3LDBB

Structure of jmjd6 complexd with alpha-ketoglutarate and fab fragment.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
217
Chain Sequence
b'DIVMTQSPSSLAVSAGEKVTMSCRSSQSLYYSGIKKNLLAWYQLKPGQSPKLLIYYASTLFTGVPDRFTGSGSGTDYTLTITSVQAEDMGQYFCQQGISNPYTFGAGTKLEIKRADAKPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLSSTLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional arginine demethylase and lysyl-hydroxylase JMJD
publication title Interaction of JMJD6 with single-stranded RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbB01
5I15H 3MUZ1 4HUVA 2F19H 4XB7A 3VFWA 2FJHB 3CDFA 4XCCL 3LDBC 4LCWB 2GW5A 5T1LD 3H3BC 2PO6C 3QIBA 1WAAA 1D5XB 1QFWM 3OJDA 2ZCHH 3VG0H 3N9GH 3L9RA 5E99H 3RVUC 5AYQA 1A9BA 3B9KB 4HIXL 2K7QA 4PJIB 4IIQB 4JVWA 4KROC 3KAAA 3OB0H 4LCYA 3PHOA 3U9PL 1QKZL 2C1OB 5JHLH 4QRSA 4ZUSA 1Z9MA 4OT1H 2ZUWA 5IIEA 3DOSA 4WUUD 4LLDB 5FV2A 1X7QA 2NW2A 1OB1A 1W72A 5IOPA 3ULUC 1XGRB 4KFZC 1R3JB 4MD4B 3MV7B 2X44D 4MNGB 2X9XA 4M7LL 3ARDC 4RMSA 2I24N 4GXUN 4ELME 2XOTA 2EKSB 4X6DA 1RZKC 4PYGA 5KG9B 3MUY1 3U46B 3GIZL 3UDWA 5I18H 5LGHL 1UH4A 5INDB 1MHHA 3T3PE 3BQUC 4XI5D 1BVKA 4YXLL 1MRCL 2OJEA 3RUGB 1Q9WB 2MMXA 3WFEL 3MACH 4YFLI 5KJRL 1FG2B 4V1DA 3F7PC 4PJ9A 3IFNL 3PP4H 2OK0L 1K6QL 3CDGB 1LK3H 2WP3T 2VWEE 3MRMB 1YN6B 4X98B 3GSXA 1OL0A 3C5ZD 3G08B 4BZYA 4ZNEA 2A77H 3AFLA 1QSEB 2NCMA 3BIAX 4Q6IA 3OX8B 1BZ9B 3G6JE 2X4QA 5BOZG 4D0BA 3S88L 2YPLD 2X42A 2DLGA 1NBYB 1A6AA 4UAOB 4NSKA 5ENWB 2HT2D 2IFGA 4J3VA 4DK3A 2V7NA 3KJ6L 2AJYH 2P5WB 3GMRA 4WNQA 5E9DD 1DBAL 4C58B 5J1AA 1U8PA 5F3BB 3FB5A 3K8KA 3OXRA 5DD5L 1KLUB 1U8MA 3L3JA 4FA8A 1TXKA 1ZT1B 3V0VB 1FE8H 1KB9J 2OP4H 4CN1A 2P7TB 1JV5A 2VE6B 1GOFA 3PWLB 4XP1H 4M7JH 3S34L 1JPST 4PRHA 4NQUA 3P9MA 1OAUH 1S9VA 3Q2CA 3HE7A 5D6DA 3FQWA 5DJ6A 3V4PL 4U6XA 2BSSB 1JGEB 3RTQD 4I18B 5EIIA 3T65B 3QWQB 4X4YA 3VWKD 2ESVE 2W65B 4MD5B 5EU5A 3RDTB 2ZOKB 3HA0A 4NHUA 4MDJA 2P43B 4LSUL 4BZ1H 3ARFB 1J0KA 3GSOA 5H35A 1QNZL 4AH2A 1EEQA 1WWCA 2EDFA 3ULVC 1LMKA 4ONOA 3HUJA 4ZUWA 4LSTL 1UKSA 1VCAA 1L6ZA 4APQD 5HI5C 4NRZB 2EH7L 3B2UD 1NL0H 3V8CA 4OZIE 3GSNB 4JKWA 3SE3C 1YEHL 2KKQA 2AJ3B 1D9KA 3PWJB 3PDDA 3TA3B 4ZTOL 4HKZB 4ZFFA 4I0CC 1U8LB 3OV6A 4N0FA 2RJMA 5CHNB 4MJ6B 5E94A 2QSVA 3P73B 3E6HA 5CWSB 3EFFB 3OXSB 4JFYA 4Y7MA 4NO5A 1S78C 4OLYH 1P7KB 4NT6B 1FLRL 3GIVA 1JP5A 2ZCHL 3L3DB 4JANB 2L7UA 3CXDL 3HC0A 3N9GL 4JFEA 5E99L 4JKLA 3T4YB 1JZ8A 3MV9A 1SMOA 2R56L 4YWGH 2Z35A 2HTLC 5DXWA 4G6JL 5C2BL 3F5WA 2WWMD 4X4ME 3L7EA 2WUCH 4OLVH 5JO5B 5MEQA 4OT1L 2ZP0T 4PGDB 1DBML 5AUMA 4L8CA 5GGQL 3G9AB 4N9GB 2OYPA 4YBQC 2AI0L 4KI5C 1H8SA 5ISZD 1XF3A 3O3DA 1QFWH 5CJQL 5DK2B 1DN2A 3RX5A 5IESH 1FFNA 1U8QB 1VEOA 4XC1H 4U1SB 4R97C 2ARWA 4ORGB 5I18L 5CEZE 3QCVH 4PJ7F 1BJ8A 3WFDH 4GXUM 4U6YA 4AIZA 5DMYA 2UZYB 3DIFB 1HI6B 3IDIB 3VD4A 4WUUE 2YZ8A 1QBMH 3MACL 4TUJA 5HY9B 1JWMB 3IJHA 2PYEB 3U0WL 5AAMA 2XXCB 2VZ1A 3S37H 1MRFH 2HN7A 3MLWH 1BFVH 3ROOB 3KHOA 5IMMA 1FO0A 1U91A 3TN0B 3VGDA 3G04B 2CLZB 4HWBL 5D2LA 4OFPA 3NCJH 4BQBA 5BCAA 2X89D 1ACYL 4JFHD 3KPSA 3MXVH 2P46B 3QFJD 4XAWH 1IZKA 2ZJSH 1Q9KA 4LLVB 2IBBA 3IB4A 1MNUH 5JPMA 1NQBA 2MPAH 3SDDA 4YDKL 5IFAH 1HNGA 3SDCB 1G6VK 1KCVH 2VABA 1SYSA 2OQJB 5BXFB 4S1SH 1QRNA 5SV4A 2OP4L 4P3CH 5F7EH 2Q86A 5CEXB 5JTWA 2YPLE 4JO2H 4NQXA 4MNHA 4JFFD 1NAKH 1LNUB 1JUFB 1OAUL 1NEZG 2H32A 3PG2A 3VGGA 3BUYA 3X11B 5IBTH 2H41A 3QDMD 3QQNA 4TYUA 3HZKB 5FOBA 4OCYH 4ELKA 4GG6B 2FLRT 3KPTA 3LV3A 3S3JA 5HYFA 5I8CA 1VGKA 5AZEH 2XTJB 1U8IB 4OLZH 1OOAA 3QRGL 3D9AL 4KZEL 4OD3H 1MAJA 3MRQA 1G9MH 2JJVA 3CPLA 2I60H 3TNMB 4Z7UE 4RZCB 1XR8B 3BZEB 4JO1H 3LQZA 5EORH 3UC0H 3BIKB 1UXWA 2NW3A 3JBG7 4PTTA 4A6YA 3O9WB 2I9LB 4DZ8B 1AGDB 1MCNA 3LEYL 3NIGE 5DUML 3MJ7B 2EDTA 4WFHE 3W11D 1T83C 2A6JB 2A6KB 3UYPA 3PDOB 1SJHA 5ALCL 3G6JB 1NCNA 4QRPD 1MI5E 4K7PL 5JMOC 5JOFA 4PJAB 1KEGH 3B4NA 4YWGL 5KS9A 3VI4E 3OF6D 1BVLB 2GUOB 2DWDB 4NO0B 4JFPB 4P46B 2WUCL 2Q6WB 4PJIA 4IIQA 3TT1H 3C8KA 3MJ8B 1KCSL 4PGEA 2ICWB 1BIHA 3WFHB 2ICEA 1CFTB 3V4VH 3GHBH 4UINL 4Z6AT 1M05B 35C8H 4LSDA 4M1CC 4MS8D 3LH2H 1OSZB 4LLDA 4JLRA 1U8HB 3REVB 1XGRA 3MUJA 2VXSL 1R3JA 5GGSB 4MD4A 1SHMA 3IFLH 3P4NB 4MNGA 5IESL 1FGVL 4ODUB 1V7NH 3AGVA 4XC1L 4BUHA 1ORSB 3VI3E 2JJWA 3RY6A 5K9OB 2EKSA 5IQ7H 3QCVL 2X09A 5KG9A 3WFDL 3H7BB 3ZDYF 4FG6D 3G5YA 3SGKA 3U46A 2HMID 4TSCH 5FK9B 3W0WA 3P4MA 5INDA 3MJ9H 4Y1AD 3UTQB 2EC9T 1MY5A 1RK1B 4HC1A 5IEHB 5TQ0H 5ACLA 1CFQB 4XMPL 1FG2A 1BFVL 3V7AG 3WUWB 1C16A 2DMCA 3DXAD 1ZLWH 1DQQA 3CDGA 2BXZA 4P2RB 2GHWB 3SKOA 4GQ9L 3MRMA 4I0PD 5J06A 1YN6A 4X98A 5H94A 3CU7A 3G08A 2EO9A 2C5DC 1JF1B 3KHQA 1QSEA 4XAWL 3OX8A 1BZ9A 2D7MA 1GCFA 4OCMC 5B21A 3NIFF 4HW6A 1O7SA 4JVUA 5ENWA 5LKNA 2KH2B 2H1PH 2UVFA 4M00A 3ZE2F 3RU8H 1WLHA 1XF5B 1XMWA 2VITA 1T1XB 1QUNA 3VDBA 3DHMA 2WINB 1AXTL 4TTDC 4EBQH 1CXFA 4JFHE 4WI8A 4GAGH 1ZT1A 3ARQA 4QTIL 2P7TA 3ZSTA 2VE6A 5IBTL 1Z6JT 2EC8A 3PWLA 3JUZA 2M2DA 1UYWL 5DD6A 2X4UB 1YC7A 4ZFZB 43CAA 3P9WB 4IJ3C 1TTFA 1FPTH 1BGXH 4OV5A 2G5BB 1JGEA 4I18A 3FQUA 3P0GB 2EO1A 2W65A 4MD5A 3RDTA 2ZOKA 1EFXB 2VDQH 4JFFE 1IGIL 1MCLA 4HS8L 4YHLH 2OM5A 1JL8A 4JQIL 1BREA 3UJTH 4OFYA 4ZO7A 1QG3A 1ZMYA 5AWNH 4W68A 5DC9B 2QEJA 1HZHL 1ORQB 4JPVL 4WW1B 3GSNA 4XWOD 5CLTA 3DARA 2AJ3A 3PWJA 5CD5D 4OF0A 1INQB 1OT2A 2BVYA 4MJ6A 1WIOA 2GK0B 3P73A 4XPAH 1K85A 5CWSA 4PG2A 1Q9OB 3OXSA 4RRPG 4R2GD 1P7KA 5D1ZB 4NT6A 4F9PC 1YMMB 5J7CC 5SWZD 1N0LA 3UYOD 3MLYH 4TNWF 3L3DA 4JANA 3ARGC 2BDNL 1F8TH 4GAYA 1BQSA 3EYFA 5ABDE 5GGVH 4O2EB 3TVMD 2HRPH 5GS0L 3W5NA 4IM8A 1EEYB 2Y7QB 3PGCB 2YZ1A 3C5ZB 4UU9B 5D96C 4U6HB 1BQHG 3V4VL 5EU6E 5DJYB 1JGLH 35C8L 4G7VL 3FO1B 4YHZH 1TVHB 4CU6A 2YPKB 2ADJA 4QRPE 1KN2L 4YC2C 5KVMC 5IGXH 2BSED 1PZUB 1TCRB 1EJOL 4K3EH 4L3CA 4UNTA 4N9GA 4OCSH 2OCFD 1CZ8H 4MJIA 3I50H 1BM3L 3HTLX 1FV1B 2D3VA 3HUJF 4WI5A 3ZYIA 4KQ4H 5DK2A 1DTUA 1LEGB 1J8KA 4R96B 3WHE0 4OF7A 5B3JF 3KS0J 1EZVX 2Y5TB 1U8QA 3GHEL 4U1SA 3QAZB 5E8PB 1ZLSH 2ADGA 4W70A 4CJ0A 1TNNA 2J8UF 4X8XA 5EOQH 2FEDC 3DIFA 5IG7B 3IDIA 5F6HJ 5HY9A 1JWMA 1DUZA 2PYEA 5EO9A 2VLRA 4NQDB 1NCWH 2VLMD 4PBVC 3TBWB 1MRDH 4BQ9A 2VLJA 4NQEB 3PQYD 5E2WL 4DOHE 3C5SB 1AC6A 3ROOA 5GS1B 3GO1H 3A6OA 4BSJA 4R7DB 1E28B 3NPZB 3G04A 3SKMA 3O41B 1S9KC 3CFIC 3GK8H 5AD0B 1F3DJ 3MA9H 5EO0B 4Y1AE 3QHZH 1CLOL 2DBLL 2IAMD 3ULUH 1MI5B 4YZFF 4Y4FB 4M02A 2MHAB 4APQB 3QXVA 1HXMA 2OI9B 3DXAE 4GUPA 4UIKL 1J10A 1I9IL 3SDCA 1UACL 5HBBA 1S3KH 1HE7A 3PL6D 1RZKH 2OQJA 5BXFA 2MNUA 2B2XL 2NXYC 4TPRL 1QLRB 4OB5H 1HYRC 3WS6C 1AGEA 3JVGC 4HUXB 4Z7VE 3FMGH 4Z0BH 4C55A 4MQSB 5CEXA 1OTUD 5A2IH 1JIBA 1LNUA 1B6UA 5FM4A 1JUFA 3V5HB 1UZ8B 2OXGA 2X1WL 3HI5H 4PG9A 5I75C 4FZ8L 4I0KA 1XIWD 1I3UA 1FPTL 3RIAK 3F8UB 4F15B 3HZKA 4NUGL 1N26A 4R4FH 4UILH 2HJFB 5D1QC 3OGCB 4XBPB 4ZG1A 4R4NC 2FO4B 1KB9K 1VESA 3D3VD 3STBA 1U8IA 4O2FB 1CQKA 2B1HL 4WHDA 2YRPA 3U7YH 4JFOB 2HFEB 3RNQB 3FKUS 1G6RL 3FO9B 3DRTA 1F6AA 2F58H 4QGYA 3UJTL 3TNMA 5JW3L 4RZCA 3BZEA 1A02N 1A47A 4PP1C 5DJ0B 3BIKA 4UDUA 2F8XC 5EBMB 2E5EA 4KU1A 1RIUL 3O9WA 3I84A 3DV4B 4LHUD 1EAPB 1AGDA 3WNOA 4DZ8A 4DUVA 3MJ7A 5IBUB 4LVHC 1HH6B 5BVPH 4XPAL 3SBWA 2A6JA 2VIRB 2A6KA 3BIBX 2VXTL 3G6JA 4Q9QH 3BPCB 4GKSB 3FQXB 3VRJB 3T0ED 4PJAA 1OGTB 4M5ZL 3ZTJH 3MR9B 5GGVL 4NHCL 2ED8A 3PE9A 2HRPL 1BVLA 2GUOA 2DWDA 2QSCL 1IAIH 1H8OA 4KHTH 4U33A 2C9AA 1RIHH 4JFPA 4NO0A 4P46A 5IFHH 4L8BA 4TQEH 5CIPH 4X6BB 1JGLL 3MJ8A 1CS6A 1TFHA 2FGWL 1HKLH 3QP3A 4XP4H 3X3GL 1M05A 2VSDA 3ULVH 3BPOC 4N8VB 5LAXA 2P24A 4C83B 1OSZA 5FYJU 4KQ4L 1GC1C 1U8HA 5D5MF 1MQ8A 3T04D 5CS7A 2E9IA 3NACL 3P4NA 5M94B 3ZDZF 1WWWX 4ODUA 3G5VA 2OZ4L 1KTDB 3H6JA 2DD8H 1I1YB 1ORSA 1ZLSL 5K9OA 2NY3D 3H7BA 3ARXA 3BYYA 4JY4B 3O4LB 4N5ED 3DO7B 3DPBA 2AQ3A 4JFFB 3OG6B 2V2XB 3UTQA 2EE9A 2XRAH 4P3DB 1EVTC 1RK1A 3WXVL 5IEHA 1V05A 5JXEC 1CFQA 1MWAB 1P7QD 3WUWA 3GO1L 1P9MC 4OZIA 1I1CA 1GSMA 4P2RA 3WD5H 3QXWA 1NGYB 3SGJC 3VFPA 3QWOB 5CD3B 1UENA 5HDOA 5IHLB 4LKXA 3MA9L 4KXZI 4PJIF 1JF1A 3RWIA 3MJ6A 4N8CH 3ULUL 1ZS8A 5LXGH 2NXZB 4JM2D 2VLME 2LABA 3QJHA 1T7ZA 4HKBB 2EDYA 2FJFA 4FQCH 1DE4A 5I1KH 3DUSB 3PQYE 1S3KL 4OZFG 3VXUB 4TN9A 3S7GA 1YEJH 4FQQB 1XF5A 5CKGA 1T1XA 3BYTA 5DURB 4X4MA 3UJJH 3S5LB 4X7EC 4HPOL 4U2ZA 5A40E 3PABB 5EU6B 2PTVA 2CD0A 1NAMB 3BAEH 3MNWB 5F7LB 3ZYJA 6CGTA 4HWEH 1YEIL 2VZOA 3WXWH 4U6VH 2X4UA 5GS0D 3SQOH 5FUCE 5GXBB 5GZOC 3RUGF 4ZFZA 3THML 4KV5F 4YGVB 4EN3D 2V9TA 5KSBB 1G7HA 4P5TB 3MRKB 1HOCB 5ICYB 5KANI 4KUCF 1NCDL 4MVBC 5GHWH 1BX2B 2JJUA 3V7MA 5I19H 2Y07H 4YHKH 4WUUA 1BIIB 5MP6L 3IDGB 5I16B 4H0GA 4PJ8C 5MENB 1KGCD 1Q38A 2A74A 2BVPB 4Y16D 4NKOB 3D0VB 1ORQA 4KTEH 2NY5C 4WW1A 2XQBH 5TE7H 3L5IA 5CAYB 3CUPA 4DOHB 3D3VE 1F4AA 1MUJB 5E95B 5BVPL 3ARUA 1INQA 2OJZL 4JHAH 3ZKND 2VDKH 2A1WL 4FQJH 3HMWL 3SO5A 2C3VB 2DQJH 4X5WB 4LBEB 2R4RL 2NY6C 5L7XL 3VH8A 4LDOB 4G7YH 4ZOAA 1Q9OA 4GT7A 4F2MB 4C4KO 4Y2DB 3WFCH 1PSKL 3BDBA 2CRZA 1YMMA 2RBLA 2NTSP 3Q1SH 4V2BA 4MJ5B 4KHTL 1DBKH 3O4OB 4XNZC 1RIHL 4QO1A 4PV8A 5AYUH 4OQTH 1J86A 4PLOB 4ZXBD 1GOGA 4P2YA 3S35H 5JQ6L 5IKCA 1EEYA 2JE8A 2Y7QA 3PGCA 1EHXA 4EI5C 3C5ZA 4HS6A 4UU9A 3GMOB 3S8WA 1P6AB 1LDSA 4U6HA 4XP4L 5DRWB 4X9FA 4QYOA 1TVHA 3I02B 3UTOA 4MA1C 1J0IA 4NZTH 3H9SB 4OGAD 2V5SA 3CU1A 3OBAA 3SCMD 5J11C 5D6CB 5DHVB 2VXQL 4QRQB 2DD8L 3MRLB 4ZAKD 1KB5H 1LEGA 4R96A 1UA6L 5BO1L 3ROLA 3FCTA 1JNJA 4K3HA 5EUKB 5KAQG 4P99A 2APXA 3C09B 3DECA 2NYYD 4EXKA 3BRGC 3F7RA 5ITBL 4Z7UA 3WS3B 1MHCB 3P4OB 3TBWA 1BVZA 4GMTH 1FNFA 4NQEA 3G9VA 3CK0L 2VUYA 3C5SA 4KVNL 3RTQA 5GS1A 1RUPL 2XG4A 5CJBA 4D2NA 1QR1B 2Z9TA 1E28A 4R7DA 3QCUL 1XZ0B 3O41A 3EDEA 2VDRH 4JRXD 5EO0A 3VFGH 3MCKA 4OLWH 4M62H 1MI5A 4S2SB 4Y4FA 4O9HH 3MCG1 4APQA 1N59B 1U95B 2ATPB 1YEJL 3DSFH 2CXKA 4NWTH 2QBWA 5KVDL 2BCKA 5E2VH 3SDYL 3UJJL 1H3PL 3UAJC 3DX8A 5IR1A 5E8OB 1G7QB 2WAHA 2GJ6D 4Y4KC 1QLRA 5GRUL 5K9JH 1H8NA 1A7RH 1VSCA 5KZCB 5I1CL 2D31B 3UP1A 2YD1A 3V6ZB 1KJ2L 1TJGH 1UZ8A 3V5HA 3ZDXF 2AJSL 3MLTB 5EG6C 4RGMB 3U4BL 5FO7B 1QSVA 1YMHB 1GHFL 3QIBC 2WK2A 3MODH 2I5YH 4M5YH 3CC5B 4XWGL 3WFBH 5FKAB 2VH5L 2HJFA 4XBPA 2HVJB 4LF3B 5JZ7D 4HF5H 2DTML 2XN9E 1SY6H 2Y9RT 4KMQA 2HTKC 5CILL 5CBEB 3EDFA 3NPSC 1FIGL 4NNPH 3QEUA 2HFEA 3CD4A 3RNQA 2D7TL 4MLSA 5I19L 2Y07L 4KHXH 1CFSB 4GRMB 2DI7A 5HI3D 1RZIB 1FZKA 3NZ8B 5DJ0A 1HDMB 1B2WL 1UKQA 4JO3L 4KTEL 5TE7L 2XQBL 5EBMA 3IJYB 4ZTPH 3RWCA 4ZS6D 4JHAL 2ZCLL 5CCKH 2CUIA 4TUKL 5EIQA 4HKJB 4FQJL 4EIZC 4M7ZB 3RGVD 2VIRA 2FEEL 2ZUVA 2OL3L 4DKDC 1M7DB 3NBNA 4D9QE 5ANME 3VXRD 3B43A 1CF8H 1DFBL 3EW3B 3BPCA 4GKSA 3FQXA 1A7OL 4O4YH 3UDWC 3VRJA 1KGCE 2Y1VA 2FX7L 2R8SH 1OGTA 4OQTL 2NZ9C 3P2TA 4WV1B 4OSUL 3VXOA 3MLSH 2EZ0C 1ODAA 2EDJA 4PJ9C 5GGRB 4FHBD 4X6BA 4GG6F 2GJZB 2AKRB 3H3KA 1FVDA 3ULUD 5TDPB 3NN8B 4D9LH 1RURL 1Y18B 4NN5B 1IJ9A 2CMRL 3ARDD 4NZTL 2B1AL 2ZSWB 4H1LB 4NN6B 4Q6IC 5EU3B 4C83A 4NBYB 3K2MC 3L1OH 4KRPC 1PG7W 5BJTA 4PREB 1U93B 2YR3A 3JV6B 1E27B 1CDGA 2CLVA 1PY4A 3LKQB 4LP5A 3O0RL 2Y23A 4DKFL 1KTDA 3I3BA 1YEKL 1BFOB 4GKOA 2GSIB 5I8OL 2OMNA 3BKJH 4G6FD 4H25B 2EYTB 3MCLL 4JY4A 4Y89A 3O4LA 3KPPB 1AJ7H 3DO7A 2BJML 2F9BT 4HS3B 4JFFA 4X7SL 2V2XA 5EULV 3GBML 2WLZA 4HZLB 2DQEL 1VFBB 1N8ZB 5ADOL 1PG7X 2DIJA 4PJAF 1BAFL 4DEPB 2O5YH 2A2QT 1WT5A 5GJSH 3EOYG 3HE7C 1IL1B 1MELA 5HPMB 2Z31B 3QWOA 5CD3A 3CZJA 1GPOH 5DS8B 3DX7A 4UNUA 3HG1D 1PJ9A 4WFFD 4XNQB 4K3DH 5IMLB 3ZE0F 4Z0XB 3IU3B 1J0YA 2CK2A 1CD9B 4DCQA 5L2JB 1ZLWK 2R69L 3VFTB 2LU3A 4XPHL 2BRRH 2XNAB 3KLDA 4XT1C 4L3AA 4NQTA 3Q3GB 5JR1L 1F02I 3E8UH 4DGVL 4P23B 1Q94B 1A7RL 4HK0A 1D9KC 3S5LA 2BSRB 3TJHC 4JRXE 3PABA 4JQXA 5EU6A 1OCWH 3VG9B 3MNWA 1JK8A 3GJFH 5DQ9B 3S97C 3K1DA 3TZVD 3QHFH 1Q72L 2IBZY 3MODL 5IF0B 4M5YL 4HUKB 3OF6A 2WIIB 4ENEC 1PYWB 2VXUL 1HQRB 3CLFL 1RUMH 5LQBH 4HF5L 1F4WH 3V0AC 4DFIA 1CQYA 2WUBH 5TE4H 1KXTB 2JIXB 4YUEL 2GJ6E 3I3DA 5DJCB 5HVGB 4PRIB 4NNPL 1A8JH 3L5XH 4P5TA 2VN7A 3MRKA 4XP5H 5HI5D 3MRGB 3OAYH 2GJJA 4HUUB 1AD0B 1HOCA 1RZJC 3B8SA 5ICYA 5F70A 5C0DB 1BX2A 1BHGA 2CJUL 1BIIA 4Y4HD 2DDQL 3TO2B 3IDGA 5I16A 3RZCD 3U4EB 1JPFB 3BPNB 4P2OB 1UJ3B 5B3NA 3U6RB 2GI7A 2A9MH 2VYRE 4PB0H 2ARJA 1MUJA 2J3SA 3MNVA 4JFDD 4Z7QF 2JCCE 4OF5A 1KIPB 4X5WA 2UZXB 4LAJH 5CSGA 1T1ZB 1E6JH 2HTLD 1RZFH 4Y1AA 4F2MA 1NBVL 1BZQK 3RJDA 5C6WH 3GJEB 2G60H 1OTSC 1P7QB 4HMCA 1X5IA 1LO0L 3HS0B 3DXAA 4ZQKB 1BBDL 4K8RC 4IOSD 5CUSH 1MREH 4NBXB 4KI5D 4NJ9H 1RHFA 5A43C 5DRWA 3TO4B 3RNKB 1K4CB 2B20A 2DLTA 3I02A 4IOFC 4Z7VA 4CDHA 3L1OL 5TQ2L 1IQWH 3NZHL 5K9KA 4WWKD 5FECB 3AROA 2EIEA 3QUMB 2CGRH 1FP5A 3LSOA 1DBBH 1RI8A 5FUOH 5D6CA 4QRQA 1UWEH 4X6FA 3SDDC 3WSQL 4JEGB 1CGVA 5F9OL 2XN9B 1WBZA 5T3ZL 2H26B 4OZ4B 1Z2KA 1EO8L 3DGCR 3BI9X 5FO8A 3LMJH 1MHCA 2B8OT 4WENB 3P4OA 4KDTA 5ACMA 1TPXC 4NM8L 5L6YH 3QSKB 2H3NB 4JDTH 2MJWA 1JNNL 4PBWD 1QR1A 4K3DL 3MOBH 2QTEA 1XZ0A 4BM7A 4BYHA 1I1AD 1PG7H 1KC5L 2DTSA 3EYQC 1GC1H 5CEYB 4G8FB 4R4BB 1KG0A 3IXTB 4JJ5A 4NP4H 4PV9A 5CJ5A 5LJYH 5D70H 4QXUL 1N59A 1U95A 2ATPA 1NC2D 4QWWC 1NCAH 2MCPH 3QIUB 3D2UB 3EJZC 4OF3A 4L8SB 3ALWA 2AK4D 3TBSB 2XZZA 3ZL4L 1QRKA 2DKSA 3BSZL 1IC5L 4B5EA 3BFOA 4WFFE 2YK1H 4LSPL 3MGTA 5E08H 3QHFL 3T2NL 3DVGB 3V6ZA 2VDLH 3MLTA 4MJ2A 3T3MF 3HLAB 1RUML 2C3GA 3WKMH 1YMHA 2C7UB 4I48B 3CC5A 4F9LA 5BS0B 1F6LL 2A6DB 4JHWL 4QHUB 5J12B 2HVJA 4LF3A 4XC3L 2VDNH 4XP5L 1EIBA 1T03L 3F58H 1UXSB 3NIGF 4GS7B 4IIQC 1FH5L 3ILPB 3DURA 1P1ZB 4LQ1A 1CFSA 1NUNB 4TSAH 4HBCL 2X4TB 5F9AC 2RCSL 1MVUB 3CCHA 1HDMA 4PB0L 1NLBH 5I8KL 3VI4F 4WGVB 4LEOB 1T2QL 5EN2A 4KK8C 3RY6C 1HHGB 3GI9H 3LKNB 4N1CA 4QHKJ 2G60L 3SGKC 1NCBL 5C0IB 4CADB 4ZO6A 5F7WC 3ZT7A 4ZFOB 1CFVH 3C6LB 3PQYA 4WV1A 1JVKA 3U0PA 4NNYB 4LGPB 2PKDA 5GGRA 4ONFH 2AKRA 3QWRD 5TDPA 3NN8A 5FEBA 1A0QH 4WEBH 4FTVE 1U3HD 3B9AA 2WBJB 1BOYA 1R5WA 4H1LA 1HINL 5EU3A 3TT3H 4DGYH 3OTTA 5FUOL 1E27A 1AHWA 5IHUH 2EDOA 2NY5H 1CWVA 1FNEA 2R23B 3V6FB 1OM3L 2GSIA 5IK3B 2X4NB 3LIZH 2IALB 4H25A 2EYTA 1HIML 5JLZB 2AJXL 4YQXH 3KPPA 5IB2B 4NC0B 1HN1A 2J5LB 4HS3A 3D39D 3ZKSD 1U8KB 1R0AH 2ZZUT 4DGIL 4AL8H 1PQZB 1N8ZA 4EUPH 3TC9A 1XR9B 5HVHC 1EK3A 1CDHA 3D3VA 3SE8L 3WJLA 1IL1A 3I6GB 3MREA 5HPMA 1P5VA 4MXVE 2JCCB 1PG7L 4I18C 4L1HA 5DS8A 3TLRA 2HAZA 5DZNA 4XNQA 4Z0XA 3RDTC 1HQ4A 5KVGH 5L2JA 2ITCB 3CZFB 4NP4L 3KPOB 5D70L 1UGNA 4YHIB 4G6AD 3O3AB 3O3UN 1NCAL 5J9PB 4TTDD 2J4WL 4X5XA 5I6XB 3U7WH 1NEUA 3Q3GA 2JKXA 4LHUA 5C0GA 3MLZH 1AGBA 5F7DB 4MAYD 3KYOB 4P23A 5DHXB 3UBXI 5E08L 3S36H 1WZLA 1EAJA 2BSRA 5J13C 1D7FA 2AVGA 2P8LB 4RBPH 3FB6B 1ZKAA 3O2VH 3GSVB 2N7BA 2VL5B 2YD4A 1KN4L 4H8WC 4PG2C 3BD4A 5EZIH 2E7LA 5F6IB 3GB7B 2WIIA 1PYWA 1U58B 1WTGT 4XP9H 1IC7H 1MJJB 1JF6A 3F7YA 4HUMB 4PRBB 2JIXA 4XCYB 1OGAD 2V2TB 4FRWA 5DJCA 1GVIA 3EOBB 3IDXH 4HUUA 1AD0A 4TSAL 3PXJA 1JI2A 5C0DA 4EUPG 1FG9C 4MZ2A 5HYSA 2QADC 3TO2A 3DX6B 3U4EA 3TFKD 4P2OA 5FFLA 1UJ3A 3GM8A 1YQVL 3U6RA 5L2KD 3MLPA 4G5ZH 2ENYA 1I3RB 2G75B 4JRWA 5T3ZD 3L3GA 5E8EB 4OIBA 1Q0YH 5JIHA 4TULH 3FTGA 4RFOL 2Z0BA 3HMXH 1P84J 1T1ZA 3SEPA 4HGWB 3WV0A 4P5MB 2V9RA 3IDMB 5ILTH 3GJEA 1R5VB 3QCTH 1IT9H 4F80A 3TIEB 4U1LB 2X70A 1A6WH 2W0FB 3AC0A 1P7QA 4TUOA 5D7KD 1NFIB 3HS0A 4ZQKA 2VKWA 5IB3B 2R0ZH 4HCRL 1P2CB 1QO3A 2ADFH 3EYOA 1Y6NR 5EBLB 1CL7I 2COQA 1KSRA 3T0XA 5HHOE 5KSBF 3TO4A 1K4CA 3C8DA 1DEEA 4HJ0C 1ZT7B 4DGYL 3RWHB 4L4JA 1MCSA 3QULB 5FECA 2FCBA 5HPOA 3QUMA 1AO7B 3PWUB 1T4KA 2X41A 2NY5L 3FB8B 5DEFB 3MGOB 4YAQB 4WI6A 3VXQA 2I9TB 5HVWA 1W72H 3ISWA 1S7XA 4I13B 4PJDB 3VXNA 4D9RD 1ND0B 1F58H 3QQ9C 3LIZL 4RA0C 1HHHB 5EIVA 3SDCC 2XN9A 5F21B 2NY4C 4CVUA 4YQXL 4POYA 2Q76B 2WIMA 2H26A 2OSLA 4OZ4A 3FN0H 1S7SB 2V5TA 1AQDA 4NQSB 5EDXA 5E6ZA 5FGRA 3VGAB 1SVZA 3KG5A 1R0AL 5DWUL 3W2DH 3MV8D 4QHLB 2RFXB 3FOLA 2DKMA 4OM1L 1DLFL 3RZWA 2V17H 3K2UH 1X5AA 3EYUH 4NBZB 4EN3A 3HKFA 5JIPA 3ALXA 4QRRD 3G6DH 1LD9A 3Q6FA 2Q3AA 4UQ3B 4Y2OA 3QUKB 3D6GA 2VO5A 3MLXL 5C0FB 3UTTD 3VA2C 1ES0B 3D39E 3SGEH 1E4WH 1FL3B 4PJGE 2E3VA 5ANMA 1KPRB 3INUL 3MNZB 4Y4HB 4KZDH 3N1QC 5CEYA 4G8FA 5DSCB 3IXTA 4X8JA 5GRXG 2DS4A 3VFMB 3EYSL 5DRNB 4H0IA 3EGSA 3D2UA 2OTUA 3QIUA 5ALBL 4ZUVA 4J7RA 4GRWH 3QR2A 1DQDL 2H2PD 2DM7A 4HPYL 3UBXB 4YR6B 2BSTB 3O9WC 4BFGA 2BY2A 1BP3B 5D1XD 4XXCA 2VWEC 3O2VL 4MAUL 1CGTA 1KCKA 1OSPL 4FTVB 1W0WB 4UB0L 1ZXQA 2R29H 5CJXA 3SBWC 3DVGA 4R4ND 1FIEA 4XPTH 3VFNB 3ZZ1A 2X5PA 3WNLA 1PEWA 1JMXA 3QUXB 4PS4L 4R0LA 3SGDH 4XP9L 4I48A 3WLWD 2V5YA 5C07D 3W82A 2AXGB 3R8BB 2XZQL 4KVCL 5BV7L 4ISVB 4RCAA 1RU9L 1KLGB 4PP1D 3R8QA 3NCEB 4P46C 4HSQA 3QEGH 3ILPA 4KKNA 2K9UA 5DMKB 4HH9B 4WWKB 3M8OL 2X4TA 3TYFB 4OCLC 2R2BA 1NSNH 4U6TA 1MVUA 3BZ4B 4OCXH 4ZAKA 1DLHA 4GAFB 1EA9C 4F7EA 4XBGA 5D72H 1OGAE 1NFKA 1IKNA 2AXJA 4R26H 3WL9B 5KVFL 3IDJA 4LU5H 1SVCP 4LEOA 4M3JA 1KJ2B 4Q0XH 5CFHA 3BMVA 1HHGA 2VTFA 3LKNA 2H2SD 3O6MH 1FBIH 4HHAB 3HC4L 1ZVSA 5C0IA 3E2HC 4CADA 2UUDK 2D7QA 4LL9A 1DL7H 3O2DL 5L2KE 4G9FB 4NN7B 3C6LA 1WBYB 3ILQD 3DO3A 2ADFL 1ZGLB 1FNGB 1ZLVH 1LP9E 5E6IB 1G6RA 5DK0B 4KK6C 2R0KH 1H9VA 4DTGH 4JG0H 4LSSL 3ARRA 1DJSA 1RZJH 4JRXA 2IPKB 2PTUA 1ZVYA 2BZDA 2WBJA 1DUYB 1AR1C 4OIIH 3A6BL 2DJSA 1W72L 4S1DC 5K9QI 5D7KE 4EKXA 1OQXA 3NA4A 2LV4A 3OG4B 5CJ8A 4BZ2H 1FZMB 2R23A 2VXVH 1A4JB 1I7RA 2VC2L 3V6FA 3MRCA 5C92A 3SJVD 3J8F7 5IW6B 2GJ6A 2IALA 3MBXL 5HGHA 5JXED 2DLFH 2AV7B 4N8PA 1HWGB 1XGUB 2IGFH 5AAWA 2FIRT 3ZE1E 1KCRH 1URLA 3T0AA 4LNRB 1JWSA 4QHNA 4KMLB 4AENB 1A1MB 3SDAB 2JTDA 1OP5K 1U8KA 1PQZA 1IGFH 4D9RE 1XR9A 1JRHI 3M07A 5KOVC 4KMTH 1JPSL 5E5MA 1RVFH 4ODWB 5D7LB 4U1MB 5FYKE 2M8XA 1RHHB 3V8OA 2JCCA 1FO0H 3EFDH 3FQNB 2Y6SC 3F7VB 1YNKL 5HGDB 5I1IL 1QFPA 1IEHA 5DMGD 4Y5YA 4BH8A 1OTTD 4KZDL 1VGEH 3FZUD 2GTWB 3CZFA 5FYLL 2OZ4A 4YHIA 2NY1B 3O3AA 4NQCD 1L7IH 5J9PA 1F90L 3REWA 4QRRE 1R3IH 4J23A 1QBLL 5F7DA 1I3GH 3RGVA 3UTTE 5HHOB 3CH1B 5GZOD 1VPOH 2R1XA 5DVLA 1J12A 3NVQA 5DJAA 3ARSA 5DD1L 3GSVA 2VL5A 5D7JB 1C7TA 3BX7C 4LASL 3W9DB 2H32H 3RX8A 3KR3H 4G6MH 4LPTA 3NABH 1OP3H 4GBXB 1H3XA 4AK1A 1GGBH 3EZJB 2V2TA 3ZTNL 3FRUB 3GJFK 1KJVB 1N7MH 3EOBA 2BVQB 3LZFH 1NBQA 1U3HB 1AQKL 3C5ZC 5C6PB 3MRIB 3U4AA 3UCRA 4OCRL 2YBRA 3VA6A 2ARJQ 4UUJB 3GMQB 1AC0A 4GH7B 4WHCA 3DX6A 2OXHA 5EWIH 2KZWA 2YA2A 4HK3N 2NY6D 2HT2C 5EZJB 1WZKA 4R26L 3MSPA 5DK3A 3GFUA 4U4BA 1I3RA 2G75A 3OAUL 1LE5B 2JJTA 4WTZA 2XFXB 2BVOA 4HG4J 1A5FH 3VMNA 1SEBA 3DLQR 4J3OC 3C60D 4UT6L 4P5MA 5DO2D 5GISL 3IDMA 1DL7L 2ZWLT 1R5VA 2F53D 2XZCH 1IMHC 3C2AL 4U1LA 5BW7A 2J88H 4JN1H 2W0FA 1JNHB 1MLCB 1CU4H 4RGND 4OGYH 5IB3A 2XZAH 3CSGA 2I27N 1FYTE 1P2CA 5EBLA 2ZUSA 5F7YC 3RTQC 5GS1C 1GGCH 3LD8B 4NZUH 4OFVA 4AIXA 4LLWB 5J6GB 2V9QA 2ZCKH 1MCIA 3QULA 1AKJD 4EVNA 5HI4C 1VFUA 3PWUA 4C4KT 5A16B 5DEFA 3DI2B 3HNTH 3MGOA 2BOBB 1RUKH 1KYOJ 3TCLA 2I9TA 4CVXB 4Y4FC 2E8ZA 2GY5A 2ZPKL 3KXFD 4APQC 4IDJH 4MAYB 3B2UC 2E27L 1MCFA 2OI9C 1BJMA 5FUZL 1HHHA 4JPWL 4OF6A 5FYJH 4ZSOE 4J4PD 4DUWA 1J1PL 1U8NA 2Q76A 3L3OA 5B38A 1S7SA 1PLGH 1ZHBB 1NGWA 3TZVA 3HZMB 1CBVH 4N0YH 4QHLA 2RFXA 4NJAL 4OZHB 4L8DB 4HC1H 3D1MC 3FFDA 4K8RL 3CFCH 5HHNA 4K94C 5GZND 5T3XL 2DKUA 4LARH 1JBJA 4ODTH 2D0HA 4ONGH 3BZFA 3QUKA 2WWMC 2X2YA 1BLNB 4BSWB 1YEEH 1H3VA 3MC0A 1VGEL 1YY8B 5C0FA 2PYFB 4J3UA 3O3BA 3IJSB 1FL3A 4HIEB 2SEBA 4XVSL 3BKYL 4X0KA 3MNZA 1K3ZA 1RZ7L 4Y4HA 1ZSDA 1FORH 5EA0L 4M7KL 4N0UB 4NZRH 4Y4KD 5DSCA 3VFMA 4HX1B 2ORBL 1D5BA 5DRNA 1I3GL 4HV8B 3UBXA 1MJ8L 1LP9B 3RBSA 3V6OE 1VPOL 5TDNB 2B5IB 3RFZC 1MHPL 2Z8SA 1KEML 1AY1H 1CD1B 3VFVB 4FTVA 3GI8L 2H9GB 2R1YB 2G5RA 2CK0H 2APVA 2HTKD 4G6ML 5F1KC 3VFNA 3BVNB 3NABL 2PXYD 1X5GA 3JWNC 4PJ7E 3QUXA 1IM9D 1X9QA 1NGXB 1GGBL 1FFPB 6FABL 4JREB 2DWEB 3DVIA 4ISVA 3LZFL 1KLGA 1YDPB 4YPGB 3B9VA 3L5WA 1P4IL 5E2TL 4YEFA 2ZG1A 5D93C 4RFNB 3LAFA 2BHUA 1VKXB 4HH9A 4WWKA 4OJFH 4XNXH 1OD9A 1B0WA 1H15B 1X5KA 4HFUH 3TYFA 1NUDA 4LRNH 3BZ4A 1KT2B 2CQVA 3F6IA 2DQDH 2GSGB 4RAVA 2CIIB 4A6YL 4MA8H 4I3GA 4P4RB 3WL9A 4Y5VA 2NMSA 4M1GH 1A5FL 4A2LA 4I3RH 4FQ1L 1KJ3L 1KJ2A 5HYIA 4WO4D 2KQMA 1ZE3C 2AABH 2CRMA 4NIKB 3PGFH 4ERSL 1AP2B 3K8LA 2XZCL 2AEPL 4H8WH 4I5BA 4HHAA 3UPCA 3MFGB 3VD3A 4G9DA 1A6ZA 4JN1L 4QXGH 1GZQB 4GRLB 1PEZA 4F7TB 2XZAL 1LO2L 1WBYA 4PGBB 4QRRB 1P84K 4HWUA 2D9QB 1ZGLA 1VACB 3ZKQD 1FVCB 4D3CL 3MLVH 4KRPD 5E6IA 4XVTL 3DHJA 4K7FB 4NZUL 1WT5C 4HXAH 2PR4H 5FYLD 1Y6KR 1I1AA 4XX1E 3PP3H 2J6EL 1R5IB 2VDPL 1A7NH 3TBYB 2F53E 4KDWA 1FGNH 1S7WB 4ZMAT 4GW5A 1IAOB 1WFTA 1X6LA 4RQQB 5DTFB 4F57H 1F42A 5I1AB 3WEXB 5I2IB 3KDMA 4IDJL 4RGNE 5HHXH 1YECH 1X5HA 1FZMA 3WJJA 4M6OH 1NGQL 5FYJL 4AT6B 5DLMH 5IW6A 4LSQL 5DR5L 1J7VR 2KPNA 1PLGL 2AV7A 2EYSB 5J89A 1QVOA 1LO4L 4HLZH 4Y5XA 1OHQA 4LNRA 4AENA 4JQXC 4RGOH 3CFJB 4ONHB 3U0TB 4Z5RB 5JXAH 4OF8A 5E8NB 1IFHH 1EEZB 2KBGA 4JB9H 4CU7A 1MAKA 3KXFE 4LARL 4K23H 4WI3A 2VR5A 1SQ2N 1K8IA 4ODWA 5D7LA 3DMMD 4BFBD 1RHHA 3IS1X 4IRZH 3FQNA 3F7VA 3C5JB 5HGDA 3ABZA 4P5TC 1EUUA 4FFZH 2B39A 3EO0A 3JSSA 5HGGS 1D9KD 1WC7B 4YBLB 1CFNB 4MS8C 5M95B 5ERWA 4JKKA 3KLAA 3QNZB 1EGJL 4ZPTB 1FYTB 3CIQA 3FT4A 4XB8A 2XWTB 4YXHH 4C54A 5HHOA 2MQCA 3CH1A 4HH8A 3VJ6B 4S10A 3GSWB 1GAFH 1BD2B 4FG6C 4JFED 2HMIC 3PNWB 2ZKHH 5D7JA 4ODSL 3W9DA 3ZDYE 4MSWB 4PGJA 4HKXB 3ZYOA 2C3HA 4KKCD 2J1KA 3NIDF 1I1FB 3O4OC 1X4ZA 3UMTA 4B7LA 3FRUA 1KJVA 4JQVA 3QWRA 1X4YA 4O02L 1C1EL 5L88L 4OJFL 4XNXL 1U3HA 3MRIA 3G5XB 2BVTA 4XCFH 3GMQA 4LRNL 1KIRB 1KPVB 3W9EA 2W0PA 3BRFA 1NEZB 4JKPH 2Q3ZA 1SBSH 5JPNA 3GSNL 3O11B 5I73B 3BEVB 3RPIB 3UJIH 5HHVH 3NIFE 1N6QL 4QRTB 1ETZB 1OTSD 5IJVA 2CSPA 5TE6H 3BE1H 1M7XA 3ZE2E 1RUAL 3I2CH 5C3LD 5ICZB 4H8WL 4CN4A 2FGZA 3D39A 1CN4A 1MFDL 1OARL 4PB9H 4PJGA 4K8RD 5F9DC 5FGCB 1G9NH 2BNRD 4M03A 5T3XD 1KTKE 1I9RH 1KTRL 5DD3L 5SV3A 3MUGB 3S9DB 4KAQL 1JGVH 1OLZA 1FFOB 2CH8A 1MLCA 1CDUA 2CR6A 4FQHB 4KDTC 1MCWW 3OKEB 2PR4L 2AXHA 3KPSD 2QQKH 3EHBD 3V2AR 3H2WA 5GJTH 3BPLB 1U8JA 3FRPA 3QXDA 5SX5H 5J6GA 3SDDD 4JZJB 1AXIB 5DUPH 3QG6B 1MCWM 5IEKA 3R4DA 3BOVA 5A3IC 1EFQA 1ZK9A 5SWSE 2BOBA 1HCVA 1J88A 3OR7B 4L4TE 1RJLA 4WHTA 4CVXA 1LEIB 4TOYH 5ACZB 5FA3B 4MAYA 4FFVC 3TH4T 4ZD3L 4XWOC 1T7WA 5FYLE 1D6EB 3EO9H 5C9JB 5DFTA 2D7NA 2OR8A 1ZHBA 1ULVA 3RKPA 4YDLC 1IQDB 3HZMA 5KVEL 4Z78B 3O6FB 3OB8A 1IFHL 4LMQE 4JB9L 4OZHA 1YYLH 4R2GC 1JFQL 4K23L 4L8DA 4YBHA 1CTOA 2XA3A 1QP1A 1G7LA 2X1XR 4DW2H 3QIWB 3V52L 3PDGA 1U36A 1MQKH 3QZWB 4F9LC 1IGJB 3T08A 1DN0A 4BSWA 4QWWD 3V4UH 2PYFA 3EJZD 3E1F1 1Q8MA 3IJSA 4HIEA 2JJSA 1FFRA 4O5LH 2R0WH 1O7VA 3UZEA 4HX1A 3FAWA 1MIEL 4RISL 4MJ4A 4BQCA 5L2KA 5IBLD 1T2JA 1NC4B 4D0DB 5DJDB 4U49A 4HV8A 4PJDF 1UH3A 1MCEA 1LP9A 2C4FT 3QI9B 3HUJE 1I8KB 4LCWD 4M7ZC 1CD1A 1MHEB 1VADB 4X80L 1QR4A 2ZKHL 2NTFB 1LE9B 2H9GA 2R1YA 4X7DC 3BJ91 5I1EH 2F74B 3BVNA 3B9KD 1FRGL 2AK1H 2J8UE 1GXEA 2PUQT 1NGXA 2VLKB 1GIGH 3JTTB 1KPUA 1QTYT 1PX4A 2Q8BH 2DWEA 4WV1C 1KJMB 2DQIL 1YDPA 4TNWK 1QLEH 5DJ2B 2VAAA 1Z5LA 2E7BA 5CEZH 4Q9RH 3MV7D 5JHDB 1CD0A 2DQFA 1UG9A 2P48B 1H15A 3QPXH 1FL6A 2XV6B 1KENL 3O45B 4RMQA 3WUWG 2DM4A 5FYJD 1IGCH 3AS3A 4LMQI 1HEZA 4NN6C 3CVIL 3UJIL 4GO6B 1KT2A 3EIFA 1ZV5A 4CW1B 2CIIA 1QSFE 3TYGH 1AHWC 4S11A 5FUCC 4FABH 4YZFE 3BE1L 4FQIH 2CKNA 12E8L 2DJUA 4PB9L 1AD9A 3VD7A 1AP2A 3E6FB 1VERA 1JHKL 5MEPA 3L3HB 1OTUC 3GMLA 1A7QL 2GT9B 5IT2H 5ID1A 1JPTL 3GSRB 1Z3GL 4BFIA 4OZGF 2FJGB 4HG4K 4YHML 4I9WD 4PJCF 4QRRA 3RRQA 4KUCD 5TF1H 1VACA 1DP0A 1FVCA 3WHXB 5GJTL 2FYYB 4DEPC 1ONQA 1JHTB 3PWNB 3WJLC 4HEPG 2FBOJ 2ICWJ 3DV6A 3EOTL 1R5IA 3P0YH 3ECBB 3TBYA 2BNRE 5T3XE 2P5WD 5BRZE 5FHBL 1S7WA 5K93A 1IAOA 1QA9B 4TOYL 5DTFA 1DVFB 1F4YH 5I2IA 3WEXA 4CDGC 3MQIA 2VZUA 3KPSE 3MA7B 3EO9L 1OAKH 4ODBD 5KSUB 5D1XA 1IEAA 5HHQB 5HYJB 1N0XL 3CX5J 2EYSA 4P23C 4MXVF 4PJEB 1FNAA 1KYOK 3RL1A 3S3SA 1BQHB 4B7IA 4M61B 2D03L 2HJKB 3LEVL 4J3WA 3VG9C 4Z5RA 3U0TA 1T0NB 5E8NA 3U36B 4GJTB 1KFAH 5FCSH 3RDTD 3LVEA 2E7LC 4PRPB 4L1DA 4M4RA 3ARFD 1MCPL 1KIQB 2X05A 1KCUH 15C8L 1QPPA 4ZDHA 3RWDA 3VH8G 1FZOB 3KNBB 3J7HA 2HWZH 1ADQH 4JGMA 1NUFA 4OFYD 1YJDH 2FATL 1ZT4A 4X9IA 2R0WL 3RHWF 3BT2L 1H3WM 3IDYB 1K2DB 5FAAA 3TA3D 5IHZB 1CFNA 3L95B 3HE6D 3G6AB 3B3IB 4IBLT 3QNZA 4X6EB 1AIFB 4P2OC 2B4CL 2EH8H 4ZPTA 1UJ3C 2A73B 1FYTA 3K7UA 5DT1L 2XWTA 5C9KA 2E6JA 3QUYB 3MYJB 5D5ME 1DQLL 3IS0X 1NMCB 2XY2A 3O6LL 4PLNC 3GSWA 2NY3C 2PETA 3ES6B 1WQVT 4TRPH 2E6PA 1H3TA 5I1EL 2Z4QA 2EDQA 4N5EC 3PNWA 4FFYH 2DLIA 4MSWA 1X4XA 3FT3B 1AE6L 4HGMA 4KY1L 3M45A 2FL5A 5SWSB 3VE0B 5TFSH 4L4TB 4HKXA 5KTEL 3P30L 2AP2A 3VWJD 1GL4B 2OTPA 3PHSA 3P11L 4J6RH 2EDEA 4ZSOA 4LCWE 1HILB 2CKBB 5CEZL 1ZEAH 3HN3A 3LQAH 5DA4A 3VRLF 4RFEB 2FZ3A 3T77B 2MKWA 1I4FB 1KTLB 3G5XA 4HFWB 2HJLB 4M1DL 3TO4C 4KRNA 1MH5A 3DUUA 2IPTH 3BRDA 1N2RA 3P0VL 2VMFA 1KIRA 4C59B 2LVCA 3GGWB 4IRSB 4X6CE 3HI1B 1N64L 3RVXC 1UCBL 5B8CA 2DLEA 3O11A 1R3KA 3BEVA 2BY3A 5I1HL 4FQIL 4Z7WB 1U3JA 4DZBA 1ETZA 3L7FB 4UT7H 1Y6MR 4YLQT 1CDBA 3HNVH 4AG4H 2PYED 2GY7B 4MXWL 3MV7E 3O81A 2PO6B 1NGPL 5IT2L 4AJ0A 4U1GB 1KUMA 3T0WA 3E3QE 4L5FH 3MUGA 3N85L 4LAQH 3CMOH 1D5ZA 4I77H 4DQOH 1FFOA 3TN0D 5TF1L 5GS0C 1JYNA 4FQHA 4WI9A 2VQUA 1GGYA 4PLKD 4GG8B 4KROB 2NY0B 4PP2A 3QBTB 3OKEA 4EN3C 1J0JA 4P4KB 2O5XH 2JK5B 3RUGE 4KV5E 1WGOA 2D4DA 3I9GH 5CSZB 4JFQA 4LGSB 3QDAA 3QQ9D 5JW5A 3QG6A 3T0VA 1ZA3B 1VDGA 5HYQA 3QPQC 3QXAA 4IS6A 4WHYH 1CGWA 3BWUC 1LEIA 2J8UB 5ACZA 5FA3A 1FQ9C 1BEYH 3F62A 4YFEA 5LG1A 3QIUC 4Z8FH 2UZIH 2EDNA 3NCFB 1D6EA 4UTBL 3MRPB 5C9JA 4XCCH 3BQUB 3BUTA 4IHOB 4GSDL 2P5WE 4XXCC 3CAFA 3O6FA 1ZA6B 5CJXC 4HCRA 2XTJD 4HIXH 3TH2T 4P59H 3MUHL 1GOHA 1KCUL 3QIWA 4G8GB 4WGWB 1UEYA 5IBUG 1QSFB 3ZKXB 4R0LC 1EERB 3QZWA 4LIQL 5JDSA 2HWZL 2XQYK 2DIBA 2QR0B 3V9FA 4IOIB 2BY0A 1L0YA 1XFPA 3E0GA 5J56B 4UIMA 2HH0L 1XAUA 3C9NB 4K07A 1YEGL 5E2UL 5IW3A 3QYCA 5C09D 3O9WD 1DBJL 1F6FB 2APBA 2OR9L 1KNOB 5IVZB 5I1DB 3MRRB 4D0DA 4ZAKC 2F8VA 5E70A 1EXUA 3O6KL 3GIZH 4NKDB 4XCEB 4ZUUB 5AZ2H 2BC4A 3QI9A 1IKNC 1J8HB 5F3HB 1IE5A 3C60A 5FB8B 4W81A 1MHEA 1MRCH 4ODXB 1VADA 3WFEH 1RZGB 4WHYG 2NTFA 2W60B 1LE9A 2DL2A 2F53A 3HNSL 4K94L 5BRZB 2EKJA 2F74A 4NO0D 2OTWA 1G7PB 4NDMA 4P46D 2VL4A 1K6QH 4DK6A 4OZHF 4PJBE 4J6RL 4OQ1A 3C6LC 5CIPB 1G7JA 1F4XL 1HHIB 1KJMA 1VEPA 2HT3C 3NH7L 5EZLA 3QISA 3KJ6H 4KGLA 2AJUL 4OCWL 3MRDB 3O45A 3WE6B 2AAVA 5FYKU 2WBJC 1DBAH 1OAXL 4OFIA 4UQ2B 1A7PL 1B90A 5DI8A 1K5NB 3KXFA 4CW1A 1WEJL 5DD5H 3C08H 3GBLA 3ETBF 1T66C 1S5IL 4CMHC 5D8JL 3P77B 2WWKO 1T5WB 1KV3A 4MNQB 1CGSL 32C2B 3BMWA 5GRWA 1BJ1J 2LAGB 4AEIL 1AI1L 5HJ3B 4LGRB 2HKHH 3B8YA 3L3HA 4EIGB 4LAQL 3BZDA 3CMOL 2GT9A 4KK6D 4DQOL 2JF1A 4JGJA 4P2RD 3GSRA 5FO9B 2FJGA 4MQTB 5E8DH 3WIIL 5DQDL 3ZDXE 1C5CH 4LSUH 3S5LG 3WHXA 2DOCA 5CGMA 4FMKA 1QNZH 2FYYA 3X17A 5JZ7C 4PJHE 2ATKB 1M7IB 4IMLB 4LSTH 3MRFB 2EH7H 4Y5YC 3IFPB 1QA9A 2FWOA 1YEHH 2P8MB 4MQ7B 4BK5A 5E1AB 2BNQB 4Z8FL 3NFSL 4EOWH 1CLYL 3IETB 1VHPA 3WLBB 1T1YB 1MFCH 2DYPD 4YIQA 3MA7A 1FFQA 4ZS6C 5KSUA 1A3RH 2UYLA 5HHQA 3AXLA 3IKCA 3GMPB 4PFEA 3O2DA 4Q9BA 1FLRH 2RB8A 3RGVC 1OPGL 5DYOB 3CXDH 3KYNA 4ZO8A 2PXYA 1UB5B 1WFOA 4GFTB 5C0BB 2R56H 1OAYL 1SYVB 4P59L 4G6JH 2Y6SD 1MWAL 3ULSA 5C2BH 4X6CB 3U36A 1IM9A 4U1HB 1B0RB 5KW9L 5F6IC 2JB6B 1EFXD 5CEZD 3OMZA 3MRBB 3EDDA 2R2EB 5J57B 1JGDA 4L4VB 1AFVL 2PNDA 2YD9A 1DBMH 4KXZH 5GGQH 4M4PA 4NUJB 2FSEB 3A67L 2AI0H 4YHYC 4GG6E 4MA3B 5C86A 5CJQH 5C0JA 1G0YR 1K2DA 4C57C 2XTJE 5T5FH 4KTYA 5HGBB 2P4AB 4X83A 3L95A 3B3IA 3H3PL 4X6EA 4XCNB 1AIFA 5IMOB 1OF2B 1CVSC 3EO1B 5AZ2L 4N9OB 2H6PB 3IU4L 3P9LA 3MYJA 3PGDB 4WO4A 1A6UL 1M71A 4F37F 4I4WA 5D1ZD 3BGMA 1YMMD 2JJTC 3U1SL 4WFEE 1NAML 3IGAA 3U0WH 2ZUTA 5GRYA 4PGZA 1S7VB 5FHAH 5C09E 1NCCL 1F2XK 4GMSL 2XKSA 5E24E 43C9B 1J87A 3QNXA 1EX0A 3FT3A 1MFBH 1P4BL 5SWSA 3VE0A 4L4TA 4JN2B 5BW7C 5LCVL 4HWBH 3I6LD 4JY5L 3VFOB 3NCCB 4D0CB 4L9DA 4CKVX 1ACYH 1HILA 5I76A 3MFFB 4PJAE 2CKBA 4RAHA 4M6AA 4AQ1B 4CU8A 4QXWA 1QD0A 4RFEA 3T77A 3C6SA 1I4FA 1KTLA 3KPMA 4HFWA 4ZYKA 1QYGH 4YDKH 3FOMB 4RWYL 5SWQB 4P48A 3HAEB 4PJXF 4N5UA 2FRGP 2MQ3A 3IF1B 4G80B 4IRSA 4Y8DC 5T1KB 4UOW1 3ZE0E 3AMLA 3C08L 5E7BA 1KB5B 1TNMA 2NX5B 1GH7A 5C0AE 5JMRA 2EEBA 4HBQA 3L7FA 3U30C 2W9LA 5F8QC 3NTCL 3R06B 4RAUB 1E6OL 2HKHL 4NQDD 4XAKE 1XCQA 4DFHA 2GQHA 4NQED 3VGAC 5FM5O 5E8DL 3TZVC 2ERJC 4LKCB 1XH3B 4K7PY 1C5CL 4WFHD 3VCLB 4BJLA 4GG8A 3DMMA 3QRGH 1QLFA 1V3JA 3D9AH 1IEBB 3DI3B 3IFOB 5HI4D 1T04B 4KZEH 3LHPL 4TSBL 1S7RB 4P4KA 4ZPVB 3H7LA 3F7QA 1CXIA 2JK5A 4PRAB 3H9HA 1MI5D 5A2LH 1CVRA 4Y4FD 5CSZA 4J8RB 1H3GA 3VRIB 4U1JB 3DVNA 4HIJB 2CLRB 2GTZA 2FLBT 4JFXB 4OTXL 4P2RE 4H1LH 1L4IA 1ZA3A 3HE6B 1U6AH 4Y4HC 2KUTA 4LPWA 3RZCC 2J8UA 4EOWL 3LEYH 5DUMH 1MFCL 4PJBB 2BVEA 5SX5K 1A3RL 1WVZA 5JIKA 1PKQB 3LPGA 5KANG 5ALCH 3GDBA 2WANA 1MJUH 1T6VN 4K7PH 4IHOA 1MPAL 5DEGB 2X9WA 4RIRB 1CYGA 4Z7QE 2MOVA 3DX9B 1MFEH 3CX5K 3VWJB 1MLBB 3V79C 4BA8A 1KCSH 2ICWI 4G8GA 2C3WA 1QSFA 2J7LA 3QXUA 1HK6A 4E42B 2ZUUA 2X7LB 4JO4H 4UINH 5D71L 5C7XH 3TJEL 5IB4B 1N5YH 2Z91B 2HRLA 2QR0A 4IOIA 3KPRE 5KSAB 1RJCA 4Q6YA 1R3HA 2VXSH 3C9NA 1OW0A 1ED3A 1V7MH 1YN7B 1NFDE 3BO8A 5T5FL 4XMKL 4WWKC 2C4XA 1FGVH 4PD4J 4CBPA 1JZ7A 3UTSB 1KNOA 5IVZA 8FABB 1K3IA 5EU4B 1D5MB 4D94A 4ZUUA 4CGTA 4NQVB 1NMBL 5C1MB 5F3HA 4Y5VC 4PJHB 5DC4B 5FB8A 4ODXA 4H1LG 5FHAL 3OKYA 3ARPA 3UO1H 3PWVB 3T2PA 2W60A 3JTSB 2BNRA 2D0GA 4XMPH 5BRZA 1A6VL 1MFBL 5IMKB 1HSBA 4UV7L 4GQ9H 1OWRM 3BP4A 4OI7A 2CDFB 3OAZK 5CIPA 1HHIA 4P2QB 3HCVA 1LDPL 1YMME 1HH9B 1WTLA 5E6IC 5CBAB 1QYGL 1C12B 4GLRH 2XI9A 4JDZB 1I1AC 3MRDA 3SPVA 1BECA 3WE6A 4PJFE 3UTZB 4UQ2A 3LS5L 3FQRB 2V5RA 2EXYC 3VFUB 5JW4N 4U31A 3HB3C 3I6LE 4X4XB 3O4LD 5TDOB 1AXTH 1UWGL 1CR9H 3O3EB 4G43B 5CKAA 3P77A 5D7SH 3WJJC 1QEWB 4XRCB 1T5WA 4QTIH 2UWEB 4H26A 5IUSA 3FFCE 4YHOL 1A3QA 1UYWH 1FCGA 3QUZB 5HJ3A 2VQ1B 3ARGB 3BN9C 1F97A 4Y5XC 2FB4H 1WUNT 2CDEB 1RFDL 4LHUG 4OLXL 5CINH 1ZANH 3T3ME 2NLJB 2NY2B 3MRHB 1I7ZA 3HZVB 1IGIH 4XPBL 4HS8H 5D5MA 5DVNA 3WMSA 2NXZD 5C0RL 1JZ5A 2ATKA 8CGTA 4NQDE 3SHSA 5CZXD 4JQIH 3DSNA 1M7IA 3RVWD 2VZ3A 4CAGA 4NQEE 5FCUL 2W9EL 3FB7B 5C09B 3VXUD 3MRFA 1U6AL 1CT8B 1HZHH 3IFPA 4JPVH 3IAQA 3MV11 3QUMH 4LIQE 4MZ3A 1AH1A 5DURD 4MQ7A 4XZUB 5E1AA 3AUVA 4E0RB 2BNQA 4QY8A 1IZJA 5EU6D 1EEUA 1T1YA 4FXLA 2FJHA 3LS4L 2WBKA 1MJUL 4LCWA 2F54B 1D5XA 1NLDL 3GMPA 5HYSG 1L9NA 3MROB 1TZIB 4X4ZA 3D5OF 2BDNH 1T89A 5J6HB 3LKPB 5C0BA 3B9KA 1MFEL 1SYVA 1I75A 2V7HB 1FAKT 5GS0H 4X6CA 2LAAA 5D7JC 2HFFB 4U1HA 3FONB 4P5TD 1B0RA 2P47B 4LLQB 1P6FA 2JB6A 2Q87A 2C1OA 2CIKB 1N5YL 4JO4L 2EDBA 5CMAB 5C0AB 5C7XL 4U7SA 2J6EA 3MRBA 5F8RC 2AEIT 2R2EA 4G7VH 3AMKA 4L4VA 4DVRH 1RULL 1KN2H 4M93B 5J8OA 1X5JA 1EJOH 4NUJA 2QSTA 4JQVC 5MEND 2FSEA 3IXAB 1V7ML 3MV7A 5C8JB 1BM3H 4N0CC 1U3HC 3WN5B 4UT9L 3I6KB 1JNLH 1MCOH 3KS0H 4C56B 3BD5A 3K80A 1YPZB 3D18B 2J8HA 4TVPL 4DJMA 3GHEH 3MO1B 2IQ9H 2Z92B 5IMOA 1OF2A 3TP4A 2RR3A 4DN3H 3EO1A 4HQQL 2NXYB 3X3FL 4HEME 1BZ7B 5DEZA 3PGDA 4Y2DD 4GXVL 3RUGA 1Q9WA 3UO1L 2E9JA 5T1MB 1IKFL 1E0OB 3VW3H 4PJEF 1S7VA 2X4SB 2APFA 5E2WH 1CI5A 4XMLL 5D1QB 2VISB 1RAMA 4JN2A 4BKLB 5DD0L 5CJOL 3LPFA 4LVNB 1F3DH 1UFUA 3GRWA 5EOCL 3VFOA 2P5EE 4D0CA 1NBYA 4JG1H 5H37H 1CG9B 3MFFA 5EOCJ 1CLOH 4MXQD 3H9SD 2DBLH 2DI8A 2R2HB 1MOEA 4NRXB 4S1QL 5DRZB 2P5WA 4BK4A 3FOMA 4AEFA 3HAEA 4UIKH 5F3BA 1EGJA 1I9IH 4G80A 1UACH 4G6AC 5GS2D 4EDXB 1RIVH 1KLUA 5T5NF 2O5ZL 4LK4A 2NX5A 4MYWB 1CR9L 2B2XH 5I9QC 4LVHB 1A6TB 4TPRH 5D7SL 1TMCB 2DYPB 2X10A 5C70A 3V0VA 2G9HB 5JA9A 4QTHB 4MAYC 1UM6L 5JW4M 1T0MB 3R06A 4RAUA 3KPRB 4OLEA 1A3LL 3N1GC 4FZ8H 1TJHL 2FB4L 2P45B 2BSSA 1NFDB 4NUGH 3T65A 2IH3B 1L0QA 5CINL 4HJGB 2VZSA 2VKXA 3O4LE 3ARFA 2B1HH 1ZANL 2PW2B 5CGYD 5ITFB 5GGVY 1A4KB 3T4AB 3VGFA 1T04A 1A7BA 1S7RA 2XWJB 5A3ID 1G6RH 5DRXB 4PRAA 5JW3H 3BPOB 4J8RA 3NAAH 3VRIA 4NRZA 2A83B 4U1JA 4FFVD 3HFML 4NC1E 4HIJA 3QUML 2CLRA 1PGRB 4JFXA 3TA3A 1FAIL 1RIUH 2JJSC 4HKZA 4NKQB 4K55A 1U8LA 3HE6A 1LO5B 5CHNA 5JOPE 5H37G 3TFKC 4PJBA 3EFFA 4F7PB 5KZCD 1II4E 2VXTH 4Z7WF 3R0MA 3Q48A 5DJ8B 4U0RB 2WV3A 5JIIA 3T4YA 1V3LA 2B5IC 5DEGA 4XNYH 3VXUE 4M5ZH 2FO1A 4Z76B 1E4XI 4NHCH 4RIRA 1MCDA 1GZPB 2QSCH 3H9YA 3K3QA 4PJFB 1G9EA 3DX9A 3VWJA 1MLBA 2IANB 4NCC1 1RY7B 1I7UB 1LGVA 5JO5A 1VFMA 4DVRL 4PGDA 1SY6A 3MRNB 4E42A 2FGWH 3QT2A 5IHBA 1TZGL 3X3GH 4RNRB 5IB4A 3RAJL 1ZTXH 3SO3C 1UM5L 2KQNA 5KSAA 3FFCB 2NR6D 1JNLL 1MCOL 4KK9C 4JZNB 4Y0GA 4RFNC 1O5DT 1YN7A 3NACH 5KSBE 2OZ4H 1UWXK 2IQ9L 1JYXA 1XT5A 4DN3L 2OS7A 4ORGA 2R39A 8FABA 4V2CB 2Z93B 4CVWA 1LO3L 2MWCA 5GIRB 1HI6A 1D5MA 3NCYS 4NM4L 4H88L 4MD0B 3EOAB 4I2XE 1OT1A 5MENE 3LOWA 4PJHA 3VW3L 1CCZA 4NO2B 5F89B 5E56A 3WO3B 3WXVH 2DQUL 3PWVA 1YNLL 2E9WA 5F72S 4NOBA 1YYML 3JXAA 3TN0A 2J2ZA 3HRPA 2CLZA 4HIHB 4E41B 5L0QB 5IFJB 4O58L 5B39B 1T20B 2CDFA 2CPCA 4JG1L 3HPJB 1EHLL 4WCYH 2W59A 4CVZB 1HH9A 4LLVA 2UV3A 1WZ1H 1C12A 3T1WA 4PJ8B 3LEXB 3GKZA 4JDZA 5F96H 1H5BB 4EQ3A 2HKFH 1RIVL 5GRJL 4KQ3L 3R1GL 3FQRA 1ZGLM 3VFUA 1TTGA 1YY9D 5TDOA 4HPOH 5IWLC 3M17B 4YXKL 3P40A 1QEWA 1NANH 1UJTA 2H2PC 3H9SE 4XRCA 5D7IB 1J18A 4WJ5B 3X11A 4M6NH 4LVOB 2F15A 1YEIH 4WTWA 4RMRA 5D1XC 3QUZA 2VQ1A 2XYCA 4JFZH 4GG6A 1NKOA 3THMH 5I17B 5F9JB 4XNZB 3CLEL 1DCLA 1OLLA 4DAGL 4ZFOL 2HFTA 2Z31D 3QDJD 4EI5B 3GBNL 1V3MA 3WLWC 2FHBA 2NLJA 3MRHA 5E5RB 1WWBX 3HZVA 4YNYB 1XR8A 4I3SH 1NCDH 3NAAL 2APTA 1XF2B 5EZOL 5MP6H 2KL6A 4AM0B 3SGEI 1TDQA 5J11B 3FB7A 4TVPD 5C09A 5E0QA 3ULVF 3QFDB 1CT8A 2I9LA 1ROWA 1TETL 2PCPB 5ESQB 4P23D 3MBED 4XZUA 2OJZH 4E0RA 4YBLC 2DI9A 2A1WH 3HMWH 3PDOA 3GSUB 2R4RH 5L7XH 2P5EB 2EC9U 3RA7L 2FNBA 2AQ2A 1MJ7L 4XNYL 1I9JL 1W8OA 1PSKH 4PLJD 2LU7A 1UVQB 3BP7B 3MROA 1TZIA 3D48R 5BMFL 4Z7OF 5J6HA 3LKPA 4E9LA 2H2SC 4K3JH 2ILLA 4NKIH 1B4JL 1HYSC 2JIXD 2Q6WA 1J05B 4OZFH 2V7HA 5JQ6H 2DB8A 1EZVY 2WM0A 3HRZB 4PRID 3SE9H 2ICWA 3FONA 3WFHA 4WTZG 4LSRL 1CFTA 2CIKA 1C5BL 5CMAA 5C0AA 2EDXA 1CGYA 4P9HL 3ILQC 1WBXB 3NA9L 1ZTXL 5TJWK 1LEKB 3GMNB 4GOSA 3REVA 5GGSA 4R3SB 4P2OD 1ZLUK 3WN5A 2VXQH 2Q1EA 4C56A 2MCG1 1BOGB 4GQPH 1MFNA 1UA6H 1YPZA 2YSSB 3D18A 3OSKA 5BO1H 2WBWB 4R6UA 2ZOLB 5IQ9B 3MO1A 2Z92A 2WQRA 3N0PB 5FK9A 5B8CC 3LRSB 1BZ7A 5I73C 3JVGA 4L3EB 3WIHA 3RY5A 3PUCA 5E2JA 3GNML 4PD4K 3QDHA 5ITBH 1Y0LB 2GCYB 3FT2B 2R9HC 4OI9A 3CK0H 3QIBB 4XBEL 4I8DA 4KVNH 1RUPH 5D1QA 2VISA 5T33L 2F5BL 4X6CF 3QCUH 4WCYL 5HHPB 3TO4D 1IGML 3KLSA 3ARYA 1WZ1L 5B38G 4JPKL 4DKEL 3RVXD 5EUOB 2R2HA 4NRXA 1CDJA 4G6KH 3DYMA 3V6OC 2AJZB 5F96L 3STZB 5DRZA 2HKFL 1DR9A 4QRSB 5DMGC 1OTTC 3FZUC 4W4OC 5JW4R 4JRYD 5KVDH 3H42L 5MEOB 4UI2A 3SDYH 1X7QB 1OB1B 2YPVL 5IOPB 1H3PH 4EDXA 2WINA 2XN9D 1M4KA 1A6TA 2DYPA 5GRUH 2G9HA 3WNMA 3O8XB 3VMPA 1H0DB 4M6NL 1IILE 4OUUB 5C6TH 2W9DH 4YFDB 5I1CH 4MCZB 4X6DB 1TVDA 4HJJL 1KJ2H 3MMEB 4JFZL 3KPRA 2XA8L 2AJSH 4KWUA 5DMIL 1JI1A 3U4BH 4FFWC 5BVJB 4KTDL 1MHHB 1GHFH 1NFDA 2G5BA 4XWGH 3SQBA 3X13B 2VH5H 2IH3A 3O6FC 2X1PA 4HJGA 2DTMH 1EFXA 4V1DB 3UBXG 4PJ9B 5CILH 2AW2A 3TV3L 1NUGA 5ITFA 1FIGH 1A4KA 4D9QD 4I3SL 2IADB 1ZGLP 2D7TH 3QIWC 3UTPD 3QPQD 4I2XB 1BFTA 3BKCH 1BPVA 4LRIA 4RMTA 4Q6IB 4D8PB 2A83A 1QFUH 3FN9A 1IBGH 1B2WH 3D2UD 3QIUD 4JO3H 4X9HA 5CGTA 3AM8A 2YC1B 3OKKB 1A6AB 1OAZL 3V0WH 3GM0A 4YX2H 1ZOXA 2ZCLH 1LO5A 1EPFA 4TUKH 3QDJE 4GRWB 2GK0A 1I9EA 1MVFA 4F7PA 2OL3H 3N1FC 4XP6H 5D1ZA 1DFBH 1KELL 1A7OH 3L3JB 5DJ8A 1O0VA 2FX7H 5C0ND 3QI9C 1P5UA 4TVPE 5HHMB 4K3JL 4Z76A 3C60C 4NKIL 1JV5B 4O2EA 5BS0D 2XWBB 5DO2C 1J5OH 1NPUA 25C8L 4OSUH 3SE9L 4PRHB 3P9MB 4LFHG 1EH9A 2W0LA 2VB5A 4PJFA 1M1SA 4MMZC 1CICB 3HE7B 5DJYA 2IANA 1GYAA 1NCTA 1WFUA 1I7UA 3FO1A 5DJ6B 1RURH 2YPKA 4Y19D 2P49B 4NCC2 4RGNC 5EIIB 4X4YB 1A14L 2QL1A 3AREB 1TCRA 2CMRH 3ZHLA 4RNRA 5AG9A 2B1AH 2HT4D 5D9SB 1DANT 1FV1A 5H35B 4QF1B 3OPZH 3FFCA 3K81A 3LKOB 3ORJA 2VDOL 4JZNA 2Y5TA 4ZUWB 3O0RH 4DKFH 4EDWH 4KC3B 4PRIE 1YEKH 5E8PA 1DSFL 5I8OH 2Z93A 4Z7NF 3MCLH 2DJ4A 2ENSA 4PJBF 5IG7A 4AMKL 2BJMH 2BK8A 4N0FB 4X7SH 3GBMH 2W91A 4J4PC 4NQDA 3V5KB 4NO2A 2F5AL 2DQEH 3D0LB 4Z18A 3E6HB 5FGSA 1RMFH 1U92B 2E7HA 3C6LD 5ADOH 1V8HA 5GGTA 1BAFH 2YA0A 2HT3D 3HC0B 4HIHA 4E41A 5IFJA 4H20L 3MV9B 5B39A 1T20A 5AD0A 5BV7C 5GZNC 3X14B 5I1GL 4X7FC 3F5WB 4JAMB 3U2SB 2WBJD 4G6KL 1A64A 2MHAA 2R69H 4G3YL 2BOCB 4XPHH 3AB0B 3LEXA 1T66D 1BF8A 4NC2B 4K2UL 1H5BA 1EV2E 4KJWD 3O2WL 3RIFF 2W07A 5JR1H 3VU2A 3DROB 4DGVH 2FH8A 1N4XL 5E4IA 3O3DB 1MCRA 3SDXB 4B53A 5FV1L 4IDLA 4HUXA 2H45A 4AEHL 5C6TL 4LCCB 2W9DL 3M17A 4H0HB 3KPQB 2EDDA 5I0DA 4WJ5A 4P3WA 3LRHA 1Q72H 5CZVH 1SM3H 4OBSA 4PJHF 4U6YB 2EIBA 2YXFA 3WO4B 4JRYE 3OGCA 2VXUH 5I17A 3CLFH 2FO4A 3VXSE 1X5XA 4O2FA 1MFAL 1OVZA 3QO0B 4YUEH 2PXYC 1T22B 3BGFB 5BQ7B 2CRIA 4OV6F 4JFOA 3ARBB 1CL7L 3FO9A 3B9EA 2IJ0C 1FO0B 2YKLL 3BKCL 1HXYB 2WWKT 3LN5B 2A9NH 1ITBB 1QFUL 1IBGL 3JWDC 4H5SB 2CJUH 4AM0A 2DDQH 4IRJD 5ESVB 2R1WB 3V0WL 4YX2L 3QFDA 2UUDH 3DV4A 1Q9KB 1EAPA 1NMAL 3NGBC 1X5LA 5ESQA 2PCPA 4XVUD 1HH6A 4LEXH 4XP6L 3UTPE 1SYSB 2QQNH 2DBJA 1OP9A 2P5EA 3D25B 1QRNB 4QNPF 1NBVH 2C3XA 3BP7A 1UVQA 1YNTB 3MR9A 4WO4C 2UWEF 1J5OL 1NMCC 5IVXF 4MNHB 2IH1B 1LO0H 1TPXB 1CIDA 1J05A 1BBDH 4TTGA 1YUHB 5D2NE 3HRZA 1JRHH 2BFVH 4PUBL 5I8CB 2QLVB 2FIKB 3K0WA 4N8VA 5TQ2H 5A2FA 3NZHH 3OPZL 3GMNA 1MCKA 3TEUA 2L4OA 1UC6A 2Q8AL 3HC3L 4J12A 2QQLL 4ZFGL 5BS0E 4P9ML 4Z95L 1OD7A 1CXHA 4EDWL 1JE6A 1OP5H 1I1YA 3LQZB 3WSQH 3JWOL 4YJZL 5F9OH 4IRSC 4Y19E 4PTTB 5C08D 5T3ZH 1MEXL 3LRSA 3FRPG 1EO8H 4R8WL 2MFNA 4L3EA 3BDYL 1F5WA 3MLUH 5I71B 4P3DA 3ZHKA 1RMFL 2HLFC 2NNAB 2D2OA 1MWAA 5K9QG 1T5XB 1Y0LA 2GCYA 3BDXA 2CRYA 1YC8A 4UZGA 2VAJA 3FT2A 4NM8H 1EO5A 3L5JA 1NGYA 5JOFB 4JHZA 5D6DC 4U1GC 3W81A 3QDJB 5KS9B 1JNNH 1G1CA 2EYRB 5HHPA 1A2YB 1BWMA 2JB5L 4HXBL 1KC5H 3C8KB 3DMMC 3F12B 2NY0C 1AO7D 4PGEB 5EUOA 4P4KC 4HKBA 5CZKA 4DVBB 2AJZA 2ICEB 3DUSA 3STZA 4QXUH 3VXUA 2P1YA 4FQQA 1MCJA 5MEOA 3MBEB 4JLRB 4M6ML 1JZ4A 3ZL4H 3BSZH 1IC5H 1YPZF 1NAMA 4LSPH 3O8XA 1H0DA 4OUUA 5FYKH 4YE4L 3T2NH 4MCZA 1J1XL 5CZVL 1SM3L 1IC1A 3S37X 3MMEA 3G5YB 1IAKB 3W0WB 3P4MB 4YGVA 5BVJA 3BKML 3X13A 5C71A 1K8DB 2N7AA 4JHWH 3VXMD 2AEQL 5KSBA 4XC3H 5HDBF 1T03H 1C16B 1JMZA 1DQQB 3RY4A 5H2BB 2DQHL 2IADA 1FH5H 4XPGL 1U2CA 2A9NL 3SKOB 4KKCC 3ELAT 4LLUB 3ZKXC 5H94B 4I2XA 5MENA 1DANU 4HBCH 2BVPA 4JR9L 4D8PA 2RCSH 3NIDE 4NKOA 3VXPB 4Z77B 5K59F 3D0VA 3B5GA 3OKKA 2YC1A 4NFCA 4NPYB 4LEXL 5I8KH 1OW0C 3WHE1 4LQFH 4LLAA 4NRYB 2C3VA 4LBEA 1T2QH 4LLYB 4AIOA 2QQNL 2YUVA 4FTVD 4NWUH 2VITB 2ADIB 4Y2DA 4OCNC 3ZKMD 4MJ5A 3MXWL 1NCBH 1D5IL 5DHYB 3QUXD 3OZ9L 4XVJL 3OKNB 5I0ZA 4X5LA 2XWBA 1B88A 2C1PB 3FL7A 4WUKL 1FDLL 1JRHL 5DD6B 4CL7A 5HDQL 2BFVL 5HVHB 3GMOA 1NFDF 1CGXA 3B5TA 1T7XA 1CICA 4R90L 4ALAH 43CAB 4UNVA 4K71B 4B0MM 4OV5B 1WZMA 3FQUB 3AREA 3H9SA 3CNKA 3EHBC 1HINH 5D9SA 4U3CA 3JZ7A 4QF1A 1A1NB 1HCFX 2ZNXA 5DHVA 4MA7L 2AERT 3MRLA 3LKOA 1JYVA 4JRYB 4QT5B 3SOBL 4LFHD 2IFFL 5EUKA 1OM3H 3VXSB 4ODHL 4F58L 4OKVB 4JZOB 5CP3A 1HIMH 3MLUL 1TENA 2AJXH 4LPXA 2LTQC 5J13B 3A6CL 7FABH 3WS3A 2CO6B 5I15L 3V5KA 2F19L 3D0LA 1NGZB 1IGYB 1U92A 4G9FD 4DGIH 4XHQA 4CN6A 3DUHA 5HD8C 4GW4B 3VG0L 5E6ID 3SE8H 4GAYB 1RQ5A 3EYFB 5C08E 3WNKA 4PJFF 3X14A 3U2SA 4JAMA 1YEFH 3I75B 4MGXA 3QG7H 5JHLL 1FSKC 4S2SA 2ZNWA 2EXYD 4HZAA 3HB3D 2BOCA 2QADB 2ADJB 2J4WH 2XT1B 4JCLA 4F33B 5L9DH 4L3CB 2I26N 5E8OA 4MJIB 1G7QA 1FNLA 3DROA 2GK2A 1RJYB 5D2NB 3SDXA 3RGHA 3BN9D 5IBLC 5FYKL 4LCCA 3SE4A 2D31A 1AO7E 3KPQA 3SDAD 1FZJB 5FO7A 1I3VA 1KN4H 2ADGB 1YEDB 4PJDE 4OFKA 5FKAA 1Q9LB 4X7CC 4PTUB 2EDKA 5D7LD 4X99B 1PKOA 1DUZB 5EO9B 2VLRB 3Q0HA 5CBEA 1T89C 3CDYA 3PP4L 3QO0A 3B9KC 1T22A 5BQ7A 2BNUB 4HT1H 1LK3L 2VLJB 3ARBA 4Y19B 2M1KA 4GRMA 5I74B 1HXYA 3RVVC 2A77L 1RZIA 3LN5A 3SKMB 2NY1D 4WW2B 1S8DB 2YN3A 3IVKB 3NZ8A 4H5SA 5F7MC 3ZMRA 1NDMB 5ESVA 2YD8A 2R1WA 3IJYA 1BBJB 1YQVH 3VXME 4HKJA 3MTRA 3NCMA 3RBGA 4W4NA 4LQFL 4POUB 2AJYL 3JV4B 3BD3A 1HXMB 3E3QC 4GUPB 5HHOD 4NWUL 1M7DA 1RD6A 4RFOH 2NY4B 4KJYB 3D25A 2YA1A 1L9MA 5D7JD 1QFHA 3RKDD 2BERA 1FE8L 5D7IF 5ESAB 1YNTA 1AGEB 4X9GA 4TVSa 4NZJA 4XP1L 2YRZA 4KKLD 4M7JL 4GBXD 2IH1A 1VFAB 1CK0H 4PG9B 1PD6A 4ALAL 2GJZA 1G7MB 1YUHA 4HCRH 2X4OB 1R3LB 3GSQB 3EDJA 1VEMA 5E9DE 1Y18A 4N0CD 4YO0B 3H9ZA 2ZSWA 3S4SB 2FIKA 4ELMB 4BZ1L 4OZGE 5C0CD 4PJCE 4PREA 1U93A 3JV6A 3QDGD 4G8EB 4WY7H 4UAOC 3LKQA 1QZ1A 1LVEA 3DRTB 1F6AB 5FKPB 1BFOA 3DETC 1JF5A 4PJ5D 1NL0L 4UDUB 2WQ8A 5H8DA 4RMUA 2ED9A 4FN0A 7FABL 1C8PA 3WCYA 4PPTA 4HZLA 5D4QA 1JHLH 2NNAA 5DWUH 1VFBA 2RQ8A 2Y72A 1T5XA 4KH2A 4OM1H 4OLYL 2YD5A 1G1YA 1DLFH 3K4ZA 5IVOA 2Z31A 4JPIB 3MOAH 3CFKB 3QDJA 3UROR 4OGZA 1YEFL 2EYRA 5IMLA 4HD9A 1A2YA 2EE2A 3IU3A 3MLXH 2OR7A 2X1OA 3QG7L 4L8BB 3ARFC 5C0EB 2B0SH 4OUOA 3VFTA 3F12A 3INUH 4OLVL 4IRJB 5SX4I 4DVBA 4KI1A 4G9FE 5L9DL 4KGJA 2XNAA 2P8PB 3EYSH 2VERN 5IV2B 4FQ2H 5LAXB 2P24B 5ALBH 2AJVH 3JV5A 1UM4H 3L3IB 3MBEA 1DQDH 1Q94A 1QFWL 3BHBB 4HPYH 3TA3C 1U3ZA 1CTNA 3QZWG 3UYRH 1KIUA 3HE6C 3LN9A 3G5VB 1CXEA 1TIUA 3CDCA 4MAUH 2GAZB 3BH8B 1XF1A 1OSPH 5DQ9A 4UB0H 1WV7T 2ESVB 1UZ6E 5IF0A 4WFGD 1IAKA 1PDKA 1QBML 1HQRA 3E2HB 3N06B 4PS4H 1K8DA 5F1SA 5ISZE 3S6CA 4PRIA 4HT1L 3S37L 2XZQH 3UXFA 4KVCH 1MRFL 2DL9A 1WAAF 5BV7H 3MLWL 1QSZA 1RU9H 4EI6B 3MRGA 4OZIB 3LY6A 2IG2H 4UV4H 5H2BA 3VWJC 3VFPB 3D85B 1JTPA 4LLUA 3NCJL 4XX1G 3I85A 4LKXB 3M8OH 1JPFA 3MXVL 4WI2A 3RWIB 5EUOF 4KPHH 3VXPA 4Z77A 2ZJSL 1ZS8B 5D7LE 5FM8A 5KSAC 1MNUL 2HYMA 4NPYA 1KOAA 2MPAL 3QJHB 4BELD 5IFAL 3VRLE 2FJFB 2ICCA 5KVFH 1DE4B 3QEHB 4NRYA 1KIPA 1KCVL 4LLYA 5C08B 3U9UB 4S1SL 3RQ3A 3RHWK 2ADIA