 4OKSA 1QHIA 1RW4A 4UXHA 4R8UA 1U47A 1CKEA 1T3LA 1E79D 2QE7A 1R10A 1TQ6A 1G5RA 4M9ZA 4F5RA 3ZIAA 1J2JA 3QZ8A 3WBJA 2JATA 2BCGY 4MFCA 1CEEA 1E9BA 1JBKA 1GL7A 2CEAA 2FE4A 4ZPXA 1JEEA 1MABB 3VR4A 1O87A 4NCNA 2A5YB 1UF9A 1QHHA 2MAXA 2J1LA 4ON9A 1JALA 2GETA 4I2CA 4Z8XA 2DWPA 3OESA 1N56A 4LHYA 4GZLA 5FTLA 2ALZA 3ECCA 3TNFA 1G3UA 3T15A 1CR4A 1NN3A 4ECVA 2ZRCA 3IHQB 3T5GA 1DELA 3QEAZ 1VG9B 4TMVA 3TR5A 2V3CC 4C30A 3GLGE 1MO4A 5JEEA 1XWIA 1T91A 8ICIA 1YZLA 4QM7A 4K81B 4PQFA 3W6NA 4BLOA 2OM2A 4ZDIA 4TUSA 3HR7A 1J70A 3TR0A 2XY5A 5LPNA 2FU5C 3TMKA 3ZD6A 4NYMR 1R7RA 5FFMA 1DS6A 1WF3A 3QENA 4HAXA 2IHBA 5CIQA 5CM9C 4I28A 5DI9A 3OJSA 3JPNA 1NIJA 2PX0A 5KDLA 2ASJA 1XZQA 4G5OA 5CYPA 2SHKA 3VNUA 1ZQXA 9ICGA 2WSSD 3M4YA 1BIFA 3TAPA 4QW9A 2QSZA 3R9XA 5EE0A 2QA5A 1Z00B 2J59A 2ODBA 3T1VA 2HHUA 3RJIA 3W9YA 4M1OA 5KG2A 1Z8FA 4PSVA 1NG9A 1DG1G 3AVYA 2ZJ8A 1CBUA 1ZQOA 3K9LA 3GV5B 4DSOA 1OFIA 2RGEA 1CS4C 1CP2A 4QGFA 2ODWA 4MUAA 3H7IA 1GNPA 2J3EA 1LVGA 4J0QA 4B47A 9ICUA 5EQTA 3QE9Y 3SJZA 4IDOA 4U7DA 2DB3A 5FUVA 4A0GA 1JR3E 2JJ2A 2QAJA 3KJGA 2ZU0C 1E9SA 3MJHA 4Q47A 1XF9A 4JLKA 4BWMA 1S4QA 5E7IA 3WYGA 1GDDA 1MC8A 1HV8A 2GXUA 3PEVA 5CJ2A 2ERXA 4P4SA 1Z3IX 1J90A 4EEYA 1UM8A 1Z0JA 1LV7A 3W34A 5DB8A 5KT6A 4MA4A 4DL2A 1HE8B 3AF4A 3CIOA 4JLAA 2UVUA 2AKAB 2CHVA 4OK6A 5KHOC 2IUTA 4J9PA 4OK5A 1NJXA 1F2UA 1BMFD 4JLPA 4UNNA 1MQ2A 3JPPA 1AGPA 1SVKA 2V7QD 4DVGA 2FDCA 5A4JA 3TI0A 4M1YA 4QZ8A 4QZIA 1W47A 2BIFA 3AP2A 2FZ4A 3PCRB 4IOMA 1OH6A 2NRXA 1XXHA 3AKYA 3KQKA 1KO4A 1TK8A 1LNZA 4R8UB 2UVVA 4HDQB 4DWJA 4RD4A 3ADDA 1E0AA 1ZQAA 3M9MB 1R8QA 2BCUA 4IQUA 5KFTA 1VYVA 2BBTA 3FVQA 3JZMA 4LRWA 1ZVQA 4QWBA 1TX4B 1G6OA 4ACAA 3RLFA 4DCUA 2JEJA 2C2RA 1Z6XA 5C4MA 4PHPA 2C2DA 1ZIPA 1E9DA 4UB1A 3IHLA 1NLZA 4PC1A 2ZR9A 1ZQWA 1QHHB 3GP8A 4OHYA 4D4KA 2GDJA 4HB4A 3CR8A 4QBIA 5AJVB 2ONJA 5AUPB 4TN1A 3OIUA 3EW9A 3Q8SB 1E9EA 1R2QA 3KJHA 4HI0E 3HPQA 1HH4A 2R6CA 3FPAA 4BLPA 4F50A 1JJ7A 5BXQC 3FHTA 3Q7PA 1G17A 4MRVA 1ZM7A 5FUWA 1KJYA 1NK9A 1E2IA 1MR3F 2D3WA 1VECA 4NDZA 1P9NA 7ICJA 1ZU4A 3RC3A 3RYTC 5K8IA 8ICZA 5C46F 3TH5A 2CCJA 1NBMA 2NO9A 4MRSA 1GKUB 4RQ2A 3RB4A 3A58B 4LOAA 1NMXA 2VHJA 3AVXA 2A7QA 1OJLA 3CONA 4BUJA 3BBPA 3Q8QB 2XGJA 5FBRB 3K70B 4M47A 1KSFX 5GJCA 2AQ4A 4DKXA 3HYTA 4WW0A 1QVRA 1FUUA 1B0UA 3U4QA 1EXMA 3IIKA 1OXXK 3TKLA 5J5CA 2V54A 4NCJA 3GLFA 2ZJ2A 4XQ8A 4R66A 3W8RA 3ZVLA 4RFVA 3UG7A 3FKQA 1BPBA 2IYVA 4V03A 2Q9BA 1Z6TA 3T5HA 3QXJA 4BWYA 3O8CA 3MGCA 1OE0A 2WJYA 2IYZA 3AGPA 2QN6A 3E5HA 5TB5A 1RRGA 3HWTA 4I1VA 2GKSA 2ZRJA 4NMMA 5DG9A 4PZLA 5IINA 2REOA 3PJRA 3CRRA 3LBIA 3U3RA 3WMFA 4RNMA 3Q8XB 4IDHA 3A8TA 4Z6CA 1JXLA 3I61A 1XP8A 4IEIA 2XZOA 2KB0A 1D9DA 5IIIA 3BB3A 4M2YA 2JEFA 1XJQA 3NVAA 3LW8A 5HP4A 4PFSA 4XJXA 2R8HA 4Q1DA 3BWDD 4Q7LA 2BVNA 4OQMA 2WWXA 5D46A 3X1DA 3RJKA 1Z06A 4B2IA 2A5FA 1EFRD 1X6VA 3UWKA 2BM1A 3QKRA 1OFUX 5EE9A 4B34A 4TMZA 5CB1A 2GK7A 1U2RA 9ICOA 1HT2E 3MJRA 5FOSA 3FWYA 1YRBA 2IW3A 5IIOA 4LJ7A 3ISCA 4G01B 1IN6A 2PFNA 5L3RA 1V5WA 4M9XA 3WNDA 5FH9A 3O47A 5KFQA 2ZANA 1ZQCA 2A3RA 2O0KA 3BH6A 4FCVA 3BQ1A 1WQ1R 2WOJA 3FDIA 2HXYA 3KUCA 3TQ1A 5TV2A 3OSNA 2IHMA 5J0WA 5AUNB 1SKRA 1COWD 1Z0AA 2FH5B 3I73A 4B33A 4IRDA 1K6MA 2KBFA 3W6PA 3X1WA 1HA3A 4J9OA 3HR8A 3QKSA 4DLXA 4ERNA 4BEBA 3R20A 3QVVA 1KDPA 3RS7A 3N4MB 4LJAA 4OHXA 3LXRA 2FMPA 1R6BX 2IA5A 3ADBA 4UB4A 3MUFA 1GM5A 2A5JA 1S3SA 1Q12A 3MSXA 3G5UA 4PAQA 1E9FA 2LKDA 5KFGA 5LB2A 7ICRA 2P0EA 4M9LA 5KFEA 221PA 2C28A 2EQBA 1OIXA 3THWA 3CPHA 1A76A 4ARZA 4IXNA 1NVVQ 2ASLA 1KFSA 2NOAA 3I92A 4M4SA 5KNBA 2QE7D 4PZYA 4YR3A 3PR5B 3BGWA 4F91B 2IS2A 2CL0X 3H40A 1NJZA 3TAHA 5FTJA 4LJ5A 3U4QB 3EPKA 4M9JA 3SV4A 4RD2A 1ZD9A 1QRAA 4XSGA 1N0UA 1ODFA 2AK3A 1GVNB 3AUOA 2ZUBA 4P4OA 1ZNYA 1GFIA 2OZEA 3GQCA 4NHOA 2P3SA 4HLCA 4RKFA 2JLUA 1WCNA 4WXPA 1XMVA 4ELTA 2ZRKA 2J0SA 3F3YA 1XWLA 2IWHA 4OI2A 4GLXA 2NZ8A 3CH5A 4XWKA 3I5YA 1YR9A 1BS1A 3PO4A 4XSHA 1SL0A 1S0UA 2QNRA 4RQ6A 1Q1ZA 1RE0A 4O25A 2ZSFA 2XOKD 2C77A 2Z43A 2R8IA 5DBBA 4J9LA 1ZQGA 4I2GA 3K0CA 4LCBA 2DCUA 4JLNA 4GP7A 2GTPA 3GJ8A 2FJUA 2FF7A 1ZD1A 2RH5A 3H84A 5DB6A 4DFMA 3CF0A 2AGPA 4YMVA 4TSFA 1ZQEA 3TQFA 2HT1A 1JB1A 2WIAA 4US1R 5E7MA 4P0TA 3WMEA 3SBDA 1NIPA 1KJWA 1Q3HA 3L8YA 3R7WB 4F5PA 1IAQA 3VR2A 1NMYA 4QGGA 4FI3C 4KLTA 3FMFA 1Z2AA 3QKRB 4B43A 1AM4D 4D81A 2VP6A 5J2KA 1SVSA 4IOKA 4UJ3A 5FUYA 2IUUA 3ONWA 1YKSA 4KLHA 1SGWA 4BFTA 4GMXA 4ZDWA 4D2IA 5KFDA 5EWFA 4K4GA 4M9HA 4DLUA 5D4BA 2G3YA 4F4JA 3LVRE 4J9MA 2BC9A 2XTNA 4DB4A 1H65A 4GI7A 1G4AE 4KN4A 3BERA 2XEXA 3VKWA 2JJ2D 4LYJA 5ANRB 2PZEA 3FTQA 2W2XA 1XU4A 3QKSB 1HY3A 5B30A 4M53A 3MLEA 2BCSA 3AQ4A 3IILA 4L15A 1Z28A 2IXGA 2ZI4A 3CX7A 2BMFA 3A1UA 5KFBA 3N97B 4LZGA 2ZIAA 4O3MA 5C2JB 4TURA 5F9LA 1N6OA 4O5EA 2NO7A 4GBMA 3BJIC 3EAQA 3IIMA 1GRRA 1U45A 4D6PA 1KOFA 1SL1A 3T5KA 4M9NA 2HF9A 5EP4A 2AJQA 2NZJA 2RGBA 1CEZA 2AWOA 4F4YA 2ZE5A 4TMXA 5JRJA 3OGUA 1E9RA 2G77B 1VDZA 2AFHE 4DHEA 4B75A 1EESA 2Q6TA 1CLUA 3RRGA 2R6GA 5HPYB 1TQDA 1U8YA 4UQGA 4LV8B 2MUTB 4R9UC 4QKQA 2JIZA 4FMCF 3U3OA 4GT1A 5C5JA 2CCGA 2QM7A 3V6KA 3PIRA 4PC7A 2ZEJA 1A5TA 3T61A 1UT5A 4UNRA 1FW6A 2PJZA 4EKDA 4ED2A 1KNXA 3G6YA 2GXSA 1G1MA 5G3YA 3L0IB 4CGZA 1ZQTA 4FBTA 4XD7A 4GL2A 4JLJA 4HYYA 9ICRA 4B9TA 2HHSA 4V02A 5JJIA 2PEZA 4LPSA 3LA6A 1ANKA 4CEIA 2FMXA 2Z0MA 5H8WA 5J2IA 5L3QA 1KI3A 1EWRA 4JSYA 1BH2A 4QBHA 1VHLA 1CJVC 3QKTA 4KLZA 1ZU5A 5C4GB 4DUGA 3G6VA 3B2EA 3PG5A 4Q4AA 5H68A 4CEHA 1UA1A 1X9WA 1DAIA 1Q1EA 1S9DA 4Q9HA 5G53C 1P2TA 1CR0A 4YXWA 2QUZA 3KQUA 1ZQFA 3UPQA 2OILA 3MMPA 1NI3A 2HHXA 8ICVA 1E69A 4JJKA 2YOGA 4LZDA 1ZQPA 2GRJA 1TEXA 2VHCA 4UNPA 4LVSA 2BQUA 2QM8A 1S0OA 3HW8A 1SXJD 2OWOA 1FMJA 2ODNA 1RKBA 1OXSC 2G83A 4LJYA 1TADA 2NMVA 4AYWA 4QZDA 1NJWA 4LBZA 2CJWB 3JPQA 4FS1A 4JKYA 4ZCIA 3JPSA 4Q18A 4A0RA 1A2BA 2PLFA 5KU1A 1NVVR 5F9FA 1G3RA 1QDEA 1BVSA 2ZRAA 4F2SA 4IFBA 3UANA 4AIIA 5CA7A 4PANA 2ORIA 3BAFA 1QG4A 4QNMA 1Z47A 4DQPA 1CJTC 1VCIA 2N1BA 1FMLA 1N48A 5CJPA 1E0KA 2G0TA 1KI1A 4DCTA 5HNKA 1NK0A 3MGIA 1Z6YA 1ETUA 3W90A 8ICKA 3QBTA 3GFTA 3T1OA 3MFIA 3OHBA 4B3BA 5JI2E 4TL8A 2OFWA 3AP3A 3RBDA 2J5XA 4NZYA 2DWQA 2BMJA 4KYIB 1P72A 4IKEA 1XTQA 2OXRA 3CB4A 4PTLA 5FOUA 1E79A 2CL7X 3A4LA 4I29A 4Q5IA 4HB0A 3VTKA 3JVUA 1NLYA 4BEJA 1E2FA 8ICXA 3QF4A 5EJEA 4U5XA 4DLWA 1Z5ZA 1RC8A 3Q8MA 4DDWA 3NIBA 1E0JA 1TAUA 5DE3A 5JI3E 1U8AA 5DHAA 1UJ2A 1SXJC 5D3MA 1G3QA 7ICSA 3DKVA 2EVWX 5CK4A 3LBHA 2C9OA 1E2PA 3WYFA 4KXFB 4BRUA 3KXLA 8ICJA 2PCLA 4TYPA 2WWGA 1E96A 2CXXA 1MOZA 4HUQA 3GLIA 4Q8EA 2XAUA 3SEAA 4JMPA 4DWIA 1IY1A 2ZSDA 2ZYWX 3NBFA 5JLJA 4PC6A 5IIKA 4URZR 3T5LA 3U7EB 4Q1AA 4BXOA 2V1UA 1UDWA 3RRZA 1UT8A 4DEZA 3DZ8A 1A1VA 1GOTA 2Z4SA 1SVMA 1VCNA 2A5GA 1T0JB 3UPUA 3NDBB 4YVZA 2QT1A 5DGBA 4XIGS 4K4HA 5BYJA 1N6RA 7ICVA 4TWZA 4PQRA 5L3QB 4RUAA 3B5JA 1X9MA 2FSGA 3MDAA 4Q9KA 4XUSA 1MO6A 4KHZA 5GJVC 4Q4AB 4JLMA 4CEHB 4DLZA 2ZI7A 1JECA 1WDTA 1JX4A 2X2FA 2CVHA 4KU4A 2W00A 3OE7D 2WJVA 3ND8A 1NVUQ 4PR0A 3V7LA 4UAZA 1C1YA 1E2NA 4P33A 5KFCA 1CR1A 1GZSA 3FMOB 4O0IA 2IXFA 3PUWA 3AKDA 1FUKA 2QRZA 3IPYA 4N0DA 4QC2A 4PX9A 4A6XA 5EWGA 5LD2C 2ASDA 3W5IA 3UIEA 4Q4JA 3ZDBA 1DO0A 4LBYA 4LC1A 2H8KA 4BLSA 1LW7A 1YZTA 3TFSA 4IR9A 1II9A 2EWWA 2KWIA 1UPTA 2ZRIA 8ICYA 3NG1A 2KBEA 4DBLC 2XNSA 4CCHA 1GL6A 1W36D 1RIFA 3ADKA 2OBMA 4G1UC 1HT1E 4TL6A 3QOFA 3AKCA 3V00A 1LB2B 4J9SA 5EXTA 1IY2A 2OO7A 1EXNA 3KHRA 1FFHA 1ZUNB 2J9RA 2V7QA 4AK9A 2QTFA 4EPWA 2H57A 1DAFA 2OEPA 2R6AA 4TSFD 5A0FA 3U7FB 1CRPA 5C18A 4G0NA 4DZZA 3CPEA 4DSLA 3GLIE 1XX6A 1NKEA 2WJJA 3QF4B 2IS6A 4FO6A 4Q45A 2VL7A 2VSOA 5G41A 4UXIA 2QTVB 1LS1A 9ICWA 1SZPA 1OHHA 2RGXA 3NC0C 2WHXA 2WSMA 3CF6R 3CLVA 1NMZA 4BZQA 2DPIA 2KE5A 4AY2A 4DL4A 1NL3A 2JEOA 4JVSB 5D3MB 3ZVMA 2WVJA 2RB4A 3U3KA 3EPJA 4NYMQ 4DEXA 1F5NA 4HUQB 3G6XA 3GLIB 5DB9A 3C14C 1UA0A 1ZJ6A 3CH4B 3LBNA 4B9NA 1ZQLA 1JEDA 3NHBA 4U00A 5F3WB 3X1XA 3N2IA 3HP6A 2ZJAA 4BXOB 2XC9A 2FLPA 2CLDX 1W36C 8ICLA 3IDQA 3PUYA 2O8EA 4R71A 5IILA 4O9MA 4H1UA 3THYB 2H7VA 3IEUA 5BPCA 4EBEA 2A5DA 3TUJC 3K0CC 4Q03A 4EIWA 1KHTA 1AS0A 1MT0A 2BEJA 3EZ6A 2GEDA 5KT5A 3TBKA 4IOJA 4ZIRA 4QZCA 1PLKA 1LY1A 2V4RA 1ZD8A 3PMNA 2D06A 3P4YA 1GNRA 5J0TA 1SVIA 4Q66C 5BN4A 2KZZA 4JL5A 3SQWA 3MWLA 4TQSA 3DMDA 2J6TA 1NJFA 4X8LA 9ICQA 2WTUA 3A4MA 3TSOA 4I1SA 3TAQA 3ZZ0A 4EUNA 1D2NA 1S1CA 2HVHA 1GIAA 4HAVA 2N42A 4YG2A 5UKDA 5E4FA 2B8WA 3THXB 2IHNA 1IXRC 3RS4A 3U6BA 2GK6A 2IYSA 4Q4JB 5DQHA 2WICA 5JS7A 4YMUA 2ZETA 1XD8A 2GJAA 2QMUA 5TMPA 1OXTA 2PFQA 2QG6A 1EFUA 4OHZA 3GEHA 3SYKA 1ZINA 1MO3A 4DLEA 1TFRA 4NLGA 1N6PA 2MSDB 3SZ2A 3IGFA 3IHWA 3WRXC 4O3OA 4PPXA 1T5IA 5HCIA 5JWRA 1W7AA 3QNUA 2ZJZA 2C04A 4OQXA 5K8LA 1YR6A 4X8MA 2BKUA 5FBLB 4AURA 3WHLA 4DLSA 3RH5A 1KK3A 3I8XA 1G8GA 3C41J 4LHWA 1EFRA 4DUGD 4KV9A 2XSZA 1GILA 2AHOA 2C78A 1GUAA 1D9XA 2BHRA 3WBKA 1S10A 4N1AA 4IFEA 1LFDB 3RJGA 8ICPA 2WV9A 1FX0A 3KZ1E 3KJIA 2IYQA 1Q57A 2WWIA 8ICEA 3IPXA 1KKLA 2R6FA 1K1SA 3KTQA 1CJUC 4IHQA 5DNYB 1COWA 3SE0A 3U3MA 5JMTA 4HAYA 1PLLA 3LWLA 7ICMA 3AVPA 5FTMA 1YR8A 5L8VA 1KMQA 5TZVA 2WIBA 4TL7A 4A36A 1S2MA 1Z3EB 1XSNA 1D6JA 4NU0A 1SVWA 2V4QA 1TEVA 1WE2A 2JLYA 1W1WA 1Z07A 4MH0R 4KI0A 1TUIA 2A2ZA 4RZXA 4DSFA 3VX3A 2I1QA 3GDXA 4Q8FA 2QMEA 3AVQA 2J41A 5DH9A 1T0HB 1OKKD 2O8EB 3KKOA 2EFCB 4LBVA 2IS4A 4A4DA 1W49A 1KK2A 2AL7A 3K0AB 4F4WA 1N6LA 2CNWD 2EW1A 2LWIA 1CTQA 1XTRA 3B7GA 4ZIRB 4UB5A 1CJKC 1FP7A 4B3GA 4HZUB 1SKQA 3ISDA 2IK8A 2UZIR 5FBWB 3QXSA 2ODEA 1G7CA 3BOSA 3VHXA 4QZFA 5B64A 5C1BA 2HHTA 4AKIA 4KBGA 1WCV1 5H70A 2OLJA 4CVNA 1NN1A 1US8A 4FMCB 5GVSA 9ICCA 1K8RA 4J9RA 1ZQRA 1A4RA 1FTSA 4XRHA 1EX6A 1KDOA 2FSIA 3LLMA 3S1AA 2V9PA 4MF2A 3BH0A 1KRPA 4GOXA 1KFDA 2IBKA 3VU9A 3JZAA 1VTKA 1IN8A 1XD2B 3KB2A 4B3CA 4B44A 5KG3A 4D4MA 5KFPA 3D8BA 1Z08A 1XEXA 2GVDC 3GEEA 3H8SA 9ICKA 2JA1A 1VCOA 4ZI3A 1SL2A 2FFHA 1AS3A 3BS4A 4HUTA 1Y3AA 3RJHA 5L9XA 1ZM4A 2XOKA 3C5CA 4RT3A 4PHHA 3WHKA 3IO3A 3BORA 1R0WA 3MBYA 2AX4A 2BDPA 2WKRA 4I2DA 1YHNA 3B78A 2ZRNA 3B0XA 3ZQJA 4TTPA 1L3SA 5DB7A 8ICBA 1XS9D 3EIHA 4OJKA 3RWOA 3PUXA 4FD2A 1QVAA 2GJSA 3AM1A 5KFZA 3ZH9B 2YZ2A 4B9UA 4MFFA 4AYTA 3Q3JB 1P9RA 2AU0A 1XNJA 1PZNA 4JVMA 1RZ3A 1ZYQA 5FTNA 4RU9A 1GP2A 1JPJA 1ZQKA 2Q0HA 3NWJA 3Q5DA 4B2LA 1G7SA 2B7CA 2OV2A 4ELUA 2IUSA 2X19A 4QJ4A 2VP4A 4TTRA 3GIJA 3JVVA 4WOPA 1AS2A 2XTMA 2WPDA 4EAQA 4MFAA 2CVFA 3SYZA 2FPMA 2DFLA 4GXIA 1RZTA 1N5JA 2JCSA 4BE7B 4C2TA 1OYWA 2YYZA 4BDPA 1KSGA 2YWEA 2VANA 3H8WA 4XA5A 3RH4A 1P73A 2OAQ1 1E1QD 4AI6A 4BFSA 3T34A 3I3SR 2JEGA 1KO8A 2IWRA 1Q3TA 4UB2A 2DWOA 9ICNA 2F1IA 1U94A 1UKVY 5CB8A 4KJZA 5KFLA 1AJEA 4D26A 1OLOA 4CZ2A 3LH5A 5JRZA 2QAGA 3GCGA 4JKIA 4TLBA 2WWYA 1VCMA 1NVWQ 3QE0A 1S77D 4F8RA 4YMOA 1P62B 3I8SA 4JVLA 1E2GA 4LI0A 1TTTA 1KEJA 3BE4A 3PY8A 3QQ5A 4DQQA 5EOZA 2FWRA 4QZEA 4RZ3A 4FWTA 5LDDC 4RPXA 3ORYA 3GLHA 3HDTA 4A0FA 3T3FA 1J8YF 3LWNA 1ZNXA 4LK2A 5AUOB 2O8FA 3K0EA 3PR4A 4LV6A 2GWSA 1T3HA 6Q21A 9ICLA 2ZSEA 4KLFA 3KHGA 5E3HA 4QWEA 1AROP 5H1YA 4KLUA 1DE0A 4C2UA 2QMHA 1VMAA 5KUTA 3TSWA 2W9BA 4Q9LA 4ACBA 1JJVA 1US8B 4DLGA 3QPUA 1D5CA 1OHHD 1S96A 3HU3A 4YDHB 1KDHA 4HSEA 5JWHA 5CK5A 2ZRDA 3I4LA 4B3FX 3OJUA 2IXEA 1G64A 5EUMA 3R9WA 1PUIA 1HQYE 1DTSA 4FW9A 5DQGA 4IJMA 4LZZA 1Z22A 4DQSA 4JL8A 5J2EA 1XEXB 4ECYA 4LGMA 1XCGB 5G40A 1T4GA 4I99A 2PL3A 1ZQQA 2V55B 4PPNA 3NEYA 1TL7C 2BWJA 3L43A 4FINA 4JVNA 4Q48A 1KK0A 3CR7A 4C3ZA 4D80A 1AA9A 1G16A 4HDCA 2REXB 5FPHA 4MDEA 1ZUIA 4B9LA 3U2QA 2WTFA 2JLWA 3KTAA 4HZIA 3Q8RB 1SKSA 4LHZA 3OHMA 4IOLA 3EZ9A 2O5VA 3QJYA 4R98A 2B8TA 2IF0A 1TKDA 4FS2A 3IO5A 4RVCA 7ICKA 2ZRBA 4P4TA 1NSTA 2E9SA 2R9VA 3UQ2A 2RGAA 5KNDA 2Q21A 1IJFA 1EX7A 1X1RA 4ED7A 5KG0A 2BMDA 2E1RA 2ZJBA 5L1KA 2GXQA 2V6IA 5EZ6B 1SXJA 3PW7A 3CZQA 3K9NA 3Q7QA 1DVRA 5EE5B 3KKMA 7ICPA 1BKDR 5EE1A 3SC3A 4PGQA 3UMFA 1D8YA 2DR3A 3EIEA 3K75D 4HAUA 1F3OA 2GNOA 3A1SA 5EP2A 3RJEA 4WXRA 4IVQA 1XTIA 5J0SA 4RZ2A 1XPUA 4LYHA 2F1RA 2QU8A 2F55A 4MQBA 4MRPA 2P6NA 5FOWA 3KB1A 1AN0A 1XPRA 2GAOA 4TLCA 2JEIA 3PR1A 2IT1A 2P65A 3A4NA 3GIKA 3PX0A 3GLHE 7ICEA 2XJ4A 2PCJA 3CRQA 2J7PD 3FHOA 3OEHA 2W6JA 1XXHE 1W2HA 1E2JA 1GSIA 4NXZA 5FR2A 4P4SB 1WA5A 4BQSA 1FNNA 2WMNB 4B2PA 3A36A 4IDNA 4IVRA 7ICLA 1CU1A 1YRAA 2PH1A 1TAGA 1ZM2A 2ZAMA 3DM9B 4DOBA 1R0YA 1F2UB 4G5RA 4NCHA 4GC6A 3PX4A 3AF1A 2BEKA 4S2EA 3L82B 3GLHB 4QHTA 5KFOA 1UBGA 4A2PA 1KTVA 4DSTA 3CNOA 5KFSA 1XXHB 4NBSA 1ZC4A 4PAOA 2XSZD 3DPUA 8ICNA 1G7TA 4V0KA 2W2TA 4A8JA 7ICGA 2QL6A 1L7VC 2Q0ZX 5J4KA 1AKEA 2J45A 5DG7A 1D8TA 8ICMA 3E2EA 2W9BB 1DG3A 5J0QA 4PGXA 4ZV4A 3JPRA 5L1IA 1ESMA 1Q0UA 4Q1BA 4AKEA 3RABA 2ZRGA 4F2RA 5BN5A 1ZCBA 4QJ3A 3H8JA 3A1TA 4IEEA 4G5GA 4DFJA 2FLNA 2VO1A 2VF8A 1NBME 2IYRA 3DOFA 1GKYA 3TSZA 2FN4A 1JXOA 2R2AA 1YR7A 1KI2A 1TV9A 2OG2A 1DOQA 4DOAA 4NE2A 1DBSA 8ICAA 3BH7A 3AU2A 1QSYA 1SXJE 4HAWA 4JIMA 4OQLA 3X2SA 2PZFA
chains in the Genus database with same CATH superfamily
1L3VA 4HAZA 3BWBA 4M1TA 3KT8A 3GJSA 2PI4A 4B6SA 1WPGA 4YLGA 3OE7A 2ATLA 3KFXA 1YQQA 3BMNB 3E3NA 3FFBA 3TB6A 3H42B 1A96A 3H9QA 4IS3A 2KHVA 2MYUA 1L5HA 4L4ZA 2A1JA 4ZQGA 1R12A 1HX7A 2IDMA 4NYIQ 4PNZA 4L5JA 3QE2A 3U19A 1NKSA 4FIZA 2NADA 2GSDA 3AL3A 3BKXA 2IXAA 2V6GA 4WIAA 3Q9UA 4L73A 1QK3A 3CF2A 5GTDA 1EFLA 4R3WA 1E2KA 3EEIA 5BQOA 4JJ6A 2CUTA 3GRZA 2QP3A 3WNBA 3THWB 1SUDA 3NTUA 2AFIE 2Y9TA 1KO7A 2VBIA 3V2UA 2FW9A 3RFTA 1KF0A 5CM2Z 3G0GA 2ZVPX 5K9ZA 3LOQA 1LC3A 3EXG1 3C3PA 3UKDA 4FCTA 4RD6A 3ANXA 5CT5A 5BN3B 5JE8A 1BNOA 4NSNA 3ESRA 3GLVA 1OWPA 2D1QA 4J0CA 2PMWB 5DLQC 1OI4A 3AEZA 1QFZA 1ZCAA 4M8IA 1MQ3A 2NNWB 2HMVA 4WNAA 2WSBA 4JQCA 2F67A 4MQLA 1Z7WA 2O8BA 3IR6A 1ZITA 2CNWA 2VF2A 3OCVA 2XOXA 3H6HA 4LF9B 2WG2A 4AVYA 4B7XA 4OP3A 2JIDA 1A88A 2GRAA 3UQ0A 1QORA 4F3CA 2WAOA 3BB4A 5C51B 3Q87B 1F7UA 2IS1A 4JXXA 1PJQA 4C7YA 4HWGA 4QSMA 3ZZUA 1WXIA 4JEUA 3ZBUA 5DHQA 3VU1A 2I2WA 3L4BC 5BYAA 1VGRA 2JBAB 5IM4A 5BNIA 3OAAA 5C8DA 4CEIB 3F2IA 3COSA 2B4YA 1WMBA 1XJWA 4QUHA 4RMGA 2C5HA 1SCQA 5LCXA 5BWCA 3JATA 4PXAA 1F5SA 2EZTA 4LHXA 5AVTA 3ETLA 5D00A 4AMZA 1GCGA 3DQQA 3IDWA 4EECA 4LN1A 1FVXA 2OHVA 4BWGA 2Y8EA 2YVUA 4CCYA 4M0AA 2IZ0A 3BF7A 5INTA 1T2DA 3CLSD 1I36A 4WJ3B 3L02A 4B1FA 4XM2A 4R0NA 2YV3A 1MT3A 1SV0C 1DBVO 4ECSA 3QVSA 1AQNA 3D6AA 1Y8AA 1LLUA 1C7QA 3BYZA 1K4MA 2QORA 4FBUA 1SC3A 5LC1A 3V8NA 1RI4A 5BMVF 2QTLA 1KEEA 4PICA 1T9GS 1GNQA 1L1FA 5A71A 1K8YB 2RG7A 3FI0A 1NZBA 5HS6A 5DDMA 3ZHXA 3RE1A 4OFBA 4UUPA 5DNCA 3HWX1 2CK3D 4Y0NA 3CUWA 4MAFA 1GXSB 3ELUA 1H1TA 3IVRA 4IUYA 3KT0A 5T8KA 3WNZA 2ZB7A 1L3TA 4M9CA 2W8LA 5F3XB 3DMHA 3G0HA 2FDRA 3EUAA 5KFNA 5LDGA 2AD1A 2LKCA 1GYRA 3KPWA 2H7XA 1YKGA 4KFSA 4V24A 3NBQA 4C2BA 4L6CA 1I24A 1UXJA 2WK1A 5A0LA 3GFPA 5L6MB 2GAFA 2XUOA 3V8QA 2YTUA 4EQZA 1CCWA 3JQPA 4S0XA 2QW1A 3Q8PB 5FQOA 3DL4A 4J0EA 1YVEI 1G19A 3LDAA 3IP9A 1U8UA 3DFIA 5KSOA 1S9FA 4AMBA 1H8ED 3ERCA 1GITA 3FMGA 5IVHA 1KYXA 3K94A 4HH4A 4OAOA 3WGTA 3OAAD 3C1TA 1QIIA 4HZGA 1UADA 4KR0A 3AESA 3DJYA 2COUA 4JBGA 2A0KA 4WL0A 1MEOA 4UBJA 5J4YA 1IBRA 5IT0A 3DA8A 4MO9A 3B7PA 1KAEA 3DZKA 1XVTA 4C8KA 1UK9A 4DL6A 4UNQA 1WHTA 4Y18A 2PSEA 3OWHA 1WP9A 7ICIA 2WAYA 4QG7A 1POWA 2I0FA 3DUFB 3T7DA 4P0PA 1PBTA 4A6DA 2ABWA 3KLOA 4J9KA 4B2YA 1A0PA 3JQ7B 2L19A 3MWKA 4ZOBA 4F4XA 3ADCA 5JNTA 4YH1A 3OEED 2DKXA 1KR2A 3K6SB 3WMGA 3OZIA 3VZQA 3EOBI 2K60A 3VC7A 3ZDXB 2WPNA 5KTOA 1R5NA 5CFRA 4G25A 4EG6A 1O94C 4W5TA 3ZOZA 2VYQA 5AOBA 1QIEA 2DPLA 2BFPA 1SBYA 4A0QA 1HUZA 2ZR8A 2ZYUX 3AKEA 1NULA 3ETEA 1T4CB 3ZI0A 1JHAA 2FEXA 7MHTA 4BQFA 2XRZA 3WB9A 1U5BB 1XEFA 2C31A 4IV0A 3BK1A 3KDPA 3OX4A 4Q39A 5DCYA 1C3OA 4NF2A 4IILA 5IYZB 1OZGA 3LA8A 1BG6A 1J42A 4YRZA 4WWHA 1FL9A 4OBWA 3BCRA 3GLSA 3LK6A 4UTVA 1QOPB 1Q7EA 5JZBA 3PDJA 2AOVA 1JU4A 3KQPA 2DM6A 4L3VA 4ENWA 1KI9A 3W5DA 1UIMA 4HP8A 2WYOA 4Z7OB 4WRRA 3UKOA 4XQCA 2R8RA 3I0ZA 1B16A 1L3CA 4YJ3A 3K70D 1R4MA 3JQQA 4GEGA 3D3QA 4GZMA 3SX4A 4DLTA 5AVSA 1DPFA 4W1QA 2AQIA 2QZZA 4DZRA 1GPDG 3E6AA 2I2CA 1I5EA 3AI2A 1QGOA 2BCEA 1FJGB 1VL2A 4YI3A 1CS0B 3JWJA 3IAM6 3STWA 2H17A 1P5ZB 3CX8A 2JZCA 3JD1A 1TAQA 4BNZA 4IJQA 1S0NA 3AFNA 2QVYX 3E7PA 4RHXA 3PYLA 1BN6A 3P2JA 5ELXA 5J29A 1TFUA 1YQXA 4PYRA 1QH1A 5AESA 2ATEA 4EPVA 4BJHB 3VMMA 4FSDA 4Y6GB 2RHRA 2ZXHA 2Q1UA 3HS3A 3PFFA 1XAIA 4IIUA 3ZHOA 1OV4A 1XLTA 5J0RA 3DEJA 3E1SA 4RDXA 2QB0B 3IQEA 1Y37A 3VYSB 3I05A 4ZCPA 4JXJA 2D2IA 3T5TA 4KL8S 1I2MA 1UT6A 4IIVA 1LVUA 5IT9A 4NICA 2FZCA 3BS5A 3AHCA 1L4HA 2WIFA 2FE9A 2H4WA 3NM6B 4P7KA 1HUQA 5IKXA 3UJ7A 5IUJC 4OFXA 4ED0A 1IK4A 1L5NA 1BMTA 4FN5A 2OO5A 2R0QC 2HBJA 4PHTA 3UWDA 3UAYA 5T57A 4K9KA 5IFLA 1C1DB 1KAHA 1RAAA 3HYNA 4YMIA 4NL9A 2YL2A 1XTZA 3W5AA 2IXDA 3HNPA 4M04A 3CNBA 2FR0A 2DR0A 1Y33E 4PHFA 3IXLA 5EWJA 4N4AA 2ZITA 2L17A 1L5FA 3OF3A 1TIPA 1XALA 3HCBA 4KMMA 4ZO8A 2C3MA 2P9FA 5B3AA 3OHPA 2HHVA 1SUCA 3MT8A 4UQLA 5HK9A 5J4HA 3ZNOA 4D8VA 5B36A 4D02A 1HF3A 4JLOA 5AVJA 1UBOS 1NQUA 4XW2A 2PKRA 4F72A 5EJGA 3N0TA 2J3KA 5LFAA 3H04A 2PD3A 4DLVA 1SHTX 1XZIA 3EPIA 4KITB 2PNFA 3NATA 3GUCA 3VNRA 5IJZA 4CL3A 4MA5A 2Q9CA 4CM6A 3ZGOA 5K3OA 1NOKA 2FQYA 2Y99A 1NJYA 2XWPA 4MUHA 4GC7A 4B3DA 2QYSA 2FEKA 2GJKA 4DOCA 4KN7A 1WV0A 4KFCA 1VE9A 2H65A 2WKQA 1ISFA 5E95A 3IXMA 2XQFA 1KYQA 3JAKA 4BP1A 2ZBFA 4OOFA 3ICOA 2AEJA 4FONA 1HOXA 3D4LA 1PVVA 3L49A 5FLXA 4I9GA 2CEAA 4UVEA 4ZPXA 3TKAA 3ED1A 2GZ1A 2QW0X 3OOHA 3TL6A 3QEAZ 1VG9B 3TR5A 1KVTA 1UBSB 3GDWA 3ZKWA 1UJ5A 2OM2A 4AIRA 2XVMA 4NYMR 5FFMA 1PFUA 3QKWA 2IHBA 4BVHA 1QLWA 5BN1A 5AW2A 4YJ2A 3TAPA 3IG5A 3B3GA 4TV9A 3DD5A 3BWYA 2P9QA 4BE4A 4G37A 1YBHA 1GGKA 2J3EA 4GMFA 3E4DA 2ZBVA 3FVTA 3PWKA 1ONOA 1BKSB 2R1VA 2A33A 1J90A 3RTDA 3OZEA 3N8KA 2KK0A 3MERA 2LKYA 1MQ2A 1SVKA 4DVGA 4M1YA 1UWVA 2LHTA 4JSRA 1V96A 4I9FA 4RWEA 2BBTA 2XT6A 2F3SA 3GU3A 2E7ZA 4RV4A 4X3PA 1ZIPA 3GDGA 1NW9B 2KJ8A 5AUPB 1OX4B 2D1TA 5FUWA 1P91A 4TUYB 1MR3F 4NDZA 1VECA 2Y76A 5CAEA 1LQ2A 3SHOA 4K3VA 3AVXA 1C9NA 1QVRA 2M6SA 1B0UA 1HQKA 3AW9A 3BMNA 1ZXXA 3HG7A 2VBFA 4F8YA 2ZYAA 4RFVA 8ADHA 5AM4A 2C4TA 1Z6TA 3K1AB 5E1OA 4FJ0A 2WJYA 4WSOA 2M32A 1QO0A 4CL2A 3UFXB 1WEKA 5CNIA 4WASA 2A7XA 4Q1DA 3MIIA 1D1QA 4KP7A 1VE7A 1ZHHA 2HU8A 3UK0A 1ZQCA 3K72B 1VKHA 1HG0A 4UATA 2H2AA 2X4DA 1TEZA 2JB9A 1Y7LA 4O33A 2JPDA 4HH3C 3TADA 3GN2A 3HBMA 3DZHA 2VF4X 3FCOA 4M9LA 5KFEA 3THWA 2M6KA 2IITA 5KNBA 3PC7A 1NP7A 3NDIA 4V1CA 1ZD9A 1ODFA 4RKFA 5DHRA 4KMRA 4OI2A 4XWKA 1BS1A 1G5IA 2R8IA 4Y9UA 2QARB 2IYOA 1BCRA 1GSOA 3ZLVA 3HVKA 1XCOA 3RM3A 2HT1A 3ZK8A 3WMEA 1NMYA 4LTDA 1U8FO 3V4OA 1KQ3A 4OV6B 1L5LA 5KFDA 1T36A 3DOHA 3F9CA 4E3WA 5DRTA 4LYJA 2PZEA 2W2XA 4XRGA 2UUBB 2WA1A 4L74A 4UULA 1TK9A 2I8LA 1ORTA 2OUIA 2L69A 5DULA 4OIFA 1AB5A 1QAQA 4D6PA 3KZNA 5JAHA 3QNMA 2YQ5A 1TQDA 3V1MA 4UNRA 1FW6A 5GZ6A 2ZEJA 4ED2A 4HRAA 3L0IB 4JJEA 4QTXA 3FTFA 4JROA 4MVJA 2JBAA 3TKYA 5LLTA 3A2NA 4CEIA 2FMXA 1KQPA 4DCMA 3OPMA 2WAMA 3KQUA 2WUGA 4Y2VA 2I8CA 3JZDA 2HSEA 1H9BA 1RMTA 4TT8A 4HD8A 3IESA 2EJWA 1H6CA 4JI6B 2DT5A 5CA7A 1CJTC 1JG1A 4BMXA 1NK0A 3FZGA 5JI2E 1QRUA 5K4HA 3I04M 4FR0A 5JIBA 1C3EA 2NZXA 3JASA 4X6LA 2PFSA 3KE8A 4YP0A 3DLTA 4DLWA 3KVYA 3FDZA 1M0SA 4YUVA 4HUQA 4RENA 3GLIA 4Q8EA 2XAUA 3NGMA 2IYNA 2V1UA 1Z4NA 3AIOA 1Z2PX 2PL1A 1GOTA 4MA0A 4TKLA 1R15A 1DKQA 3B5JA 1W29A 1NVFA 1JZQA 2X2FA 4PR0A 5JASA 1CR1A 3IP6A 5EWGA 3AFGA 2YMPA 2FSVC 1DO0A 3QMVA 5K6TA 1M2GA 3OUTA 4OO1J 1HT1E 3P2EA 5M34A 4U6QA 1UDBA 3SXPA 4RJTA 1HOTA 2H57A 4QU0A 5I5EA 1M67A 4MW9A 2SKCA 1N2EA 1WG8A 2G5CA 2NYVA 3NC0C 2WHXA 3PNBA 4BUCA 5D5PA 3EPJA 1QQ5A 5EHNA 5DB9A 1C0PA 1ZJ6A 4WBNA 2F64A 4BMNA 5AI9A 2VR1A 2H7VA 3KLBA 1AG9A 1MT0A 1LY1A 4KQ9A 3DCJA 3K2QA 3KJNA 5CVVA 3EEBA 2RHLA 2AUNA 1M0EA 4I1SA 3ZZ0A 4GPEA 1YRHA 2JK0A 3O3CA 2IHNA 4QFCA 5ABPA 3RS4A 3WLEA 3L3FX 5EZSA 2BEVB 1N6PA 3E15A 3ENKA 1KJNA 4B7UA 1KK3A 2QJRA 1CY8A 2P9BA 4CWAA 1LLFA 3RYCB 4RK6A 4E1AA 4M7OA 3T4XA 5CNMA 4BN4A 3LHDA 2AMVA 4QYXA 1YR8A 4MUGA 5CLHA 3W06A 4N9WA 4D3YA 3GLKA 1VLVA 3GDXA 2O8EB 4KK3A 4KKVA 2P7IA 3QLUC 3M6KA 4YP6A 3KK0A 3FRIA 3FYUC 1C80A 4P80A 4KBGA 1NN1A 2K8AA 5K20A 2FWNA 4GZ6A 2GD2A 1PBNA 1XJ5A 1L5ZA 2KQUA 4RGYA 5T41A 1IUNA 3F47A 5ARDA 4FR5A 1ZIYA 1GNSA 2ZJ0A 5LZ8A 1R0WA 4LG1A 4I2DA 1Z5NA 1PZEA 2WNIA 5EJ4A 3EIHA 3EXEB 4OJKA 2VCEA 1YI1A 1DQRA 2BLLA 5FPQA 5F23A 2J31A 1JPJA 3EGEA 3NWJA 2GTHA 5B6PA 3NRZA 3GIJA 1T2FA 4R5HA 5E0OA 3ELYA 3PGMA 3HB9A 3EGVA 3RH4A 1TEHA 3WB0A 2NXWA 3I9V6 4EVSA 2DWOA 2FETA 5HK8A 4CZ2A 1D6NA 2AC4A 4YMOA 1N4DA 3I8SA 3N0RA 3M89A 2FWRA 5K1ZA 1X42A 5E3HA 1AROP 5H1YA 1HRKA 1S96A 1JP7A 5CK5A 4RTSA 3F7NA 4KQCA 4LZZA 5DNUA 1U5BA 4Q48A 4LC9A 3U1TA 1LDMA 4IOLA 4YCLA 4OP2A 3MT7A 4YIKA 5EZ6B 4TV8B 4D0SA 4Y2SA 7ICPA 1CFZA 3TSYA 1DMRA 3RJEA 4WXRA 3CCFA 3A4NA 3DBIA 3GVHA 2QRVB 2J7PD 5JISA 5J8YA 1FNNA 4P38A 1Z8NA 1ABFA 3DM9B 4G5RA 4XX0A 4NWIA 4ZQBA 5E1MA 5DGIA 2Q5LA 4YT5A 2VDNB 4QPPA 2Q5IA 2W2TA 3QX8A 1KVUA 3NKFA 4CKZA 4PGXA 2AJCA 5BN5A 3H8JA 1J0XO 4P84A 4R51A 4G81A 4D43A 4FYJA 4MP3A 3NHUA 4TOIA 3N28A 1SXJE 4HAWA 2OL4A 3X2SA 1JE1A 4XX1A 3M83A 1H85A 2NPIA 3FMVA 4CV1A 1TMKA 2QJWA 4F8EA 2JIBA 2P9JA 3LT4A 1UKCA 3TLCA 3RSFA 3OF2A 4GX1A 4JYMA 4RIFA 4EW2A 1GD1O 1SV4A 2NPFA 3U4DA 4ED6A 5FUBA 4ENUA 4RJLA 2YRXA 2AKEA 3LK7A 2WJ4A 4LWPA 3I9JA 1O4WA 3M9XA 1VG0B 3HPRA 3QEJA 2QI9C 3KFUF 2W8KA 2BBOA 4ONEA 1UQRA 3ONFA 2HCTA 3D0RA 2PBZA 3FOBA 5KFKA 1KEPA 5K0LA 3RC2A 3CWZA 2D7CA 3RQIA 1PZMA 4MUMA 1JHZA 1M5RA 4P6VF 1H0RA 3B3JA 2OCAA 4DN6A 1L5YA 1DC8A 4MGZR 1MDFA 4O3FA 3Q9LA 3MJDA 2OCBA 2BCJQ 2I4RA 4GLJA 5FO0A 2ZBRA 3DYVA 4XUGB 1W36B 1Q95A 2C95A 3AX6A 1IBKB 4ARAA 1K5GA 1I9GA 4NBLA 3NGDA 1BRTA 3V7NA 3LUBA 2JDIA 4GGMX 2BV3A 4QYMA 1EUQA 3DVAA 1IPHA 1C1DA 1R0ZA 5AK5A 4FQ5A 3RVBA 5CG1A 1VZ3A 4YMWA 3FPEA 1VFPA 1D03A 3DTTA 4Z99A 4ZH4A 4XUDA 3HCOA 2XBUA 3IE0A 3HR4A 2EDUA 1GQ2A 2AG8A 1NONA 3HJAA 4MGYR 1BYUA 1T6BY 4NOLA 3N6RA 1GDHA 3QVUA 3OTHA 4BBJA 4UFNA 3BT7A 4RZSA 1D2RA 4QXAA 2ZI6A 4DMRA 3ABZA 2YUIA 3GJ7A 2VEDA 1JLHA 1T13A 4QJBA 3SM3A 1MSWD 5I4CA 2P6OA 3B48A 3T3EA 3UPTA 3WKCA 5AUQA 1HK7A 4PO1A 3G2LA 1IBCA 1VJ1A 4TMFA 1BSVA 3H17A 4NBWA 2O2EA 1RQRA 5LB4A 4HGOA 3JYLA 1QZUA 2O8BB 3H2SA 3X3HA 4DR2B 2W5UA 1XAGA 2HREA 4E5MA 3E84A 1S2GA 1VL0A 5JAIA 4C0AC 2I66A 2HRZA 4LSMA 3RH0A 1BJKA 4OQ4A 3G13A 3WGUA 4OJ5A 4I8IA 2J87A 4H0CA 1BYIA 2WUWE 3FZQA 1RPLA 5KWSA 4GMHA 4QWAA 4OXNA 1Q91A 3WKBA 4W9NA 1VIVA 3IVMA 4PSUA 4M86A 5EUQB 1FTNA 4XWOA 5CEFA 1UXHA 1SZHA 5BYKA 2F3TA 1KA9H 5IEBA 3JATB 3WDSA 1BPEA 4MWOA 3PO5A 2GERA 2HMWA 3JQRA 1M7GA 4J7UA 1Y8RA 3W8EA 4EYOA 1CQPA 2Q29A 2QMYA 1ZQIA 5BPFA 4EKYA 1CRWG 1USGA 2UZ3A 4DQUA 1L4YA 4D98A 2JDID 5C1PA 1V37A 3W5VA 4AC9A 3IQWA 3AUXA 1XP5A 4QELA 1LVHA 1E7RA 3LY8A 3WJ7A 1F4VA 3T3HA 1I7PA 4ZA2A 2HOFA 3ENQA 2ZM5A 1KEEB 3DM5A 3PUZA 4GL4A 2OBBA 3PTLA 5KVVA 3IMKA 5DCLA 2WC1A 3D64A 1W4RA 5DN6A 4WKCA 3KOYA 2PL9A 4FDVA 3PHLA 3TFWA 4DARA 4TXMA 1TLFA 4DXDA 2JW5A 4JT4A 2HXGA 3RB0A 1IB6A 3L7NA 2VYNA 3GFOA 4G1FA 3UHPA 2JCBA 4M8NE 3LF2A 1KNQA 4OIMA 3SIWA 3V34A 1OX4A 1O6ZA 4V0LA 3H0LB 3ZIUA 1GQQA 3HGQA 3CUEF 1CZHA 4E09A 2PVSA 4YP3A 3F6EX 3DE3X 3PHIA 2LGJA 2GCOA 4LQLA 2G7MC 2KEYA 1H2BA 1DRWA 3P96A 4P81A 2FMFA 3F97A 4YPOA 1XTJA 2DGZA 1F8UA 3UFXA 4Y1FA 3U3DA 4V1CI 1P6UA 4X8HA 1LI4A 3S1AB 1JJBA 2JI6A 3UUFA 2WI8A 3E8SA 2BHTA 4DDHA 1ZX1A 1XYYA 4O2AF 1DV2A 3VNVA 2FMHA 2VPPA 1U8CB 2J7KA 3U61B 4BKRA 1EHIA 3FYTA 5BRAA 4KBFA 2IYYA 2YNMD 3ASVA 4EFDA 4RJ2A 4IDCA 3QVKA 3AESB 4K2AA 3HUTA 1S5LU 3NAGA 4R2WA 5HHIA 4UUMA 4UKDA 3LNCA 2DHEA 2W58A 3P94A 3H1EA 3RADC 3DZDA 3H2HA 4TRNA 3QX3A 1WRBA 4Y30A 4B4WA 2CWDA 3DLHA 3RS0A 5F2OA 1TD9A 4AJKA 1N5XA 2PX4A 1V4BA 3RR8A 3OMXA 1Z5OA 4MQMA 4DIDA 4MVJI 1NWCA 1OWOA 4A2QA 1EIWA 1AUOA 3C8DA 2CYAA 1E0SA 4RE6A 4ECQA 4LHVA 4YRAA 2W2KB 4QPJC 1SKBA 1CUKA 1Y63A 2J67A 3N8GA 3OETA 5TXGA 4L4UA 1MBZA 4IIEA 5DN6D 5KNBH 3LYSA 2UVPA 2RC6A 2JJ8A 1ZMRA 3NX4A 4Y6RA 2A57A 7ICQA 4O3QA 2BQ3A 5CYFA 4CMBA 1E2DA 2QV0A 1CC1S 4JBXA 3SV3A 2HPHA 3UM9A 3DLIA 2BFWA 4NMXB 3KOMA 4EFNA 5KIAA 3LXXA 2C5GA 4PLYA 3OTGA 4R2HA 2FW0A 2G08A 3LLSA 4AQYB 4RQBA 1JDBB 3HDQA 1C4XA 1P1KA 4YD1A 2BSAA 1C3OB 3MCUA 3W1EA 4DMMA 1RZRA 3CR3C 4KLSA 2EFEB 3TSAA 2AE2A 3VYWA 4K86A 3BSWA 1A27A 2JVJA 2FEAA 4S35A 2J5KA 4Z9XA 4MJ3A 2GCEA 2JI7A 2P4SA 2PZGA 1OXVA 3HMQA 1OIWA 2RHDA 1W4AA 4MVJH 2D5LA 3CX3A 4Y0AA 3IAS6 2AR7A 3TRHA 5FPSA 1UDRA 5HE8A 1NGSA 1T5BA 5CR0A 2WU4A 1XJ0A 3ZW9A 1U2DC 2WVHA 3D54D 2I3BA 3P2OA 4BVBA 3LPNA 2W6IA 1XMJA 3SZUA 1PJSA 1R4MB 4ZCLA 4J3JA 1NOIA 2IEZA 1U9LA 4OAQA 1I4WA 1ZG3A 2F1JA