3LDAA

Yeast rad51 h352y filament interface mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
319
structure length
293
Chain Sequence
GSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVNIMAYSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of Rad51 recombinase from the structure and properties of a filament interface mutant.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD51
total genus 99
structure length 293
sequence length 319
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ldaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ldaA02
2XTZA 3PEWA 1E9RA 3OIYA 3CW2A 9ICVA 5CYOA 3WYFA 3RRGA 5JWHA 4Q02A 1S76D 2GK7A 2EYUA 2KBEA 2AK2A 2PT5A 1J99A 3OEEA 4DCTA 1KK2A 1XD2A 2FU5C 3QEBZ 2XZPA 3JPTA 2BDPA 4C8KA 3Q72A 2F55A 2NRVA 4G3XA 2PI4A 3BRWD 4IDHA 4QZCA 5DGBA 1ETUA 5FL7A 2ZTDA 4CYMA 3PMNA 3O8DA 3Q7PA 5IIOA 1OW3B 4R98A 3VKGA 4FD2A 4KLEA 5G41A 4Q1FA 6Q21A 2MSCB 4PHPA 3LBIA 1AM4D 4E22A 3EZ6A 4DCSA 4OKSA 1OSNA 1S8FA 4JSYA 3T3FA 1BS1A 4L5BA 1KJWA 4I1SA 1Z00A 1NK4A 4HB3A 4KI0A 2ZAMA 3AGQA 5EE0A 1WP9A 2W83A 3GJ6A 1G19A 4IQVA 2V3CC 4ZDIA 1ZCAA 5HPYB 2ERXA 7ICTA 2FFHA 2GJSA 2NIPA 3G6VA 4JS0A 5JJIA 1YRAA 4QZGA 3PVXA 3WNDA 1DOAA 4ZO4A 5J47A 4TL6A 5LD2C 1E2NA 3AKYA 1G4AE 1E2LA 3BOSA 3RS5A 1NBMD 5KYKA 2N1BA 4YMMA 3R20A 3PX4A 1S3GA 4IEIA 1A77A 1K1SA 5DISB 2ZVPX 2A30A 1SXJE 4DC9A 3WHKA 3OIUA 3KTQA 1KMHB 3RNLA 4GP7A 4Q8EA 4QNMA 4POAA 2ISPA 1G64A 1WDTA 3A4NA 4LWZA 1ESNA 5AWFC 1RRCA 2R6GA 2IHMA 1YR7A 3KB2A 2NG1A 3QPWA 1QSSA 4I1VA 3AM1A 1J8MF 1GKUB 5D3QA 1KI4A 2WMOB 3C16C 1IAQA 4ZKEA 4M1KA 2YOFA 3C1ZA 4XD7A 4HUQA 2J45A 3X2SA 1PVOA 1AZSC 3GD7A 5J0RA 4K4GA 1P75A 4RUCA 2AHOA 3FVQA 2B8TA 3X1ZA 3LXRA 2WJGA 4TMTA 1RW4A 4TMVA 2PZFA 4MRVA 2BBOA 5KFVA 4I29A 2BM1A 3NEJA 4DCVA 3PR5B 2WKQA 3V72A 2AXNA 5JECA 2E9SA 4RT3A 2ZJOA 4JLNA 4C0QC 1G8YA 4XA5A 4L16A 2D2EA 3I62A 1TQ4A 2H57A 3MCAA 4BPBA 3B1YA 4DLRA 4FN5A 1P3JA 1DARA 4DB2A 2J41A 1AZTA 1MV5A 2GF9A 2QMEA 4LK2A 4R65A 3RWMB 4RQ8A 2Q9CA 1X3SA 1JMSA 1FTSA 3P20A 4OQMA 1IM4A 9ICBA 4PQRA 4GNKA 2PX0A 4B33A 3I5YA 1JR3E 2L0XA 3KHRA 1LF0A 2ZSAA 3B78A 3SC3A 3FMPB 2J87A 2ZRPA 4MGYR 9ICQA 4JJKA 3EWAA 2XITA 1QHSA 3GLFB 1PLLA 4CEHA 2R8IA 4Q48A 5SZIA 3K0CC 4JSTA 3JPSA 2EFHB 2OUKA 5HNKA 3N5CA 4Q21A 2VA8A 4B9TA 3BH7A 5IIIA 2WWYA 3SFZA 3T5JA 3AKCA 4TTRA 5C1BA 1EK0A 2XJ9A 4LBVA 3ZZ0A 4D25A 4YR0A 4G5SA 2YKGA 3ZQJA 3WMEA 5KFCA 4A82A 1T0JB 3E70C 3MJHA 4LY6A 3THYA 4A8JB 1IN8A 1VKJA 2DR3A 1N25A 1Z63A 4IXNA 2GEVA 4PXAA 3C23A 4QWBA 1BYUA 1Z22A 1ZQIA 4IR9A 4QJ4A 4TN1A 3EZFA 5EUQB 2F3RA 3TR5A 4GLXA 3W6OA 1KDRA 3GIMA 2VQSA 2OCYC 3RJKA 1RZ3A 2W9CB 2FSFA 4ZH4A 2W2VA 3BB1A 4JZKA 1DAFA 2ZUBA 5KFPA 3H1TA 5KFLA 3PVSA 1X86B 4O3QA 2ZU0C 1Q1EA 4F4YA 1YZUA 5BWMA 1RFLA 2NPIA 2WKPA 2ZI7A 3Q9LA 5DH9A 3VX4A 4IDNA 4XD7D 3LRPA 1ZQPA 3HPQA 2O8EB 1HEIA 1ZMXA 4RQ6A 2X77A 4AWXA 2W9AA 1SXJC 2QTHA 3K09C 4XWOA 4DSLA 4K4IA 1L3SA 3LWLA 3EA5A 2ZJ5A 4QZAA 3FB4A 3QKUA 1OH5A 3CRW1 2KJQA 2FGJA 1RE0A 4BFXA 3CRMA 9ICLA 3HP6A 2EVWX 2VRWA 2OM2A 2WWIA 4DSJA 5KNDA 4LRWA 1XZPA 4TL8A 3W90A 1MH1A 5KPDA 1MKYA 5L3SB 1D9FA 1S0VA 1G8GA 2ZRFA 2X8AA 1E0JA 1I2MA 2OBNA 2R62A 3Q5EA 3L8YA 4R2IA 5C4MA 4OHYA 4M1MA 3LBHA 8ICEA 1HV8A 1RIFA 4FXPA 2GZDA 3KKPA 2ZYWX 421PA 5JS8A 4ZI2A 4P31A 1Z0AA 3H8JA 1WBBA 3RB4A 4ZKDA 2RMKA 2A5GA 1W2GA 5J0XA 3REFA 5KFQA 1U8AA 4PZZA 7ICLA 3VKHA 1QRAA 5KFXA 2AL7A 3GDXA 3EPGA 7ICKA 4EPRA 1Q1ZA 2CVHA 5KFMA 3GV8B 1GRQA 4OI2A 2GCPA 3OZXA 2HCJB 4LSGA 4TSFA 4F5PA 3RJJA 1TEXA 3PUZA 3SYZA 1T6NA 4CCHA 3THYB 1VYVA 4HDCA 1NY5A 5H8WA 2WJJA 5KFNA 2ZTCA 1E0SA 3K9GA 3OFND 2IXGA 1YZQA 4M2LA 2CEAA 3EZ9A 1VCNA 2D62A 2QM8A 3BQTA 2V4QA 4RZ3A 3T61A 2QPTA 1UEJA 2BWJA 4Q9JA 4B3CA 4JVMA 1NK7A 2IYRA 4I2IA 2OE2A 4IHQA 4B9SA 4XVUA 1II8A 5KNBA 1AS0A 4C0BA 1IJFA 1Q1BA 4B2LA 3VQTA 1ODFA 5DDMA 5L1JA 1KGDA 3T35A 1JQLB 1GITA 2CL7X 5EZ6B 1TAUA 3RHFA 5SZJA 3CBQA 5TDHA 4QBGB 4DIDA 5JRJA 4UQGA 3QEAZ 1QVAA 4UJ3A 5GJBA 1B0UA 1WQ1R 4DXAA 4NONA 3VHXA 4JKIA 4JJZA 1XJ0A 4YMOA 5JJLA 2IF2A 1J70A 4LJ8A 2WJYA 3NG1A 5CDFE 4O5EA 1JECA 3ZVMA 4BEJA 1ZAKA 1KDPA 1N6IA 2C2HA 4NTZA 4LV6A 3QNUA 4KMUA 4D4MA 2O8BB 3NH6A 1M2OB 2CCKA 2FA9A 3B2EA 2ZI4A 3BS4A 3H84A 5EE1A 1KI6A 4ASUD 2HHUA 2J6UA 1G1MA 1NBME 4IFEA 3HPRA 3TFRA 2Z43A 2GESA 4HAZA 2O8BA 1A82A 2OCPA 5IK2A 1CJTC 1XTSA 5GADl 2BKEA 2R2AA 1E98A 2BC9A 5L9XA 1NRJB 1SGWA 1XU4A 1QLNA 3MR3A 4BXOB 1JALA 4DDTA 4UAYA 4JKYA 4BLQA 4TTQA 1XZQA 2HXSA 2P0EA 4BGDA 3WNCA 1ZYQA 2IXFA 1DG3A 3UG7A 4RNOA 5J4VA 4GXIA 3IIKA 1JPJA 3ICQB 4M9QA 2QU8A 3ASZA 5EJEA 2C22A 4ZDKA 4DBLC 4AG5A 1GM5A 4H1UA 2ZYVX 5J0TA 3KFXA 3TVTA 4M9NA 5KFSA 2P5SA 5EXSA 4PGYA 5FI0B 1T3LA 5H1YA 4OI1A 4DB4A 2GAAA 5KG7A 2WM9B 5ELXA 4J9MA 2RDIA 2MSDB 4R64A 4KHZA 2KSQA 5G3YA 4G5GA 2DHRA 3T34A 1GKIA 3MWKA 4DCUA 3I8XA 2FMPA 4MDFA 4OK5A 1AKEA 5CM9C 4W5WA 4QM7A 5GJCA 4Q44A 3EPHA 3UXMA 3DO6A 1UT8A 2KZ3A 5HCNA 4DEXA 1FUKA 4WOPA 3K9LA 4NLGA 3B1WA 4WXRA 1U8YA 4DKXA 2BGWA 5IK2D 1NKEA 9ICXA 4HB0A 4LJ6A 3RJHA 1H8HA 5FTLA 3UIEA 2ZETA 3GMTA 3WHLA 1ZQZA 2GJAA 2NRTA 3JPRA 3SV3A 2ZROA 2PFNA 4BE7B 9ICPA 4G3IA 2HF8A 2OFWA 3LNCA 4QG7A 4F4IA 1TADA 2FDCA 3ZQ6A 2DCUA 2OFOA 4RY2A 4Z6CA 3THVA 2AGOA 1EX6A 1XDBA 1NN1A 1E0KA 2WJHA 2WKRA 4A0RA 1FX0A 2VLIA 4J9KA 2GWSA 1NJFA 3AVWA 3U4QB 3UMFA 1KJZA 4D4KA 1XJCA 3EPLA 2IS6A 2GXUA 4D26A 3GIJA 1ZNWA 9ICCA 2LKDA 2W6JD 4XJXA 4Q9HA 5KG2A 1N6RA 1G291 1HQCA 4DLXA 5AR1A 3EG5A 3UXOA 1U0LA 5KFAA 4RQ3A 4BZPA 2QNRA 2GDJA 3RB3A 5CK5A 2XOKD 4QZEA 3N2EA 2HF9A 5KDLA 3SNHA 2AKYA 2DWPA 2LCFA 2ZXUA 4QGFA 4A4DA 5L8VA 2AN9A 1BIFA 4UB4A 1D2NA 3DVLA 1VHLA 2VHUA 4A2WA 3A6PC 2BMDA 2ORWA 3WBKA 3C5GA 5DKWA 4ED1A 1FL9A 1M6NA 2J7KA 2PJZA 1G8PA 5F9FA 1XXHA 2FX3A 2ZREA 1Q1QA 9ICEA 2CXXA 2YC2C 4HLDA 3RS4A 4ZIRA 3ZS9A 1NKSA 4ELUA 2PLFA 2F1JA 3K09A 1XTKA 2IC5A 3U7GA 3NWJA 4OHZA 5DB6A 2FGKA 1FPMA 2QROA 3T5DA 4DLWA 5BN3A 1HE8B 4IXMA 3G6YA 4DRZA 4ZIRB 3HX0A 2F1HA 1IY2A 1OXSC 2Q9BA 3FE2A 1TX4B 3IEUA 4Q4AA 2WMNB 3VR4A 2BQRA 3CX8A 4RVCA 1P2VA 1Z00B 1TQ6A 2IYLD 3KUDA 2QE7A 1OH7A 4KSBA 5BN5A 7ICNA 4JLAA 4EFNA 2JEOA 3V6JA 4DL6A 1GL7A 3MLEA 2CHVA 4QHYA 3ZIAD 2PJRA 4NH0A 2NO1A 4M9SA 1S0MA 3MMPA 3DHWC 3O8CA 4NKRA 1ZQAA 1N0WA 1B23P 3AF2A 1DTSA 4O3SA 1F48A 5KFKA 4NP6A 4C8MA 1MSWD 3B1XA 4DFMA 5GJVC 4C2UA 4UNQA 4IQWA 1SVWA 1RXVA 3ORYA 1R8QA 2AGPA 4XIGS 4LZDA 3P4YA 3QXSA 2BHNA 5EWFA 4DLTA 4KLOA 4PSAA 3AF3A 5L1IA 1ZRHA 3TIFA 4KO8A 1SKQA 3BJIC 1BPBA 3KKOA 4D0NA 1U47A 3TLXA 4WXPA 1U90A 2EFDB 2HW3A 1UKEA 4H1VA 4GC6A 3U6BA 4I2HA 1G6OA 2G88A 5KT2A 2QSZA 1W36C 4QHTA 5CYPA 4DOAA 4HB4A 3BC1A 1EXMA 1H8EA 1KZ7B 2VIIA 1X8KA 3HJNA 4EZ9A 4KYUA 5HCIA 3V7LA 3C2LA 2HHVA 3PW4A 1YVDA 2XNDA 4A15A 4DZZA 1UBGA 5EXPA 1IXRC 2CCGA 4IVQA 1QTMA 1KO8A 9ICGA 1MR3F 1YR8A 1Z6GA 1Z6YA 1Z8FA 2O5VA 3AKEA 5FH9A 1XXHB 5J5CA 3RS3A 3RS2A 1KOFA 4XUSA 5DO9A 1T3HA 2J3EA 3Q8MA 4JVNA 2G77B 4TUQA 4QWCA 4TYPA 3DL0A 4UXIA 3SBEA 2H7VA 2ZS7A 3EW9A 4TQRA 1T8UA 1Y63A 3ADKA 4NM2A 1L5UA 1JB1A 1LS6A 1G8FA 4TQSA 1XCMA 2W9MA 2IWRA 5J2IA 3MDAA 1ZM7A 2RCNA 2YINC 4OJQA 4BFZA 4JK1A 2ZRJA 2JLZA 5KG4A 2X1VA 4B71A 5DE3A 1KFTA 2AFIE 4IOLA 4KYIB 5FI1B 4CEJB 1GZSA 1E2JA 5FOWA 1IN6A 2BPCA 2GTPA 5CB6A 4DS5A 4QZIA 4M04A 1TAGA 5FOXA 2FLPA 221PA 1EFRD 4F7WA 4X8MA 1LVGA 1XPRA 3X1YA 3PXGA 1GWNA 5TY0A 1CJVC 1HYQA 1C1YA 1TKDA 4MEXA 1QDEA 4U00A 2ZI9A 1GAJA 2ZJ8A 4KN4A 1W1WA 1FTNA 4NYMR 5FOTA 721PA 2GHIA 2JJ2A 1ZM4A 3M9OB 5CA7A 1ZJNA 1KI2A 3F5FA 2IWHA 4AYWA 5DBCA 1CR2A 1JQJC 1PJRA 2GZAA 3AUOA 2Z0MA 3C8UA 4RD6A 4RZUA 1JXEA 1G6HA 4PHAA 2XGQA 1B43A 2VHCA 4L9WA 2J9RA 1RYFA 3LLUA 4BFVA 3OFNA 8ICPA 4LC1A 4B9NA 1W5SA 4YP3A 2NO9A 1H8ED 2F9MA 1M8PA 1U81A 4YD2A 2GJ9A 3I73A 3NHAA 1AGRA 5IHPA 4MFAA 2ASEA 3BQ1A 1X8JA 5KFYA 4OHXA 3Q8RB 2KBFA 4OQFA 4EFLA 5K8IA 3GP8A 2MMCA 4DL7A 2WJIA 2KTQA 3AGPA 3L2OB 3RDPA 4I27A 2AFHE 1GSIA 3I4LA 1UDXA 1UAAA 4ECYA 4B9UA 4TZ0A 1KAGA 4MKGA 9ICFA 2PFQA 4URWR 1Z06A 2QG6A 3CONA 3GV5B 3Q8QB 3QI2A 3VR3A 1CRQA 4Z8XA 5KSPA 1DS6A 1AS2A 3QKRB 4M1OA 4YXWA 4G0NA 5JWRA 2J0QA 1D9DA 3LDAA 1QHYA 4XSHA 3Q8SB 4XSGA 4KLUA 1Z2AA 5D49A 2VSXA 1F2UB 3GJ4A 2CE7A 2HJGA 3CNNA 3UXPA 4LX0A 2R8HA 5FTMA 1DG1G 3UK6A 1NVWQ 1ZQTA 1HY3A 2GWHA 1G21E 2JCSA 5DB9A 2ATXA 1SQ5A 4LC0A 3KQLA 3HR8A 2FWRA 4BLOA 4C7OB 4QZHA 4ECUA 3U3OA 1NLFA 3TI0A 3TBKA 1NN3A 1XTJA 2JLQA 1JIHA 5FUXA 1NY6A 4PO9A 5FR2A 1KAOA 4O2LA 4XRHA 1P9WA 2YHSA 2BPFA 4PANA 3C14C 3RH6A 4QW8A 1RZTA 4LCBA 4PC6A 1NJWA 4EQ6A 2GF0A 1P6XA 3RAXA 2JEGA 3IO5A 4NZYA 2ZUCA 3W3ZB 5CJ7A 1GRNA 1A7JA 3KUCA 4QWEA 3TK1A 3UWKA 5BOMA 3K70B 3VR6A 2ZITA 2BR0A 2BCUA 2JEIA 1CUKA 2V1XA 2WAYA 4D4JA 3HU2A 4DS4A 1U2RA 2C77A 4GI7A 4IQTA 4PHFA 2FE4A 3RAQA 1T3NA 1X9WA 3MFYA 1M1YE 4B3DA 2DFTA 3GLGB 4I2CA 5TZVA 2FEMA 1II8B 1W0KD 3I92A 3LX5A 4QHSA 2JAQA 1XCPA 3RS0A 4J9SA 1TEVA 5L3VA 1FP6A 3GJ8A 4NM1A 2BCRA 4NCJA 3CPJB 1CRPA 1RPZA 4F4XA 2ORIA 4L9SA 4RJLA 2WBLC 4KLQA 3VTKA 1U99A 3QENA 5KFFA 4MGKR 3I3SR 8ICTA 2GETA 2IXEA 3L8ZA 4B34A 2WOOA 4Z54A 3OEHA 1P73A 1YZLA 3BORA 2NMVA 1MO5A 4TQUS 4FCWA 2VA3A 1NKTA 4B3BA 1SHZA 4QZ8A 1VYTA 3K8YA 3DEFA 4CZ2A 2O0JA 3ZLJA 3AB3A 3EAQA 1U9IA 3AU2A 1HH4A 3B60A 4BWYA 4AY2A 4PPXA 2P6RA 4DCNA 5A0FA 2HT6A 3M8RA 4LYAA 3U2QA 4LHYA 1WE2A 1G8HA 2BM0A 2JJ8A 1KNXA 2BJWA 4QNRA 4ON9A 4CRWB 2IX3A 2QQEA 1P9NA 3GJ0A 4BFYA 1E4VA 4B9MA 1MABB 2P6NA 2VP4A 1YHNA 4TT3D 5E95A 4DFJA 3HYRA 1OYYA 2RGNC 3OGUA 4Q1AA 5DB8A 4XOIA 2F9LA 3A4LA 5G40A 4DWIA 4YMWA 4EQ6B 5KPJA 3ZIAA 3GILA 2LKCA 2W00A 3TKLA 4JWMA 2VP9A 3O8BA 2QAGA 4EPWA 2W6JA 1Q3TA 4Q9IA 4PGXA 5FPKA 4OI0A 3SYKA 3AKDA 2NRWA 1T7PA 1U48A 3U6KA 4EYHB 2OXCA 4IVPA 3FKSA 1UF9A 4ED8A 3BWDD 2DPIA 4F38A 4Y0AA 2VPPA 1AKYA 5KFWA 3IKJA 3NDPA 4S2EA 1XD8A 1MT0A 4N0EA 4BDPA 1WB9A 1Z0KA 4JLKA 1KMHA 1I4DD 3WYGA 3QSYA 3R9IA 1FW6A 5J0OA 2KE5A 3OEED 3PEVA 5DBAA 1DVRA 2DWOA 3GLHB 3QBTA 5A5GA 4KLZA 3B0YA 2GEUA 2P3SA 2QT1A 5LD2B 2VP2A 4C0SA 5FR1A 4PC7A 4GDFA 2B7BA 3H4BA 2ZRDA 1GTVA 2CK3A 4HUTA 5FBVB 1E9SA 2Q21A 1TK8A 3RB0A 2J1LA 1Q22A 2V8OA 3EIEA 1Z47A 3CNOA 2GKSA 4QJ5A 3PX0A 4O0IA 9ICKA 2C99A 4DQQA 1Q21A 2W9CA 1DO0A 2DFKB 4C0KA 4M9GA 1UM8A 2OSBA 1VPLA 3RWOA 3I61A 1KO1A 2FSGA 2AU0A 2GCNA 2QBYA 4QW9A 1YZNA 1V43A 3CRRA 3PENA 1SVMA 3DOFA 2BPGA 4HUQB 2IHNA 2ZYTX 3MGCA 1AS3A 3DZ8A 2XB2A 4I2JA 1XCGB 4AD8A 2BBTA 1WMSA 4F4WA 1W4BA 3W3AA 1BPZA 2ZSFA 4LHVA 1E96A 1KDTA 9ICTA 3H40A 2P66A 3CZQA 7ICPA 4IQUA 2ZRKA 5DG8A 5KFIA 3OESA 4FWTA 1ZD8A 4O25A 3H86A 4PPFA 3RJFA 1YJ5A 1JN3A 1TF7A 3GLFA 2C04A 3BK7A 5CLLA 5EE3A 3ONWA 4W5HA 1JBKA 4ESHA 5HE9A 2Q0ZX 4UAWA 2AQ4A 8ICRA 2AD1A 2EU8A 2HVHA 3CNLA 4DL5A 1NN0A 2V54A 3M6AA 4Z1MD 5FTNA 3EASA 2KZMA 1S0UA 1W48A 3PUWA 2JGNA 4URZR 4UB5A 4HDOB 4RKEA 2GVZC 4ED6A 2EFEB 4MKFA 1CKEA 3A37A 5FOSA 4DQPA 1KNQA 4MGZR 2IS2A 2FFBA 5J2GA 4DEZA 1NJZA 1Z6XA 3ZD8A 2NOAA 2BIFA 4IEEA 1K6MA 2NRZA 2JEFA 5DLFA 8ICSA 3FMIA 3FFBA 5JBQA 3D31A 4MGIR 3BXZA 1FQJA 4GRAA 2IA5A 3FKQA 2OT3B 4BUJA 2XTNA 3IIMA 4D0LB 5KDOA 2O8EA 4HLQB 2QORA 2QY9A 1EWRA 9ICSA 3GLHE 3RSLA 2Q3HA 3C41J 3U44B 1UFQA 4NXZA 2IK8A 3AVVA 5KFJA 5JCZA 2W9BB 4M47A 4UBBA 3NHBA 4ZDWA 2O8CA 4ED0A 2Q3FA 1R5NA 1KO4A 2QQ0A 4M2YA 1IONA 5L3SA 3LH5A 3TFSA 2D3WA 1XEFA 3U60B 2GXQA 5IILA 5TB5A 1K1QA 4MRNA 1BO6A 3BH6A 3DKVA 3SS8A 2Q0HA 5CM8B 4ARZA 4BECA 3QXCA 3W6NA 5FTJA 4R7ZA 1CR1A 2PMKA 1L7VC 1Q3HA 4F5NA 1ZUIA 3VAAA 1ZINA 1N6NA 2C96A 1OV4A 2Z83A 4ARZB 3K0EA 4EYIB 1DPFA 5FOUA 2D4HA 4YDHB 2REOA 4Q4HA 4V03A 4ASUA 1TQDA 3QOFA 3V6KA 4WZAE 1QZXA 1Z29A 5AJXA 4KLHA 1C9KA 3SOPA 1HURA 2C95A 4IOJA 4RQ1A 1KRPA 1D8YA 4MKHA 1OHHD 4US2R 3SI7A 3AVUA 3UPUA 5LPNA 3BFVA 2NTYC 2FMQA 1Q0UA 3FHOA 1G7CA 2DY1A 3T1OA 4CF7A 3RLFA 2KB0A 5KG0A 1NN5A 3GLIB 4MQBA 4LYFA 7ICRA 1G7SA 8ICHA 2ZRLA 3PIRA 4P3YA 2W58A 3A1VA 3ZDEA 1QHHA 4TL9A 3VR2A 4KCGA 5FUWA 1R4AA 3THXA 1A1VA 4A1FA 3KKQA 5FPSA 1X9SA 3B85A 4GPTA 4YMVA 4A0GA 4HDQB 2ODEA 3THOA 2BCQA 1OH8A 3SDZA 3PUYA 3GPLA 3CF2A 3NBYC 2J0UA 3LA6A 4HAUA 4IFBA 5F9LA 7ICSA 1ZUHA 1NIJA 2IHYA 4RFSB 3MDCA 3SQWA 4M53A 2ZYUX 4YLGA 7ICQA 1TUIA 2G3YA 4M9XA 4PZLA 4BLTA 1HT2E 3PUXA 1XSNA 121PA 1FNNA 3P32A 1JR3D 3CPHA 4FINA 4KLMA 1G3IA 3EXAA 3C5CA 3JZMA 1L2TA 4M21A 4XH9B 2HHXA 4Q1DA 1ZQBA 3QPUA 4Q4JA 9ICWA 3EYZA 1JNYA 2I4IA 2ODNA 4ABYA 5D4BA 4B76A 2CL6X 1VYUA 2GRJA 4CGZA 1UEIA 2WZQA 1NK0A 1WA5A 2OAQ1 2IYTA 4EPTA 3JPQA 4RQ7A 1KSJA 3MWYW 4Z51A 4F5QA 1OIVA 3V6HA 2ZI5A 4B74A 2RGEA 2HHSA 3IHLA 3SYNA 2F1RA 1XMIA 3FMOB 3BAFA 3K0AB 5L3QB 2QE7D 3QY0A 4J9NA 2C28A 1T3SA 2J7PD 2Z6VA 4E09A 3LFUA 2VSOA 4X5VA 4EJSA 4GSYA 4JVSB 3UQ0A 1TV9A 1DADA 2QSYA 3OJUA 3I8SA 1FFHA 2QN6A 2XNSA 1SXJD 4Q9LA 4PO1A 4NPHA 1AQYA 4HATA 5KG3A 1E9DA 1UADA 2ZRIA 3QKRA 3ADBA 3FYHA 1NG9A 3CH5A 3I1FA 1XD2B 4RU9A 3H8WA 1LB2B 1B22A 5JUMA 1EX7A 1BPDA 4K81B 4PSKA 4MYUA 4BXOA 2IYQA 2ZR9A 4YVZA 3I72A 4PAQA 2O8FA 1VCMA 3OHMA 2I9GA 3L0PA 2J6TA 4PAMA 1HA3A 5FUYA 5C18A 2YWEA 3KJHA 4YQWA 1N0VC 5GVSA 3SQXA 4AKHA 1O87A 4JBWA 1R0YA 4MRRA 3DKPA 1Z0DA 4I2BA 3IM1A 3SN6A 5KG6A 2V9WA 2BKUA 4GP6A 8ICMA 2QA5A 3QBVA 1T5LA 1XEXB 1W36D 3AH8A 4NYIQ 2PT7A 3FHCB 3GJ7A 3ZZUA 2JLVA 1R7RA 4D2IA 3SJCA 3JVVA 1CU1A 4NYJR 3IEVA 2C9CA 4R9UC 2WWHA 4MYHA 4HAYA 3ADCA 4ZCMA 5F3WB 2WSSD 3K70C 1TVAA 4QZBA 2BEKA 1ZM3A 3TSOA 3T5HA 1KDOA 1E9FA 1U45A 2FNAA 4DDUA 5TXGA 4EZ6A 2H8KA 2G1KA 3L82B 1U0HC 1TF5A 4JLJA 3ZJYA 2BBWA 2AKAB 1XMVA 1XMJA 4PPGA 2P67A 2CLSA 5BW8A 1R5OA 2OLJA 2ZJAA 4RPZA 4HLUA 4UQOA 3MR6A 2QTFA 3TJZA 3BJYA 3L43A 4NHOA 4TMXA 3HPOA 8ICGA 3RYTC 2J6SA 1ZQYA 1S9HA 4ACAA 621PA 4LV8B 1A76A 1E6CA 5ANRB 2E1RA 3TANA 4PHHA 1E2KA 1YE8A 4DLGA 2ZSBA 4RFVA 5J2EA 1JEDA 3U4QA 4Z6FA 3DZDA 1OIWA 2GXAA 4JLVA 2RDJA 1ZQWA 1S9FA 1GP2A 3UXNA 1DBSA 1HUQA 1EFCA 3U3JA 1HT1E 1W2HA 2ZI3A 5JS7A 4M6WA 1RJ9B 4A9AA 3WY9A 3GJXC 4F4ZA 1JXMA 1ZYUA 4TMKA 3F3YA 2V55B 5K8LA 4JLBA 1CTQA 2C2EA 4PHTA 4M6WB 5LB2A 2BCJQ 4V0LA 1RRGA 5KG1A 5J2BA 4LYHA 1SKYB 1F5NA 3KXLA 3H4MA 2X2FA 1IXSB 3PY8A 2ATLA 2ZJBA 4Q01A 4WZ6A 5FPHA 4J9OA 4L8GA 2V9PA 3T5KA 1HUOA 4B9LA 2ZSDA 4N3NA 2GXSA 3Q85A 5TV2A 5J29A 1EFHA 5CB1A 5KFHA 1KSPA 3RJGA 5H68A 1KK3A 4EEYA 2UVUA 2BCGY 4NDZA 2C9YA 1Q57A 4K4HA 1OF1A 2B7CA 1DELA 2DPXA 3RVBA 3EIQA 4NU0A 1DAKA 3QUSA 1N2CE 1COOA 1WF3A 1EGAA 4DO9A 3SV4A 5CLQA 4NLZA 1U9LA 4O3NA 2IA6A 2WIAA 3QF4A 1D5CA 4Q19A 1QG4A 5DNYB 1S0NA 1SKRA 1BOFA 3LW7A 2BQ3A 2DFNA 2O8DB 2B92A 4M4SA 1E9CA 2J5XA 3OSNA 1SL0A 3GLHA 521PA 4QM6A 4WBSA 5JHGB 3IQXA 5BXQC 4RD0A 2CLCX 2RGGA 1ZQMA 1KI1A 1G18A 1P9RA 2N46A 2A3RA 2XSZA 4TYYA 1AGPA 2D7DA 2HEIA 4QZ9A 5DBBA 1CBUA 2RB4A 2ZI6A 5J0YA 2QZ4A 4CEHB 4FMDB 3R9WA 8ICNA 4EDHA 5IIMA 2JDIA 4EJSC 4UBCA 3P1JA 1NI3A 5EE9A 2I3BA 4OQXA 4I99A 4TLEA 3UWOA 4RQ4A 1OXTA 1DAEA 5KG5A 3EC1A 3MR5A 2KWIA 1UBCA 3IILA 1TQ2A 2H5XA 4J9RA 1VIYA 4GT1A 1IXZA 1OFUX 4FCVA 5J0PA 3LVRE 3LQQA 1JJ7A 3BE4A 1KO5A 4F5OA 4ECQA 2A5DA 2YV5A 3NBZC 3P27A 4LJYA 2ZR7A 2NO6A 2VHQA 4RD4A 5DHAA 1HE1C 2JLXA 1IN4A 4II7A 5CJ2A 1MRSA 4DLVA 3RBEA 1ESMA 1P62B 1NK6A 2ECKA 3RABA 3BDPA 1L4YA 1BPYA 3U7HB 1FMJA 2F3TA 3MBYA 4LYJA 5AUPB 4ZCIA 3H2YA 3LK9A 1W0JA 3QVVA 4EBDA 4YC7A 3W5IA 4CT4B 4QGHA 4HZUB 2AQ0A 1Z6TA 1I2DA 2HV8A 3QF7A 3CM0A 4UXJA 3G0HA 1Y88A 3JPNA 3MGHA 3WNBA 5AJYA 4DSEA 3NKVA 4IOMA 3KXKA 1DGSA 2VHTA 4M1SA 2HJVA 5FOVA 1ZQKA 4M8NE 2FZ4A 4QFMA 2ALZA 3PEYA 1MQ2A 4C7OA 3H7IA 3CKLA 2PEYA 3C1YA 3ND8A 4QBIA 3PR1A 4GC7A 1F6BA 3ZDBA 4NCIA 1TK5A 2JZBB 3N97B 4CEJA 4LHZA 1XWLA 2A1JA 3LQRA 1KI7A 3LLMA 4TYNA 2RAPA 1KLNA 1D9ZA 1GOTA 5HMLA 1MRNA 1ZQQA 2QT0A 4OI4A 3WP1B 4A92A 4QJ3A 5LDDC 4BWJA 2FH5B 4C2TA 2OZEA 4PHGA 4AK9A 1QSYA 1L3VA 1NMXA 4PH5A 3RTVA 1DEKA 1CP2A 3UPQA 1LF5A 2IYZA 2PLRA 4NCNA 1E79D 1ZQSA 3GV7B 2V7QA 2JLSA 4GXJA 4I4LA 4X8LA 1GG2A 2IYXA 4RKFA 1GILA 1OFTA 2PXIA 2K5UA 3QXJA 4TTPA 5D3MB 3PQCA 4PTLA 4YMNA 3AUYA 3TW8B 4YFKA 1G3RA 2RGXA 4Z6EA 4JYCA 1ZW6A 2QEQA 3WRYC 2QUZA 4I28A 2XNDD 3GLGA 2UVVA 4C8LA 1NIPA 2WPDD 1TF2A 4OHWA 3PNCA 1R0WA 2OBLA 3NEYA 5LBIA 5EE5B 2DYKA 4O3OA 4O5KA 3LBNA 1FNMA 2IS1A 3PW0A 4TMZA 3H4DA 3H0KA 4AKIA 3FKSD 3VR1A 2O0HA 4B75A 4QWDA 1P2UA 2H5EA 1GDDA 1W46A 4KFSA 4JT4A 2W0MA 3W5JA 4OHVA 5BYKA 3U7EB 4V02A 8ICFA 4BRWA 4F5RA 2B6HA 1F3OA 1SVIA 2CNWA 4JYBA 5E7MA 3EPKA 4TLBA 4W5JA 2R8KA 4JBXA 4DUGA 1KIMA 3QIAA 1JX4A 2VANA 4DL4A 4HZUA 4DJTA 1UPTA 2IYVA 2AJQA 4DSOA 1R0XA 1UDWA 5DQIA 1NVVR 2XCPA 3V7JA 5B57C 4US0R 1YR6A 5J0WA 3KKNA 5HZKA 1GL9B 2QRNA 4ELTA 1OPXA 3WMGA 4A0FA 2NZ8A 2VP0A 4IDQA 5G3ZA 5J2FA 3LVQE 2ASDA 3MFHA 1SVKA 7ICGA 2JIZA 4UB3A 1X6VA 2ONJA 4MDEA 3MJRA 4IRCA 1UBFA 4UXHA 9ICJA 3NBXX 3UG6A 1KO7A 4JT2A 3W6PA 1NL3A 1G7TA 1FP7A 4P4UA 3QKSA 3NC1C 3HYTA 4I1OA 3KHLA 3CUEF 3RR8A 1R6BX 4MF8A 1UKVY 2WSSA 3RAPR 3PFIA 3KQHA 1ZQHA 1NG1A 4RSGA 5FBRB 5J4YA 2GBLA 3NGDA 2FEOA 2YVUA 4LUCA 4TYWA 4R66A 5E3HA 1KY2A 1UA0A 3JVUA 1CEEA 4RUAA 3CWZA 4K8OA 2CCJA 1U94A 2ANCA 4DF4A 4PX9A 2UVWA 1D9XA 3ZD6A 4IR1A 1GNPA 1W5TA 3O8RA 4NCHA 2J0UB 3U3KA 4FBTA 5EZ5A 4LJ4A 3QJYA 1K5GA 1MOZA 3G6XA 1HJPA 1S97A 1OFIA 2PI5A 2ASJA 1E99A 3MWLA 8ICBA 2CK3D 2JJ1A 3K0FA 2FLNA 1E2FA 2WV9A 2H18A 4R8UB 3C2KA 1NK8A 2HHQA 3N70A 3QXXA 4AIIA 1ZD1A 2VEDA 4O3RA 4AKEA 2GJKA 2V6IA 2ZTEA 2PFOA 7ICEA 5D46A 4ECRA 1DAIA 3V00A 4DEYA 1TMKA 3LO5A 5E4FA 2YYZA 4MUBA 5J4KA 5JI3E 2PL3A 4FW9A 4KFRA 2FFQA 5KOYA 4R71A 4KFTA 2WICA 4NYJQ 2IEZA 4MITA 4I2DA 4C8NA 5KFDA 4W9MC 2ZU6A 1XPOA 2RGBA 1R8SA 1FX0B 3TW4A 4KLLA 2OO7A 1VG8A 3ZH9B 3CB4A 2BDTA 1NP6A 1W49A 1TU3A 2OCBA 4JLOA 3L0SA 3T1VA 4EBCA 3QQ5A 1FUUA 4B6EA 1DO2A 2C03A 4Q5IA 4DOBA 1ZCBA 4N0DA 3NDBB 4ACBA 3TAPA 1QHNA 1ANKA 2OESA 2VF8A 4U5XA 2HUPA 1TK0A 2XO7A 1XEWY 2Q6TA 4LBYA 2DFLA 4TUSA 2ERYA 5JI2E 2R44A 1XFAA 4C3ZA 2ZRGA 1YZTA 2Q9AA 3CO5A 3REGA 5JMTA 3WYAA 2JA1A 2IBKA 4YXMA 1NF3A 1S77D 4KN7A 1ZJ6A 2XXAB 1WCNA 4D6PA 2HXYA 2AX4A 4MYCA 4M22A 5BOLA 4URVR 1N6KA 2A5FA 3SJAA 3EC2A 2QGZA 4RD2A 1JPNA 4F4CA 1NJXA 1XC9A 3MD0A 1AA9A 1NBMA 4B3XA 5KTQA 5KT5A 1SL2A 1LV7A 1KI9A 1IN7A 1XXHE 1TNDA 2QENA 5C46F 3BIFA 4M1WA 2QPOA 3E5HA 2O52A 3SE0A 1W0KA 2IYWA 4JMPA 3ISBA 1RYRA 2FF7A 3B9PA 4I2GA 1N6OA 2HHTA 1S1MA 4Q47A 4OQLA 3E2IA 5DYGA 3D7MA 8ICWA 1DE0A 2JEJA 1S96A 3CF6R 3HU1A 3KDSE 3MRSA 4LI0A 1RVDA 4A8JA 4KLNA 2R65A 3R8FA 1K8RA 1XMSA 3MR2A 2R6FA 4FMCF 4WVFA 2KFNA 3AVTA 3T06B 1N5LA 1Z28A 4HB2A 5CB8A 1ZQUA 4KU4A 1BYIA 3RR7A 4QC2A 4FS2A 3M1IA 4P32A 1OB2A 2DBYA 3O47A 4LHXA 5CHGA 3NXSA 1D2MA 2WWFA 3QEJA 4JUZA 1EWQA 5CR0A 1IOZA 3C21A 4LGMA 5KSOA 4W7SA 1VCIA 4XQ8A 2ZE6A 1IM2A 2CE2X 3Q8XB 4OBEA 5IIJA 1FQKA 2N42A 3PX6A 3E1SA 3EARA 3AVYA 4QBFA 4FBUA 3TQ1A 1E94E 1EESA 2ANBA 4RD3A 3T5LA 1NJGA 5CK4A 3UQ2A 4LHWA 1NMYA 2PMDA 4GFDA 4DWJA 3A1SA 3R8CA 3ZD9A 1AK2A 4O2RA 1OIXA 3CRVA 3KZ1E 1E3MA 4DQSA 2JLWA 2RGDA 3FHTA 1R10A 7ICMA 4DLYA 4ERNA 5JRZA 3IPXA 4JIMA 4AG6A 1R2QA 4F3OA 4HAVA 3SHWA 2F7SA 3WP0A 5JZVA 1G3UA 2WPDA 2WTFA 3K53A 1BPEA 1SXJA 1CR4A 1LTQA 3C5FA 3PW2A 1CXZA 2CLDX 4L4UA 5DDYA 5KFRA 4MA4A 4WZBE 3BFKA 3FDSA 2C2RA 4KLJA 1NVXQ 4KBFA 4JLPA 5DIFA 1SXJB 4CVNA 4UNRA 2RKOA 1DAHA 3BERA 1Z3EB 3NC0C 2PCJA 4YD1A 3BB3A 4YN4A 3MAAC 2F1IA 2KN7A 2KFZA 3S1AB 4D0GA 1XP8A 3M0EA 3SHFA 3GLIA 5P21A 3IPYA 1GKYA 2E87A 5G53C 5CIWA 3I5XA 5FTKA 1CR0A 2P6UA 5KO2A 1TFRA 1SVSA 3PCRB 3S1AA 3PW7A 4LJAA 4XWKA 1XJQA 2UZ3A 1W7AA 1IY0A 3SZ2A 4DLEA 1NK5A 1GFIA 3THXB 1HUZA 4PQFA 5CWRA 1AIPA 3DM5A 5KNCA 2VL7A 1VIAA 3DDCA 4P4TA 3LWMA 1CJUC 2EFGA 5BYJA 3Q8KA 4LOAA 2GAOA 2WTUA 3TVDA 5J0UA 4Q66C 5L1KA 2V4RA 3K9HA 2PEZA 5AUQA 2A5YB 1EFRA 2BMEA 4B3FX 2M9NA 3Q3JB 5JSZA 3EZ7A 3X1XA 1ZM9A 2XZLA 4JLMA 2IYUA 2FG5A 4HLCA 2ZS9A 2DPJA 2ZR0A 3JZAA 4TL7A 3GFOA 4FMDF 4A2QA 4QKQA 4YR3A 4RPYA 1BGXT 5EXTA 2AXPA 3CH4B 2AGQA 3CR7A 1KKLA 5EQTA 1JR6A 2FPLA 4BLPA 4RZRA 4PO8A 1BKDR 2NRXA 1KI8A 3PJRA 2GA8A 1RPLA 2ZRCA 2FV8A 2CBZA 4A2PA 1GNRA 3AF4A 2QP9X 4HI0E 3ICEA 3K70D 4MFCA 5KFUA 2HLDD 4B2IA 4FI3C 2OCAA 3ND9A 4NLNA 1FMLA 1OHHA 1M7BA 2IEYA 2IHBA 3EA0A 4J9QA 4E03A 4ECTA 4I2AA 3VHLB 3QZ7A 1E32A 5FFMA 5JEDA 3PV8A 1BVSA 5J2DA 1RRPA 2ZANA 4V0NA 2D06A 3DOEA 4YMUA 1PZNA 5DB7A 1JR3A 2MAXA 1BH2A 5FUVA 4DDVA 1Y3AA 2G0TA 2NPFA 5J0SA 4DL2A 3LWNA 5KFTA 5J2AA 5C2JB 3OHAA 2PCLA 5KFBA 4XVQA 2VA2A 4P33A 3RRMA 1KFDA 4YR2A 3B0XA 1J90A 5JEEA 9ICAA 3EIHA 1G5TA 4CEIB 4G1UC 2C98A 5CITA 1CJKC 1WXQA 4B3GA 5C4GB 5IIKA 1OKKA 2R8JA 3SI8A 3QEOA 3VKWA 5B64A 3LV8A 1US8A 4V0ME 2A1JB 4I2FA 4RQ2A 1D6JA 2UVQA 4EAQA 2UVRA 3SBDA 2WOJA 5J0QA 2XEXA 1H8HD 2FSIA 2GCOA 2YOHA 3T12A 4JLDA 4MEYA 3K75D 1A2KC 1U9IC 3A1WA 1KDHA 3B6EA 5SZKB 2IUUA 1ZP6A 2A5JA 3KB1A 3ZVNA 4HAWA 1A4RA 4YXJA 5BPCA 1VECA 4ED2A 1OE0A 4TQAA 4XTRA 2IUTA 1ZQOA 1OH6A 1IQPA 1W0JD 2W6IA 3DMDA 1K5DA 2BCSA 3THWA 1NVVQ 4BFWA 4EJSB 1Z3IX 1NK9A 4TT3A 2HDNB 4RQ0A 1W4RA 3GIIA 3A1UA 3VU9A 1WBDA 4IRDA 1P4SA 2MUTB 5DGAA 1QHGA 2ZTSA 2CHGA 2H16A 2ZJYA 9ICOA 2QPAA 1E69A 2XC9A 1KK1A 2ZS8A 4OK6A 3W8NA 3KQNA 1NVUQ 1KHTA 1KSHA 3AQ4A 4F92B 1N0UA 3AF0A 2BQUA 4IRKA 2BOVA 4AURA 4B44A 3AP3A 3PMLA 1JXLA 1ZQEA 3IIJA 2ZAOA 3IUYA 4XWAA 4YMSA 3CIOA 4ZPXA 2QP3A 4UNNA 4LBWA 4PC2A 4PFSA 4YDSA 3R7WA 2JLUA 3NH9A 5AUNB 1U8ZA 1XEWX 4BFSA 2BMFA 4ECWA 3TUIC 3CPEA 4TSFD 1ZQDA 2A78A 4CW7A 9ICNA 1XWIA 5KT4A 2BEJA 2ZRBA 1Q20A 5F9NA 1E1QA 2MMGA 1KKMA 4X8OA 3V9PA 1NNEA 2FMSA 1PLKA 3TR0A 3K4GA 2FFAA 1MABA 4M9HA 4CEIA 1G5PA 2G1JA 1T8TA 1HTWA 1XEXA 1P7CA 1CEZA 4R2HA 1US8B 2ODWA 2Y8EA 4EUNA 3K1JA 2QAGB 1IN5A 3VR5A 2CHQA 4GOXA 3QG1A 3D6TB 1DAMA 2VH5R 2QTVB 2RHDA 1T0HB 2V4ZA 2VHJA 3LXXA 3TRFA 4EKDA 1CIPA 2EYQA 1E9EA 2C5LA 5AK0A 1ZQLA 3EPJA 2GNOA 4NE2A 4NMMA 3CR8A 1ZU5A 4KXFB 1N6HA 1FOEB 4ESVA 4B35A 8ICJA 3C5HA 4BFTA 3TSWA 4GOJA 2X2EA 4YXWD 4RZ2A 3F8TA 4UNSA 4Z1MA 5FBLB 1ZIPA 1H38A 2AR7A 3OIWA 4N1AA 4RQ5A 8ICLA 2NO0A 3VU9B 1R5BA 4X8HA 1E2DA 4UAZA 4EFMA 1VG1A 4DSUA 1ZM2A 3B13B 3KQUA 4A36A 3GFPA 2LWIA 4J9LA 1X8LA 3B1VA 2ONKA 3K0FB 4M0LA 3A8TA 4LPSA 4F4JA 2OV2A 3P26A 3QE9Y 3OJSA 2ZVQX 3Q8LA 4LJ7A 1Z0FA 4HAXA 5JWOA 4A8JC 4C8OA 4F4KA 2P65A 4QOSA 5FPTA 2UKDA 4QWAA 4FS1A 2IUSA 2DB3A 2VO1A 1E2IA 5FPYA 3FOZA 2ZE5A 1LB1B 1P61B 2QGNA 3GLIE 3K0SA 4GXKA 3MABA 4PGQA 1RJ9A 7ICOA 4Q4LA 3C15C 1KI3A 1F60A 3ZGXA 1EXNA 2RGCA 2ZRAA 2V6JA 5F2EA 4I81A 2J59A 2QRZA 3U61B 4Q7MB 8OHMA 9ICMA 3ISCA 1ZQCA 5KUTA 1RC8A 3C2MA 5HP4A 4ZDJA 3ZDDA 3BH0A 1SZPA 1XPUA 4KLSA 5KFGA 1CLUA 5HZHA 4DSNA 1V9PA 4ILEA 2D74A 2CVFA 2AWOA 5EP4A 4MKIA 4B6FA 1ZQXA 2BMJA 4HYKA 3TSZA 4TMWA 2AD5A 5DQGA 1Z0IA 4KSCA 1MQ3A 3TAHA 4Q7KA 2AK3A 2FN4A 3TNFA 2BJVA 3HWTA 4TLAA 2OWOA 1KYIA 1YQTA 1V5WA 4BEBA 1AQUA 1ZC4A 5IT5A 1LNZA 4IDOA 1T5IA 1OXVA 8ICAA 4Q4AB 4C0AC 1Z6AA 2OAP1 3KJEA 2FPMA 3Q8PB 3QF4B 5FBQB 4DDWA 4DQRA 1G4UR 1PUIA 4F8RA 1ZNYA 2VSFA 4PQYA 2O8DA 3KHHA 2IBMA 1R0ZA 1T8EA 2HLDA 5JJKA 3A4MA 4US1R 4URYR 1F2TB 2JLRA 1RYSA 1NLYA 2YWFA 4DVGA 4G01B 3H8SA 4DSKA 1OFHA 2ZIAA 4DOCA 3A36A 1IY1A 8ICYA 4TURA 3PITA 4QBHA 4P4PA 1P2TA 2QM7A 1N5KA 5CDFA 1P5ZB 4PZYA 2JASA 4WAUA 2W8KA 9ICHA 2V7QD 3IQWA 1S9DA 2NQ2C 4QGAA 1KY3A 1IBRA 2JATA 2ZJZA 4C0HA 3LX8A 2YJTD 2J7PA 2ZM5A 5GVRA 4MUAA 2XZOA 1XRJA 2R6CA 2EQBA 4Q8FA 5HKKD 2R6AA 2FPKA 4B73A 3EPIA 2Y1JA 3PO5A 1KTVA 4V0KA 3GCGA 4KVAA 3TARA 4Z8YA 5D3MA 3SU8A 1L8QA 2JLYA 1VMAA 2JJ1D 1ZNZA 4O3PA 3D3QA 5HR5A 1J7KA 3HW8A 2YWHA 1OYWA 1ZQGA 3BD9A 3FTQA 5EP2A 1II9A 8ICCA 1XTIA 2QL6A 4I1UA 4NBSA 4C4PA 4OL0A 1KSGA 2DWQA 4BZXA 4MRPA 3GEIA 3HWSA 5EXXA 1JAHA 1AJEA 4Z6DA 1P2SA 1UKZA 2XB4A 4JL8A 1LY1A 1N3BA 9ICRA 2OILA 3CF0A 4TLCA 4D80A 2R9VA 5E7JA 1S1CA 4LDJA 4ED7A 2ATVA 2PBRA 4P2HA 2OG2A 3V4RA 1ZQFA 4QRHA 2EW1A 2ZJ2A 1G5RA 1Z07A 3RC8A 4F2SA 5JCPA 3RBDA 4HYYA 1NLZA 5FL7D 1G16A 3L0OA 1E2GA 2IS4A 3BB4A 4Q4HB 1KJYA 4Q03A 4DLSA 3TGPA 1G9XA 2XJ4A 2GILA 3W8RA 5DQHA 4YMTA 1NKCA 2JIZD 1W4AA 1XTRA 1VCOA 3M9NB 8ICKA 2PZEA 5HE8A 8ICVA 3TAQA 2XAUA 4A0HA 3B5JA 1OXUA 2WJVA 1SKSA 2GK6A 4OYHA 1L4UA 1YKSA 5HHIA 4P4MA 1TU4A 2WWXA 1KSFX 2D2FA 3AEZA 3KKMA 1P72A 1E1RA 2P2LA 3TUJC 2V1UA 1GVNB 4F50A 4XTCS 3ZS8A 3RB6A 1NKBA 4KV9A 2WAXA 1DAGA 1KFSA 3ZDCA 3FFAA 5IRCD 1E79A 1T9HA 2WSMA 1XD9A 1QVRA 3KJIA 1N5IA 1OLOA 4QZFA 3OAAA 4B43A 1ZQRA 3ZDAA 2W8LA 3ZDQA 5HMMA 5JHHB 4NL4H 3DM9B 8ICUA 2BVNA 3RSOA 4JV2A 4JBYA 4IRUB 5KU1A 5L1LA 4KLDA 2FZLA 4GZLA 3W34A 4KBGA 4D81A 3RRNA 3QZ8A 4LV5B 3LY5A 1W44A 1N6LA 2XCAA 3J81k 1S2MA 1Z83A 4NLKA 1M7GA 5UKDA 2XOKA 3AVOA 4K46A 2ASLA 2A2ZA 5HTKA 2YNMA 4IDPA 1OXXK 3PO4A 1LFDB 2J46A 1IXRA 4PPNA 4Q4JB 4B2PA 3ZD7A 4EIWA 3OEHD 4GOKA 4H9GA 2F43A 3KTAA 1D2EA 1G7RA 3GIKA 3IBGA 4BASA 1AROP 5DI3A 1XF9A 2CJWB 3GEEA 1X2IA 4M0AA 5TVKA 1HQYE 8ICZA 4IVRA 4G5QA 2FLLA 1KEJA 1NSTA 2OHFA 1J2JA 4LJ9A 2F43B 1D8TA 4KTQA 3KTAB 5AJZA 3V4FA 4MYTA 4BFUA 1LS1A 3BFXA 4KLGA 5EOZA 2CL0X 2Z4SA 1W36B 4QL3A 4FWIB 3VFDA 4DL3A 2PX3A 1KI6B 2JJ2D 5IF9A 1XSPA 3VNUA 3QE0A 1C4OA 1UKYA 1BMFA 1M34E 2EFCB 3RJEA 2Q3MA 4HZIA 4MRSA 3BQ0A 4ZI3A 2J0SA 4BRUA 1UA1A 1X9MA 3OE7A 5DN6A 3KL4A 5KTYA 3QPVA 3DMNA 2A7QA 5F98A 3AVQA 3JPPA 4DHEA 4YCXA 2YWGA 2RH5A 3IO3A 2BCVA 3DPUA 2BHRA 3M4YA 1OB5A 7ICIA 4IOKA 2O8FB 3VNVA 3QKSB 3UATA 2WHXA 1OT3A 1L3TA 5IDVA 3RH5A 4PR0A 3KJGA 3PG5A 4S35A 4D4LA 3CZPA 3KX2A 4M9ZA 4UNPA 1IHUA 1E2PA 1VG0B 5AJVB 4L15A 4HSEA 5J2JA 3EX7C 4TZ6A 1NSFA 3WMFA 2C8VA 3U3MA 3NIBA 4P4SB 1GL6A 2HCBA 3D8BA 3P4XA 3SZRA 4D82A 4FIDA 4O0MA 3PV0A 8ICQA 4RFSA 3OHBA 5TARA 5TMPA 1XO1A 4CIDA 1ZUNB 2NO7A 1Q12A 1YZGA 9ICIA 3U7FB 5J2CA 4JL6A 4F93B 1GRRA 2GJ8A 4MF2A 4O9MA 1L3UA 2G9NA 4OQNA 4P4OA 1N5JA 2IL1A 5DI3B 2OXRA 2GCOB 5KT7A 3TH5A 1ZD9A 3U3RA 4AYXA 4EPYA 3AF1A 4URXR 1A2BA 4LZGA 4J9PA 2QMHA 1XS9D 1TAQA 1WRBA 4Q1EA 5K8UA 1KTQA 1KZGB 1TPZA 3B8HA 3GJ5A 1Z0JA 5LB4A 2IYSA 3SYLA 2QMUA 2R6DA 1NJYA 4DSIA 4PHDA 4RT2A 3RJIA 4KAXA 5J40A 7ICVA 7ICHA 1U49A 3CX7A 5CJPA 2C78A 1UT5A 1E1RD 2TMKA 4UB2A 3K0AA 5L3QA 5E7IA 3SEAA 3ZZTA 3U5ZB 5J2HA 2OEPA 4DFKA 2QBYB 3N4MB 3E2EA 1KMQA 4ITRC 5B2ZA 3MSXA 2PH1A 4KLTA 2C9OA 1TL7C 5KT3A 3T15A 5CP2A 2XY7A 1O3YA 5KFOA 2YZ2A 2XTMA 5B58C 5J4HA 5KSZA 2XGJA 1TUEA 4IJMA 1XSLA 4C30A 1SVLA 3F0TA 4PC3A 3R7WB 3W9YA 3LD9A 5DHFA 2FMXA 1S3SA 2G83A 2YOGA 4ZV4A 3WXMA 1QHXA 2ZE8A 4Q7JB 4NYIR 1JXOA 3WRXC 1SKYE 1T4GA 2D7CA 4MH0R 2YC4C 5HHHA 1C7YA 1MC8A 5F9HA 4V0MA 3MGIA 2W6ID 5AUOB 1XTQA 4DFPA 4LBZA 2ORVA 4P4SA 3WBJA 2XXAA 2G6BA 4E07A 4TWZA 7ICFA 2EWWA 1SVOA 2XY5A 2XSZD 3BBPA 4BZQA 2Z5FA 3NBFA 1EFTA 2Y1IA 2ZPTX 1G20E 1QF9A 1MO6A 3GJ3A 1RXWA 2R8GA 1CS4C 1YR9A 1ZJMA 2IYYA 2ZEJA 5DG9A 5C5JA 2AWNA 1ZVQA 1QBKC 2ZRNA 1D8LA 4QGGA 2VP6A 4J0QA 4WA7A 5B30A 3N2IA 3RRYA 1W4CA 3BQ2A 3V7KA 1AN0A 1OKKD 4DIEA 9ICUA 2HYDA 1GIAA 4M9LA 1I4LD 2QAGC 2GVDC 3T1TA 2HT1A 2HYIC 1YRBA 1II0A 3FMFA 5A4JA 2I1QA 1E2EA 2A9KA 3OSPA 3OF5A 1PUJA 1ZNXA 2WWWA 5KSYA 3AP2A 3CRQA 3B1ZA 4O5CA 5SZHB 3ZVLA 4DF8A 2UZIR 1QG2A 4GZMA 1COWD 4GMDA 1UJ2A 3GEHA 1SHKA 2OFXA 3PEUA 4RNNA 1XB2A 4YONB 2REBA 1Q44A 1VDZA 4RCZA 4JV0A 3TQCA 1FZQA 3CWQA 3K9NA 5BN4A 4EPVA 4E5UA 3QXHA 5FBWB 3KQKA 2W9BA 3IHQB 1WCLA 3RRHA 1PV4A 3QKTA 1E2HA 4HLUC 5EP3A 3QG5A 4NCKA 4TQ9A 2ISOA 4V0OA 1U98A 3HP1A 4BQSA 4DSTA 3PR4A 1RKBA 4QZDA 1GUAA 4C9BA 5HKKA 3SJBA 3TQFA 3UMSA 2BV3A 3GLFE 1GNQA 5DLGA 1TTTA 1N48A 3VX3A 1RRFA 2WIBA 1EFUA 3R9XA 5IINA 2KZZA 4Q1CA 4CT5A 3K0CA 2GZHA 2VYFA 1ZIOA 3EWSA 2O0KA 3MG9A 8ICXA 2H17A 1W47A 4KVGA 3Q5DA 4Q1BA 1MO3A 1Z5ZA 4A6PA 1XBTA 2H1LA 3AVXA 2VF7A 3AP1A 4DSFA 5EWEA 3GQCA 3G5UA 2LYHA 4NY8A 3FGNA 4LJ5A 3RRZA 3SR0A 3TMKA 3OAAD 2GBLC 1XNJA 3X1WA 3B82A 4PAOA 1JJVA 3AUXA 4DLUA 1E1QD 2X19A 4ECZA 2Z4RA 2W0SA 1BPXA 1E2MA 2VBCA 4KODA 4B48A 5K8TA 3ETLA 4DUGD 2R8RA 4RZXA 4CDGA 4NYMQ 2OBMA 4DLZA 4OK3A 5EP1A 5H70A 1E9BA 3C7KA 4ECVA 4C0JA 2QP4A 4R63A 2VP5A 1E4YA 4U02A 4Q45A 7ICUA 1MO4A 3IBYA 4UJ5A 3MUFA 2SHKA 1JEEA 3GQBA 2KI5A 2JZBA 4ECXA 1NMZA 5EUMA 4BLSA 4KLIA 1Z2CA 2EWVA 4Y0VA 1F2TA 4A6XA 5KFZA 1E9AA 4C0LA 1QHIA 4PSVA 1Z08A 2ZUDA 5JSZB 4Q43A 4QXAA 4TUPA 1UBEA 2WVJA 5FL3A 1KK0A 3UANA 2QAJA 3TAUA 1COWA 3NVAA 3MWJA 4BWMA 4JV1A 3L0IB 4XVRA 4JVLA 4KITB 4RNMA 2NGRA 3IHWA 4OJKA 3VMFA 3U44A 1DOQA 1ZU4A 4G5RA 2MSEB 5EWGA 2RGAA 3A1TA 2FJUA 7ICJA 5DYIA 1A5TA 4WW0A 5GJWC 2QMOA 2FOLA 4GL2A 1JAIA 3OIVA 2O8CB 5J4LA 1RYHA 2J0VA 2W2XA 4UKDA 1JI0A 2IT1A 3KFVA 4FMBB 2XY6A 2PFPA 3LW8A 4RCYA 1G17A 4LPKA 4U7DA 4IW3B 4EPXA 1S0OA 2XX3A 1ZQVA 3ISDA 2C2DA 2JDID 4F2RA 1P60A 2VTKA 3B7GA 3IDQA 1QSLA 4PC1A 3QVUA 4PPQA 3AVPA 3ECCA 2QI9C 4MFFA 3GLGE 2CDNA 2RGNA 4WIAA 3TE6A 3MFIA 4Q00A 1S10A 1M74A 1WCV1 4UB1A 1CJMA 5DI9A 4I2EA 1IJEA 4LZZA 2XGPA 4AKGA 1PLJA 3PW5A 2IW3A 3RS7A 1U0JA 3HU3A 3C4JA 2B8WA 4GBMA 1ZQJA 1S4QA 3UKDA 3M9MB 4O3MA 3T5GA 2CNWD 2H92A 2IF0A 4HEJA 4M1YA 3GFKB 3Q7QA 4GMXA 4PHEA 1ZBDA 3HR7A 4B9VA 1M7HA 5DGXA 4KFUA 1SKWA 3EZ5A 1ZC3A 3AU6A 2OLKA 1NOMA 2BBSA 4BLRA 3TUZC 2RHMA 3X1DA 4Q9KA 3CX6A 3A58B 1VTKA 4URUR 5KT6A 1QHHB 5M04A 1YU9A 4TLDA 2F6RA 4B32A 5JFGA 2I1VB 1G3QA 2PZGA 1F2UA 4Q18A 3UMRA 4M9JA 3I32A 3G82C 3SFVA 4RPXA 1VHTA 4P0TA 1U4BA 1BMFD 4ELVA 3NTUA 5DG7A 3FDIA 1G3MA 3GFTA 1I4TD 5JLJA 3ADDA 3LAWA 4KJZA 3RH4A 4DQIA 5CIQA 3ZVRA 4AYTA 2WWGA 1VG9B 4JWNA 4Q7LA 4DT1A 2FSHA 8ICIA 4AI6A 5KDDA 1CULC 3T1QA 1ONBA 1X1RA 3RC3A 1T91A 2ZSEA 821PA 2G0NA 1ELOA 1SL1A 1ZQNA 2ODBA 4M1TA 3THWB 1CF4A 3B9QA 1LW7A 8ICOA 4DT1B 3HT3A 3IGFA 4IKEA 4ZCLA 4FCTA 4YQFA 3FWYA 2MUTA 4KLFA 3ASYA 3KHGA 3ZYCA 1H65A 2NZJA 2REXB 2B21A 1EG7A 2P5TB 3AV0B 3M8SA 4JL5A 4TYQA 5DLQC 2HVIA 2W2TA 3RANA 4R8UA 1G41A 2ZQ5A 3CLVA 3OE7D 5DN6D 1OJLA 3KXIA 3PUVA 3JPOA 2GEDA 1X1SA 4B47A 5KHOC 2CMKA 3FPAA 5L3RA 5KFEA 4G5OA 4YG2A 1YZKA 3SJZA 1XX6A 3HDTA 4ED3A 4LVSA 2ZE7A 3BGWA 4ECSA 1E0AA 4RD1A 1N56A 3EZ2A 5AJWA 4EBEA 2CJWA 5BQ5A 4E0DA 2ZRHA 1LV5A 5J2KA 4FO6A 2ZRMA 1N6PA 1J8YF 5DSZA 4AC9A 4F91B 2IMWP 2HHWA 4FMCB 1ZETA 1SULA 1E2QA
chains in the Genus database with same CATH superfamily
2PGNA 3MGBA 5KVQA 3FC4A 3CW2A 2JARA 3G59A 5CYOA 3EB9A 1I6LA 3RRGA 1QKJA 4OYRA 2FP4A 2GK7A 3HKDA 5HDBB 5JWHA 3OEEA 5AK6A 3SF8B 4AJ1A 1KK2A 1JT2A 2PMWB 5EPUA 5FBKA 4C4SA 1PT7A 3B5IA 2NAPA 2VRBA 2AZTA 1WDWB 2DH5A 1NR7A 4ND2A 4XGQA 2PI4A 4FS3A 3BRWD 2VPYA 1MC1A 3CN7A 1Z7WA 1ETUA 4N3AA 2QRHA 4BCBA 4CYMA 1FYEA 3U1VA 3PMNA 1QFXA 3VKGA 2WB1F 1PKEA 4UM5A 2VK8A 5L3SA 1ZQ1C 4N5LA 2I29A 5TLSA 1WABA 5GIPE 2P4QA 4FNAA 1U7HA 2C4MA 4OBWA 5DT9A 1SHTX 3EZ6A 4A23A 4HS4A 1UP4A 4OKSA 5I51A 3P0JA 4FQ7A 4X5OA 1G8KA 1DRUA 4O2BF 4XYBA 5JRTA 3AGQA 2GF2A 2J3HA 2W83A 2IH4A 1Q14A 1N2OA 3P52A 4D43A 2V3CC 4L3WA 4ZDIA 4YJ2B 2FFHA 3ZXYA 1FVXA 2WZCA 4UUOA 4BS9A 3LTNC 3U56A 5I7SA 1K7FB 5JJIA 5AXAA 4QZGA 3PVXA 1FLAA 2RGUA 3JR7A 1Q19A 1KQGA 5J47A 1Y1LA 3C1AA 5DGHA 1S4MA 4BTVA 2JA2A 1RKQA 1NBMD 1TM1E 2N1BA 4F45A 3I1JA 4EYKA 4YMMA 3E82A 3PX4A 1K1SA 4QQKA 4XQGA 2P9TA 3TR6A 2Y1FA 5JXIA 1GR0A 1N2HA 3KWLA 3O0FA 3WHKA 4D8TA 4F11A 5LUBA 3OIUA 3KTQA 3VC7A 5BORA 1XNRB 1FNDA 4POAA 2ISPA 1WDTA 4BMYA 1PVDA 5AWFC 3R3UA 4F2HA 4YPFA 3KB2A 2NG1A 3QPWA 3AM1A 2CKMA 3OQIA 2JI4A 1SG6A 1H6CA 2XCTB 4FCCA 2IHTA 4MV6A 2YOFA 5D87A 1A98A 5DTRA 3I6ZA 3E3LA 3RNOA 4KE9A 3H9EO 4DM3A 3BGDA 4PAWA 4RUCA 4LC9A 3FVQA 2I6UA 1QH9A 5IDYA 4CMEC 4RAOA 3SSOA 1Q7TA 3LXRA 2WJGA 4IJQA 1RW4A 3NGMA 4YRLA 2BBOA 3FNIA 3RBZA 2KM1A 3ORSA 1Y7LA 2BGKA 2M6SA 2WKQA 3OPYB 1R00A 1KP2A 3WA7A 3IDSA 2ZJOA 1L5QA 3GRUA 2VAWA 4HRVA 5BRNA 3I05A 3SXPA 3VO9A 3CLKA 3MUNA 2I6XA 1OUMA 4I1IA 3QFCA 5HS6A 1TQ4A 1I30A 1U8TA 4L72A 5TQ2B 4FN5A 4B6RA 4P8RA 2QYTA 2GF9A 1NJ5A 1TO6A 5K4LA 2GZMA 3O8LA 3WGNA 4QUIA 2H3VA 2R97A 3DVAB 2ZKIA 4NENB 2FG6C 3FAKA 3OQ1A 1IM4A 1TKAA 4MKRA 1BS2A 2PX0A 3I5YA 3KHRA 4EM6A 2J87A 1F0NA 3FUVA 9ICQA 2DECA 1LDNA 3PDCA 2D2VA 4JJKA 2YRWA 1XHEA 4YAKA 5F2NA 5SZIA 1J0DA 4PS0A 3N5CA 2EFHB 4N9QA 4QLBA 2IP2A 1QXSA 4Q21A 4DUPA 2WWYA 3A7DA 5TPZA 2CNBA 2JD1A 1L4KA 4G9EA 2NM0A 3ZLUA 3ZHUA 4JP5A 4MW7A 4D25A 1YGYA 1Q0TA 4WACA 4RTNA 5KFCA 2I67A 4F4UA 1JIUA 1T0JB 2CXQA 2FXVA 3H42B 3E70C 2C4WA 3FVVA 3MJHA 5HKBA 1OREA 4A8JB 1IN8A 1PNVA 1U9CA 2FQXA 4H77A 3THYA 5M2QA 2PYIA 1Y9DA 3HFRA 4IXNA 2GEVA 1T36A 3LT5A 4TN1A 3IMKA 3TR5A 4IR9A 3VNSA 3E9YA 3LJKA 3EZFA 3RYCB 3R5SA 4GLXA 2VQSA 3GIMA 1RZ3A 4JZKA 2FSFA 5JDCC 1YQEA 3WLIA 1DAOA 3BS7A 1TCBA 3RU3A 2XB6A 1PT6A 4KPUB 1XZBA 1ZOSA 3VR5D 1Q1EA 4LDZA 2HK7A 3GZJA 2ZI7A 1MPTA 2YXLA 2QMQA 4P6VF 4XD7D 1O5TA 3LRPA 5HYVA 1AKWA 5J2UB 3ZV3A 4UMFA 2PGOA 1C0LA 1WZEA 3PRKE 3PX7A 4B4WA 4XWYA 4MW0A 4RQ6A 1JIQA 2P41A 2QDKA 4V0QA 4AWXA 4JXXA 4CKWA 2OVFA 3KPYA 3ONFA 5ALKA 3I2FA 5FA6A 1KYZA 1Q0RA 2X15A 1SNYA 3KU4A 1X9HA 4QZAA 3PVCA 3QKUA 4BVLA 1FFDA 3RV3A 3WLHA 1OH5A 2FGJA 3TW0A 3SVZA 4BFXA 3ASVA 9ICLA 4CLEA 2EVWX 1NWCA 5DASA 5KYGA 4DSJA 4QYXA 4MINA 4TL8A 3W90A 1MKYA 1D9FA 5JNRA 5F51A 1GZ7A 2ZRFA 2X8AA 1E0JA 1FSGA 2XZTA 1STOA 1SURA 3LBHA 5AQ1A 1RIFA 4C6RA 4F1KA 5JS8A 3K3PA 4S04A 1PIWA 1LX6A 1Z0AA 1WBBA 3DTTA 3D6VA 4I9UA 3RTEA 4ZKDA 4G24A 4UCQA 1DCMA 2CEKA 1WHTA 5YASA 3X3HA 3T7DA 3QU2A 1TA9A 1E5TA 2E4YA 2JHDA 1JHMA 4DWOA 1K4KA 4ETWA 5KYVA 3WFJA 4KR9A 1AKMA 3FI0A 5G4KB 1Z6ZA 3SZMA 1GRQA 4EG4A 3X2FA 1WM1A 2E18A 4TSFA 3FI9A 3WL3A 3KZKA 1YB2A 4H3SA 3VR3D 1NY5A 4OAPA 2ZT7A 4TTAA 2K4HA 4MS3A 2O3JA 2XRFA 2IXGA 1YZQA 4M2LA 1NJ8A 2CEAA 4X1OA 1OLSB 1PGNA 4RZ3A 1GT91 1UEJA 1AG9A 1JYFA 3PICA 2HBRA 1A9PA 4PLPA 4A8PA 3F6BX 2O2JA 4LMRA 4YUWA 2NN3C 1EVQA 4IHQA 3ZGZA 3LYAA 4B9SA 5IANA 2XB9A 1O1YA 5AM1A 5J2UF 5KVSA 5D86A 3VQTA 5DDMA 1KGDA 1SHJA 3T35A 2MSNA 4FIZA 1JQLB 2CL7X 1GUDA 2PFSA 3TZLA 3T1YB 5EZ6B 3LLVA 1TAUA 1ZIYA 5SZJA 1OQAA 3EGOA 5JRJA 3JZFA 5A62A 3QEAZ 1QVAA 2XMQA 4UJ3A 1W6UA 3VHRA 4A27A 5GJBA 4FB5A 1WQ1R 4HH4A 1T25A 4NONA 2R7LA 5EJMA 1YMUA 3SHTA 3TQOA 2TS1A 3COZA 5K0GA 4JJZA 3RU2A 4UU7A 3TADC 2YJ4A 4ESEA 3WU2U 1HYBA 2AJLI 4RC9A 3NRWA 3F7OA 1CF2O 2PL1A 3HJAA 3B3QA 3X1KA 1M5UA 3OPXA 1KEUA 1N6IA 1THGA 4ARAA 3H4IA 3QV1A 3QNUA 4KMUA 2PRSA 2KG5A 3OE1A 3G8DA 4IHJF 3TSCA 2O8BB 1AXRA 4IINA 4BNZA 2DHQA 3D2SA 1DXQA 1GUZA 1ZSNA 1YULA 2FA9A 4ODIA 2ZI4A 4U6QA 1ZR4A 1UPFA 4OXXA 3BT7A 2HHUA 2HDOA 1KQ3A 2J6UA 2G06A 1G9SA 4L50A 4JUBA 2FZEA 1CD5A 5ECDA 5C3UA 2PDAA 4CKEA 4KJXA 1CERA 2OCPA 2C5HA 1QRUA 2BKEA 4LWQA 2BC9A 2YHUA 4RGVA 1YFKA 5L9XA 3GWGA 3PFWO 4QXMA 3DC7A 4IO0A 1BKSB 1OXJA 1KYWA 4EY7A 3HZOA 4NSNA 2JXJA 2MDTA 3FIUA 1A04A 4L8WB 1PNTA 1DC3A 4BOYA 1C7FA 4KE7A 2B8NA 3F3SA 4R2MA 4HP8A 4RS3A 1Q83A 3REQB 2A4KA 3OBIA 2Z8YA 1TQ8A 4M9QA 2DPGA 3W8DA 3ASZA 5G1OA 3WISA 4DILA 2VAMA 1L0BA 1WR8A 4JOSA 2PGXA 4QRDA 4ZEWA 1GARA 5J0TA 1DINA 2ZYVX 4JLUA 2PKCA 5EFOA 1GM5A 2QTTA 3O3OB 1ORTA 1Z12A 4OA5A 4OI1A 4BQQA 3CSDA 1XVUA 3MCZA 4KE8A 4R64A 4ZOLA 4GD3Q 2IQIA 2KSQA 3FSRA 4C80A 2DHRA 3LHSA 4HBGA 5ALXA 4LZOA 5G3YA 2DUYA 2FMPA 3RAJA 4NWIA 1N2GA 1PFWA 1XZCA 4W5WA 2XMZA 3C24A 5CM9C 5BSFA 1RWBA 1C3OA 3A6FA 4RMIA 3UXMA 2KZ3A 2C4KA 4DEXA 1FUKA 4WOPA 4XEHA 4DAEA 2O06A 2ZDQA 3B1WA 3NHPA 4R81A 4WKPA 3ZXXA 3L4KA 4UUNA 1HEYA 5AQEA 5HR6A 5FTLA 1Y3CE 3IR5A 4ZMBA 3FHJA 4JP8A 4LDRA 3SV3A 4PX3A 3A2MA 5CVTA 5I4CA 2BYTA 4F4IA 2QXTA 3LNCA 4QG7A 5JDIA 2BH2A 1Z5PA 2HU7A 1AX9A 4MV1A 5FPPA 4PG7A 2OFOA 4RY2A 3RC7A 1AXGA 2J9FA 3THVA 5IAKA 2AGOA 4MB2A 1NN1A 4J6EA 1P1FA 3PWSA 1FX0A 4MI1A 1VE7A 2P2ZA 2FWAA 3K5HA 3KJNA 4NJOA 4CL8A 4PCLA 4XAQA 3LBFA 5ALNA 2GM4A 4LOHA 2Z98A 2JK1A 4O4JF 4D4KA 1B15A 5JYEA 3GIJA 1UFOA 1LI5A 2LKDA 3P2MA 4FE4A 3IVCA 4K40A 4XJXA 1HQCA 2GM9A 3L6BA 5AR1A 3AI2A 4GICA 2QNRA 1U2QA 2GDJA 3TOZA 2ODTX 3KOXA 4QOFA 5EIBD 5C1OA 1H2ZA 1V2HE 3IQDB 3WWYA 3SVLA 4P08A 3KUUA 2LCFA 4FYYA 4IPTA 5L8VA 2X5KO 1DIHA 3GIDA 4MWZA 4A2WA 3IEMA 2BMDA 3TZHA 2HNAA 2DCMA 2ORWA 5DKWA 3KKAC 3IL2A 1USGA 3CMCO 3IUMA 1PW5A 1Q1QA 3ANNA 1YJCA 2CXXA 1FRQA 4Y9RA 1DMSA 3INRA 3KBOA 3KPVA 3S1SA 4H6WA 4RDCA 3SNKA 2FGKA 1JAZA 3HJTA 1U7UA 2WAAA 1VSQA 4XZ3A 5BN5B 1OXSC 3FE2A 3VDRA 2UYQA 1H6BA 3IJ5A 2BQRA 3CX8A 2I1LA 1XVAA 1Z3CA 4ER0A 2FE1A 3E8XA 1T9DA 4KSBA 2TMYA 4JLAA 3G0GA 3W5VA 3V6JA 4DL6A 5DXJA 3ZD6A 1GCGA 3CF4G 2YVAA 3DA8A 4LCJA 3ZIAD 4H15A 3S8EA 3OD1A 3PHLA 2FQQA 5CVJA 4QYSA 1RXEA 4DQUA 3ZU3A 3O74A 5IP5A 4ZAYA 4HRAA 5AHXA 1QG6A 2FOXA 3GPIA 4S1OA 3PPIA 4IQWA 1YIOA 5SY4A 1R8QA 3QPDA 3PFBA 2OP1A 3QXSA 4CQLA 3WKEA 5EWFA 2HQRA 4ND5A 3AF3A 3F6EX 5CFMA 2RD2A 2J5BA 1IBMB 2ZWPA 3O94A 1BPBA 2MWMA 3KKOA 4GU5A 2ZIZA 3ED5A 4Q3KA 2LKYA 3QWHA 1DRGA 2HW3A 1A88A 3LUAA 4F2PA 3T4XA 2QSZA 3S7TA 1WPXA 3C3XA 4FDTA 4QHTA 5CYPA 4HB4A 3X0DA 2YCBA 3TGWA 1H8EA 3I58A 1QPGA 5ALRA 1K7SN 1X8KA 3V4FA 3V7LA 2C0CA 2XNDA 3IAS6 4A15A 3DE2X 5IW8A 1UBGA 1IXRC 1WL8A 1NXSA 5DM4A 1QSGA 4LXIA 5CLIA 2JF0A 3MBKA 4BNJA 1X0VA 2FRDA 4OB7A 5JH7B 5J5CA 4GOND 2GZ2A 1JI7A 4MB0A 3EOZA 5DTEA 2PRIA 1L5KA 1T3HA 2A58A 2J3EA 2VAVA 4BDTA 4F85A 2XCRB 3M6XA 4UXIA 5A5DA 1O6CA 3KV3O 2H7VA 2V4MA 3ZQ4A 1T8UA 3PNSA 3K4HA 1L5UA 4H3KB 2XKBA 3RPEA 3OQHA 3CA8A 4TQSA 4YP9A 1E89A 2FR8A 5CD9A 1XTBA 1UXJA 2AMYA 2IWRA 2YIJA 4N39A 3MDAA 2RCNA 3WFIA 1A69A 3TL3A 3W1WA 4JASB 4ZVOA 4BUGA 4B71A 1SBQA 1I7LA 3IBCA 3RODA 1N78A 1SHUX 3KZCA 4D8WA 3KQOA 1RZRD 4ZVKA 3G1UA 3PIDA 3A0UA 1IN6A 2BPCA 1VOTA 2GTPA 1L5ZA 3AYXB 3IAEA 3KZMA 3EDOA 3EPRA 3IHTA 1U9ZA 4QZIA 1QAMA 3NP7A 4IUBS 4Q3EA 2AZ4A 5KTNA 1KL9A 2FLPA 3DB1A 4WL0A 1EBFA 3CRNA 4S05A 1YQQA 2BGRA 2CLLB 3CUVA 1SB3C 5FBZA 2IKSA 2KNJA 1UBLS 4GQBA 1GWNA 1W76A 3JQCA 3T9AA 1TKDA 2ZI9A 5K3FA 1GAJA 1M72A 2G72A 4OHOA 721PA 2WT8A 3I9KA 4Q3OA 5DNVA 2GHIA 1KBQA 2JJ2A 2O7VA 2GDZA 1CUYA 4AYWA 3E3AA 3F5FA 2B1GA 3LPNA 2IWHA 2GZAA 2Z0MA 4ZGGA 3RYIB 4YS6A 3RYCA 1C9DB 1GD1O 1G6HA 2PFKA 2GNAA 2APJA 4CTMA 3LLCA 4X1YB 2O6LA 4XQEA 2NO9A 1JS1X 1POWA 1T3ZA 2MYUA 1M8PA 3NHAA 4GPEA 1TT5A 1ZN9A 2CLEB 2H08A 4ZOBA 4ZCSA 1QX4A 5J2UA 2ASEA 4LDQA 5KFYA 3E7FA 2MU2A 2V97A 3M4JA 1W75A 4GXRA 4PZAA 4WOJA 2MMCA 1N2XA 3C3EA 3OI7A 4RYDA 1QIKA 4I27A 3HZZA 3IG5A 2OWDA 3GPDG 5E9WA 1YZ7A 7REQB 1P19A 3LC2O 9ICFA 1LD3A 1Z06A 2BZSA 2WAMA 3CONA 5GPBA 4DLPA 1ZFNA 3VR3A 5LQUA 4LFAB 4Z8XA 3QVMA 2CV0A 2HBYA 4YN3A 1FFXA 1DS6A 1Q77A 1AS2A 2ORED 4YXWA 2XUJA 2H0AA 1W6RA 3H0RB 3Q8SB 1A27A 5DLYA 5TT1A 4YJDA 3T1HB 4NG4A 3ILHA 3DC2A 3GJ4A 3UXPA 2H1HA 5FTMA 2Y0DA 1LU9A 3UK6A 1ZQTA 3WIBA 3KQLA 2ATXA 4LC0A 2B3TA 2MHCA 4XGNA 3ZIDA 4QZHA 4EJ2A 4ECUA 4HYTA 1NLFA 1YFZA 2PQMA 4Z5XA 5ICCA 5AM5A 5KPJA 3ROXA 3TBKA 1NN3A 1U80A 1XTJA 1X7WB 4PO9A 3RRFA 4O2LA 4XRHA 3BMNA 2IX9A 1UT6A 3RH6A 2C92A 2IITA 2Q4OA 1EEHA 4OFZA 4PC6A 4RNCA 1NJWA 3NVVA 3ZNOA 4KDFA 4RQAA 4GI1A 4WESA 3RAXA 4YRTA 1KYTA 4FM9A 2F4NA 1M5TA 1ZXIA 4DWVA 4FWBA 3W3ZB 2COEA 1A7JA 5JJBA 3KUCA 4IS2A 4QWEA 2O3UA 4OVKA 3TK1A 1LK7A 2WU0A 1EJ0A 2Z1DA 1ZQ9A 3MRXA 4R8KA 5CDTA 3D7SA 2JAHA 3JPYA 4J94A 2WAYA 4HGZA 1CUKA 4Z3KA 3D8TA 2IY9A 3HU2A 1BVYF 1Z7GA 2VUSA 3NBUA 5INTA 4DA9A 4IQTA 1Y82A 1W0CA 4PHFA 3QPBA 3ZHXA 3MFYA 2CW5A 3RSZA 4B3DA 2DFTA 4FDVA 4J3NA 1XL0A 1ZMBA 5TZVA 3PKZA 3RUAA 4DARA 2FR0A 3ZWBA 5HBGA 3AT1A 1XCPA 3NVKI 2PA3A 4HX9A 3RS0A 3TJMA 4LGCA 1FP6A 3GJ8A 3L9WA 4G1FA 1LPSA 1O2DA 1F2VA 2J48A 2UAGA 3QTTA 4MYSA 3EGCA 5DRTA 4D4GA 3S2UA 2OXIA 2DUWA 4K05A 4R83A 3DOJA 3EGXA 4J76A 4YVFA 5ADUS 2ZG6A 2W04A 1QDUA 3LWDA 2PXHA 1LWOA 3U9SA 4KX5A 2CWWA 3FZYA 1GAQA 2ODAA 1YZLA 2Q5FA 3O4GA 5KKCA 2WFLA 2A1UA 4XA8A 2VA3A 1NKTA 3A31A 5JSFA 4CQNA 4B3BA 2WU4A 4YCSA 4QZ8A 1UBUS 2YWXA 3I6MA 4ALIA 3DEFA 4CLOB 2QSJA 4UEQA 4CZ2A 3AB3A 4W1RA 1N4AA 4KQCA 2WHPA 4PPXA 4AY2A 3O7WA 4MUJA 3CSSA 4WNYA 2QX7A 4LHYA 1R9GA 1BVUA 1RM3A 4FDLA 5I7VA 4ON9A 2G9RA 2IX3A 3K9FC 2AE1A 5I8PA 1C14A 2J9XB 1E4VA 3ZLTA 2P6NA 1YHNA 2E37A 4TT3D 3LX4A 5E95A 2CVQA 1OYYA 3C70A 4Q1AA 3RQSA 5DB8A 3F4KA 3A4LA 3CV3A 4IVNA 3P19A 4EQ6B 2AZMA 3GUVA 2Q9UA 1FDUA 3RASA 3ZIAA 3MOSA 1EZ1A 1GPH1 3UHPA 1E4EA 1X7DA 3Q3GE 1NUAA 2QAGA 5BUQA 5IJ9B 2WNSA 5DGIA 3X44A 4PGXA 1K63A 4YCJA 2ACWA 2FW7A 4C5BA 4CM6A 3ZNPA 5FNVF 2NRWA 1K0FA 3F3MA 4V3BA 4YV1A 1W88A 3WG9A 4EX7A 3K94A 5EC8A 4EYHB 2OXCA 2DG2A 3TADA 1IJBA 3FKSA 3QE2A 1UF9A 2H11A 5JG7A 4ED8A 3BWDD 3TSZA 3BWVA 2VPPA 2QX4A 2FPGB 1TIBA 3AR6A 3BCUA 3HJFA 3U81A 1GAXA 2I9KA 4S2EA 3CCFA 4IRMA 4N0EA 1Z0KA 4QNNA 3WYGA 2AH5A 1I4DD 2D4AA 4MQEB 5JCJA 2JGJA 3PJDA 1FTQA 3PEVA 2ZQYA 4PLYA 1WTCA 1JP7A 2DWOA 3GLHB 4KLZA 4DCCA 3HKZF 3MA0A 2QT1A 4PQGA 4YECA 3HB7A 3I9JA 4DG8A 1FQOA 3CLRD 5KKNB 1OA1A 3UK0A 1UHUA 1CYDA 3DWEX 3JASA 3H4BA 5KREA 2ZRDA 3L8DA 4RPHA 2CK3A 2I9PA 4R01A 2O1XA 1TK8A 1I4WA 4EECA 2Y0PA 1Q22A 2V8OA 4YGYA 3LVBA 5EA2A 3WWOA 4ZJYA 2QMYA 3ICXA 2YNMD 2C99A 1NYLA 4KMRA 4JU9A 3SLRA 4F3CA 1IIRA 4B09A 2PKRA 3RIGA 4MI3A 4C0KA 5FWXB 5JCXA 1VPLA 3I61A 3WC4A 1O94C 5H81A 5TJ9A 2AU0A 3VR6H 1UC9A 1Z7EA 4G4IA 4G0QA 2DL0A 5KOHA 1XGKA 1UM9A 5FWXA 1BDJA 1SK8A 1SVMA 3T7SA 3GJSA 2ZYTX 5I9BA 2B94A 5GM2A 3WL8A 4BQEA 2BFBA 3IMEA 3ROKA 2XB2A 2UZ1B 1G63A 4I2JA 1ZH4A 3T9BA 2BBTA 4K2HA 4J0GA 3ZI0A 2KV2A 1I7NA 3W3AA 4BNTA 1SCNE 2PR2A 4K3VA 4Q9NA 1YKFA 5LLTA 2P66A 3KVNA 1ATIA 4IQUA 2ZRKA 4ADSG 2RAVA 3JQAA 1ES9A 1ZD8A 3JQAD 4O25A 3QHAA 3WSTA 1E0DA 3H86A 4PPFA 3WB1A 1JN3A 4DC1A 4OUDA 1U1EA 2C04A 3U4DA 4CTOA 3ONWA 5EXEA 4W5HA 3TRKA 3JAWB 4B6PA 1R3DA 3H1EA 1V1MA 8ICRA 2EU8A 4KIJA 5J2TB 2PVCA 5CA0F 3IYLW 2DZDA 1NN0A 5FFNA 2Q5IA 1M8FA 3TDNA 1EP1B 2P40A 2JAWA 4G41A 3EASA 4ZQIA 1S0UA 2HJSA 2OCGA 4HDOB 4KQ9A 3UJHA 4ED6A 2AT1A 4MKFA 4R9RA 1RHUA 4NLBA 3SYRA 3PC7A 4KR7A 3A37A 2CVPA 2LPMA 3N2YA 2MJLA 4GLLA 1N8SA 2FFBA 5J2GA 4DEZA 2FJPA 2NVWA 2W6MA 4JJ4A 1H1LA 2QN8A 3NASA 3HVIA 3R7SA 1HO3A 1P17A 2NRZA 2R5WA 3LYUA 4M98A 4NBTA 5DLFA 1WCIA 5JATA 1NLUA 3FMIA