3LDBB

Structure of jmjd6 complexd with alpha-ketoglutarate and fab fragment.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMSCRSSQSLYYSGIKKNLLAWYQLKPGQSPKLLIYYASTLFTGVPDRFTGSGSGTDYTLTITSVQAEDMGQYFCQQGISNPYTFGAGTKLEIKRADAKPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLSSTLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional arginine demethylase and lysyl-hydroxylase JMJD
publication title Interaction of JMJD6 with single-stranded RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbB01
5FCSH 3ULSA 1ZT4A 4OZFH 3NBNA 2YMXH 2QHLA 4WDIB 3BZFB 3VMNA 1KIPA 5BRZB 2A6IB 2HLFC 2ADJA 5F7UA 4KKAC 5BQ7A 1MRCH 2OQJA 4JZOA 4UT7H 6FABH 2DQIL 4I48B 1BPVA 3RY6A 2BOBB 4TUJB 3R06B 2E7BA 1K2DB 4KXZH 2R29L 4ESKA 1FAIL 3OR6B 5D9SB 1XF4B 4HIIB 4HK0B 1YY8B 1IQDA 5L0QB 3BZEA 3BXNB 3ARQA 3FOLA 1XGRB 3RZCC 3VGDA 3VE0B 4XNUH 3IJHB 3SEPA 3L3OB 4P23B 5ADOH 2NY7H 4NN6C 4HG4J 3AAZB 2APFA 5E1HB 5FCUH 4F3FB 4ZO6A 3SJVE 3SCMB 2CO7B 2GW5A 2R23A 2YPLE 5IOPA 4NN7C 4U1IA 5ABDE 1I9IL 3VCLB 1CFBA 5C0BD 4NPYA 2O5ZL 3UTTD 4PRPB 4HUWB 5C0FA 5I16A 3O0RH 3T65A 2JK5A 1RZGB 4CRPA 1KCLA 1I7ZA 5D1ZD 5MP6L 4Y7MA 2Y5TA 4H1LA 3SJVB 1CU4L 3BSZH 1LO0H 5F9WC 4BQCA 1GGUA 3OX8A 3C9NA 3RAJH 2Y6SD 4ZUUB 4LCWD 4M5YH 4I3RH 2EIBA 4LHUB 3JBG7 5IB4A 3N9GH 3OAUL 4HUUB 1NGQH 3GSUA 5FO8B 3G6DL 1MHEB 4HWBH 2D3VA 3VD9A 2XWJB 4FZ8H 4JZNA 4X9FA 2ADGA 5JTWA 1XGTA 3AMLA 1ZLUH 4OFYA 5CD3B 43CAB 4TUOA 1OTUC 3AB0B 3IDMB 1MNUH 4XMPH 1MLCA 3U6RA 3UTPE 2X4QB 1TZHA 1I7UB 3RX7A 3QDGB 5I19H 1X5XA 5IFHL 2YPLA 3MA9H 4JY5H 4TTDC 1HINL 3L5JA 3EHBD 1AGBB 4GKSA 2AJ3A 5E99H 1MFEL 3HRZA 2XY2A 4HKXB 4YGAB 5C0JB 3I2CH 2ADFL 5E94B 5T3ZE 3MMEB 2DM3A 2H41A 3EOYG 4N9GB 2NXYD 4HUUA 3T0EB 4MS8C 2QQNH 4M3KB 4PY7A 3PQYB 4QYOB 5TDNB 4QHMA 4N90E 3I50L 3KGRA 4ZPVA 1ZSDB 1XGUA 4MA1B 3BKMH 1WICA 1H5BB 2R8SH 5MERB 3BGMB 3D3VD 4KQ4L 2OR8A 1LNUA 2EECA 2X70B 2AJXL 4XHQA 3UTZA 4H26B 3F7PC 3KLHD 4JJ5B 5FKAB 2EIZB 1KULA 5DVMA 3O6KL 3PL6D 1GZPB 2OI9B 4WTZA 4MJ5A 4HFWA 5CGMA 3B9KC 2VRAA 1FL3A 4IHOA 3V6FB 3VA2C 3W5NA 1HXMA 5C0RL 1DQJB 4DGVH 1OP5H 4YHML 3VFPA 2I25N 4OGYL 3MV11 1S7QB 4J3XA 5T3ZL 1JZ4A 1E27A 2VDRH 3QPQD 4O5LH 4XWOC 5EN2B 3CSBA 4WWKB 4S1SH 2AEQH 5E9DE 1UEYA 2HKHH 3OAYH 3PWLB 1QVOA 3O6LH 3GBLA 4XNQB 4LU5H 4TPRH 4JO3L 2F58L 1KPRA 3MROB 1PZ5B 2AK1L 4LCCB 1PG7X 3S36X 3S3JA 3QZWG 3FO0L 3F12B 3ZE2F 4OM1L 1HSBB 1T20B 4Z95L 4UUJA 1MEXH 5EU5A 5ACLA 1NAMB 1PY4A 4LFHD 3KPNB 1A6UL 3QG6A 5EU6E 3LRHA 3BEVB 1OCWH 1E28B 1LEIA 4BQ6A 4Q6IB 1UCTA 1AGEA 5F3HB 5KS9B 1JZ2A 2BXYA 1DEEA 5HYQB 3ZHKA 3K46A 4OBRA 1IM3A 1IC4H 5I1IL 1UB5A 1YMHB 3O6FA 5ITBL 2H3NB 1GPOL 4RCAA 4JY4A 5E9DA 3L1OL 4U7MA 4WFHE 4HAGA 2ITCA 1JUFA 1RUAL 2AVGA 3B83A 3MRKB 1JWMA 3K4AA 5F9DC 4LDEB 1A1MA 4M7KH 1XMWA 3L7EA 1K5NB 5GSRA 4I0PD 3FMGL 1BZ9B 4L8CB 2CKBA 3OG6B 2DTSA 1J86A 1FNSL 2DQCH 5MENB 4X4ME 3RWCA 3G5XA 3TVMB 1ORSB 5IM7A 3U7YH 4FNLL 3RJDA 4LPTA 3KNBA 3QQ4A 1PKQE 5HXMA 4YDKL 4M1GL 4JLRB 3RGVC 3MLTA 3NCYP 5E1AA 2Z31C 5EU6A 4XX1E 3QULA 3LQAL 3VXOA 2HJKB 5GGRA 4BJLA 3SGEH 1T1ZA 5MEOB 5K9JL 4MA3B 4J6RL 2UYLA 2RB8A 3AY4C 4FOMA 2GJ6D 4DCQB 5DRNA 1CXEA 1TVHB 4S11A 1SVZA 1W0YT 3DECA 2Z35B 4XVJH 4FP8L 2EDBA 5HGHA 4OB5L 3TN0B 3CLFH 4HG4K 5JQ6L 4HIJA 1VKXB 2VKWA 3GIVB 2X4PA 3IDNA 4NQDE 3I85A 1INEL 1JGVH 2C5DC 3ZZ1A 5LCVL 2FDBP 4FZEH 3VFMB 4YHYB 5H8DA 4X4MA 4R7NB 3IJSB 3UYRL 2QQLL 2W60A 3VRIA 1I3RB 4IBLT 2GEEA 2IAMC 2VZSA 5BV7H 5IW6B 1PKQA 1AXIB 4DTGL 1FO0B 1YYMH 2OMNA 2WSKA 3DETD 3QDJE 2R0LH 4RWYH 5D72H 5GGQH 1CXIA 4NQDB 5C0BA 1HEZA 1C16A 3LN5B 3SO3B 3KYMB 4Q58C 1T1WA 3KDMB 1U8IB 2P5ED 2CDGA 3HNTH 2F5AH 2ZOKB 4LARH 5C2BH 1N0XH 1FL6A 3C2AH 5IHLB 1INDL 3DUUA 3G5VA 2D2OA 5D1ZA 4L8BA 3T09A 4IMKA 4GG6F 3EFFA 1Z0NA 5JPNB 1NMCB 2P8PA 4ZFZB 1CGYA 1QFOA 4G8IB 4R7NA 4Y19B 1EXUB 1RU9L 1OHQA 3JUYA 2CR3A 4UT6L 1OGTB 1UM4L 4RMVA 4RGOL 2FSEB 1SM3H 4NHCH 1XIWB 3ARBA 4PLOB 5F7DA 1U3HC 5IEHB 5EBGA 4Z7WE 3N1GC 1G7PA 4EI6B 1DQQA 1KB5B 2JCCB 4U1JB 4EJ1C 3QUML 2OSLB 4JQIH 2H8PB 3C5SA 5CBEA 4PUBL 3FQUB 2EH8L 5I1EH 2CJUH 5D5ME 5IB3A 2NW2A 2D7QA 1RMFH 1HQRA 1ES0B 2V2TA 2KKQA 1B9ZA 1MHCB 4PG9B 1SYSA 3QUMA 2R1XB 3QDJA 3B3IB 1RIHH 4ZFZA 5SX4H 1JNNH 1FZOA 1YECL 5F44A 3L3IB 4IDJH 4FQCH 5TQ2L 4U0RC 4Z7WB 3FOMA 3OXRB 2L7JA 2NNAA 4NDMB 3Q5YA 3R1GL 4WRLA 5D5MB 4Y4FD 1EIBA 2DBLL 2VLLA 3UBXI 4ZAKD 5D2NC 1AQKH 2CUMA 3PWPE 4PLJC 1OAQL 3JUZA 4EI6A 5EDXA 2ADIB 4NFCA 1U8QA 1JF1A 3ARRA 4Z77A 5E7FA 3VD4A 2C1PB 1JTOA 3TBWB 2HFTA 3D3VA 3S96A 5T1KB 3G04A 1FZKA 3MRFA 4G5ZL 1Y6MR 2WWKO 4Y4KC 1DANT 4U1HB 4O02L 4GSDH 4FFZH 3ULVC 1MCHA 3ROLA 2A9NL 4AENA 1G7HA 3Q6GL 5E2WH 3DVGA 5HHOB 5BVPL 2J6EL 1CFQB 1KJ2B 3NVQA 5HYIA 3ROOB 1HXYB 5D6DA 2NY2C 3GMRA 1HILB 5IKCB 4OZGF 2Z0BA 4UMGA 4HV8B 4G42B 2BMKB 4WGWB 2R56L 4HS8L 3TCXA 3UTSB 1EO5A 5DJ6B 3X12A 3D1MC 3DSFL 1T7ZA 4PLKC 3ULVF 1CZ8H 3PWPA 3LHPL 2VXUL 2NY5L 2WUBL 3N85L 1AXSA 25C8L 1VDGA 1T6VN 1A1OB 2BHZA 5T1MB 1A7OL 1QSFE 3EYUL 4ERSH 4LLWB 5DMGC 3G5YB 3O9WD 2R0KH 5E6ZA 1NUDA 3HAEB 2HT4C 5I17B 4R2GB 4Z8FL 1DBJL 4HQQL 3QFJE 1I1FA 1NL0L 5BOPA 1HHJB 4OTXH 2W0FB 1IAOB 4ZQKB 3WXVL 1YQVL 5GJTH 1QLRA 2W65B 1DCLA 5JXAL 4CMHB 1A3LH 3EYVB 1M05A 4OZFB 2VIRB 4U3CA 5FHBH 1T21A 1BLNA 3EAKA 1RZJL 1JV5B 5JHLL 3O45A 4GAGH 4LSRL 3HI5L 2E7MA 3QFJB 2AJVL 2VL4A 4MD4A 4OCXH 4NQEB 1BZQK 2ITDB 4KK9C 1ZT7B 1B4JL 4EUPH 3TP4A 5H94B 2MMXA 4FXKB 3WS3B 3HZYA 5J11B 1G9MC 2GITA 3F5WB 5I9QB 3WJLA 3QQ9D 5E8EA 5EB9A 5IVOA 3U7AA 4P2YA 3UXFA 1G7QB 1OAUH 1WZLA 4OAWA 1QSFA 2I60L 4NO5A 4KRPB 4XTRD 5C0AE 2HRPH 2ZNWA 5F71A 4QTIH 2YA1A 3GSWB 1WT5A 4UILL 3CSYA 4XCEB 4XBGB 1JNLH 1OPGH 4PGBA 4CU8A 1S7SA 3DMMB 3ECBA 4K7FA 4N1HB 1OGAE 5F72S 4LLVA 5DK2A 1JFQL 4X99B 1T66C 3WD5H 5C86A 1J05A 4FQLL 1DUYB 3DOSA 3U48A 5HI4D 3QIWB 4J4PA 4WFFD 4P9HC 2GTWA 5SX5H 4DFHA 3RNQA 2P5WE 2CXGA 4LLUB 1FORH 3VXTB 4NM8L 3IDYB 2AABL 4HIHA 4ETQB 2UUDK 3SKOB 5EC2A 5F1KC 3VGEA 2B20A 5CWSA 3G08A 3P77A 2GJ6A 1DBBL 4X9GA 3TO4B 3KHQA 2NYYD 3KG5A 1JNHB 3H9SB 3QSKB 4HFUL 5GPRA 1U2HA 1F4HA 1VFOA 4OCRH 4AEIL 3EOAA 3EYSH 5K9KB 2YXFA 2Y06H 2ZCLH 5LAXB 4K7PH 4YUEL 4MSWA 1BD2D 1K4DB 2LU3A 5FHAH 5C0AA 3U0PA 2PKDA 4GW4B 5D71L 3BMVA 2L4OA 3V5DB 5DQ9A 3TNNA 3MBXH 1RZ7L 1NC2D 1OGAA 4GW1A 4DVBB 2CK0H 4PTTA 2B4CL 4ZOAA 2AGJL 1N4XH 2EDTA 1SJEB 3SY0A 4CAGA 1QBBA 4QOKB 1JHTA 5TDOA 4MD0A 3SPVA 4EVNB 3FFCE 3BPNC 3G5ZA 5IMOA 5F1NB 5DZLA 1S7WA 5KTEL 3C5ZA 4M6OH 1QOKA 3CFEA 4L29A 1CDBA 5IVZA 2P5WA 2IJ0C 4JFPA 5GIRA 5ESVB 3PWVA 4U1NB 5MP6H 1FYTD 4X7DC 2ZCKL 1MCWM 2DJ4A 2FO1A 3LKQA 2W1NA 1KJ3H 2GIYA 2GKIA 4HC1L 1AY1H 4PJXB 2B7DT 1EGJL 2YPKA 4OV5B 4DUWA 4UB0L 4HWEL 4NIKB 3M17B 4WENB 3U9UA 5JOEA 5KAQG 3LD8C 4O51A 4P46B 2G2RA 1NLDL 3MRCA 4JO2L 4HC1A 1CT8A 3DROB 1Q94A 4PYGA 2M26A 5TQ0L 3LQZB 1DBKH 4KMLB 1KEML 1ADQH 2EDLA 4HAFA 2FHCA 3F58L 4XP4L 1F42A 2E5EA 3UPRA 3OGCA 1F11B 5A2IH 1XGPA 2CXKA 3L3HA 3OJ2C 1LE5B 4JM4L 5C92A 3LQMA 5DC0A 2B39A 3RVTD 3U9PH 4JFOA 1XH3B 1AP2B 2BSRB 1V7NH 3FFCA 1AI1H 1D6EA 3F7VA 1FZJA 5JIPA 4PR5B 2CLVA 3BUTA 1MAKA 3BDYL 5DHYB 3QB7C 1JGEA 1DQLL 4KUCD 4R7DA 3GBML 1QFWL 4J3OC 4ONFL 2MKWA 3BISA 4J8RA 3QCTL 3I75B 3UBXG 1E6OH 1KLUA 2VH5L 3GSVA 5GRYA 4ACPA 5GS3A 4ZD3L 3BI9X 1NBQA 3T77A 5KSUB 4I0KA 4YDJB 5I71B 3UO1H 4L8SB 4M7LL 4A2MA 5GRVK 4DQOH 3RX5A 1BJ1J 2AJSL 2V9QA 3RL1B 5GS0L 2VWEC 4L8DA 4M4RA 1Y0LB 3WN5A 3GSXA 3RWFA 4D0DA 4DJMA 2N56A 3CZFB 5EIVA 3EJZC 3VFGH 3HZKA 3MRJA 3HRPA 4S10A 4NFDA 1AD0A 5FO9B 1U2CA 3DX9B 2H32H 4JFXB 1UWXH 4YHNB 5DD6A 5FK9B 1H3PL 3MLUH 1A9EB 5DUPL 4KHXH 5C1MB 3C2SA 3BP7B 3HMWL 1N6QL 4Q9QL 1CLOH 1KJMA 1UXSA 2Z8WC 2Y1VA 2AKRA 4ODHH 4YXLL 3LKPA 1N2RA 1BFTA 3QIBD 5SWSE 4ZYKA 5DR5H 2AK1H 3OKNB 3TC9A 5JPMB 4URTB 3ARZA 4NYLA 2XQBH 2P45B 1U36A 4QY8B 1ZWIB 5E6ID 3DX9A 4Z76A 1QSEB 4O58H 3RFZC 2AV7A 4P57B 5A3IC 3FQTB 4L1DA 5F1OB 1S7VB 5IFJA 5CLTA 2FX8H 2PR4H 2FRGP 3S34H 3REVB 4PGZA 4ODWB 4PJCB 4YDLC 3CMGA 4JR9L 4MD5A 4NNYA 2AXGA 1IGJA 2NY0D 4KJPC 4BKLB 1BVLA 2X7LA 4H1LG 5BVJA 4LSVL 2IGFH 1C08A 1NCTA 2OBGA 2JE8A 1LEGA 3IDGB 5IK3B 3U2SA 5SWSA 1RK0A 2ZUSA 3PWUA 2HJFA 4JRXB 5BV7B 2VDQL 3MO1B 3HC0B 3PHQA 1AGFB 1BD2E 3D85B 5KN5A 1R5VB 4PJ8D 4BFBD 1B0GB 5JLZA 4UOW1 4LSPL 4JVWA 1QFUL 4J3WA 2IMMA 5GRWA 5DMYA 1F13A 4W6YB 3ZYZA 1EJOL 1LP9E 1QKZL 2H9GB 4U2ZA 1BFOA 1XF2A 5JW5B 2VAAB 1YN7B 1L7TH 2EYSB 5FOJA 2B8OT 3IDXL 5DRZB 4QWWD 4X98B 5JR1H 1A7BA 1ZLVH 2F5BL 4LVOC 4MQ7B 3B6SB 5K9JH 1INQB 5JMRA 5HYFA 1FNGB 3TZVB 1MJ8L 1WK0A 4Y5XB 1G6RL 4YZFE 1FYTE 1I3GH 2IH1B 3QDAA 2XG5A 2WUCH 4O9HH 4Q9CA 5F88A 2FX7H 4XC1L 1G6RA 4KJQD 5EZOH 1T89A 4NUJA 2O26U 5I75C 5D1XB 3RVUD 4HBQA 4Y1AE 3ALWA 2KH2B 4OB5H 2F54B 3S88H 1BD2A 2AXHA 4OCMC 3FTGA 4E41B 4Y16C 4OFVA 1H3VA 2XY1A 5J56B 3VXMD 1JGLL 4AEFA 3D39B 1HOCB 4EDWH 5DD5H 1ZLWH 1MI5B 1TCRB 5HGDA 4KVCH 4KGLA 1NC2A 4C55A 3VJ6A 1NFIA 3ORJA 2PYFB 4U1SB 1LP9A 5J9PB 1FVEB 5IJKA 1G7IA 5BMFH 4OUUB 3B5GA 1FLRL 3VXNA 1ZGLP 5L2JB 2PNDA 5I0ZA 2J8UB 3QUZB 3VRJA 4KKLC 5A43C 4X6DF 4I5BB 1VGKA 1FYTA 4MNQB 4YFLF 2C9AA 4FG6D 4FQXC 3X11B 1OAYH 3REWB 3SBWA 3VFSA 1QFHA 1Z2KA 4MXVE 5FB8A 5ICZA 1P9MC 5F7HA 1FVEA 4Y1AA 5C6WH 3FHAA 3L3GB 1NBVL 1UACH 4AQOA 3QNXA 2OJEA 1QYGL 4HCRL 2B5IB 5EULV 3V0VB 4N8VB 1F58L 4KI1A 2YS4A 3MRQB 3H7BA 3MRGA 4JG0L 5I18L 2HFGL 1V7MH 4EN3B 3F8UB 4I5BA 3TPUB 4HCRA 3E0GA 4GW5B 5I1KL 3U4EA 3MCKA 4POUB 2R4SL 4YNYA 1CDCA 2ZSVA 5FYJH 3ES6B 4I9WD 5IF0B 4ZTPL 5ACZB 4JREC 1DZBA 3T0VA 4P5TA 4OJFL 3MGTB 3BQUA 4NQTA 3GI9L 5DEGA 3CU1A 3ULUH 3U83A 3L3GA 2DBLH 2BDNH 1FRGL 5E8PB 1OAQH 1WWAX 3B8YA 3NIFF 4LEXH 5ESQA 3C8KA 3AS2A 2UZIL 5DSCB 4YWGL 1RIVH 4O4YH 1HHHB 1WLHA 4NSKB 1YNLH 1YC7A 3B4NA 5CIPB 1NDGB 2BRRL 2V5SA 3T0XA 4G5ZH 4WEBH 1R3IH 5LXGL 4K07A 4KKBC 2BY1A 3IXTA 2XKNA 4EUPB 1MLBB 5D70L 5KOMC 4X6CB 2DI9A 3UBXB 3LVEA 4Y5YA 4G6MH 1I1AB 2UWEF 1GHFH 5DD1H 4PJFF 4F33A 4XPFL 1HCFX 5DK0A 1MUJA 5DFVC 2XNAB 3HCVB 4ZUSB 1AGCB 4Z7VE 1S7TA 1IEAB 5KG9B 5C2UB 2DIJA 3BH9A 1MWAL 1UVQB 2VLRE 2XZAL 4HS8H 3LIZH 1MJUH 5HYJB 5FYKD 4Z5RA 1X4YA 3M45A 5FM5M 1NGXA 5T5NF 3A0OA 2IPTH 4WY7H 1U41A 4QXUL 1JHKL 1QD0A 1MWAA 5D7JC 4TOYH 3RIAK 3MNVB 1RJYB 1YZZA 1YUHB 1A9BB 1JMZA 4JFFB 3N85H 25C8H 2MCG1 1T2XA 1A7OH 2Z8RA 1UM6H 5JIHA 2AJZA 2LVCA 32C2B 2VLRB 1L4IA 5D93B 4NNPH 1AFVL 4YC2C 4NWUL 4WWID 4MA7L 2ATKA 5KSAB 5E6IA 3DUHA 1JYNA 4OD2A 3QJHB 3SDXB 1U92A 4TUKL 5JXAH 3RDTD 1R3LA 3PP3K 1GGTA 1WZ1H 5ECJE 1NQBA 3SKUD 1YEHH 3C8DA 1QRND 1F2XK 1RJYA 3C6LA 4HD9A 1OP3K 2VLMD 3HI5H 4RFEA 5FFLA 3LSOA 4F2MB 2AXJA 3F6IA 4Z7VA 1RI8A 3G9VA 3LH2L 4PY8J 1MCPL 2Q76A 3GHEL 4K71B 1KG0A 1HI6A 1NCCL 4MAYC 3OZ9L 1UKSA 1FNHA 3MV7E 3WFEH 1TETL 5EORL 2ATPB 2ENSA 5CILL 1YEIL 4LAQL 2UY7A 3RGHA 3OMZA 2WLZA 4APQB 1D3CA 5EOQH 1KCUL 5F89A 1S5IL 3RWDB 4PJ5B 4GAJH 4POZC 5L8KB 2VXVL 2RFXA 2WBJD 3MNZB 3D25A 4PJ8A 2V5RA 4JY6B 1YYLH 4L4VE 3MV7B 3P4LA 2YK1H 4HGWA 2RAMA 4TSAH 1GAFL 4RDQF 4IRSB 4P0DA 3IFNH 4NKQB 3PWNA 2OXGA 3AREB 2X44D 3VGAC 1CF8L 3FT4B 4GQ9H 3F7RA 1K85A 2W38A 4HH9A 3IS0X 4F7MA 4X5XB 2IBGA 3NCJH 4OZIF 2BVYA 4M93C 1FFOA 2EDDA 3LKRA 4L4VB 4WFEE 4WGVB 2NXZD 1VGEL 1ZLSL 1S9WA 1UM5L 4LLAA 2XQYG 3VWKD 4PJHB 3QPXH 1BZ7A 4JFYA 1SJHB 4R97B 1TVDA 2DLFH 4N0CD 5F9JB 2VLJE 1QACA 1N0LA 1QFWI 3QO0A 4GRLC 2P49B 4F7EB 3LKNA 5J6HA 3I02A 5FYLH 1IC5L 2AP2A 1NGZA 4NBYB 4MQXD 1KCVL 3SDCC 4YAQB 1FH5L 4MQTB 1J1XL 4R6UA 4JFZH 4Z7NE 2J88L 3R8QA 2WIMA 3U4AA 5A1AA 3O2WH 3V5HA 1TLKA 3HPLA 3F7YB 4XNXL 4YGVA 3ARUA 2AGJH 1CGTA 5J6GB 4XAWL 4R96B 3ARFC 1LO3H 3BT2H 2XV6B 2R4RH 2OJZL 2BOCB 3CD4A 1LDPL 2C4FT 3ZDYE 3PGCA 4BSVB 1LGVA 2D7PA 3L3JA 2QKIB 1SBSH 1G1CA 3AS0A 3VWJD 3IETA 3QXAA 3PXJA 4Z7OF 4PRBB 2Q8AH 1RJZB 4FA8A 4S1RL 2VLJA 2HFFB 4UIMB 4ELMF 5EIIB 5HGAB 1IGFL 3FB6B 5F9OL 1T5XA 4CVZA 1D7FA 4RIRB 4G9FD 3HE7D 3QXWA 2A0LD 1DBAL 4P4KC 2FGZA 3MPCA 3HR6A 4RAVA 2H32B 3M8OH 1LO2H 2NQCA 4RZCA 3BWAB 4XP4H 4RNRA 4UOJA 1JK8A 2LTQB 4BSVA 1AE6L 1ZA3A 4QTHB 2HLFD 5INDB 2FIKB 1S7UA 4KKAD 2CO6B 4LFHG 4RMUA 3P30L 1I3UA 3TT3L 3NCCB 1HHKB 1AGDA 1NBZA 1JPST 1ONQA 3TT1L 5ADPL 1ROWA 5T1DL 3WE6B 3MXWH 2BVPB 1F8TH 3MLPA 1A6TB 1U6AH 3QIUB 1TTUA 3CXDH 4YHZL 3VXRE 1NANH 1PGRB 2V5YA 3D69B 3RZCD 4PJBF 2DB8A 1DN0B 1DQLH 1JF5A 1UFUA 5B39B 4AL8H 1R0AH 1CK0L 5FYKU 2QSVA 2OR9H 3B8SA 4NQSB 2NX5D 3PHOB 3QR2A 2VH5H 3JZ7A 1WFUA 3DBXB 3IKCB 1BWMA 4PP2A 3MRMB 1UZ6F 1QBML 4DN3H 1DDHB 1MCEA 3NIDF 3O2DL 3G9AB 1KT2B 3EDJA 4NQCD 4KDVA 3MV8D 5CINL 1D5ZA 1FJ1B 1P7KA 3MOAH 1A02N 1D5MA 3MRBB 2EKSA 2R2CA 2YC1B 3O2DA 3NCFB 1QRNE 3ZDXE 3DX6A 5FYKL 2VLME 4XCFL 5IUSA 3PV6A 1BX2A 4E5XA 3LS5H 5L7XH 1CFVH 4K3JL 4Z7QF 4JRWA 1CIDA 2BERA 4ELKA 3T4YB 3VXRA 1UJTA 5L0QC 4W6XB 4P3DA 1JPGA 4HUVB 4N8CL 2X89A 3DTXA 4BZ1H 4P23C 4L4TD 1OTUD 4YDIH 1A6WL 4AJ0A 2I26N 5B38A 2FGWH 4OF7A 1NPUA 2FZ3B 4RFNB 5C09E 3SCMC 3S5LB 1TJGH 4JEGB 2JJWA 1T4KA 5CGTA 2R2EA 4LLDB 4TTDD 3ABZA 4Q6YA 5I1CH 2VLKD 5DF0A 1T83A 3K81A 4IJ3C 4G6FD 3BWUC 4LSDA 3KPPA 5K59E 3QHZH 4X4ZA 4ONHA 3L3DA 4W70A 3KR3H 3TCLB 4B7LA 3G6JB 4MS8D 2E9WA 1KTLA 1YQ2A 2J3SA 3GRWH 5IB5A 5HDLA 4LLQA 5CCKH 2XN9E 4QT5B 3RDTA 3HB3C 4M6AA 5EZIL 3EZJB 5LQBL 2BSTB 1QRNA 5DA4A 5JDSA 1S7RB 5F9AC 4PG2C 4LGRB 1OSZB 3O4LB 5DYOA 2EKJA 5I1LA 2A6KB 5BCAA 4U2YA 4E9LA 2X09A 3B9KD 2WZPD 3FONA 3X3FH 5ID1A 3AB0C 3HMXL 3LRSB 4G6KH 3X13A 4NO2B 3QCUH 2BXZA 4OCSL 1BJ8A 1OT2A 4OFKA 5C09A 3TJEL 4ZG1A 3S98A 3UTTB 2X4UB 1HDMA 2VDQH 5CEZD 1B6DA 3HMXA 1OLZA 3V6ZA 4QNPE 4N0YL 1T5WA 2WBJA 1KNOA 1EBPA 5J89A 2VE6A 4XWOD 2JB5L 1GGCL 3L9RA 3OKEA 1JI1A 1AJ7L 1S7RA 4LLYA 1XGQA 5DMIH 3CVHL 3T0EC 2VZUA 1UB6A 2E3VA 4KMTH 4MMZC 3WBDA 4LCWB 2Q86B 1HSAB 5HYSA 1JHLH 2XN9A 4MA1C 4Q0XL 4KUZH 1GC1H 1H5BC 2EICA 5IT2L 1IE5A 3STZB 4M61A 2VDNL 1F2QA 4GG8A 5EO0A 4OLEA 2DWDA 3JWOL 4LCUA 1N5AA 1KB9K 3VFVA 5E2UL 2GHWB 1IBGH 2OI9C 3TV3H 5FYJE 4EOWL 4QRRD 3NN8B 5D7KE 3VFWA 2GAZB 5IIEA 2ZSWB 1Q0YL 1CE6A 1IQWH 3MV9D 1MIEH 4QHNB 2H26B 1XEDA 3BHBB 1TTGA 4KQ3H 4ODTL 3P9LB 4B5EA 2PN5A 3IS1X 3MOBL 4KROB 5TFSL 3ZTJG 2JTDA 4XMKL 3OJDB 4G9DA 4WWKC 3SGDH 4LEOA 3S35H 1BHGA 2RJMA 4CVXB 1IMHC 5IQ9B 1EEQA 3LS4H 3EDKA 2Y07H 4UV7H 1O7VA 3I6GB 3S4SG 4DN4H 4W81A 1CFSA 3HUJB 4HWNA 1PSKL 3WFCL 4X6EA 1YEFH 5BZWB 3RWEB 4LCCC 4PJGB 4XPAL 1YN6A 2WBWB 4N0FA 4XP1H 3LDBC 3JV6A 4JFDB 1T1YA 1VEPA 3VFNB 3ZMRA 2HMIC 3EUUA 1NKRA 3PL6B 4CU7A 2VERN 2WWKT 2MKLC 2X9WA 3ZKMC 2P46B 1HH6A 1JYWA 3VWJA 1VFMA 3X14B 5J13C 4G6AC 2FB4L 1J0IA 3RGVD 4C83A 4PRHB 2IFGA 2NX5E 8CGTA 5MI0B 2COQA 4BFGA 1EEYA 3VXQA 3ZKSD 1G9MH 2HAZA 2X4SB 3HE7A 5I8CB 3GKWL 1UADC 4H5SA 1IAMA 3BDBA 4NRYA 3OKDA 3MRHB 5K9QI 3VFNA 1N3NA 2VXQH 4NQCE 1F4YH 4NZRH 4DFIA 5TF0A 3WIHL 5K33A 3RNKA 3MZTA 4HJGA 4MA8H 1FAKT 3RWGB 2Q7YB 1BBDH 2APTA 4F58H 4LBEB 3RU8L 15C8L 1TQBB 1VPOL 3WFDL 2PTTA 3WIHA 1IGIH 4HPOL 4UTBL 4PS4L 2JJUA 3UC0L 5KS9F 2X4SA 3TVMC 3RZCA 4NQXA 1NCNA 1WEJH 1H0DA 2BNUA 3FQXA 4L4TE 4NZTH 1Q9WA 2IQ9L 4HHAA 1SEBA 2IAMD 2VXTL 3OGOE 5D7IB 3LPFA 4QO1A 2NCMA 1DANU 4AT6A 2NX5A 3BOVA 5IJVB 3FQRA 3VW3H 2FWOB 4H0IA 1KELL 3VMPA 4B41A 4LOUC 1WBXB 4HLJA 3SDYL 1F5WA 4WCYH 3P0VH 1AIFB 4JRYD 4MB5A 1R3JA 1U95A 3FO1A 2R0WL 4QGYA 4HDIA 4NQCA 1TENA 2X4RA 4WI4A 3NTCH 2MWCA 2P24B 1MRDL 1I9RL 4ZO8A 2J5LB 2EDRA 5HHXL 4I0PB 3WXWH 3RL2A 4HXAH 1HKFA 3B9AA 4LVHB 5FM4A 5IBTH 3FB7B 2H6PB 3OR7A 4L3ED 1U3HD 3P0YL 3CPLB 1P2CB 4YHYC 1QR1B 2AJYL 4HIXH 4GKNA 5DHVA 1JWSA 4G7VH 1AHWB 3K2UL 4L4TA 1VHPA 4YXKL 1ZA6B 1IM9D 3O3BA 3ZE2E 3EDFA 5EH1A 3INUL 4G43B 3SO3C 2CDFA 1FGVL 4XHJD 3NH7L 1BEYL 2B1HL 3KYAA 4DGIL 1I8LC 5I1HL 3MJ7A 5FYLE 4XRCA 1G9NC 4YPGB 5ALCL 1NMCC 2A73A 5HTSA 4ALAH 3MRDA 1MH5B 5JQHC 3NA9L 2VYRE 4NM4H 5ERWA 3WNOA 5CP3H 4DKAA 4GUPA 2X5PA 1X3DA 4RAUB 1OTSC 5TF1H 4UU9B 1XIWC 1ZV5A 4K2UL 2QSCL 3FO2B 4Y2DD 4Y4KD 3RRQA 2D03H 2EZ0D 5DQDL 1MELA 3ULVD 3GHEH 2EDKA 2R2HB 1MVFA 4ZTOL 2OL3L 3B9KA 4GXUN 5TDPB 1BGXL 1U8OA 3OAZK 2XACC 3MV9E 2PYEB 2Y4SA 2NY2D 4M1CC 4IS6B 3P4NB 2P5EB 1B2WL 4LSSH 2DQHH 4FTVD 5BZDB 5H37G 4DVRH 2PW1B 5GGUA 3NZ8B 1BQUA 4FQJL 3P4OA 1V3JA 3V6OC 1RUPH 4CADA 4ZFGH 2DKUA 3CFKA 5D4QA 1CXKA 4P2OD 3PDOA 2LFGA 4P9ML 3CLEL 4EI5A 3OJMB 3QH3A 5E2JA 4U6YB 4G8FB 5AYUL 3KPSD 2SEBB 2IADB 2JCCF 4YHPB 3SDDB 3P11H 3WS6C 1NCDL 4XVTL 3EIFA 3IFLH 4GRWH 1VSCA 4N9OB 5DMGD 1NFDE 4WFGD 4KK5C 1OP9A 3HLAB 1XZ0A 4E42A 3GJFK 3VXUE 1A4JA 1CFNA 5SWQB 1SY6L 2YA0A 1RHHA 4WHTA 1NAKH 3HC3H 4Z7WF 3V8CA 3MLXL 4XNMB 4PV8A 1JZ7A 4DW2H 2DTML 1SY6A 3OQ3B 3IFOA 3MV9A 5D5MF 3DGCR 4BQ8A 3DX7A 1MFAL 1LK3L 2ZNXA 1PFCA 3TBTA 2CMRL 2L7UA 4MDIA 4NKOA 1IGYA 5L2KD 4XCNA 3MXVH 3BD5A 3SN6N 5E03A 1I1CA 4RA0C 2DWEA 4JPWL 1J0JA 1MFDL 4K23H 4QRQA 4Y4FB 2X4OB 4ZAKB 3JTTA 5KW9L 3H6JA 1RVFH 1S8DA 3KXFD 4XPBH 3IU4H 1L0YA 2AEIT 1QQDA 2C3XA 4Y4HB 3QG7L 1Q72L 4XNXH 5C0GB 5E6YA 3WKML 1IGTB 3MX0A 4CW1A 4JHAH 1DUZB 1IAKA 1A3RH 3D9AL 3H42L 5EPMA 5ETUB 1FGNH 2MTPA 4JKMA 4UDTA 4MNHA 1NFDA 5DO2C 1WQVT 4I13B 4R2GC 3VFUA 4RGNB 4KRLB 3VXUA 5E24E 2VC2H 2HTLD 1JN6B 5I2IA 2GK2A 3HS0A 5DS8A 3WJLC 5F3BA 3S4SB 3GMOB 4RFOH 4CMHC 3RGVA 3HC4H 1FSKB 1NEZA 2ZG2A 4UTAL 5EZJA 3QUXB 4V1DD 2A6JB 2Z31A 5HVGB 1T0MB 3LMJL 3QAZB 3E8UH 5F9OH 4YX2H 4OGXL 4PRAB 3ILPA 3QUYB 1HYRC 4XCCL 4CVUA 2KBGA 4M6NL 1HHIA 4JAMA 3ZO0A 2E9JA 4EDXB 1VFAA 3VXSE 2P7TB 3S97C 1JGUL 3AY4A 4XPTH 5CLWA 1CFTA 4X7SH 4GMSH 4PBVC 5DDHA 4S1QH 3HPJB 5K9QG 2GSGB 4XMLL 5HHVH 2HLAB 1G0YR 2FATH 1RIUL 4HSQA 5ADPH 3FQWB 1F00I 4KRPC 5MEPB 2HVKB 4KZEL 2F53B 1GVIA 4ZPTA 3WMSA 2KQMA 1U8NB 4LF3A 3T4AB 5ISZD 3CJJA 3UZQA 3DMMC 4BH8B 2PW2A 2B2XL 4OBSA 4UDUA 1OAKH 2VDKH 5IWLC 2XKUA 1Z3GH 2XT1B 2R39A 2DD8H 2IAMA 1H8NA 1MAMH 3VMOA 1GOFA 4UAOB 4CJ1A 1Z9SA 2BSSB 3FCTB 2E6PA 4WI7A 1A22B 1YEJL 1WTGT 4PB0H 3QIWC 4R0LB 5JO5B 3W39A 12E8L 1GJIA 1C5DA 4NUGH 1ZHBA 5JORB 1LEKB 3IDYC 1KYOK 2YRLA 4I0CC 5BXFA 5MEPA 5GJSL 1CICD 4JRYA 5IROC 5E2VL 3VXSA 4JDTL 3LKOB 5D2NE 3TO4C 2ID5A 5L9DH 4OZGE 3ZE0F 2AS5M 2HN7B 3KWWB 4X5WA 4L4JA 5E56A 3FJTA 3HR5B 2RGSA 1EFXB 2E7CA 1NBYA 5KZCD 4QRSA 5DC9B 4PRDA 5HVFB 1SJVA 1PX4A 1ZTXL 2BVQB 2BX5A 3FFDA 5FYKH 3OKOA 4FFYH 4D9LL 1LILA 4ONGH 1N5YL 1U8KB 3ULVE 1U3HA 4YO0A 5I1JH 4FQ2H 4X8JA 3CK0L 2PCPB 4I18B 2BNRD 2UV3A 5D96B 1S9VB 4NZDA 1K4CA 3LN4A 1X44A 4HKJA 4HIEB 4MX7B 3UJJL 4HK3J 3MUGB 4TVPD 1IM9A 2WAHA 2VN4A 3QO1A 4P3CL 3TA3B 5D7LE 4X80H 3BEWB 5EOCJ 4FTVE 2F74B 3BP6B 1A2YB 2FEDD 4ODBD 5CJOL 4M43H 1M7IB 5CSZB 3KPTA 1UA6L 5A2JH 1BQLL 4U1LA 4JPIA 3VDBA 1IGCL 2VITA 2BC4B 5D2NA 1WBYA 4R3SB 3IU3A 4RRPA 1MPAL 1HE7A 3N06B 1OAZL 4OZGA 2P8LA 5D7LB 1U91A 2EYTA 4PJ7B 1YJDH 3PGFL 1NMAH 5H35B 3ULVL 1KTDA 5LQBH 5FIEA 1FC2D 3TFKC 4P46C 2HRLA 5I8OL 2M1KA 4HLZH 5ILTH 2DDQL 2E9IA 5GZOD 2UVFA 1FVCA 3MJ9H 4PGJA 1JRHH 3Q3GA 5GZNC 5CSZA 5JW4N 3QBTB 1QPPA 3M1BB 3HG1E 4XZUA 3L95B 4NP4L 3PUCA 3GB7B 5DT1H 4LNVA 4HULB 2NY1B 3W0WD 3CC5B 1GGYA 3FO9B 3EO0A 5LWYH 3IJYB 4D2NA 1ZKAA 5DWUL 3VG9B 4FTVA 4QKXB 2Z4QB 4IRZH 5IVXE 3PABA 2JLLA 2PO6B 8FABA 3P2TA 4PY8I 2W0LA 2KPNA 5C0EA 1HQ4B 3GKZA 4GAYB 1WFTA 1YEDA 3DV6B 4UBDC 2ARJB 3RWJB 1X6LA 5DVNA 3DIFB 1NCUA 3QQ3A 1CXLA 5DUBA 1E6JH 5I71C 4L8SC 4X7TA 1BP3B 4OI7A 4KV5F 1RFDH 3EYFB 3MLVL 5E2UH 2RCSH 1U8HA 5E5RB 1MHHA 1T04B 2DQTH 5CP7A 1XF1A 4WV1B 1BIIA 4H8WL 4P49A 4WJ5A 4OLVH 3U0WL 1WC7B 1YEGL 3HG1A 1Q0YH 4S1DC 2A6DA 5A3ID 4UT9L 1DE4A 2ZG3A 4FQIH 1J18A 4Y8DC 4LRNL 3T3MF 3BZ4B 1IL1A 4X9BA 4R4FH 3D5OF 4JG1L 1CDUA 2XFXB 1IEBB 5L2KA 3PWJB 2YBRB 1IGML 4HJJH 3TO2B 3KYOA 3NABH 1EVUA 4Q9BA 1PG7H 3QHFH 5IVXA 3MRIB 4KVNL 3S36H 5EZLB 3KXFA 2C1OB 3BW9B 4KJPD 3AXLA 1CR9L 1ETZA 4TRPH 4MJ6A 5T1LD 3A6CL 1RULH 5DJYA 4HX1A 5B4MC 4X7FC 2D7TH 3QA3A 1XR9B 5INCB 5I15L 1ZXQA 4K94C 4PB9L 5IMKA 4XBEL 3WIIL 2VZ3A 3MJ8A 4H25A 3V4VL 5ENWB 4XPAH 5ID0A 5MHSD 1M6OB 2YKLH 3DRQB 3UZEA 5HHNB 1FN4A 4RQQB 1V8HA 3M07A 1I1YB 2QADB 3OF6A 1BVKB 2CQVA 3QDHA 1O7SA 3SGJA 5DJAA 3HNSL 1X4XA 2FB4H 2AK4D 2RR3A 3KPMA 2M8XA 2E27H 4D8PB 3IT8D 4TULL 2KUTA 1JGDB 2DL9A 1DP0A 4BH7A 3CSPA 1QO3A 4OIAA 3QRGL 1IKFH 3EYQC 4JZJB 4I3GA 4ODSL 3K4ZA 5EA0H 4X0KB 3GUTA 1W0WB 4JO1H 1HCVA 2XRAH 5JIIA 5GS2H 1KGCE 1BFVL 1C12A 2NPLX 4KJYB 4Z78A 3O3DA 2H1PH 3CH8A 1FFNA 3DWTA 3P40A 3QIBB 3E6FA 1XCTA 1I8KB 2FL5B 2P4AB 2I9TB 1Q9OA 3NAAL 1IEHA 3D87B 1F6AA 5BV7C 3RU8H 5DRWB 4U49A 3KYNA 4ZXBD 1NJ9A 1VFBB 4NCC2 1JP5A 5DD0H 2YZ8A 5AZEL 3D0LA 2DQJH 3C08H 4PJCF 2Z91B 3UC0H 4PRIB 4JFED 5JHDD 4FQHB 4O2EA 2YPVH 2OTPA 3QWQB 5DJ8B 4G7YL 1IC7L 1W0VA 1G7MA 1AKJA 1WTLA 1MFNA 5FO7A 1HIMH 1W72L 2W9DL 3BKYL 1ZVSA 3TZVC 2ZCHL 2HG5B 4Y5XC 1KPUB 3L5WA 4Z0BH 4KKLD 5D6CB 4QCIA 2GK0B 1AD9B 3EO9L 4BSWA 4C56D 2ZUUA 1DJSA 3OKKA 4UZGA 1NCWL 1PYWB 1JJUA 3MR9A 1BM3L 1QEWA 1D5XA 1NGYB 3MYJA 1MRDH 3RBSA 5CD5D 5HYSG 3BPCA 5TH2B 2BSED 1CLCA 5D1XC 1P4IL 5C07D 4XPHL 5T33L 3MNWA 2VQUA 1SYVA 5DFWH 2JIXD 4U6VH 3UJIL 4KY1L 5FECA 5IMMB 3RWHA 2DQFB 1ZS8B 5DJCB 5CP3A 1F97A 4LKCB 4TVPL 4U1MA 1JWUA 4UQ2A 4TNVK 3RPIA 2BNRA 4OIBA 1OW0C 4P2RD 4WHDA 4D0BA 5TE6L 3RA7H 3MODL 2ICWB 1JIBA 2NY4D 3LY6A 3EO1B 4JKPL 4LP5A 3QNZB 2HVJB 4J3UA 1R24B 1MCFA 1O5DT 4Q9RH 3NH7H 5I1AB 1KJVB 1PDKA 3LB6C 1BEYH 3P73A 3H3PL 4GRWB 1V5JA 2OLDA 3QUZC 3RI5K 2I5YH 3O3EA 3SDAB 3DV4A 3GO1L 1P1ZA 3MBED 4MYWB 2OP4L 3KPQB 5TE7L 3BVNA 3CVIH 1QLFA 5KJRH 1YMMD 5FUZL 3TJHC 2MOVA 1KCSL 1TZIA 5FUOH 1MFCL 1KEGH 5FUCC 3BQUC 5AWNL 3MRNB 1QA9A 1H3TA 4JDZB 3QCVL 3VXMB 5I76B 1GOGA 2ZP0T 4E0RA 3QXTA 5CEXB 4KKBD 2DOCA 1DTUA 3AM8C 4LNRB 1CN4A 1J87A 4HBCH 3SKNA 1FPTH 1FVDA 1YNKH 3QNYA 1NCAH 1DSFL 1FV1A 3OJVC 5CEZH 5HHPB 5LGHH 5IP4A 2H2SC 4PBWD 3TIDB 4EN3C 1BOGA 4AEHH 3QEHB 5DLMH 2ZKHH 1ZT1B 5E5MB 3LZFH 3DXAB 1NEUA 4IRJD 1VADB 1TJIL 1UH3A 4BUHA 1MJ7L 3JV4A 1WBZA 5I1GL 2FBOJ 1FBIH 1LQSR 1KUMA 5FA3B 2OZ4L 1MHPH 5I1DB 3MQIA 5IBLD 1E4XH 1GGIH 3C09B 1A6AA 3FB5B 4Z0XB 3QUKA 2OZ4A 2V5MA 3CFJB 2X41A 4HJ0C 4UI2A 1OB1A 5D8JL 4H88L 3QYCA 4I1NB 5HY9B 3LN9A 5MHSE 1Z5LB 3BAEH 2ORBH 2K1MA 2B0SL 1FC1A 5JOFB 4OCYL 1I8IA 4NKIH 1HYSC 1T2QL 5SWZD 3LV3A 3DO7A 4OM0H 3MUJA 1DL7H 3IGAA 1OAXH 3CXHJ 1I1AC 2FR4B 4QRPD 4I4WB 4XT1C 3QI9B 4U6HA 1ZGLM 3QDMB 2DI8A 2JELH 3T1FB 1CGSL 1NKOA 1Q9LB 5F8RC 1QNZL 4JPWH 1ZEAH 3UYPA 1L7IL 5DJ0B 4MAYD 1UXWA 3EFDH 1MREL 3CMOL 2R2BA 2FJFA 1A4KA 3WUWA 5T1LA 2G60L 3C6LC 4BZYA 1YPZE 2XXCB 2C4FU 1C5BL 4ZOCA 3H42H 4X6CF 1WF5A 4PREB 4QHLA 3MRRA 3NZHL 4X6DE 5D93C 5EOCL 1MF2H 2EXYD 4PLNC 1T7XA 5A2FA 5HJ3A 5DEZA 1SQ2N 4M7JH 1CGVA 3PGDB 2DMKA 4PTUA 1RV6X 3VI4F 1J8HE 4HS6A 5KVEL 4PJEB 5HPMA 3QEQB 1YPZB 1YEKH 5TGBA 4MWFB 5F7EL 3ZL4L 1N7ML 4QHKJ 4GKZA 4N0RA 4KJWD 4XCYB 3CCHB 2VISB 1I7TB 1T6WA 3IRPX 2I27N 1Q0XL 1UGNA 4Z7VF 3WL9A 1EAPA 2VQ1A 3NIGE 1T1XA 4QHUA 4K71C 5CKGA 1DVFD 2FX9H 4MXWL 4AYFA 2XYCA 2WM0A 3MREA 3AU1A 1TPXB 4PJ9B 4GH7B 5F1IA 3RTQD 5MEQB 1GCFA 4APQC 1EEZB 5EBMA 4LGSB 3THML 3EJYC 3UTQA 4KPHH 1NSNH 5C07E 5E8DH 3AS1A 4H20H 5HI3D 4KHTH 4OLWH 2X1OA 1ZANL 2C4XA 5KANI 1CG9B 4X6DA 3DX8A 2BNQE 5IHUH 4QF1B 3ARDD 3SDCD 5ANMB 4TSBL 4Y16A 4D0CA 3OAZH 3NIFE 2CLZA 4IRSC 3FRPA 3OKMA 1J8HA 3HI1B 4R9HA 3V4PL 3AREC 2DQEH 4OZ4A 2FD6H 1JPSL 4BQ9A 5DURB 3WNMA 3OB0H 3ARFD 1A7RH 4XBPB 2VABB 4U6XA 4YR6A 5JUEL 5D7SH 3NFNB 4YHKL 3SE3C 1S9XA 3GSRB 4FXGA 2L0DA 4J3VA 5IG7B 3U36B 7FABH 4MAUL 4F7TA 2MJWA 5IW1B 1M71B 3WEXA 1F4WH 4N68A 2UWEE 5C0DB 2V7HB 4PJFE 2NLJA 4R97C 2DLIA 4FQXA 1JYXA 2MPAL 3BUYB 4ORZC 3TBSA 1AO7D 1Q9KA 4TTGA 3GJFH 1BBJB 1FQ9C 2WWMD 2AV1B 1CTOA 2D31A 4HPYH 5C07A 5EO1A 4DK3A 1P9MA 1XF3A 2VZOA 1T7WA 2XWBB 2PTUA 4K3DH 2JIXA 4P4KD 2BNQA 2IANE 5EOTA 3IXAB 3RKDC 3NFNA 1U42A 3CH1A 3U36A 4R90L 4GLRI 3I9GH 3O8XB 1QHPA 1A7NL 5J3HC 1M4KA 3CVHB 2APXA 5GRUL 1L0XA 4PJHF 2UZYB 4BFIA 4QRUB 2DYPD 1NDMB 3MRLB 1IC1A 1UWGL 1QPXA 4Z9KB 3BRGC 4ODUA 4XP9H 3VWKB 1NAMH 4HKBB 1FHGA 4WW1A 2CIIB 2NZ9C 1BQHA 4KTEL 5TJWK 3ZYIA 1KXTB 3VGGA 5HGBB 3WFBL 1A6VL 5HHQA 1OSPL 2UWEA 4AM0B 4RBPK 1F3DH 1HZHL 4PJFA 2NY3B 4JANA 1T0NB 2IFFH 3TLRA 5JW3H 5KVFH 1DQMH 1K8IB 4UIKH 3U46A 2NTFA 2OM5A 3HZVA 2J4WL 1XFPA 1X5LA 5IMLB 1MIMH 3MLSL 1F90L 2YD5A 5DC4B 4I77H 2IANA 4WUUE 3SKMA 2V7NA 5SWZE 2Q6WB 1DBMH 5DQJA 4HEME 4I3SL 4Z7NF 5C9JB 4NKMB 3MJ6A 3KHOA 3KPLA 5J1TC 3O2VH 2LTQC 2G75A 3P9MA 5BRZD 4F8TA 5DMKB 2GCYB 4G80A 3QEUA 3FN0H 2QSQA 3DUSB 2XPGB 1ED3B 4OLXL 4CNIA 1KLFA 5DWUH 3QIUC 3N1QC 3QJFA 1P7QA 4OLUH 3GSNL 3JSSA 4KAQL 3KYKL 1WCBA 4ETYA 1T3FA 3ZTNH 5DRXA 5IBUG 1FCGA 4A2LA 4OZIE 2JF1A 5D7JA 2OS7A 3SCMD 1RUKH 5DTFB 1PEWA 2M2DA 4G9FB 1B0RA 3B9EA 5IHBA 2AI0L 1I9JL 1RURL 5IHZA 5IR1B 1P6FA 1NCBH 3MLYH 3GK8L 2KL6A 4ZODA 4WUUA 5B21A 5SWZA 1AXTL 3PNWA 4G6JH 3NACH 3SJVD 4NNXA 4J1UA 5JW4R 2IPUK 2ZG1A 4NFBA 3KPRE 4NWTL 4UOW0 3V2AR 4LRNH 5IQ7H 1A14L 4DKEL 5CBAB 4PP1D 1R3KA 1IGMH 3CDCA 3S37L 4R8WL 1OL0A 5C6TL 6CGTA 5JZ7D 4MAYA 3Q6FA 3GM8A 35C8H 4XB8A 5DD3L 1RUQL 3TYGH 1WV7T 4PYHA 5LKNA 1EA9C 2ARWA 4DAGL 3D0VA 4ZS6C 4OZIA 1LE9A 4RFNC 2GT9B 4XC3L 1NLBH 1U8JB 3QDGD 4HXBH 3MLWH 3BKJL 1IT9H 4JN2B 4ZS7H 5I15H 1ACYH 3WIIH 2CH8A 3D2UA 2YSSB 5AD0A 4PGEB 4WU7B 1FIGL 2BZDA 2QR0B 2VL5B 5CSBA 1V3LA 5GGSB 4A6YL 4JHWH 4YIQA 1IKNC 3MV8B 5D2LB 1YNTA 3T1WA 4ELME 2JB6B 2MCPL 1KFAL 3UTPD 4PIRF 3PQYD 5FKPB 4OZHB 3WDHA 5F7MC 4A6YA 2BCKA 1J1PH 3MLRH 2XZCL 3KPRA 4ODXB 4GS7B 1KB5H 5IFAH 4LSTL 5GSVB 4GXVH 1Z9OA 3VFTB 4DKFL 3LEXB 3MCLH 1DLHB 2IALB 5JOPD 4NQVA 4YHIA 4YDVA 3BP4B 4ZUTA 3A67L 3MLZH 2EDQA 4UINL 1OM3H 4N90D 1G6VK 2Q87A 1KLGA 3NFSH 4P4RA 1PD6A 2LV4A 4OF6A 2Z93B 4RRPG 4P59L 3G6JF 4JO4H 2X4NA 4GRLA 5EO9B 1MJJA 3FRUA 1I4FB 2VLKB 5A16A 4G6FB 4DGYH 3L3KA 1A1NB 1TJHH 4PJBE 1NGWA 2GJZA 4L3AA 3SDCA 5K59F 1QBLL 3W9EB 3GI8H 2ZOLA 3BH8B 1IZKA 4ZUVB 2ZJSH 4G3YH 4NRZB 2GSIB 4TVSa 4ELMA 4KZDL 3H0TB 1N8ZA 5JNYA 4OLYH 4ISVB 4QXGH 4JCLA 1UZ6E 3STBA 4G7YH 3DRTA 1TVBA 1FDLL 1J5OH 2W9EL 2IH3A 3NIDE 3BGAA 2E7HA 4NN5B 4KMQA 2CSPA 4DZBA 5DJDB 5GHWL 43C9B 2DQDH 1BAFH 9CGTA 1XR8B 2WIIB 2GTZB 2VDOH 4YEFA 1DLFL 1NCWH 3P0GB 5FM5O 1WJ3A 5C8JA 4YFDB 4NO0B 1BM3H 5CZVH 3GNML 2OL3B 4HK3N 5FDYA 3ZKNC 4BK5A 2AEPL 1AO7A 4ZO9A 5GGTL 1FZMB 1F4AA 1RZKH 2OK0L 5FOBB 4GJTB 4PJBA 4KROC 1PQZB 5J06A 1GIGL 1R3HA 1VACB 3VXPB 4K7PY 3LRGA 1I1RA 4TVPH 5HGGS 1K3IA 2MFNA 2VR4A 5EU6D 3ULUC 3QXDB 1TNNA 5EU4B 3CDYA 3HAEH 3W2DL 4XPGL 2DF3A 5C0ND 4AK1A 3PP4H 3OKLB 3OHXA 4LL9A 4NO3B 5IEKA 3C60B 3IAQA 4LPXA 4ZSOB 3HA0A 5I66A 3X3GL 3PL6C 3L5XL 4YXHH 1A5FL 4QRRB 3TVMD 1OT1A 4WFHD 4LSUL 1FNAA 1D6VL 3TBVA 1V3KA 3VRLF 2FBJL 5CEYB 1L6ZA 4IOIB 2D4FA 3R0NA 3ULUF 1P4LB 5MI0C 3WHE1 2XZQH 2Y36L 1CD9B 4PRPE 3STLB 3IDJB 3HUJF 3DHJA 2ED7A 3DO3A 2WK2A 4J23A 4PJGF 2ERJB 1A0QL 3C60A 5M95B 3UJTH 5CUSH 1XGYL 2A1WH 3IFPB 4AG4L 4WDIA 1IFHL 3BZFA 3IF1B 5JA8B 5BRZA 2A6IA 3Q1SL 3BE1H 4LGPB 4YBQC 1BWWA 4I48A 1TQBC 5J0BA 2OCFD 2VDML 3SGKC 2BOBA 4TUJA 3R06A 4HS3B 1K2DA 2Z8VC 4U1KB 3OR6A 5FV1L 2BVEA 5D9SA 1XF4A 4HIIA 4HK0A 1YY8A 5H2BB 3BXNA 5IB1B 1XGRA 4CVWA 4M1DL 3OPZL 4NT6B 1J8KA 2V9TA 3VE0A 4F7PB 3PXHA 3IJHA 2BP3A 3L3OA 4P23A 4CN4A 1T03H 3LCYA 3LPWA 3AAZA 4F3FA 5CKAA 3S8WA 3SCMA 3QDGE 1IAIH 4XP6L 1JPTH 1W8OA 1ZHLB 3ARBD 4MCZB 4WIQA 4YFLI 4NQDD 3GM0A 3VCLA 1L6XA 5F97E 3LKSB 5I30L 2X9XA 4HUWA 3HI6L 4PRPA 4XAKD 1T7YA 1CLYL 3T2NH 3WIFB 3HFML 2IWGA 1RZGA 1TQCC 5C0IB 3T0EE 1OOAA 3PQYE 4CBPA 4OQTH 1Y18B 3SJVA 1G7LB 2CUHA 3QDJD 4LPYA 3VH8B 1KIQB 3B2UD 3MACL 4NT6A 1E4WL 4ZUUA 5DJ2B 4MJ2A 5L88L 2J5LC 3PJSB 1GGBH 4OT1H 1BFSA 4LHUA 4I0PC 5D7IF 3VU2A 4PG2A 5JOPE 4LVHC 1CGSH 1CS6A 5FO8A 1MHEA 1MCSA 1Q1JH 2XWJA 2FJHB 1TZGL 3U79A 4NKDB 1EUUA 5C7XH 5CD3A 1CD1B 3D48R 43CAA 1AHWC 4XXDB 3IDMA 2CGRL 1U8MB 1BQSA 1UWEH 3HN3A 3KLAB 2W07A 2X4QA 2J8OA 4MNGB 1I7UA 2HKFL 5T3XH 3V8OA 3QDGA 3ESUF 4M1CD 4LQFL 5CMAB 3I6KB 4ENEC 5HDQL 1AGBA 2FLRT 5ESAB 2XWTB 1J12A 4ZUWB 2YD2A 4D9QD 1KTKE 1K8DB 3PJSA 4TQEH 4HKXA 5C0JA 3TYFB 4B53A 4LASH 5E94A 4XVSH 1D5IL 3MMEA 4N9GA 3T0EA 5F7WC 2J7LA 4MJ4A 1WAAE 3PQYA 4QYOA 5TDNA 1CGWA 2V5TA 1CL7L 5DJXB 3RWIB 1ZSDA 3WYRA 2APVA 2FHFA 4C57C 1J1OL 1H5BA 5MERA 3BGMA 1BF2A 3PIQB 4GRMB 4NHUB 4RMSA 3GJFB 2Z92B 4KK5D 4FABH 1BVZA 1C5CH 2X70A 4GOSA 2OTWB 4HZLB 3ET9F 5GGVL 1MCOL 4H26A 5T1KD 4HKZB 2AQ2A 4EI5C 5IGXH 2GUOB 3O4OB 3DYMA 2G5BB 4HUXB 4JJ5A 5FKAA 2EIZA 1GZPA 3PWPD 4R26L 3V0WL 4BM7A 3G6AB 3V7AE 5BO1L 4BA8A 1H15B 5IESH 3V6FA 1KCRH 5HHOD 3O6ML 4OFDA 1DQJA 3GMLB 4MCYB 5E08H 3C87A 5TE4L 4OQ1A 1S7QA 4JVUA 5KS9E 2PUQT 2OMBA 1F02I 3HNVL 3JWNC 1KENL 5F7FA 4LPCA 4K8RH 4HT1L 4GRMA 5EN2A 4YPJA 4WWKA 4GBXB 3U4BL 1FFPB 3PWLA 3VFOB 1WAAA 1YEEH 3ILQD 1MQKH 4XNQA 1WWBX 3SDDC 1ZHKB 1CBVL 1LO4L 3MROA 1A7QH 2BFVL 4YQXL 1PZ5A 2XQYK 5GS1B 5F21B 4Y2DB 4LCCA 4Y4KB 5L8LB 2EC8A 2O5YL 5DO2D 2DQUH 4R2GD 3F12A 4WW2B 5MENE 3OXSB 1HSBA 3UDWC 2NY6B 2ARJQ 3WNKA 4NJ9L 5EFIB 1EMTL 1T20A 5ICXB 4ODVH 2YWYA 2CKBL 3MFFB 1QSFD 1NAMA 4YE4L 3KPNA 5KSBB 4CMMB 3RIFF 3BEVA 3SE8H 1E28A 3H9HB 4ORGB 4Q6IA 1Q8MA 2YRZA 5F3HA 5KS9A 1KN2L 1VENA 4O2CB 3QFJD 2IQAB 2ZUTA 1RJLB 3DARA 5HYQA 4NQED 4P2OB 2RBLA 1YMHA 5E2TH 4ZAKC 2H3NA 3KPSB 4K94H 2A83B 2HT3D 3TBYB 1G7JB 3KLSA 3WHXB 2Q3AA 4Y4HC 4J4PD 4OIIH 3KJ6H 3EOTL 3MRKA 4LIQH 3SQOH 1S7XB 4JKWA 1PLGL 4KRPD 2EIEA 5EBLB 1NFDF 2F19H 2EE9A 1K5NA 3SOBL 2ILLA 4M5ZH 1KTRL 1BZ9A 4L8CA 4RGNC 4BQBA 2YOCA 4M8VA 4Q7DA 3GSQB 4GMTH 5MENA 3TVMA 1ORSA 1T80A 4QGTA 1RJLA 1A6VH 1NGPL 1X7QB 4M62L 3T2PA 2D4DA 4MDJB 4DKDC 4JB9H 3WUWG 4JLRA 1FSKC 1I8MB 5BS0B 3QUXC 4OKVB 5C0AD 5LBSL 3QIWD 5ITFB 2MQ3A 1QG3A 3QAZC 4DOHB 2VKXA 1P4BH 4BFEA 2HJKA 4XAKE 3L6FB 3QUYC 5MEOA 3GMQB 1FNEB 4MA3A 5EWIL 3MLSH 4YBLB 5AZ2H 3DVNB 5C70A 1OGAD 1JZ3A 1NMBH 1A7PL 1C1EH 4YHOL 1D5BB 4DCQA 2HWZL 4XWGH 4XNYL 3TO4D 4Z6AT 4L3CB 4LSQH 3EGSB 3A6BH 4OD1H 4Y19E 4IMLB 1TVHA 3H9SD 3K4DA 5DUML 5CJQL 2Z35A 4JPVH 3C5ZD 4S2SB 2ICEB 2P5WD 4OLXH 3RVVD 3V52H 1WCQA 3TN0A 4EBQL 4D3CL 2QHRH 1VKXA 1X5YA 3GIVA 4JM2B 3SE9H 3B2VH 3LEVL 3GSNH 1FO0L 1ZMYA 2JCCE 1S3KH 4CL7A 3VFMA 1J9CT 3IJSA 1EX0A 3DVNA 5IB2B 1I3RA 2BK8A 3NFPB 3Q48A 1SEQH 4V1DB 5IW6A 1ORQB 5F96L 1FO0A 5DJZB 4WUKH 3BN3B 4QOKD 4R0LC 4KTDH 1MVUB 1EO8L 2ZUWA 4NQDA 2NW3B 3LN5A 4D9QE 3KYMA 1BF8A 3KDMA 1U8IA 3V6OE 4X4YB 2ZOKA 4L5FL 1I8LA 1B90A 4BZ2H 4JM2A 3FRPG 5JPNA 1U8LB 1IARB 4G8IA 3FFCD 1ERNA 4Y19A 3T3PF 1EXUA 2YA2A 4LRIC 4YEEA 1EVTC 4XTRC 1CLZH 1OGTA 1PAMA 3U7WH 1KBGL 4P5MB 1A14H 3TFKD 1XAUA 4P46D 4AMKH 2FSEA 5ISZB 4QRTB 1XIWA 4N1CA 2HH0L 1M7DB 4K9EL 4HF5L 3QISA 5CGYD 5IEHA 1CDIA 4JHZA 5GZND 1MFBH 1KB5A 2JCCA 4U1JA 4F57L 2OSLA 5D96C 2H8PA 4I18C 5DI8B 5HHOE 3FQUA 5EU3B 5TPWH 5HI4C 1JPFB 1UYWL 2VMFA 1ES0A 4W68A 5ALBL 3TWCH 1MHCA 2B1AL 4PG9A 3BRDA 1LO5B 1QP1A 2R1XA 3B3IA 2A9ML 3TA3C 2ZUYA 1T22B 1UZ8B 3H9YA 4UQ3B 1GC1C 2EH7L 3L3IA 4MMXC 4Z7WA 1CICB 3V4UH 4OD3L 3FL7A 3CX5J 3OXRA 4NDMA 2FJGB 3V6OA 2I9LB 4O2FB 3UTSE 1ND0B 5D5MA 4R4ND 4UV4L 1KC5H 5GS0D 3WLBB 4UBDD 1MOEA 1ZLUK 2CIKB 2ADIA 2VDPL 5KZCB 2EO9A 3BKCL 1OARL 3RY4A 5T5FL 3WS6A 1K6QL 4JN1L 5I8KL 1CXHA 3LD8B 2PXYB 2O61B 2C1PA 3TBWA 4FQQB 2C7UB 4IOFD 5T1KA 5B8CB 4GFTB 2Y7QB 4KTYA 4RBPH 4U1HA 1CE1H 3QEGL 1KJ2L 1BQHG 4K3EL 2MQCA 3DNKA 3OKYA 4LCIL 4X4XB 3C5JB 2X6MA 4OV6F 3GGWB 3VG0H 5HHOA 4S1DD 1CFQA 1KJ2A 2P47B 1OQOA 2NY1C 3ROOA 1E4XI 1HXYA 2C3VB 2YRPA 3EOBB 3QWOB 4HW6A 3W82A 4RISH 1HILA 4WHYG 5HPOA 5IKCA 1GRWA 4HV8A 4G42A 4QHKI 4PJ7F 2BMKA 4NQEE 1JE6A 1KIUA 3CFCL 5T5NG 3VI3F 4ZO7A 3SKJH 2BY3A 4KRMB 2PO6C 3UTSA 5DJ6A 1DFBL 5CIPH 3QZWB 1WSST 3LEYH 1A1OA 5T1MA 4I2XB 1OP5K 4Z7UE 2CRZA 4G8GB 4LLWA 1F6FB 3G5YA 4XP5H 3GJEB 3HAEA 5I17A 2R0ZH 3ZE0E 2D0HA 3Q0HA 3CFDB 1HHJA 2W0FA 2YMXL 1IAOA 1OD9A 4ZQKA 2QTEA 2QQKH 4WV1C 3V79C 2I24N 5SWSD 5IV2B 2W65A 5DEFB 1MRCL 2R1WB 4UT7L 3W0WB 6FABL 1RZ8B 3QFDB 4Z7UB 4EQ2A 3EYVA 3JTSB 4OZFA 2VIRA 2IG2H 5GGTH 5F6IB 1JV5A 3CDGB 4PJAE 5J1AB 3QFJA 3DGGB 1RZIB 1X5HA 5EBWB 4NQEA 3SGJC 2AJUH 3DI2B 2ITDA 1ZT7A 5IVXF 4ZFFB 5ADOL 2NY7L 5H94A 4XH2B 5FCUL 4FXKA 3WS3A 4TN9A 3F5WA 3H9SE 4M48H 1N64H 4PRNB 1G7QA 4WI3A 1VFUA 4PJAB 1VA9A 2ZPKH 3O0RL 2YEZB 3BIKB 4HUKB 5CJXA 1NC4B 2CRYA 4RDQG 3GSWA 1RZFL 4XCEA 4XBGA 1UQSB 4L9LB 1KPVB 3BSZL 1VB9A 5EUOE 1LO0L 3DMMA 2QADC 3RAJL 2P42B 5IWLA 1A6ZB 4X99A 2DQIH 1W2KT 1SJXA 4M5YL 2AXFB 1DUYA 1KXQE 4I3RL 4G8EB 4QOKE 4YDLB 2R29H 3PG2A 1JZ8A 3N9GL 3QIWA 1FAIH 1NGQL 4JZJC 1HKLL 1S5HB 3GSOB 4HWBL 1AR1D 4FZ8L 5EUOB 3C6SB 3VD7A 3BZDA 4LLUA 3TZVD 1AQDB 3VXTA 4ETQA 3SKOA 4XMPL 5IROA 1MNUL 4ZFOB 4HWBA 3CDFA 3QIBC 1XGYH 1Z9LA 3TO4A 4QXTB 4AG4H 5I19L 1IFHH 4BSJA 5C0CB 1I9IH 1JNHA 1CL7I 1UT9A 1N59B 3H9SA 3MA9L 4JY5L 4PJXE 1GZQB 2O5ZH 4H1LH 5D1XD 5E99L 5K9KA 1PG7W 5LAXA 1K4DA 1EHAA 1QFWM 2RQ8A 4GW4A 3NMEA 4JKKA 1YDPB 1CU4H 3O11B 2QQNL 1FP5A 3V5DA 4M4PA 5HI5C 1MI5D 2X4TB 1EK3A 2AK4B 4PV9B 4EIGB 3HZMB 4DVBA 3BKML 2UZXB 3GMPB 2R8SL 4Y1AD 1ZHNB 1SJEA 3VFRB 1LD9B 4KV5E 2V2XB 3OAUH 4QOKA 3ME0A 4HWUA 3G6DH 4EVNA 4LPUA 5B3NA 3P4MB 1F3JB 5F1NA 1GZQA 3LB6D 4KKCC 5BW7A 1OVZA 3IYLW 3QUZD 3SO5A 4RMWA 5ESVA 3ARPA 4IEFB 4U1NA 4MNQD 1ZGLB 1GXEA 2FNBA 4DGVL 3T3ME 1R5IB 1CVSC 1UKTA 5IFHH 1H8SA 1HINH 5I75B 3VGBA 4PJXA 3WFZA 4GKOA 4ZXBB 2KDGA 4P5TD 4OV5A 1MFEH 2VDRL 4F9PC 3BQUD 2ADFH 3M17A 5HVWA 2WANA 4WNQB 2UVEA 4XGZB 4P46A 4S1SL 3DROA 2AEQL 4H0GA 2HKHL 3LQZA 4JFEB 3CUPB 3O3AB 4LCYB 3RPKA 4LLMB 3I50H 3O6LL 1TZGH 2JJSC 4RMTA 2D0GA 4LU5L 4TPRL 2H2SD 4EN3D 2R1YB 1F11A 2W0PA 3MGOB 4QWWC 4KQ4H 3E6HB 3BP5B 1LE5A 2AJXH 3FB8B 4Q2ZB 3LAFA 4P5KB 2BVOB 1XH3A 1AP2A 1OTTC 2BSRA 3O6KH 2G5RA 1T0PB 2G9HB 3O3UN 4PR5A 4C56B 3R4DA 4M6ML 4M8QB 3SDAC 1MEXL 3WLWC 4F15B 5DHYA 5C0RH 1PVHA 3IDIB 3MRPB 4YHMH 3ZKXB 4OGYH 3RUGB 1OCWL 2IPUG 5HHMB 3ARGB 5T3ZH 3I75A 4HJ0D 1JYVA 2IMNA 2HFEB 5I8EB 4N5ED 1IC4L 5KSUA 4YDJA 2PTVA 1KACB 4Q2ZA 1WIUA 4L8SA 4WO4B 3FAXA 4LIQE 3RL1A 5GRZA 1QSEE 4GRWF 4X6FB 1HYSD 2C3GA 4P2RB 1Y0LA 1F4XL 5E00B 4JO3H 2F58H 2NY4B 2YUVA 3CZFA 5E8NB 1LDSA 3ZLQC 4M7KL 3HKFA 2V2WB 3FO0H 4PJCE 3U0TB 4OM1H 5FO9A 3FQNB 2DQCL 3HE6B 3RJQB 4Z95H 4JFXA 5K9OB 4JFQB 3MBEB 4QXWA 4YHNA 2J2ZA 3U7YL 5F70A 5FK9A 1A9EA 4FG6C 2WINB 4TYUA 1YMMB 3BP7A 1A6UH 1U8PB 5F8QC 3C09C 3C6LD 2YHGA 2W91A 4JFFD 1VERA 4JRXE 3LOWA 1MY5A 2IC2A 5I1IH 2VLRD 3OKNA 5ITBH 5JPMA 1GPOH 3UROR 1RK1B 4QY8A 1ZWIA 3L1OH 1J0KA 2A74B 3CFBB 1RUAH 1QSEA 1TDQA 1OF2B 3W5MA 1XF5B 1LMKA 4P57A 2XA3A 4XVJL 3WJJC 3FQTA 4YE4H 3RVXD 4CUCA 4IRJB 4FN0A 3CLFL 1S7VA 3FMGH 2GFBB 3QI9C 1JGVL 3REVA 4ODWA 4PJCA 1FNSH 3GMNB 5FA4B 4FZEL 2EDFA 3KPOB 4FNLH 2LU4A 5AUMB 1AH1A 2XXMB 4M1GH 4YDKH 3GSNB 5BV7L 4BKLA 7CGTA 1YYML 4N0UB 4X6BB 5CSGA 4APQD 3LQAH 2R0LL 4JCMA 1R5WB 5D72L 5GGQL 3IDGA 5IK3A 1JL8A 1UJ3B 3IVKB 3CSGA 4JRXA 2F54E 3MO1A 3HNTL 2F5AL 3HC0A 4J6RH 1AGFA 4LARL 4X8XA 3D85A 4E41E 5C2BL 1R5VA 1DR9A 3C2AL 1B0GA 2DRUA 3MV7D 4Y0GA 3D39E 2D7OA 3RQ3A 1MI5E 1RPQA 1XCQB 2H9GA 4MJIB 4FP8H 2D7NA 5E8OB 5JW5A 2XZZA 1S9YB 4QRPB 2VAAA 1KIRB 5EUKB 1IRAY 5SV4A 1YN7A 2EYSA 1P5UA 5JQ6H 3WFHB 5DRZA 1SM3L 4X98A 5B22A 3TNMB 4NHCL 2YUZA 1INEH 2HJLB 4PJDB 4L4VD 4MQ7A 3TIEB 3B6SA 1A8JH 5LCVH 2EEAA 2J8UE 3JWDL 1INQA 4WTZG 1FNGA 3UYRH 2QQLH 3TZVA 5BJTB 4Y5XA 4JQIL 4KRNA 1A7PH 4LVEA 3V5KB 4MNQE 5I1EL 5D1QB 4DTGH 2CJUL 2IH1A 1RMFL 1TPXC 2YUWA 4PJ9C 1D9KB 1I7RB 5EC1B 1RIHL 4PJEF 3IAPA 1YPZF 4WFED 1JNNL 2H2PD 5FUCE 4GAFB 4IDJL 4FQCL 5D1XA 3T8XB 2F54A 3FT2B 4M7ZB 1INDH 5SX5K 4E41A 3RKDD 1AQKL 1JF6A 2AW2A 3WUZA 3D39A 1HOCA 1REIA 2VLJD 1MI5A 1TCRA 1SMOA 1RU9H 4UT6H 2PYFA 1JVKA 4U1SA 4HMCA 1OW0A 3H7LA 5J9PA 5F96H 1UM4H 4RGOH 5FDWB 4MXQD 4OUUA 5L2JA 5E70A 4ZDHB 1YJDC 4GSDL 4FFZL 1DVFB 3QUMH 2J8UA 3BO8B 3QUZA 4PUBH 2EH8H 3NIGF 5E2WL 2ED8A 3RTQB 4MNQA 1X6NA 3X11A 3REWA 1C7TA 5AYQA 2X1XR 1E4JA 1YECH 2HT2D 4KK6C 5TQ2H 5HYEA 3ARDB 3R1GH 4X7CC 3T2OA 2ESVB 2LU7A 1FL5B 3V0VA 4N8VA 2H45A 3AM8A 1CZ8L 3O41B 3MRQA 3O8XC 4NRXB 4X6CE 5C08B 4EN3A 3V7AG 3ARFB 5FGCB 3TPUA 4AH2B 4ERSL 1B0WA 2R0KL 2EYRB 5KSVB 4GW5A 5EG6C 4KXZI 4O02H 2IEPA 5KVDL 3VI4E 3ES6A 5IF0A 2FYYB 3QIUD 3R8BB 5ACZA 2MHAB 4OTXL 2A9NH 3VWKC 3MGTA 3Q6GH 5HYJE 4WU5B 1CDGA 5GJTL 5BVPH 2J6EH 4LK4A 2OTUB 4N0CC 1A3LL 2FO4B 4PGDB 5FHBL 5E8PA 5ICYB 2NY3C 2CDEB 4JFFE 3W9DB 1P7HL 3S6CA 1MCNA 5DSCA 4GAGL 1MSPA 3KAAA 4IIQB 4P2QB 5FAAA 3UPAA 1HHHA 2R56H 3GMMB 4OCXL 3VXRD 4NSKA 5CIPA 4JDVB 1NDGA 4HWZB 4R4BB 2X89D 3DSFH 4U3XA 4Y5VB 3SDXE 1M7XA 4K3EH 3LHPH 2VXUH 2NY5H 5DHXB 2WUBH 4C58B 4EUPA 1MLBA 2A2QT 4LKXB 4X6CA 3MA7B 3UBXA 3EYUH 2OR7A 1OAUL 2DYPB 3WV0A 1EHXA 1I1AA 3BPLB 5CHNB 4JKLA 2HRPL 2P8MB 4Z8FH 1U58B 4QTIL 5M94B 1JF1B 1DBJH 3EYOB 4HQQH 3ULSB 1NL0H 1ZT4B 2XNAA 3HCVA 1JNLL 3KLDA 1AGCA 1OPGL 4ZUSA 5CZKA 2XTJB 2E8YA 1IEAA 5KG9A 1KIPB 3WXVH 1YQVH 3QT2A 1UVQA 3WDJA 5BQ7B 2OQJB 4JZOB 1OLLA 3BPOB 5HYJA 4TSCL 2MSPA 4JDVA 3AUVA 3WD5L 3V7MA 4XXCC 1RZJH 3MNVA 5JHLH 4XX1G 1YUHA 5CZXC 4LSRH 1A9BA 4JFFA 1X9QA 4PJ5E 1IQDB 2AJVH 3BZEB 2X2YA 3FOLB 1FORL 1B4JH 4JGUA 32C2A 2VLRA 1T7VA 4FFVD 3ZE1F 5KSAA 1UWXK 2R23B 5GXBB 5IOPB 3QJHA 4U1IB 3SDXA 5C09D 4NPYB 5C0FB 2I60H 5I16B 4OCRL 3EYSL 3T65B 2JK5B 2Y06L 2ZCLL 3GDBA 4K7PL 4HGMA 5FHAL 1I7ZB 4UILH 2Y5TB 4H1LB 2BY0A 1FIEA 1HWHB 4F2MA 3O4LD 3W81A 3OX8B 3C9NB 2YD8A 1JFQH 3MBXL 3PV7A 4PJHE 2CK0L 5FGBC 5JXEC 4FQLH 2ATPA 1N4XL 2XN9D 4J2XA 5IB4B 1WZKA 4APQA 1EZVX 3GSUB 3E1F1 1SBBA 5J12C 4JZNB 3RWDA 4PJ5A 4N8PA 4IJ3B 2ADGB 4M6OL 4NM8H 2AABH 1XGTB 4WI9A 3FZUD 4TUOB 3MNZA 4WTWA 1MLCB 2OYPA 4JY6A 3U6RB 1RZFH 3MV7A 1DBBH 1TZHB 4BK4A 5EU7E 4IRSA 1KJ3L 2YPLB 4HFUH 2VO5A 4GKSB 1I9EA 1AY1L 3AREA 1WUNT 2AJ3B 4AEIH 3FT4A 3HRZB 1NUNB 4X5LA 4YUEH 4GS7C 4X5XA 5D71H 2FH8A 3DVFA 4EEEA 3SE3A 4L4VA 1HKLH 4PY7B 4QHMB 5DK3A 1DBKL 1ADQL 2RIKA 1RZ7H 4ZPVB 2B4CH 1XGUB 4RGMB 4PJHA 4KC3B 1LNUB 1ADQA 2C3HA 1SJHA 4EQ3A 3S3SA 2VB5A 5F9JA 1VEOA 3UTZB 3ZKND 2YN5A 5D2LF 3PE9A 3U9PL 5KTEH 4OZHF 1V7NL 5CJBA 4F7EA 1AI1L 1TIUA 3U30B 4MJ5B 4HFWB 2K9UA 3O81A 1FL3B 4IHOB 1ZLVK 4KROD 1HXMB 2ZCKH 5FYJD 4GXUM 4YAQA 1AC0A 5D7KD 3VFPB 4FRWA 5DGRA 4EXKA 2ZZUT 4HC1H 1BIHA 3ULUD 5DGQA 1EGJH 3F7YA 1E6OL 1E27B 4UB0H 4HWEH 5J6GA 4R96A 2APWA 4KI5C 1NLDH 1U0QA 4JO2H 4KH2A 3UO1L 5TQ0H 4DQOL 1QVOB 1KEMH 2BOCA 4JFDD 4NN5C 3F58H 1KN4L 2J12B 3I84A 2QKIA 1KPRB 5IVNA 1ZK9A 3VFGL 4PRBA 1ZLWK 4JM4H 4OSUL 1RJZA 2VSCA 4PRHD 2HFFA 4UIMA 1QHOA 5EIIA 5HGAA 4CGTA 4DEPC 3FB6A 3UMTA 3SGEI 4UUJB 4RIRA 2IBZX 4AEEA 4KI5F 3MLUL 3BDYH 5EU5B 4KHXL 3HAEG 3MUHL 3QG6B 1CLOL 3GBMH 1QFWH 2H32A 1LEIB 4ONFH 4WHCA 4ODHL 3BWAA 3QCTH 1AGEB 1ZAGA 3ZTJH 3FHQA 5LGJB 4QTHA 1DEEB 5DR5L 5INDA 4ZD3H 2FIKA 1IM3B 4OZFG 4YBQD 1HHKA 1UB5B 3O6FB 4M7LH 3LDBB 5IW3A 3WE6A 2XQBL 4V2BA 2BVPA 4JY4B 5E9DB 2AJSH 3C60C 1A6TA 2D9CA 2DIBA 3QIUA 5GS0H 2WLYA 2ITCB 1JUFB 4M6MH 4O58L 3D69A 5GRJL 1MRFL 5J13B 1JWMB 2VAJA 1DN0A 4WI5A 1A1MB 3L7EB 5GSRB 5B39A 1EJ6A 2UUDH 4MVBC 2FX8L 2PR4L 2CKBB 3S34L 4NQSA 3PHOA 4WI6A 3RWCB 3G5XB 5LGJA 3DBXA 3IKCA 5IM7B 4HUMB 1H3PH 3KNBB 3MRMA 5DUPH 3QQ4B 3HMWH 3MLTB 1N6QH 3RBGA 4Q9QH 5E1AB 1DDHA 2ERJC 5EU6B 3G6JE 4YXLH 3HHRB 3QULB 3T04D 1KT2A 2IGFL 3CIQA 1F4XH 1X5KA 3VXOB 3AGVA 5GGRB 1FJ1A 1T1ZB 3PDDA 4NOBA 3S37X 3MRBA 4FS0A 5C71A 5CJ8A 4U1GB 2YC1A 2UYLB 3B9DA 3QHTC 3S3PA 3IB4A 5DRNB 3O4LE 2AQ3A 1P69B 1FE8L 5L6YL 1E0OB 4BYHA 3T4YA 1DQDL 1EAJA 4B7IA 4F9LC 1ACZA 4HUVA 5HGHB 2AERT 2XOTA 1L7TL 2LAAA 4HIJB 3QRFM 4LMQE 2X4PB 5JR1L 3IDNB 2FZ3A 5C0BE 3S5LA 4JR9H 3UTTE 5SX4I 2D7MA 4ENED 4LLDA 3BIBX 3C8HA 2MNUA 4PGCB 1OD7A 3ZDZE 2W60B 3VRIB 4OGAC 4JQXC 2E6QA 4NJAL 1CDHA 2XG4A 1I3GL 1PKQB 4LDLB 3SE4C 3TCLA 1LK2B 2WUCL 4O9HL 4LSVH 1IKNA 3G6JA 2FX7L 5C0BB 1HEZB 1C16B 5EZOL 4LCWE 1PBYA 1T1WB 5ACMA 2CDGB 4QT5A 1FL6B 3S88L 3DUUB 3G5VB 5D1ZB 4L8BB 2BSTA 4LSPH 1QFUH 3EFFB 5FYLD 2PF6A 2P8PB 2X9YA 1OSZA 3J7HA 3O4LA 5E5UB 4EDWL 5DD5L 4EI5D 4PGCA 1EJOH 1QKZH 4KVCL 2A6KA 5C9KA 1H3GA 3IDXH 1LK2A 1EV2E 3LRSA 5BMFL 4NO2A 2F5BH 3ARBB 5F7DB 2PYED 3N1MC 1G7PB 3UTTA 1DQQB 2X4UA 4NBZB 1MJ8H 3C5SB 1G6RH 5CBEB 5IB3B 2NW2B 1HQRB 3ZYJA 2V2TB 1II4E 3VRLE 1SYSB 1OAYL 3QUMB 3QDJB 4XC1H 5J7CC 2OXHA 3ULUE 1FZOB 5FYJU 2CD0A 4LCWA 3V0AC 2Q86A 2GY5A 1ODAA 3FOMB 3SDDD 1HSAA 2NNAB 3D3VE 3HUJE 1S78C 1UACL 4PJGE 2X10A 2NXYB 1QLEL 2VLLB 4JFDE 3STZA 1JGLH 2FCBA 1I85C 3JWDH 1E4KC 2P44B 3O4OC 1U8QB 1V7ML 2R9HC 4Z77B 2Y9RT 2IBBA 3NN8A 1RJCA 3D3VB 1FLRH 2GAZA 2ZSWA 2ZUQB 3S96B 3TGXA 1WFNA 4PRHE 1QSVA 3G04B 1FZKB 3MRFB 5FYJL 4QHNA 4XHJC 2H26A 3BHBA 4N1EA 3ROLB 3VXUD 4AENB 1G7HB 3P9LA 5JW4M 3DVGB 3ULUL 1RUML 3ZHLA 5KBNC 1YY9C 4FMKA 2BDNL 3OJDA 5H37H 3K8KA 3GMRB 4GBXC 4LEXL 2C26A 4CVXA 1YC8A 2YD6A 2Z31D 4Y4HD 5IQ9A 1WAAF 4Q6IC 1RIVL 4O4YL 4XVUC 3WSQL 3I6GA 4JPKL 3V95A 3HUJA 1YNLL 1NBVH 3BN9C 2GI7A 5BZWA 3RWEA 5GS1C 1QYGH 3X12B 4Y2DC 4WEBL 4PJGA 4HCRH 1R3IL 2EZ0C 4JFDA 1F58H 3DSNA 3PL6A 3PWPB 4RGND 4JG0H 1KXVC 5I18H 4WW2C 2HFGH 1AXSB 2NY6C 5GGSY 1HWGB 1VESA 3CU7A 3BGFB 3X14A 4G6ML 3GEWB 1T2JA 5I1KH 5D7IE 2R4SH 1GHFL 5DD1L 3RP1A 2WMPA 4PRHA 3QUXD 4ZTPH 1I1FB 2J6EA 4OJFH 1QLRB 2PETA 3GI9H 3QUYD 3KVQA 3LIZL 5I8CA 1MJUL 4Y89A 4P2OC 1M05B 2IPTL 3MRHA 1FRGH 4WY7L 1T21B 1BLNB 3RIFK 1EUTA 4TOYL 1WZMA 3O45B 4U0QB 2UZIH 4WW2F 4YWGH 3OSKA 5E0QA 2EDWA 4MD4B 1UM6L 3RWGA 2Q7YA 4QEGA 4LVNB 4XI5C 4NNPL 4LBEA 2BRRH 1K9TA 2F53D 5KVDH 3K0WA 5KSBF 3HZYB 3SGKA 5LXGH 2GITB 3VXSD 5E8EB 3ZT6A 5D70H 4I8DA 2ZUVA 4OAWB 1QSFB 4PJIE 4NO5B 3I3BA 4YK4B 3N50A 1WZ1L 2ZWLT 1YEHL 3AVEA 4XPFH 4H8WC 5D7IA 1J10A 3TN0C 3CSYB