3LDBC

Structure of jmjd6 complexd with alpha-ketoglutarate and fab fragment.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
210
Chain Sequence
b'QIQLQESGPGLVTPSQSLTLTCSVTGDSITSYHWSWIRQFPGKKLEWMGYIYNSGGTDYNPSLKSRVSITREISRNQLFLQLNSVTTEDTATYYCARRDYGTYYFDYWGQGTMVTVSSATTTAPSVYPLAPNTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional arginine demethylase and lysyl-hydroxylase JMJD
publication title Interaction of JMJD6 with single-stranded RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbC01
2Z35B 5BXFB 1G0DA 5KSVB 1A5FL 2AXFA 1FNEA 1HINH 1BLNB 1J1PH 5L6YH 2VTFA 5KVDL 1ZWIB 4M6NL 4HWZB 3FQNA 3QFJB 1DL7H 3MJ9A 3IFOB 4EJ1C 1PVHA 5I15H 4G8IA 3EOBB 4ODVH 3QFJE 1NEZA 3ZDYE 5I66B 5D7LD 4I0PC 4KRPB 5FYKD 3KGRA 3RVUD 3DSNA 3PDDA 4PGJA 2AQ3A 3V0WL 2Z31D 4AIZA 1NEZG 1JGVL 1KYOJ 4LSTH 1X4ZA 5J56B 2CKBB 4X8JB 5C0CB 4YJZL 4UQ2A 4PJ8D 1PX3A 1NCBH 1FH5H 2YMXL 3KAAA 2X4RB 5C0CE 4IOIA 1AQDB 2ENYA 4L8BA 3DVNB 4X6FA 3LS5H 3THML 1RK1B 2NY7H 3GSVB 1ADQL 2R0LH 4GUPB 4OBSA 4YR6A 4WW2F 3MUGA 2HVJA 1S9XB 4QWWC 2AJSH 1ZLVK 1KXTB 1RK0A 2DM3A 3V5HB 1RJZA 1ETZB 4FQIH 1LO4L 1MIEL 2ED7A 3ARSA 3HNVH 3TPUA 3CH1A 3BIBX 3KLSA 1KEML 2C1OA 3CXDL 5KAQF 3HC0B 4HUUA 4I0CC 5AAMA 5I9QC 3TBVB 3PP4L 1EEUA 5BVJB 2JB5H 2W9LA 1B9ZA 1PGRB 3FCTB 2XWBB 1QLFA 2FBJL 3NIGF 5KVFL 1B2WL 1Z5LB 4NKIH 2VLJA 1GJIA 1AE6L 3HZVB 1A9BA 1QLEH 4P57B 5BZDA 2AEQH 3GSNH 4YHML 2CKNA 3L5WA 1EXUB 4AEIH 4Q58C 4P48A 3QNZA 1CDJA 2Y6SC 2FJHA 1W0VB 2VZVA 5TGBB 1CFTA 2DB8A 5IW1B 1KTLA 4X6CA 5T33H 3SCMA 1KPVB 5I1HH 1D6VL 2VXQL 1VFMA 1XIWB 1EERB 4F7MB 5EOQL 1G7JB 3B9DA 1I1RA 4QRPB 4HXBH 2ZPKH 4OV5B 4YFDB 1T66C 4QHUB 1F2XK 2AK1L 2K9UA 5IF0A 3UO1L 3MJ9H 4KI5C 1CGSH 3GSXA 2E3VA 4S11A 1LO0H 1D5XA 1S5HB 4JQVA 1KJVB 4PRID 4HIEA 3OJ2C 4G6AD 5GS2H 5C6TH 3VWJB 5BS0B 5I1KH 3RBSA 1FZKA 5EBMA 4L8SB 3OHXA 4PFEA 1DN2A 3MOBL 1YPZA 4HH9B 1MFNA 3L5IA 5D96C 2ADGB 4UV7L 4ZAKB 5IROC 2JIXA 5EZLA 1F58L 3NTCH 4H25B 3EYUH 2DIJA 1N5AB 4IRJC 1UWXK 4OF7A 1NGQH 1CF8L 3BGMB 4M48L 3U82B 4OGYH 4OI9A 1SHMA 1JF5A 3W11C 4PJBF 1BZ7A 4ZQKB 2YRZA 5SV4A 3F7PC 5CILH 4D0CB 4GRLB 2QJDA 3RQ3A 1JF1B 1I85A 1NH6A 2FEDC 4KRLB 4LASL 3FO9B 3RVWC 3Q1SH 1EEZB 1RAMA 3O2WL 5JR1L 2FATH 2MSPA 4HPYL 2PCPA 3BUYB 1CE6B 3PWVB 2W9DL 1AJ7L 3QH3B 1H3XA 2E6JA 3EYSL 4LKXB 1KT2B 3G5XB 4QF1A 1IC7L 2EXWD 4DW2L 1A7OH 4EQ2A 4WEBH 4FFYH 4W70A 3VG0L 4DN4L 3MTRA 4I0KA 2YZ8A 3BD3A 4XC3L 5T3XD 3VFWB 3BXNB 1CK0L 5E8DL 2BFVL 2Q87A 5DC0A 4YGVB 3TJHD 1OAXH 3ZE2F 1C5DB 3O6LH 1A3LL 4JQIH 2R0WH 1CXHA 3CVHB 4OFVA 1QFWM 2DQDL 1QSFA 4OCXL 1U3JA 2NYYD 5KN5B 1ZT1B 4KKBC 4OCYH 1I3RA 3KNBB 2ZUYA 3FFDA 1JHKL 3N85H 3KLAA 4X6EB 1BBDL 1S7UB 5I74C 5J11C 3S35L 2BRRH 4EUPA 3K2UL 1IGMH 4HWUA 2DKUA 3ZDXF 1KXVC 4QTIH 2FO4A 3HMWL 2FWOA 5EH1A 2X4UA 4LAQL 4V1DD 5F9JA 2HJFA 1WZLA 1I7TA 2NLJB 1UB5A 2Z91A 3LS4H 1TQBB 2P8LA 3EUUA 4K7PH 2VLME 1MFBH 5FB8B 3SCMC 3MBED 5GRZA 4OLZH 4CJ0A 1BQHG 2Z8VC 4ZS7H 2VQUA 1A6WL 2ADFH 3C87A 3SJVE 4NWUH 5E8OB 1IEBA 4LGPB 4OIIL 2QQLL 1KIPB 3O4LB 5C7XH 5KG9B 1QSEA 3O9WA 4L4VA 5BVPH 2FB4H 5K9KA 1BF2A 4PTTA 2AEWA 2DTMH 2XI9A 5CBAA 3O4LE 5C08D 5IMKA 4RRPG 1ZGLA 2C7UA 4OQTA 3RZWA 1LK2A 4FABL 4JN1H 4BSWB 3D85D 3DTXA 3U7YH 4Y4KD 3ZZ1A 1OWRM 1OLLA 1OGAA 1CTNA 2VKXA 5EC2B 3RVUC 4X7SH 4TOYL 4WDIA 4BSVA 3B43A 3KPRD 3Q5TA 2Z31C 2R2HB 1FN4A 1A6UH 4HXAH 4NNXA 4D2NA 1WEJL 4UMGA 2DDQL 4JDVB 3QDMA 4PJ8C 5FAAA 3DRQA 4LBEA 2BSSB 5DMJB 1ZVHA 4JM2B 3M8OL 3NPSB 4ZD3H 4YWGL 5KANG 12E8L 5JXED 1YECH 1UCTA 2PW2A 3QIUA 3MRLA 5AEAA 4Q2ZB 2HJKB 4O2CA 1MCWM 3IVKB 2Y07L 4G80A 1BJMA 5LQBL 3PF2A 1INQA 4YH6A 3B5HA 1KCRL 1HSBB 3NFPA 4HD9A 3SO3B 3ULUE 1BZ9A 4BFEA 3MLZH 1D6EB 4HQQL 4QXUH 4WEMB 1OW0A 3GRWA 3LD8C 4JG0H 3DVGA 1KBGH 5DS8A 5IB5B 2YKLH 4EUPH 1TJHH 3B8SA 2DQJL 1A6VL 3LPWA 3QEQB 1L0QA 4UBDC 2G60L 1AY1L 4YIQB 1IT9L 5DHVA 4W68A 1NDGA 4QNPF 4M8QB 4P23D 1LEKB 1MAKA 4L3ED 1OD7A 2R56H 3RZCA 3HA0A 3GIZH 1XGQA 3EYVB 2IPKB 3FO0L 3ROOA 5F7WC 1QNZL 1J8KA 4MXVF 3OJDB 4TULL 3KLDA 2XKNB 2W91A 5FDWB 4DTGH 1RUPH 4NZRL 4P3WA 3FB7B 4RIRA 3DGGB 4P2RB 4CNIA 1HNFA 3MPCA 5FYLL 3MBEA 3VG9C 3RWCB 4P2RE 1B4JL 1VKXB 5CD3A 1A14H 1HINL 3RX5A 5JMOC 5BRZB 5L6YL 3OKOA 1WBYB 5DD6A 4OQTH 4U3CA 4PJIB 4PUBH 1XGUB 1SJXA 1R3JB 3MV9D 2MFNA 4PJIE 4K9EC 3VRJA 1KTKE 1DL7L 3BI9X 4ODXB 4FXKB 5I15L 4WV1B 2GFBB 2A74B 2QQNH 4G6AC 3CDGA 4XHJD 5TDNA 3T1FB 5L2JA 1VDGA 4ODTH 1BOGA 3QNYB 2YPLD 1PG7H 5FOBA 4OIBA 1T2XA 3ARDB 3HE7D 5E95B 5E08L 3WXWL 1TENA 2OXHA 1A9EA 4RISH 3GEWB 4LSSH 1U8QA 3MLPA 1PAMA 2H8PB 2XA3A 2CK0L 3G5VB 2GY5A 2NY5H 1UJ3B 1YNKH 4KK5C 43C9A 1NCBL 1FH5L 1TVBB 2GTZA 5FA4A 3RTQB 3DXAA 5EORH 4BKLB 1P9MA 4QCIB 3VGHA 2D7TL 2P5WD 3IF1B 1J11A 1CZ8H 1MLBB 1MHEB 3PL6B 1S9KC 2FDBP 5CEXA 1AGBA 3KJ4C 2NY7L 4WO4A 2GJ6B 2WAHA 2VDLH 3FT2B 2HTKD 4DKAA 3GRWH 2NXYD 2OQJB 5D70H 1J9CT 1F4HA 3ARGD 3BT2H 3HNVL 4PJEF 1XCTB 3HC4H 1V7ML 3E8UH 3VMNA 3FRPG 5DHVH 5IB3A 5K59E 5D5MA 3HI6H 4H88L 2B8OT 3H9HB 3BEWA 1A3RH 1QG3A 4UT6H 1KNOA 4NKIL 4P2QA 3ZKXB 5I1AA 2E27H 4HWBL 1MRFL 5KTEH 1G0YR 2A9NH 4YHIA 2EXWC 1NGZA 4ZXBB 3ZL4L 4Y88A 2HAZA 4JHWL 5F96H 5AWNH 3MV7D 5JXAH 2N7BA 4BH7A 5IVZB 3BZFA 4TRPH 1HE7A 5I19H 4GG6F 4YZFF 5GGUB 2J4WL 1NGXB 2NY5C 5IIEB 4J8RA 3U1SH 3QIUC 5TDPB 2K3TA 2JCCB 4PV8A 4NQDB 5JIHA 5T33L 3QIBB 5I1HL 1ZGLP 2JCCE 1U8PA 3TJHC 4XX1G 3HMXH 3U6RB 2ZPKL 3D39B 4XGZA 5C8JB 1FNGA 3FAWA 3QQNA 3BP6B 2YA1A 3D39E 3MJ9L 1F3DH 5FKPA 3X17A 2EDTA 5T1LB 4YBLB 5FM5M 5HYQB 4OZIF 4HLJA 4P9HC 4LVNB 3QRFM 3MV9A 1QVOB 1KACB 5F1IB 1I7ZB 4JRXA 5BQ7A 1DQQA 5D2LB 3L3DA 4KK6D 5IB4B 3LAFA 3RWIA 5C6TL 2R2CA 4OUOA 4YX2H 4OM1H 5D2LE 5HYJD 1ZKAA 1QR1B 3TZVD 3JSSA 3QHZL 1KYOK 1G6RB 1KG0B 4L29B 3QFDA 1H15B 4OD2B 4GS7B 4G6JH 3G6DH 4JY5L 4TSAL 1U8IA 4KI5F 1RZ8A 4F7PA 3MUHL 4L5FL 5ILTH 5C0ND 4DVRH 5B8CB 1OAKH 2LFGA 2F8XC 2WLZA 3MBEC 3KPQA 3VFNB 1DFBH 1TZHB 1RI8A 3REVB 3MRMA 3VA6A 3FO1B 4FTVB 1JNJA 1KPUA 2F53B 4NJAL 1RZKH 4FTVE 5IQ9B 2GAZB 4WTZG 3HNTH 3JV0A 3OKEA 4JCMA 4UV4L 1MPAH 3OTTA 4LPWA 4P4KD 3ARGA 4ERSH 1AGDB 2OXGA 3MRJA 4BZ1H 4EQ3A 3BHBA 3CCHB 3PWUA 5HDLA 3DOSA 3VXMB 4JPKL 5DDHB 2FATL 3MO1A 1EFXA 1EGJA 4CBPA 5T1MA 3VXME 2L0DA 1RZFL 2PTTA 3BP5A 4Y4KC 1CFNA 2ZUXA 1E27B 2VYRE 1ZT4B 1A7OL 4XC1L 5C86A 5CEYB 2DMCA 1PX4A 3FQXA 2A6DB 1BQUA 4FFYL 2HKHH 5E9DA 1WC7B 3WUZA 3W9EA 3C8DA 3K8MA 3OR7B 1T20B 4APQA 4HK3N 4LPTA 5FM4A 2W0KA 3O4OC 1T6WA 4M02A 4NBXB 2A6IB 4WTXA 3DO7A 2M26A 3D69A 3EO9H 5JXEC 1HHGB 4IMLB 1OAXL 1CDIA 1KCSH 5KJRL 2CUIA 3O6LL 4QXWA 4KPHH 2R0WL 4OV6F 1A47A 5GGQH 1PKQB 1X5HA 3RUGB 1J8HD 4IRZH 4XVUD 5ESAB 3QXDA 1IQDA 1VFBB 4CVXA 1PKQE 2VITB 4M7JH 4Z7WA 1M7XA 4DZ8A 3RUGE 1A22B 1G7IB 5L7XH 1I4FA 4ZUWB 4DGVH 2APWA 2R4RH 5L88L 3N85L 2N1KA 2OI9C 1MCHA 5AUMB 2BRRL 1IGML 2A9MH 4YPGB 3ZMRA 3TJEH 5HSFA 2H9GA 3S4SA 1K9TA 1H3VA 1K8IA 3VXUB 3O6FB 4P23C 2O26U 3VDAA 3TZVA 5HDBE 5H8DA 3JV4A 2IFFL 3VXUE 1TCRB 1BX2B 2YEZB 4U3XA 4OTXL 5IQ7H 5MENB 1NCCH 1LE9B 4NC1E 3BQUD 4MAYA 3G5YB 4M4PA 5J6HB 4K7PL 4KMTL 4ODWA 5CJ5A 5MENE 1FYTE 1MFBL 3VH8B 3AS0A 4AH2B 4Q0XL 4BQ8A 4NO0D 5J1AB 5IFAH 4ZS7L 2ADFL 2OJEB 4NWUL 4OF0A 4RGNB 1UVQB 3RL1B 2VDRL 4YFEA 5C7XL 4F7EB 2FB4L 4RGNE 3FT4A 5DMYA 1EGJH 1AGCB 2DTML 4ZPVB 1JP5A 4LEXH 1LDPH 4BFGA 3U48A 5C0DA 5HGAA 4DVBA 4JN1L 4XP1L 3U0PA 1FVEA 2CDFB 3ESVF 1H3TA 4MSWB 4F2MB 3WD5H 3EOAB 4XHJC 2VWEC 4JY4A 4BFIA 3IS1X 4HAFA 3U9UA 3GSQA 3HE7C 1P4LB 1A7PH 1M7IA 1A6UL 1GGUA 2D4DA 4JR9L 1ZHLB 4UT7L 5F88B 1NCNA 1S7SB 1JRHH 2C3WA 4PGCB 2VL5A 5D72H 2RCSH 5D8JH 4U0RC 4NN5C 2CLRB 4F80A 2HTKC 3MLZL 3GMRB 3KS0H 2AABH 3CD4A 2RBLA 2NXYC 1T1XA 3OXRA 4JG0L 3ARGC 1EA9C 1J8HA 3H9ZA 2YKLL 3RHWF 1D5ZA 1OARH 1MFCL 3BIKA 3CFCH 1TJHL 1JPTL 2HTLD 1BREA 1OP3K 3OKLB 3L3KA 1H0DB 2VERN 4CU7A 5EIIA 3PWNB 4MLSA 1BIIA 2VQTA 1KCVL 4HIJB 4GMSH 3FN9A 5JW4M 2YPKA 4PJAF 1S8DA 5IV2A 4EZMA 1JUFA 1FV1B 1YA5A 5MERA 1DCLA 3VCLB 1FZMA 1P84J 2EDNA 4PGEB 4N0RA 1F97A 2EDHA 3BO8B 1RUPL 2ZG3A 1MFEH 4RMRA 1QEWA 3DV6A 1MHPH 2J5LC 3V7MA 4XHQA 3TT1L 3FN0H 4NQCB 5E2VH 1CU4H 5B3JE 3VE0B 1A14L 5E6ID 2ZSWA 5D7IB 2WANA 5IMLB 2Y1VA 2FIRT 1U8OB 3MFGB 5KZCD 3QUKA 1LO2H 4NQCE 3FHAA 3LKNA 4OQTL 5D7IE 3IDXL 1MI5D 2FL5A 1CIUA 3ROLA 3NABL 4HK0B 1KENH 3KXFA 4AK1A 3T3MF 3MXVH 1A7RH 3QDJA 4X6BB 2QQNL 3ZLQC 4ISVA 4KK6C 3AREB 4XNMB 4LGSB 4UIKL 2BCKB 2H6PA 5TE7H 3GHBH 5F9WC 1TITA 4RISL 4LSSL 3TZVC 3FTGA 2I24N 3QUZB 5EN2A 1ND0B 4JPVH 4LCCB 2NY5L 4M9OA 3FQUB 3QIWB 4ZTOH 5M95B 1F4YH 2EH8H 3A6CL 2EDOA 1DQJB 4HKXA 4MQXD 5T3XL 1Q0XL 5I16B 2FGWL 4JKPH 5EORL 4P99A 1NC2D 1BVLB 5E8NB 1ZA3B 2ICWA 4O2FA 3C5ZD 1VFUA 3UTSA 5IVXE 5C0NC 2EIEA 3RGVD 4LCWD 1AQKL 2ZOLA 4KTEL 4QRUA 4G3YL 3DROA 3GRWL 4E41D 2F74A 3AMKA 3PHQA 1DQLL 4F15B 5D70L 1M71B 4P9HL 4Y5VA 4WJ5A 4NQSB 3BT2L 5HJ3A 2BNUB 4WU7B 1IM9D 5L2KD 3L7FB 1EAPA 4P4KC 3E8UL 4NPYB 5HHVH 1ZHBA 3F7VB 3VD9A 2YC1A 4DZBB 4BYHA 1MEXL 2J8HA 1HH9B 3DHJA 1KN4H 4CVZA 2ARJA 2NY2D 1Z3GL 2E27L 2NX5B 5KTEL 4O4YH 2A9NL 2UZYB 1I1AD 1A6ZA 3IFLH 4B50A 2NX5E 1INEH 2EIBA 3D2UA 4ALAL 2DQTL 2EYTA 3CFBA 3NZ8A 4HS8H 4TRPL 5DURD 5ICZB 5DJXA 3W39B 4U1GB 2XZZA 3P77A 1W8NA 3U1SL 4RAUB 3RWEB 3CMOH 3PIQA 5HGBA 5I2IB 2O61A 3AAZA 4GW1B 3DUSB 5AZ2H 5K33A 1WAAF 5E7BA 2W60B 5JHLL 4JM2F 3JWOH 5CP3A 3ZHDA 4HKBB 2COQA 5E6IA 4R97C 4WNQA 2AGJH 4RFNB 5IEKA 1D9KD 4XVUC 4LLMA 1IEAA 4MB5A 5EWIL 3QEGH 4OCWH 1R5IB 2IH3A 1DLHB 3SDYL 2F15A 3JV6B 4JFHE 2UWEE 5EDXA 1N4XH 2IPUK 4HIXH 1TPXB 4YX2L 1LP9F 4X6DA 4I3RH 4X83A 4KDTA 2B39A 2YD7A 3BP7B 4JFDB 3RAJL 5H35B 3BGFC 5E5UB 5BZWA 4HIIA 4JFDE 4G6JL 3G6DL 5FF6B 4YXHL 4C55A 4WCYH 3BQUC 5ILTL 4M03A 1DBAH 3GJFA 1OAKL 3UTQB 1JV5B 3VFUB 4JO4L 4PJHF 1FRGH 1DFBL 1KLUB 4L9LB 4PJ7A 1BAFH 3BH8A 4KROB 1JPSH 1LGVA 4M5YL 2PYED 3RGVA 2J88L 1OSZA 1RZKL 2B20A 4XZUB 4E41A 5JPNA 4YDLB 3HNTL 1HHKA 4PIRF 5JW3L 4JPWL 1FE8H 1G7MA 1MPAL 1P1ZA 4GKSB 4K8RH 4G42B 4OB5H 2BOCB 3PGDA 5DJAA 4HAGA 5CD5D 4FXGB 4BZ1L 4MVBC 2R1YA 3WJLC 5CLWA 1RMFH 2PR4L 5JPMB 4GRWF 2CJUH 3S35X 4YUEH 3MJGX 1AD9A 2RGSA 4CMMB 3S9DB 3CSGA 4I48A 4JPIB 3FRUB 3QO1A 4N0UB 3UX9B 4I9WD 4QHNB 2AXHA 4N0UE 2ICEB 1NMCC 3N1PC 1QRNA 4FQHB 1FSKB 2NW2A 1SMOA 4X80L 5FYLE 2HKHL 3DRTB 1EX0A 3M17A 5FUCC 3N1QC 3C5SB 2A77H 1MQKL 4X0KB 4OZFA 1IGJA 4ZOAA 5CSZB 1KIQA 3EO9L 4X98A 3TH2T 5ANMB 1N7MH 1PEWA 5CP3H 2WWMD 1ORSB 1KCSL 5SWSA 5ANME 4KPHL 2G75A 3VWKD 2BP3A 3SQBA 2XTJD 3HFMH 3I50H 1CWVA 1TTFA 1SEQL 3HCVB 3QQ3A 1DUZA 3VFGH 5IFJB 4WFGE 3I6KB 4IRZL 1NGWB 5EO1A 3GI9H 1EHLH 1VESA 35C8H 4F9LC 3VXRD 4ZUSA 4FQ1L 1S9VB 3TVMD 4DGVL 4ZUUA 2R4RL 2HTLC 1FCGA 1U8MB 2VQ1A 1YZZA 5IJVB 5C0IA 3HC3H 2ZJSH 2LU4A 5EBWA 3TGXA 3LKOB 3SKNB 1K5NA 3ARBB 1WSST 1UM5L 4CN1A 5CJXA 3GJFH 1G7PA 1T1YA 1G7HA 1Q1JL 1SYVA 5DO2D 1CXLA 4YEFA 2GT9A 4XCNB 4EI5B 4Y16A 3EFFB 3B9KB 3DX8B 2AEIT 1JZ5A 1R3KB 5FCUL 1TTGA 3QA3A 3WNOA 3CFEB 1KB5L 5BW7A 5K9JH 1NC4D 3MLYL 1C08A 5IFAL 5IT2L 1F8TH 5D7KD 2V2TA 2JB6B 3O3BA 3RDTB 5E6IC 4IRSD 4GW5B 4ETYA 2IH1A 1I3UA 1IKNC 1EGJL 5C09B 3GSNB 4GKOA 4LEXL 4N8VA 1LDPL 4M7LT 4JFYA 1QACA 2UZIH 1WCBB 5C09E 2YRLA 1XF4B 2AEPH 2VXVL 3MRHB 3WD5L 3WJJC 4ZUTA 2AXFB 1FNEB 3VDBA 1F4WL 4PJFF 3EOTL 4LSVH 4OZFH 3S36H 2GUOB 5FGBC 4C4KT 1UXSA 1Y6MR 3ZT7A 3FQNB 1MJUL 4G8IB 4MQXC 4DQOH 1NEZB 4OCSL 1Y6NR 4B41A 2WIIA 2ZKHL 5D72L 2RCSL 5BOZG 3C5ZC 3RGVC 2FIKA 4AIZB 4YHPA 3TF7C 4UQ2B 5IGXH 2P8MA 2AABL 4U6XA 2VZTA 4JKLA 1L9NA 4IOIB 4L8BB 3BGAA 5SX5H 3IB4A 1IC4H 3EDKA 3PGFH 1V3MA 4HIHA 1OARL 5E4EC 3PP3K 2EE9A 3G9VA 3VXRA 2VDOL 3WUWA 1U95A 1SJVA 1BVZA 4YHNA 2AJ3A 3ZE0E 2KZ1B 4YR6B 5I1LA 3MUGB 3PQYB 4LEOA 2HVJB 4HS6B 3RNKA 1RK0B 4XAWL 1RJZB 2NY2C 3IDIA 3TPUB 4G8GD 3CH1B 2C1OB 2H1PH 4KQ4L 4JFFD 4HUUB 3MA9L 4FXLA 5JQHC 3LRSA 3FQTA 1IGFL 2JJSC 5I74B 1QLFB 2VO5A 3MCLL 2DLEA 1MHPL 2VLJB 4AEFA 1H5BA 3FN0L 4L9DA 1NC4A 3VMOA 5I1GH 1A9BB 5I8KL 4NO3A 1OAUL 1N8ZA 3BAEH 5E2VL 5BZDB 2EDWA 4NGHL 4FHBD 1UKTA 2GTWA 3BJ91 5J13C 3L5WB 1LO2L 1XGRA 4QY8A 4Y8AA 3QNZB 2FJHB 1D9KC 1E28A 1CFTB 1KENL 3S5LA 4X6CB 4WI3A 1A7RL 1I9IH 4WENB 4I13B 4JG1L 4X6CE 1DVFA 3E2HB 1Q94A 3OG6B 4WHYG 3S5LG 4TUKL 5IF0B 5IFHL 2NTSP 3VFMA 2IEPA 3GSXB 2ZSVB 4R6UA 3HN3A 3P3YA 1FL5A 1D5XB 4JPVL 4Y5YC 3IJHA 4AY0A 4YAQA 1FLRL 1ZHKA 1F4YL 4HIEB 2DM4A 4YHOH 2WLYA 4QHMA 5GZND 1V05A 2R1WA 1FFRA 1FZKB 5HPOA 5EBMB 3OHXB 4JKKA 1BZQK 2P7TA 4QGTA 3JUZA 3HRPA 1QHPA 1GGYA 1YPZB 1FORH 2JIXB 4JFQA 4BELD 4GBXD 1YPZE 2ZCKH 4FQXD 3OL2A 4L3CA 2ZCHH 4UUJB 1HHJA 4MJIA 4XVTL 5CD5C 2C4XA 3U0WH 4G7YL 4Z7UA 1CFVH 2OX5A 2DYPB 1BZ7B 2ID5A 1Q8MA 4HPOH 1TJIH 1X44A 5I0DA 3BFOA 3IFLL 4PJAE 5ADPH 2YBRA 1U91A 3WFBL 2M1KA 1W0YT 1HN1A 4KGJA 3VD5A 1FIGH 4OI7A 2PCPB 5HGHA 3GMOA 1OT2A 1CYGA 4OCLC 3CMOL 4QF1B 4M6OH 2R1XA 1T2QL 5JW4N 2WWMC 4ORGA 5F71A 3VWKC 2XTJC 2IMNA 3UTTA 5JTWA 2E7MA 1GVIA 1YNLH 1RZJC 1EBAA 1NLBL 4OLUH 1BM3H 3TVMC 5T5NG 5FK9A 2V2XA 3HUJA 1QSFB 3OJVC 1MRCL 5HI5D 1I3RB 1KLGB 3H9SD 3FFDB 3KLAB 5DO2C 1MIML 3VXQA 1NUNB 4RFOL 4ELMA 1DBAL 4HF5L 4HLZG 1KJMA 2VDKH 4EUPB 3NIDE 4XXDB 3WKMH 4PRIE 2FO4B 2XACC 4KMQA 2FWOB 4HBQA 4OCMC 1BAFL 3HTLX 3P11H 3T8XA 4R96A 2X4UB 3GGWA 3QCVH 2CLVA 3L5XH 5EOCL 1I7TB 4UDUA 1NBVL 2B2XH 4NRZA 1UB5B 2H41A 1FFNA 2Z91B 4IRSC 4K8RL 1HCFX 1MF2L 3H3BC 2P8LB 4OB5L 3P30H 4Z7QF 1CFQA 1FO0L 4OFKA 5DVKA 3ZYIA 1DN0A 4YUEL 4TNVK 3KJ4B 4LMQE 4TVPD 4EEEA 5B3NA 3R0MA 4KKAD 3QXUA 4MQSB 1GGBH 3K46A 3C2SA 5F1SA 4HJJH 1IEBB 1KTDA 3DURA 3IRZA 1WUNT 1QSEB 2X4NA 3O9WB 4L4VB 3IAQA 5K9KB 5CGMA 4PTTB 3QPXH 4YBHA 4CKVX 3CSPA 3OMZA 1QSEE 5IMKB 1VFOA 4K7PX 1ZGLB 2A77L 2C7UB 1LK2B 1FG2A 3WSQL 5DSCA 2IAMD 1YMMD 3DTXB 2IAND 4TPRH 1N64L 1OGAB 5MHSD 5ETUA 3AC0A 4ETQA 3S88L 3KR3H 2C5DC 2CRMA 4WDIB 4BSVB 1E4XI 3I50L 3V6FA 1FN4B 4NNXB 3QDMB 3DRQB 4LBEB 5L8LB 1EHLL 5DEZA 3S8WA 1BD2A 2NY3D 3D3VD 1QSVA 35C8L 1JVKA 3QDME 5EG6C 2PW2B 3QIUB 3MRLB 1UWXH 4O2CB 4XNXH 1U8HA 1X5ZA 4G80B 1LNUA 3WFCH 1LP9E 5T3XE 1INQB 2KDGA 1BZ9B 4U7MA 1Y0LA 4GFTB 5C1MB 1ZV5A 3KHQA 5ICYA 3IAGC 3DVGB 5DS8B 4CW1A 3ZE1F 5I1JH 1L0XA 1S9YA 3HE6D 3MJ7A 2XFXA 3PXJA 1FL3B 1D7FA 1OPGH 3CH8A 2XZCH 3NCCB 1OQOA 5DHVB 2IJ0C 4Y1AD 1WWWX 1NDGB 3PGCA 5HYIA 1EEYA 3W81A 1FZOA 1F8TL 4LAJH 2APTA 3RZCB 1J1XH 1PYWA 2CRZA 1XGQB 3DGCR 1MJ8H 4HSQA 3L3IA 3ROOB 1F3DJ 4KKLD 4V1DE 3QP3A 4G6FD 5HHPA 1BGXH 1N6QH 4MJ2A 4RIRB 3K80A 2UZIL 5DMIH 2ENSA 1MNUH 1JGDA 4Z78A 5CD3B 4LPXA 4M3KB 4XH2A 3RI5K 5D2NA 3OKOB 5DD6B 4EDWH 1TLKA 3S36L 3BD5A 1HHIA 3TIDA 4LPCA 5BO1H 3VRJB 3SE8H 1NUGA 15C8L 1E4JA 1UXWA 1TETH 4MD4B 4DQOL 5L8KB 3CDGB 3KPLA 4LLUA 4N1EA 5EPMA 5TDNB 5GZNC 4JKMA 5L2JB 5TQ0H 1BOGB 2IAMA 4FQPA 5FOBB 4WEUD 1OM3L 1NBQA 2HFFA 3IYLW 1A9EB 4HGMA 1U8QB 1EO8H 4Y2DA 5FA3A 3ARQA 4GBXC 1BQLH 43C9B 3SGEI 1MOEA 2GTZB 5FA4B 4M1CD 3DXAB 2V5YA 2DQUH 4AG4L 4BQ9A 3OXSA 4MLIA 3DXAE 3O4OB 3GMQA 4XB8A 3WMSA 5CEXB 3UPCA 1OF2A 1YJDH 1MH5A 2G5BA 4WO4B 3O81A 5LKNA 5HBBA 1PG7X 1CXIA 3QWQB 4BJLA 5GISH 5CKAA 3E1F1 3ALXA 3LH2H 3NZHH 4S1DD 1RU9H 4A2LA 4ZO8A 4EDXB 1VHPA 2H1PL 4NHCH 3LEYL 2P1YA 5IB3B 5ADOH 5GJTL 5KOMC 3VXPA 4WFHE 3SGKA 2AJXH 2V5SA 4FQCH 3BEWB 5D5ME 1IGYA 2MWCA 4GAYA 1T22A 4GT7A 1KNOB 4P2QB 4TSCL 2D0FA 5I1AB 1XGTA 1G1CA 1MRDH 1UACH 5INCA 4YHIB 3GUTA 5I1GL 1NGZB 4P2QE 1NGPH 3BAEL 1DEDA 1T7VA 5DQJA 4UILL 4BH7B 5GGVH 3BZFB 3RA7H 5SWZA 4HKZA 1C7TA 2A0LD 1A6AA 4J8RB 1DLFH 3HG1D 4PV8B 1TIUA 4KHTH 4XX1E 1BPVA 4QLRA 5DWUH 1U8PB 3F62A 1EPFA 1X5XA 1MLCA 3T0EA 1XCQA 3C6LD 4XGZB 4G5ZL 1FNGB 1YJDC 2BNQA 1F5WA 4PG9A 1NFDA 5SWQA 5IUSA 1N3NB 2VABA 1AIFA 5A1AA 1B0WA 3MRIB 5HI5C 2VMFA 3MV9B 3IKKA 4KRNA 4WTWA 4JRXB 5BQ7B 1DQQB 3MLTA 3L3DB 3RWIB 3MV9E 5DD3H 4JRXE 2R29H 1JFQL 3TO4A 2APBA 1QBMH 4QO1A 2B0SL 4XBPA 3CXHJ 3TV3H 1A64A 3QG7L 1VGKA 3H7LA 1DE4B 3QFDB 2YPLE 1RZJL 5C6PB 5L0QC 4PP2A 2ZCKL 5JUEH 1U8IB 5CWSA 1RZ8B 4F7PB 3HZKA 4KJQD 4IBLT 1T5WA 1SQ2N 2PO6A 3HLAA 5CZKA 3VI4E 4Z7VF 3LEXA 5EU3A 5IWLA 3KPQB 4LSRH 1CFVL 2AAVA 3I6LD 2VLKD 3MRMB 4I3SL 2CK2A 3O3AA 3SGJA 1KPUB 2B7DT 2Z8RA 1TJIL 5D2NC 4Z95H 43CAA 5IBUG 1BEYH 1R0AH 3OKEB 1K2DA 1LO3H 3T09A 5ADPL 5B39A 1JHTA 1VEOA 1KJ3H 3ARGB 3ARFD 5M94B 3MRJB 3IDJA 4KY1H 3BHBB 4RNRA 1RHHA 4KTYA 3CUPA 3MO1B 1EFXB 5T1MB 1U3HA 5B39G 4OLXH 2QR0A 5F7FA 5GHWH 2IAMC 2NY6B 2PTTB 3BP5B 1A7NH 4M6OL 1CFNB 2BVTA 2HJLA 1OL0A 1QTYT 4Y0GA 3KPSD 4JN2A 3FQXB 3IRPX 2XWJA 1R24A 2IADA 5E9DB 25C8H 3KS0J 3W9EB 4PJ9D 1YNLL 4APQB 5E9DE 1Q0YH 3MV11 2NY3C 3DO7B 1CT8A 4OLUL 3D69B 4NIKB 2QHRH 4EXKA 4FMFA 4HC1L 4K23H 2I27N 2WBWB 1WF5A 4GO6B 3K1KC 3TN0D 2H2SD 1T04B 3LPGA 1A8JH 3P9MA 3F12A 3UTZA 1MQ8A 2YK1H 3QXDB 8FABA 4CVXB 3U79A 2IWGA 1WGOA 1JIBA 2DWDA 3H8NA 4Z7WB 3M1BA 4DZ8B 3QUYD 4LGRB 3I3EA 1I4FB 3HE6C 4PJ5D 4Z7WE 1ZE3C 3EDFA 2B4CH 3H3PL 4NQED 3FFCA 2V6HA 1P2CA 2DBLH 1UEYA 5IW3A 2VDKL 3WNPA 4IMKA 2H9GB 3S4SB 1K8IB 1W2KT 1G9EA 4DKDC 4GAFB 3JV4B 3OPZH 2B5IC 5HYJE 1NLDH 5F3HA 5I17A 5A3ID 5EA0L 3W0WD 4MAYB 1JN6A 2YWYA 3ELAT 4ODWB 1N2RA 1AXTH 1W0WA 4S2SA 1PQZA 4KKLC 2A6JA 1G84A 2RFXA 1GZPA 3IETA 4ZOCA 3PNWA 4HJ0C 3S37H 4JFOA 2VDML 5B21A 1L4IA 4KAQL 5DJZA 1GGBL 4PRPD 4RGOL 3K7UA 1MCCA 3SN6N 3PV7A 4HJJL 4PRNA 4TUJA 4XCFH 3INUH 2XPGA 3FOLA 1EMTH 2DQEH 3FT4B 5I8OH 1UA6L 2V9QA 5CKGA 4AJ0A 5C0DB 1UENA 3JTSA 5HGAB 3S7GA 4DVBB 3SGDI 3DIFA 1CXKA 3U0PB 3LZFH 1FVEB 5IM7A 4TPRL 2B4CC 1YDPA 2I5YH 4JY4B 2P47B 5IBTL 1H8SA 4BFIB 1S7WA 1DBBH 3U9UB 3GSQB 3O3EA 3MRKA 3MV8D 2V9TA 1AO7D 1MELA 6FABL 1M7IB 4PJGB 4FRWA 3ALWA 3IDMA 4QT5A 4R0LC 3PE9A 1VADA 3HI5H 5EUOA 4U4BA 4FZ8L 5DR5H 4M1CC 3WO3B 3MQIA 4PJ9A 4N8CL 3UYRH 5ESQA 1ONQB 4F58H 2QADB 2QEJA 2VL5B 5DMKA 5GGSA 4U3HA 3BDYH 2EC9U 3Q6GH 4IIQB 3BIAX 4HZLA 1JGUH 2Y5TA 2YXMA 4JZJA 1T1XB 3O3UN 3S34H 5C2UB 1MREH 3OXRB 1J10A 3GBMH 1WT5A 1J8HB 4S1DC 5DQDH 1D5ZB 4X4MA 5D1ZA 4UB0H 5ISZD 4HJGA 3BIKB 5E2JA 2LAAA 5E6ZA 1CFSB 1ZMYA 1J8HE 4X7TA 1FNFA 1U3HC 3C5JA 1XR8A 3ZKQD 2XZCL 3O8XD 4UNTA 3L3KB 5HY9A 5EIIB 3P40A 4MS8D 1BIIB 2OM5A 4OFYA 1B0GB 5GS0D 3TO2A 5CIPA 3PDGA 1J1XL 4UNUA 2YPKB 1S8DB 5IV2B 1UKQA 1T80A 4G43B 1GAFL 1BF8A 5MERB 3OGOE 1FZMB 5CZVH 5DVOA 3GBNH 5FGRA 4N0FA 4NKOB 4KDWA 1C16A 3O45B 1BGXL 2X40A 1N6QL 1EJOH 2A0LC 1QEWB 3DV6B 3ZKSD 4GKNB 1MNUL 5HI3D 3HAEG 4CMHC 4F9PC 2ZSWB 1RVFH 3C6LC 4PRPA 1FBIH 1RUKH 1ZANH 4YO0B 2DMBA 3QUKB 5DUMH 3LKNB 4PYHA 4EDWL 2FL5B 3ROLB 2MQ3A 2XNAA 3TM6A 3U83A 3A0OA 1YEIH 3HZMA 4H1LH 2YD4A 5BO1L 8CGTA 3GMLA 3KXFB 3CX2A 5BS0D 5T5NF 3U46A 3UZQA 4KZEH 3RWHA 3QDJB 1J1OH 4QXGL 3KXFE 1A6PA 2YA2A 3DMMD 4ISVB 5TQ0L 2A6KA 4G6KH 2NTFA 2H6PB 1NMCB 2VB5A 1FGNH 1EO8L 3FTGB 3G6JA 5EN2B 1A21A 3V6ZB 1Z9SA 3SJVA 4HKXB 4I5BB 1UCBH 1OTSD 3AS2A 2ICWB 1FNSL 2EDFA 4NFDA 4O2FB 3BZDA 5ITBH 4M93B 4Z9KB 3UTSB 5I71C 4ZOEA 4DN3H 5DZNA 1YJDL 2ZOLB 5JOPE 1ES0A 3UTSE 4OFIA 1ZVYA 3DROB 4NKQB 4OZHA 3P0YH 4OLEA 2F74B 3KYAA 1H3WM 1GOGA 3SKJH 4AEHH 4UQ3A 2EDQA 3HI1A 4Y5VB 3LH2L 4WJ5B 4U05A 4WHDA 5HJ3B 2NQCA 3VXSA 3NZHL 3VGFA 1EAPB 3BPCA 4NHCL 3A67L 5A16A 3TCLA 3BPOC 3ARFC 1ZHBB 4R90H 5ADOL 2YC1B 3QCUL 4PBWD 1I8IA 2EH7H 2OSLA 4U1LA 1BJ8A 4FQCL 4CVZB 2ARJB 5CIPH 4PS4H 4AMKH 1UACL 3ARXA 1A6ZB 1NGPL 4J3SA 2BY2A 3OKDA 5GRVL 3D2UB 4X7CC 3WNNA 2EYTB 3CFBB 3NZ8B 5GGVL 3TBSA 4XP4H 5DJXB 4OAWB 4R26H 1N0XH 4PJ9C 3P77B 2X7LA 1E4KA 2WM0A 3ULVD 4LU5H 4XWOD 5HHQA 3PIQB 5HGBB 3BSZH 2O61B 2AV1A 1K8DB 3AAZB 3MA7A 5DWUL 1OAQL 4N0CD 4H0HB 3OV6A 4QRRD 3TN0C 2PNDA 2ZUUA 2H2SC 2BDNH 4C56A 3ME0A 1GZQA 5DTFB 4WNQB 5GRUH 5IEKB 4LLMB 4YDIH 5E2WH 4V2BA 2IBGA 5AZEH 1IEAB 4J3OC 3QUYC 3SE3A 2IH3B 3PDOA 1MI5E 1RIUL 4Z77A 3MLRL 5DD3L 1VPOL 2NW3A 2IALA 3FONA 3LSOA 1CXFA 2R29L 4X6DB 1KCUH 4I1NB 4Y4FB 1QBML 4J12A 5DC9B 3TV3L 3IJYA 4X6DE 2ZCLH 5CEZD 3LEVH 5JHDD 5J1TC 5BZWB 4HIIB 3VI3F 1GOFA 4FNLL 4JFEA 3MRFA 2EC9T 5JUEL 4ONFH 4UT9H 5A3IC 3SDDD 4PRHD 2BSTB 2VE6A 3GJFB 4WFED 2VN7A 4PJ7B 5F9OH 3BH8B 3VGEA 3RGVB 1N5YH 1F45A 1SM3L 2EDJA 5FUOL 3UP1A 4WY7H 1XT5A 4PJ7E 1GXEA 4E41B 5JPNB 1BEYL 5E70A 1HHKB 3UPRA 1LO3L 1G7MB 3QZWB 1P1ZB 4E41E 1KJ3L 3PGDB 5DJAB 1IAIM 4EIZC 4KY1L 4LLVA 1L7IH 2R1YB 1NBYB 4PJXA 5FCSH 1PEZA 3MROA 5JDSB 5T5FH 4RFEA 1AD9B 2JTDA 1UH2A 1CCZA 1LDSA 4I48B 2HT3D 3QO1B 1U41A 4FFVD 4OLXL 5E8EA 2FH8A 5GHWL 3OQ3B 2ARWA 3QO0A 4Z7NF 1OAZH 5E94A 5B38A 5KSBA 1HEZA 1QRNB 5I6XC 2NW2B 1UH4A 1QRNE 2D03H 3LIZH 4RGMC 2DM7A 3M17B 1YEJL 1FC2D 4WUKH 4S0SD 4OZFB 1JTTA 5DURB 1IGJB 4O00A 2CLZA 5GRYA 1KIQB 1NMBH 1UADC 1I9EA 3NN8A 2WBJA 5IOPA 4ZSOA 4X98B 1FQ9C 1SYSB 4KZDH 4L4TA 1YYLH 5SWSB 5E2UL 3O6MH 2G75B 2GIYA 1DR9A 5SWSE 4GSDH 4DGIH 2UZXB 2X70A 1DUZB 3QQ3B 2XTLA 4QRRA 4FA8A 3NGBB 4M7KL 2YK1L 5EO1B 3EDEA 3HKFA 4YDJB 5D1QA 2XQYK 3T0XA 3IFNL 5BMFL 4I18C 5I18H 3P0GB 1FZJA 4ZUSB 3TP4A 5GGRY 3OF6D 4ZUUB 2B4CL 4F3FA 1OAYH 2VQ1B 4M1DH 4ZYKA 1KC5L 4K3HA 3O8XC 5DZOA 4TNWF 4JGUA 2VR4A 5EBWB 4MS8C 4D9LH 5J6GA 1K5NB 3FOMA 5GS0C 3QDGD 5BV7C 4L4JA 1G7PB 4WUUD 1G7HB 1SYVB 3IU4H 4FZEL 2GT9B 3ABZA 3Q3GA 4Y16B 3U30B 3QA3B 1YQVL 1LQSR 3U7AA 1C08B 1I9JL 4PP1D 5HI3C 3H2WA 2V2TB 3O3BB 2X1QA 4OF6A 2CMRH 3JVGC 1C5BH 1I3GH 1U8LA 2IH1B 4MD5A 5A2JH 4N8VB 1QFHA 1JMZA 3KJ6H 1CLZL 4JFYB 4MAUH 3TA3D 4ODSH 2BVOB 3LZFL 5JLZA 4ZUTB 3C60A 3VFTA 5HVFB 4MZ3A 3ARPA 4B7IA 3B2VL 2H2PD 4BUGA 3P9LA 4I9WE 3A6BH 4MHHG 1UXSB 3GMMA 3LQAC 4LQFL 4M7LH 4QRTA 3WFEH 2BNRD 4WW2A 1IAOA 3T08A 2EZ0D 4OZ4A 3NCJH 4YHYC 3WO4C 2VR5A 2HRPH 2OJZH 3UYRL 1OTSC 2WIIB 4GAGH 5C0GA 3V52L 4JRYA 3GKWH 4XNUL 2EICA 2FIKB 4NCDA 3Q6GL 4YHPB 5GPRA 4WFFE 2HP4A 1JK8A 1JGUL 2P8MB 4U6XB 3JXAA 3S36X 1ZEAL 3X3FL 3S34L 5INDA 1MREL 2XTJE 1QP1A 4HIHB 2PF6A 2BOBA 4LVOC 4Z5RA 1I8KA 2GSGA 2XY1A 4R4FL 3VXRB 2N4IA 3WUWB 1U95B 2PXYD 3PWPD 4YHNB 2AJ3B 3VXRE 2EDBA 5I1LB 4LEOB 2ZUVA 2I07A 3DX7A 3RNKB 2KQNA 2BX5A 3IDIB 5IVNA 3T04D 5ACMA 2LV4A 3HS0A 4M61A 5MI0C 1BMGA 3GBNL 4W81A 3LRSB 3HPLB 3FQTB 4OSUL 4U1IB 3BISA 5JQ6L 1IZKA 3ULVC 2P42B 4XWOC 2B1HH 4KJWD 1H5BB 2F5AH 1KIRB 4M00A 4ZO9A 5T3ZH 2QLVB 3LN4A 4P3CL 4N0CC 1F90H 4QOKA 4NO3B 2A38A 5CP7A 1N8ZB 2H45A 1A7QH 1RVFL 2XZQH 2VZSA 4NQVB 1FAIH 2GTWB 4UOW0 1PDKA 2I9LA 1ZANL 2BRQA 1X5FA 4WI5A 3MRGA 1XGRB 3IXAA 4QY8B 4J3VA 1U0QA 2F54D 3QR2A 3MGTB 1E28B 3WHE1 1T83A 4X9GA 1YN7A 3AM8A 3S5LB 3ZTJH 5F7KC 1HHHA 4GMTH 2GW5A 4NBYB 3MYZA 4KZEL 3SEPA 2Q7NA 1VB9A 5A2FA 4M1GH 1DVFB 3AXLA 1Q94B 3W9DA 4NC2B 1FYTA 4ZPTA 3NAAH 4PJCB 4DGYH 1FFOA 3VFMB 1GRWA 1FGNL 3VXNA 1R3HA 5HVHB 1FL5B 4PJBA 1G9MH 3IJHB 5GZOD 4PV9A 1ZHKB 3KLHD 4KV5E 1KFAH 4ORZC 3AB0C 2QKIB 4GJTB 1UCBL 2IG2H 3RIFF 3SDDC 2R1WB 5KVEH 5T1DH 3T2NL 4GXVL 4G6ML 2P7TB 4Q9RL 2EEDA 2MNUA 4AM0A 1S7TA 5F72S 5CCKH 5MP6L 3OR6A 3QQ4A 4JFQB 3GNMH 2F19L 2EKSA 4P2OD 4JQXA 2KPNA 3CVIH 5IG7A 4L3CB 3EO0A 4PLKD 1YEFH 1HHJB 5F6IB 1PSKL 1NJ9A 4MJIB 1A5FH 4MXQD 2E9IA 2Q20A 3V6OA 4MJIE 4Z7UB 3WIIH 2X1OA 2HT3C 3AFLA 3EJZD 4FFVC 4Z7UE 1CG9A 3PWPA 4PS4L 4OD3H 1DEEB 3WHXA 4Y4HD 1T1ZA 3NA4A 2V9RA 3EYOB 4UAOB 2YBRB 1U91B 3UBXA 4JM4H 1DZBA 4S0TD 2MCPH 4XP4L 1G9MC 4MJ6A 4P59H 3DX6A 5HGHB 3V0WH 2VXUH 3GMOB 1JGVH 4LU5L 3B5GA 4Z8FH 1YUHA 3EBAA 2YMXH 2R1XB 4PJGF 3DVIA 4W4OA 4ORGB 3QYCA 2ITCA 4YBQD 5E5RB 3MODH 3THMH 3MYJA 2FHBA 2F5BL 2BDNL 1T4KA 1JJUA 3UTTB 2AK4A 3RPKA 1EUUA 1KIUA 2HFEA 5DEGA 2A1WL 5AZEL 3UTTE 4XXCC 5HHOD 5AD0A 4XNYH 2JE8A 1G6VK 3GB7B 5FK9B 3BPNC 3WNKA 1KEMH 3CXDH 1KCUL 3T0DA 5DVMA 1SJEA 4JZOA 4ZUVB 1KB9K 2V2XB 3HUJB 3VRIA 3PP4H 4X7EC 2ZG2A 2ZCLL 4K3JL 4OZGF 3JWDH 1U42A 5I1DA 3HUJE 2CXKA 2FBJH 4DFIA 5C92A 1AH1A 4I8DA 4IM8A 3VGAC 3MRPA 4ONFL 1AHWC 4UT9L 4OF5A 5A2KH 4U7KA 5IJKA 4HGWA 3VXQB 1H3PH 4ELMB 1KJMB 3MUZ1 3QDAA 1CLYH 1AI1H 4ELME 5F9OL 3T8XB 2J6EA 4EN3B 3IS0X 4R96B 3D9AH 3GGWB 2X09A 4PP1C 2CLVB 1NCWL 4G9FB 1JYXA 5D6DC 4UDUB 4DEPC 4M6MH 3CFIC 4NRZB 1FFNB 4YK4C 5KS9F 3K8KA 5EOQH 1T83C 1CFQB 5M7QA 4JGJA 4XBGA 1L7IL 2JJVA 4MMXC 1DN0B 2AK1H 1QFUL 4ZTPH 3UO1H 2NXZD 4F57L 2ESVA 3TA3C 3DURB 5GS0L 4LIQL 4MNQA 1OAZL 5EZOH 4MJ4A 1OD9A 4LPUA 2X4NB 5BV7L 2H2PC 2XWTA 1NGYA 4Y4HA 4NT6A 2D03L 3LIZL 4MB3A 2LTQC 3JWDC 3WV0A 3GHEL 2EZ0C 1FG2B 4RMVA 2D31A 3RNQA 4UV7H 5DSCB 2X2YA 1NMBL 1QKZH 2VDPH 5C0AA 1F58H 5ETUB 4ETQB 2HG5A 1RUMH 2FH6A 3O6ML 5CHNA 1UH3A 1G7QA 3IXTA 1CF8H 5IB1A 1X7QB 2EEBA 1IL1A 4GSDL 4R7NA 3V6FB 4O02L 3CFKA 3E0GA 3ZSSA 4FG6D 2EECA 3G6AA 1BD2B 1BFOA 5CAYB 4N90E 2O5YL 1BD2E 3GJFK 3NCEB 5TE4L 1U8HB 3SO5A 1LNUB 2YD9A 4M1DL 2PXYC 1FIEA 2V2WA 2X4OA 1Y0LB 3R1GH 3O2WH 4UDTA 4D9LL 2P5ED 5ICYB 5GRJL 4CW1B 1S9YB 2W9DH 2AQ2A 2XFXB 3EYSH 1MAJA 3LCYA 2IBZX 4OGZA 4LCUA 2I60L 3AROA 1HILA 4DW2H 5D7JD 1JBJA 2J6EH 3AU1A 4GQPH 4KKNA 4OGXL 3OB0K 4MA8H 3VG0H 4DN4H 4C83A 2MKLC 1EEYB 5BOPA 4KJWC 1FZOB 3FKUS 5DRWA 3GJEA 2GK0A 4KRMB 1MCBA 1SJHA 4DOHE 3I9GH 1R3LA 5E8DH 4RAHA 2CMRL 3L3IB 2ED9A 1NBZA 3LVEA 2W38A 4KMLB 1A3LH 5HHPB 4U6HA 3UTOA 3KJ6L 2CRIA 4MAUL 4YXKL 5DUBA 3CC5A 3TESA 4ODSL 2WK2A 1JPST 1JGDB 4Z78B 4Y19D 3RPIA 4POUB 3VU2A 4XH2B 4X99A 3DSFH 2X4QA 5D2NB 4W4NA 1BBDH 2VLRA 5D2NE 3K2UH 1HHIB 3TIDB 3VW3H 3WFEL 5ESVA 2VDNL 5GZOC 5D71L 5C6WH 3HMWH 4PBVC 4I0PA 3KLHC 2VISA 5FUZL 3ULVL 5IJKC 2HRPL 4LAQH 3KPLB 4LLUB 4P0DA 2BY3A 4PJEA 3ZYJA 5KSUA 2J3SA 1JYNA 4TN9A 4WI6A 3MNWA 3BD4A 2GJZA 2HFFB 4LARH 1QA9A 1AGFA 4Y2DB 5DJ6A 2DN7A 4XNZB 5TF0A 1UFUA 5FA3B 2I9TA 3C6SA 3FB5A 1I1YA 2G2RB 5I73C 4PJDF 5TF1H 1I8LA 3QFJD 4NUJA 4P2OC 1A6WH 3OXSB 3VD7A 4PLKC 2XYCA 4FFWD 3GMQB 5I75C 4LHJB 4MXQC 3TIEA 5HYSB 1OF2B 1MH5B 4GG6A 4KRPD 1UJTA 1IRAY 3C8KA 2V7HA 5CEZL 3EJZC 5C0CD 1B6DA 4FABH 1JPGA 1HCVA 4Y4HC 2Q76A 1HKFA 1YN6A 2FNBA 1A6TA 2P5EA 3ETBF 4BK5A 5C70A 2JKXA 1PZ5A 4U1SA 3VXPB 4NDMA 1D5BA 1YEGH 5D7JA 1IGYB 4GAYB 1T22B 4OZIA 1WEJH 2DDQH 1K4CA 1XGTB 2E6PA 5T3ZL 5INCB 3GUTB 1F90L 4YWGH 5DQJB 3UC0L 1FAIL 4PYGA 4U0QB 5SWZB 4HKZB 4F37F 2AI0L 5SWZE 1QLRA 2XIDA 1TTUA 2MMXA 1A6AB 1U8JA 1UZ6F 5IVOA 1RZGA 4XP9H 5DA0B 4HQQH 3WFDH 4LHUA 3D0VA 4XP5H 4N0YL 2X4PA 1QPPA 2MPAH 1XCQB 3T0EB 5TQ2L 3ULVF 1I75A 3P2TA 1OGTA 4L3AA 2BNQB 4PG9B 1NFDB 5SWQB 2DQJH 3T0EE 3NAAL 4DGYL 4FS0A 2X5PA 4FQJL 4MDIA 2DLFH 2VABB 2BNQE 2G60H 1AY1H 1TNMA 1AIFB 1G9ML 1GCFA 3CLFL 1Q9OA 1E6OH 1P7QA 1WTGT 4XCCH 2APVA 3LV3A 2O5XH 3MLTB 3STLA 4P5KA 2IG2L 5IROA 3ZO0A 1XIWD 5KVEL 3UPAA 5ICXB 3CDFA 4QRPD 5T1DL 3TO4B 4BM7A 3GSUA 4XBPB 4Q9QH 3FO0H 5BXFA 5CCKL 2DAVA 4IJ3C 2MJWA 1VGKB 2WP3T 3F6IA 3F7RA 3GNML 1CGVA 3CFDA 4BQCA 3PJSA 4NZRH 5GXBB 4HT1H 4PP2B 1CN4A 3RVXC 3CVIL 5CWSB 5FYLH 3HZKB 1YEFL 1B4JH 1DUYA 2D3VA 3X11A 4G7VH 2PO6B 3VWJD 3LEXB 1V7NL 5EU3B 4RMQA 3WIIL 3O3AB 5C07A 2NXZC 5CJOL 3ES6A 4ZAKD 1C12A 43CAB 4OD3L 1D5IL 3R06A 2OBGA 4C57C 1JHTB 5DMGD 3IDJB 4JM4L 3U4AA 4RNRB 1RHHB 5J89A 1B3JA 2MCPL 3CUPB 5C0BA 1MCJA 2WUCL 3I6GA 5E08H 3WXWH 4NUGH 1MCFA 3BRGC 4P59L 1U3HB 3U0TA 2VXUL 2YN3A 2QR0B 2CK0H 2YXFA 3SGDH 4Z8FL 2D0HA 3FZUD 2HJLB 4POYA 4JN2B 5EO9A 3BPLB 5IW6A 4P49A 2DICA 4GRLD 2D7TH 3MODL 1AKJA 1NPUA 2XWJB 3RVVD 1R24B 2IADB 4X9FA 1TDQA 1I8LC 1E4XL 1FG9C 4KFZC 2MTPA 3TEUA 5AG9A 3TT3L 4FG6C 4PR5B 1V5JA 3DYOA 3TBVA 1LEIA 5FOJA 5F7DB 5DD0L 4HMCA 4XNYL 1DTUA 3OAZK 4OJFL 2D7NA 3X14A 2OZ4A 1K6QH 1V7MH 4HW6A 3F12B 2W0PA 5FYJD 3UTZB 4U6YA 3O6KL 4AIOA 3MC0A 3JWDL 2DWDB 4H88H 5F6HI 5E2TL 3M1BB 2XN9A 4ZO6A 3C09B 2V7NB 1HI6A 3A6OA 4HWBH 3FFCB 1MRFH 2MKWA 3N9GL 4KHXH 3ZL4H 1H3PL 5D7JC 5T1KA 3FFCE 4JHWH 1KPVA 1CLYL 1AI1L 3WLBA 1LILA 4QRPA 2J4WH 3CFJB 3D9AL 2X6MA 1N59A 4XBEH 5F3HB 5I17B 4M6ML 4NZTH 3P4MA 7FABL 1IQWH 1W0WB 4S2SB 1KJVA 1PQZB 2A6JB 2R0KH 2VUOA 2RFXB 3PNWB 1A02N 4ZTPL 3HNSL 3BWUC 1A7BA 5DRZA 5DJZB 5C3LD 5D1XD 4NN6C 2Y5EA 4PRNB 3BN3B 1OHQA 4TUJB 5EZOL 2XPGB 3FOLB 4ZAKA 5D93C 2VLMD 1WFOA 1N5AA 3OJMB 1ZSDA 1CICD 3N0PB 2FX9H 3JTSB 1PY4A 5D7LA 3S37X 3DIFB 5SX4H 4H1LB 3WKNA 4UIMA 3QHZH 4PJCF 4BZYA 5IM7B 1QKZL 1AFVH 2VDPL 5E0QA 3K81A 1YDPB 2Z31A 2OL3L 4HX1A 1B90A 1RUML 4JY5H 4TSAH 4ZFOA 1S7WB 3MXWL 4PJ8A 3O3EB 2RIKA 3MRKB 3EOYG 3O4LD 4L5FH 1X5AA 1XH3A 3IDMB 4QT5B 3CK0H 4RBPH 2DJSA 5EUOB 4NCC1 4OLWL 1X5KA 4YHKH 1JWSA 3JV5A 2OZ4H 3C2AH 5EUOE 1MWAA 4KKCD 3V4PH 5EU7C 5ESQB 5HVWA 4LSQL 3MCKB 4G8FA 4NJAH 4PJAA 3VRLF 5DMKB 4UV4H 5GGSB 2GKIA 2V5MA 2RJMA 4KRPC 4LF3A 4CU6A 4Z7OE 3R1GL 2P45B 2J12B 4JPKH 5TE6H 4JZJB 1CGWA 4W6YB 1CGYA 4JM2D 5D1ZB 1RZFH 4X7TB 4P46B 4X4ME 2K1MA 4XC1H 2F58L 1XR8B 3C5JB 2J6EL 4CADA 3ULUD 5J1SC 3K4ZA 4BH8A 4JY6A 3R4DA 4MA8L 3DBXA 2GEEA 1OB1A 4WU5A 3ZDZE 2PTUA 3E3QE 3O2VH 3TO2B 5CIPB 1JPFA 3I9GL 4XMPL 1RV6X 1NCDH 3DUUA 5KJRH 2P49B 2YPVH 3EIFA 4N0FB 2E7CA 1C16B 2FD6H 3QEQD 5E1HB 3EFDL 3UYOD 4K94H 2DQHH 3EJYD 3HRZA 3UDWA 3BP4A 1M1SA 1HQRA 1NAKH 3QXVA 1Q38A 1ROWA 5D1XA 3DSFL 4YNYA 4CUCA 5L88H 3LDBB 3D6GA 2YUZA 4PRIA 5K93A 4PRPE 4NO2A 3HZMB 2NLJA 5FYKH 3VW3L 3GMLB 4J3TA 2PN5A 3SDXF 3U46B 2DKMA 4P2RD 1CICA 3RWHB 1JNHA 1CL7I 3MBXL 1GOHA 1MJJA 2BHZA 1B88A 2IFFH 4RQQA 1XIWC 2A6KB 1UC6A 4OTXH 4WHTA 2VC2L 2NTFB 4LARL 5E8OA 5BRZD 1BQHA 5I6XB 4KMTH 3G6JB 3LN5B 5IESH 2PTVA 1MWAH 3G6JE 4Q0XH 3SJVB 5TF1L 2EDDA 2L7JA 1TZIA 2VDRH 4RRPA 3VWJC 2VN4A 1ES0B 3ARDD 2WZPD 4PRAA 5FYJH 1FNAA 4K94C 3UEZA 3EHBD 1C1EL 3CMGA 3F58H 4UQ3B 4ZAKC 3HI1B 4OZHE 5K9OA 1DJSA 3VXSB 1S3KL 3RTQD 4XP1H 1ZGLM 1ZT7B 1CLOL 3BPCB 5A16B 3TCLB 5GRVK 3VXSE 1WAAA 5DMGC 3NIFF 2JJTC 3PL6D 1LE5A 2DQCH 4JHZA 1I8IB 4RWYL 2GJ6D 2OSLB 1YEGL 4U1LB 2HJKA 5J12C 3MSPA 4JR9H 2YUVA 4JO3H 2J8UF 3FZUC 4UT7H 4DKEH 5JOFA 4LKCA 3OKDB 4GRLC 3RVVC 1LP9A 2XKUA 3LKPA 3TBSB 2CPCA 2XOTA 3OAUH 4X4YA 5IMOB 2X7LB 3F7QA 4K7FA 4MNHA 2XQBH 2NZIA 4JCLA 5HHQB 2UY7A 2A83A 2AV1B 4XP9L 3WFDL 4UTBL 4XP5L 3MA7B 5I1EL 2ZNXA 4K9EH 1F3RB 2EYRA 5GGTA 2MPAL 1OP9A 4ZXBD 2Q1EA 4KQ3L 1MFCH 4C56B 1QYGH 1GZQB 1J0YA 4M7ZB 4PJHA 1KPRA 4RWHA 1GYAA 1JPTH 2DLFL 4C56E 5E5MA 2VXTL 1MFDL 4OLYH 1E6OL 2Q86A 1URLA 1P4IH 3LB6D 3PDOB 4XCCL 3QUMA 4NQDD 5FFLA 4XT1C 2O5XL 3QIBD 1NL0L 3L1OL 3TBTA 4Z77B 1KCVH 2NW3B 3K1DA 2IALB 3LSOB 2WW8A 3V8CA 4V1DA 2IBZY 5FV1L 5BS0E 2MOVA 1CLCA 4Q9QL 3IJYB 3V2AR 2UY6A 1KUMA 1O0VA 5BRZA 5T1LD 3UJJH 4HT1L 4JFEB 4XAKE 3MRFB 2ICES 3TT1H 3HPJA 4JFPA 1GPOL 4JFEE 3PG2A 3WS6C 3TC9A 4YHYB 1YEHL 4G7VL 2VE6B 32C2A 5LBSH 2Q6WA 2FECI 3QI9D 3UDWC 2AQ1A 3IDXH 4HUVA 3NABH 5HYEA 4ZFFA 1EH9A 5D1XC 3PHOA 3RX8A 1MHHA 4PD4K 5C08A 3UPRB 2EDYA 5F93C 5DJDA 4X4ZA 4NWTL 5FM5O 3SE4C 1IC5L 1TQBC 2HT2D 1QFWI 2IQ9H 3D85A 4LLVB 3RTQA 4PJXB 3MROB 4UIKH 4PLOB 4Y4KA 4RFEB 1CICC 4NUGL 1MHEA 4PJXE 4FTVD 3CAFA 4JREC 2GJ6A 3QO0B 3KPRA 1JNLH 1Z6JT 4P3DA 2F53D 3A6CH 5E94B 1MCRA 5B38B 5KSBB 2NY4B 5T3XH 1Q0XH 2B1AL 2FGWH 3IDYB 3MJ8A 4H8WC 5L9DL 4HEME 4LSPH 3SQOL 5KSBE 2Y06L 4AQ1B 2IPUG 1RJCA 2OR9L 1TQCB 5JXEA 1T0NA 2RAMA 3S96B 1AQKH 4KTEH 1ZOXA 3AS1A 4PG2A 3VXMD 4G3YH 3GI8H 1RIHH 5GGTH 3NN8B 4CGTA 2WBJB 5IOPB 1DQLH 3FRPA 3JZ7A 4KKCC 4LSUL 1WZKA 4J2XA 2X1PA 4ODUA 4P9HH 3GSRA 4L4TB 4ZSOE 1K6QL 5GSVA 4L4TE 3LKQA 1OCWH 3T3PE 2X70B 4LMQI 3L3GA 4IDLA 3QUMH 1MEXH 5DC4B 5D1QB 4QRRE 5IVZA 1FZJB 1J0IA 4JM2C 2EYSA 3NPSC 2HFTA 1Z3GH 1QRKA 2FLBT 2ICCA 5IK3A 4ACPA 3PUCA 4KHXL 4GRWH 4O9HL 4PGDA 4P23A 5MEOA 4URTB 3ULUC 2QSCH 4L3EA 4ZYKB 3S6CA 4ALAH 2DQTH 1EDQA 3KG5A 5E56A 3SDCB 5J6GB 1SEBB 3FOMB 1A2YA 4K2UH 5DI8A 1QBBA 3BVNA 4XBEL 4NCC2 2MCG1 5E1AB 1HH6A 4NZTL 5CEZE 1IQWL 4JAMA 3OX8A 5JHDE 4PJFA 2R0KL 5JHLH 1F6LL 4ODBD 2WUBH 5MEPA 4M6AA 3P4NA 3LQMA 3EJYC 2DLTA 3QI9A 3O6FD 2M8XA 2NYYC 4EIGB 5EWIH 4ZG1A 2XZAH 3OGCA 5IHBA 3SDYH 5DD1H 2V5RA 3KPNA 4N68A 2JLLA 4OKVB 4L29A 3SBWC 4FN0A 4MD5B 4TUOA 1NKRA 5T3ZE 2DJ4A 4LPVA 5CJQH 1FVDA 2FX9L 2UYLB 2YPLA 2HKFH 3MNVA 2AJUL 3RAJH 2V17H 5GGVY 5D6CA 1NFDF 3HE7A 1OP5K 3TPKA 7CGTA 5IBLD 1AFVL 3SKMA 2IF7A 5JLZB 1BBJA 1W72A 3C60B 3P73A 4XNQA 3VFTB 5A2IH 3DX9A 4RGND 3JTTA 4YXHH 1UG9A 2W0FB 2F53A 2A73A 3P9LB 1JZ7A 3T77A 1R5WA 2DMKA 3GMMB 2GAZA 4QRTB 4S1RL 4WW2B 1IAOB 3CK0L 4JO4H 2P5WA 4WTZA 1YYML 5ERWA 4OZ4B 1IKFH 4YHKL 4M5YH 2OZ4L 3C2AL 2J88H 3R0NA 3V4PL 5DDHA 1KB5A 4WV1C 5C0GB 1VGEH 4JRYB 5JW3H 4JPWH 5BJTA 3ZSTA 2GSIA 2CDGA 4JRYE 3ARDC 5F8QC 3MREA 4MWFA 3EHBC 1JK8B 2PR4H 5TE6L 5L8JB 2AJZA 4ZNEA 3NIGE 5INDB 1IGTA 1UJ3C 2NZ9D 3E6HA 4GLRI 3RTQC 3N1MC 2BOBB 4Z5RB 1NMAH 1I8KB 1S9WA 2GSGB 5TFSH 3PL6C 5SV3A 2XA8H 4X80H 1AGEA 3ZDYF 2EEAA 2I07B 3DX7B 4ZS6D 3RP1A 3MV7A 1OT1A 1MQKH 2XXCB 3O2VL 2DTSA 1Q9LB 3KDMA 1F4AA 1ZXQA 1VACA 1NEUA 3HS0B 4M61B 3SDAB 5HHXL 1UM4L 4PG2C 1NCDL 1J5OL 3D48R 4N5ED 2CUMA 2FSEA 2YPVL 1BWMA 1G7IA 4CN4A 2FD6L 1WV7T 2HT4D 4OCRH 3UAJD 3CDCA 5FHAL 1AD0A 1SEQH 4K94L 1U3ZA 2DQHL 1FDLL 1N0LA 4XPHH 3DI3B 3LN4B 1RFDL 2AW2A 4QOKB 1NAKL 2C3HA 1P69B 1CI5A 4FQ1H 3F6LA 1HYSD 4ZXBC 3O6FA 4QOKE 2I9LB 5KOVC 3IXAB 4R3SA 2AV7A 4QHLA 3WIHA 1JYVA 4LNRA 4YK4B 5FYKL 2YD3A 2VKWA 4Z0BL 1LE9A 4IOSD 1W72H 3G5YA 1HHHB 3LB6C 5HYJA 4ZFOL 3QIBC 4RAVA 1FLTX 2NY0B 3AXLB 1UM5H 3W9DB 5H2BB 5EO0A 4NQCD 1QHOA 5JA9A 1FYTB 4ZPTB 1Q1JH 3VH8G 1FFOB 3VXNB 1R3HB 2YUWA 4PJBB 5IESL 5FCUH 1BVKA 1MWAL 1KB5H 3QUXD 1YEEH 2LTQB 4PJBE 3MLYH 5DJCA 4LVNC 5IT2H 1V3JA 5EU6D 4GAJH 1JGLH 4JFXB 2OYPA 2BNRE 4NBZB 1YY9D 1MY7A 3AY4C 3QI9C 2ITDA 1Z0NA 1S7TB 3B8YA 4O51A 2W9EH 2OLDA 4M62H 5FYJL 2OMBA 3OR6B 1VEMA 3QQ4B 4L8CA 2ORBL 3GFUA 3F58L 3QUZD 5ENWA 4P4KA 3PWJA 2EKSB 3RU8H 2VR9A 4HUKB 2R8SL 3QIWD 4GS7C 5IG7B 3EO0B 2H26A 2VXVH 2BY0A 1V3LA 1NJ9B 2HT2C 3QRGL 4RA3A 2DQCL 1F4WH 1Y18A 5B8CC 4U1HA 3EOTH 3V4VL 3CVHL 3MRDA 3L7EA 3V6OE 1CG9B 1WICA 2HFGL 2HWZH 1MJUH 4JO3L 3WHXB 1U9KA 1T1ZB 3PWPE 4KC3B 1I1FA 4DKEL 3UBXB 1EAJA 4M9PA 4OCSH 5B22A 3C08L 1L6ZA 1XF5A 2ZKHH 2YSSA 3ZE2E 1WBXA 2VZUA 5EUKB 4CJ1A 4MJ6B 3OAUL 3OKNA 3DX6B 1FCCA 2XQBL 2P4AB 1YUHB 3EO1A 1EJ6A 4K9EL 5CMAA 2NX5D 4YFLF 4KVNL 2ITCB 4JFZH 2UUDK 3MYJB 1TVHA 4LRNH 3QBTB 1T4KB 1QYGL 4NP4L 3KYMA 2VDOH 2AK4B 5DEGB 2HFEB 2ATKA 2DI7A 4OLYL 3ZDXE 3NACH 2BMKA 1DBKL 2AK4E 1P4IL 1TJGH 1S7XA 4XAWH 5F3BA 5JZ7D 1DSFL 5FHBL 5AD0B 1NCAL 2I26N 4YQXL 1R5VA 4RX4D 1E4WH 4H8WL 4KQ4H 1SJEB 4JZOB 2VDQH 3MA9H 3VRIB 1WK0A 4JHAH 1HXYA 2AXGA 5IMLA 1IGFH 3U9PL 5I1DB 2OTUA 1UYWL 3IGAA 3BQUA 4C54A 3MCLH 2IPTL 3UJJL 3EJJX 1WZ1H 3DECA 4JFHD 2BK8A 3MRPB 3Q5OA 3QUXA 4NO0A 5I8KH 4XPGH 1OAUH 5C0FA 3VFPA 4NGHH 5LBSL 5EU6A 3NH7H 4X6BA 2D9QB 5H37G 4JFDD 3FQWA 1GHFL 2Y23A 3O6FC 2YR3A 4GKZA 4NNYA 3WJLA 4Y7MA 1U93A 3QUZA 5CINH 4JG1H 1IFHL 3WBDA 3H6JA 4PTUA 4XBGB 3WFHA 2P24A 3MUY1 1C5CL 2IQ9L 4TUKH 3ULUL 4KVCH 5EOTA 1ZA3A 5IFHH 4HCRL 2ESVB 3ORJA 5ECJE 4KROD 5IBLC 1PG7W 1FLRH 1EVTC 2ESVE 1JNLL 4MNQB 5ACZB 4PREA 1RHFA 3NCYS 4RGNC 4LSPL 4MNQE 5IVXB 2XWTB 4AT6B 1NGYB 4NT6B 3WL9A 4AL8L 4N9GA 1MCWW 4MA1B 3NPZB 3QQ9D 4E0RB 2BC4A 1IGIL 3GI8L 2D31B 1RIHL 3RNQB 5GGTL 3FB6A 5CBEA 5C0AB 2HG5B 1NSNL 4DKFH 5C0AE 3BZ4A 5CHNB 5ALBL 5J06A 1G7QB 3IXTB 5IB1B 4XVTH 4R7NB 1OCWL 4F9LA 5DJYB 3CFKB 3CSYA 4G7YH 1S5IL 2VNCA 3QUML 5D7SH 2BY1A 3G6AB 1BFOB 1MAMH 2NZ9C 4QNPE 1FO0A 1LVEA 1U8NA 4MCYA 5CSGA 5FV2A 5CGTA 5DHYA 3WFBH 4I77H 2QSCL 3KPPA 2V2WB 3G04A 4WFGD 2WINA 2K7PA 4RX4A 4UDTB 5GGSY 2OTPA 4MXVE 3BESR 4ZS6C 1EUTA 5DT1L 4KWUA 2X4SA 3IFPA 4K2UL 3UTPD 3Q6FB 5JIKA 1MFAH 3FAXA 5DK3A 2MQ0A 3FQRB 4LCUB 3ZKND 1HILB 1T2QH 4N5EC 1JYWA 3AU1B 2C26A 2NY1B 2HT4C 3JV6A 1ORQA 2WUBL 3QWRD 3UAJC 4C83B 3GJEB 1IKNA 2GK0B 3ULUF 1MI5A 1NLBH 3ARBD 2UWEB 2XZAL 1R3LB 1HYSC 5DD1L 4U1JA 1NBZB 5C9JA 1LHZA 2ZUWA 4EKXA 4PB9H 4EI5D 4U6HB 3B9KD 3WJJA 4RSVA 5CJQL 5DUBB 5IEHA 1FYHB 1MRCH 2HKFL 3CC5B 4I4WA 2V17L 1KCKA 2HN7A 3EDDA 2FX8L 1TFHA 5FGBA 3RL2B 3RPIB 2EE3A 2ZG1A 4X99B 3VFRA 2X4QB 1HYRC 3RDTD 1IC1A 3BWAA 1MIMH 2VLRB 4RFOH 4HF5H 1JWUA 1NC2A 5ESVB 5C09D 2VLRE 4I0PB 5F21B 1NKOA 3C5ZA 1IKFL 3QUXC 1QQDA 4LCWA 4PJEB 5EOCH 3NA9L 5KSUB 1K4DA 1PW3A 3VMPA 1VGEL 1NBVH 5FECA 2FX7L 3MNWB 4PJEE 4F8QA 2GJZB 3D5OF 1MF2H 4NC0B 4QTHA 1QA9B 5E00A 2BSRA 5DJ6B 1IM9A 5L2KA 5CGYD 2I9TB 3C6SB 1FO0H 5AG8A 3FB5B 5H94A 1I1YB 3QUZC 3CX5J 4LCCC 4NUJB 2QHLA 3QIWC 1MY5A 4KU1A 5DJ0A 1G0XA 1J0JA 4PJIF 1MCKA 3MMEA 5GS3A 1NMAL 5TFSL 3TIEB 5GSRA 4XI5D 4FFZL 5DZLA 1CIDA 1NUDA 2XA8L 4GG6B 5GS2D 5HGGS 2F8OA 4NRYA 5EIQA 3C8KB 1I1AA 4MNGA 4U1KA 4GG6E 2V7HB 4Q9BA 4YZFE 4HG4K 3V0VA 3U36A 2FJFA 4N5UA 5I9QB 3WSQH 4F15C 5DFVD 1YEKH 3D1MC 5HD8D 2JJSA 2Q76B 2Y9RT 5I8CB 2BJML 1YN6B 1N64H 1A6TB 2P5EB 1NFIA 1PZ5B 1O5DT 1KJ2A 4U1SB 4NDMB 2P5EE 4PGZA 3S88H 1JL8A 5DYOA 1D5BB 4OCRL 5D7JB 4XP6L 4ZO7A 4OZIB 1K3ZA 4KUCD 1ZA6A 3PQYD 3RY6A 1K4CB 2DQFA 4J3UA 4XPHL 2DM2A 4OZIE 4UOJA 4IDJL 3EZ8A 4UI2A 1ZTXH 1D9KA 1VERA 3SKNA 2ICWI 5DFWH 1KXQE 4PY7A 4X7DC 1U8JB 2Y7QA 4J23A 3IJSA 3DPBA 1W72L 4XCNA 1RZGB 5K59F 5JZ7C 4LHUB 3D0VB 2VLJD 4XWGL 4Z6AT 4ZMAT 2X4PB 2D2OA 1MCOH 4MXWH 4Y5YA 4NM4H 1OGTB 4KI5E 4Z7VA 1H3GA 2W0LA 5C0RL 4AQOA 4MDIB 2JB6A 2MHAA 4RZCA 4RFNC 5HHMB 1Q9OB 1P7QB 2LQRA 3PWLA 1A1MA 1YEEL 2NR6D 3LV3B 5HHME 3STLB 5D96B 4P5KB 2NMSA 4GAJL 1JGLL 4FQ2H 1T6VN 2PYEA 4LFHD 3GSUB 3P4OA 1TPXC 2JCCF 4IRJB 3MRHA 4GRMB 2W9EL 4M62L 3OB0H 3CFDB 3OZ9H 3PJSB 2D9CA 3MR9A 3RU8L 4OI8A 1IEHA 2GUOA 4E5XA 4XPFH 1DUYB 3X11B 4X9BA 1T3FA 1RPQA 4WGVB 5TDOA 1UB6A 5EU7E 2E7LC 5C07B 4L9LC 2WIMA 3ES6B 5D2LF 2JIXD 1PY9A 4KROC 1M6OA 1C12B 2HWZL 5C07E 1PFCA 15C8H 3R06B 2OTWA 1KJ2H 1R3IL 4X5WA 2PUQT 4OD1H 1FP5A 1U6AH 4YDLC 4WGWB 1ODAA 3O3DA 4DK6A 1T7XA 4EI6A 4D3CL 3KPTA 5C0BB 4LLQA 3BUTA 3I6GB 1OM3H 3QQ9C 5JW5A 4TTDD 3U0TB 5C0BE 4UINH 2DYPD 3VWKA 2J1KA 2X44D 3STBA 4GOSA 5EO9B 3PQYA 4HS6A 3F5WA 4AG4H 2GQHA 3MLSL 4X6FB 5IW6B 3WIHL 4JFZL 1AKJB 1FSKC 4LRNL 1K3IA 1KELH 3MRCA 1CDUA 1DQDH 3TVMA 3G5ZA 3NACL 3E6FA 1LEIB 1T89C 4UBDD 1TJGL 4BZ2L 2D7PA 3CU7A 3EAKA 3SKUD 2BVQA 2WNGA 3X14B 1LEGA 1MCEA 1E4WL 1I1AC 5J57B 3SPVA 2OR7A 3LEYH 1KN2L 5CFHA 2VDQL 4U6YB 3BKYH 5GJTH 1JHLL 4JHAL 5J11B 3D25A 2XN9B 2IQAA 5GQBA 1T03L 5HVGB 1HI6B 2DOCA 1WZ1L 4M8VA 4TSCH 2C3VA 4QHKI 2XN9E 4LSDA 2Y4SA 2VH5H 3CNKA 2Z92A 3RBGA 3ZKNC 4XPGL 4NM8L 5T1KB 5ID0A 1FNHA 1WFUA 4UILH 3RY6C 1M05A 3WLBB 3NH7L 4J1UA 3CDYA 1OY3B 1KULA 1PBYA 2MQCA 4IRSA 1QSFD 4HFUL 1N59B 4QRPE 1KTLB 4CN6A 1NDMA 3ARBC 3SCMB 3QPQD 5I30L 2ZSVA 3P4MB 4LFHG 5CINL 3K3QA 3RUGF 4QYOA 4U7SA 4NOBA 4G5ZH 4JLRA 4HC1A 4EI5C 3B9KC 4KVCL 4JDZA 3RJQB 5JNYA 3ZT5A 5IHUH 1YY8A 1EHAA 5DRZB 1CTOA 5IHZA 3RWDA 4LRIC 4XPTH 1Z2KA 2NCMA 4KK5D 3RDTC 5HDBF 1XR9A 3UZVB 1ZSDB 1JFQH 2E6QA 5F44A 2B0SH 4UUJA 5D7LB 3QG7H 4UIMB 3PV6A 1K85A 5EZLB 5D7LE 2Z31B 1CL7H 5J12B 1RZJH 4HX1B 2BHYA 5FYKE 1KF9B 2DYPA 1PLGH 2GCYA 4KJYA 3RY4A 4ZFOB 4DKFL 2R69H 3BKMH 4P2CG 3CZJA 4PJ8B 3DI2B 1QSED 3O9WD 4L4VD 1XH3B 3T0WA 3DJ9A 1KSRA 3RGHA 5CGYC 5EZJA 5D7SL 1CDGA 4I3SH 3WNLA 1JWSB 1MAML 1MWAB 5FDYA 4LP4A 4G8FB 2YD8A 4PJAB 1CD9B 1OGAD 1HWGB 3RWJA 1HQ4A 5CJ8A 1JZ8A 4XI5C 4MGXA 5DUPH 3LD8B 4I77L 4K3DL 4LF3B 1FPTL 1RQ5A 1VSCA 4G8GA 2EO9A 1I8MA 4NZDA 5TPWL 4JFFA 5ACLA 3QDMD 4TQEL 5DFVC 1MFAL 5HD8C 5FYJE 5MEQA 5FGCB 4XCEA 3QIUD 3OSKA 4CADB 2AJVH 3RKDD 5FGCE 5LGHH 4BH8B 4JY6B 3DBXB 1CQKA 3CLEH 4WHYH 1OB1B 4LDEB 1J87A 4WU5B 3HR6A 4MHHI 5J9PA 1JPFB 2R2BA 3T3ME 4HC1H 1AXSA 3DUUB 3KYOA 4U6TA 2FLRT 4PB9L 4G8EA 3VG9B 1KLGA 1EIBA 2X89D 3MV01 3HRZB 4B5EA 1BFVH 3BP4B 4X8XA 4XXDA 1HQRB 2CUHA 2VJXA 5E24E 5D1XB 3RZCD 4U1NA 3K2MC 4YNYB 4U1MA 3H3PH 4CRPA 3OAZH 4EUPG 3LQZA 4PRIB 4NO2B 2YZ1A 2CD0A 1J05A 3IT8D 3BN9D 4ONOA 4O58L 1RUAL 1CICB 2NR6C 5HTSA 1JNHB 4HKJA 1EO7A 3D18A 5DEFA 1JI2A 1MJJB 5F9JB 2HJFB 4RQQB 1OTTD 4WHTB 4JREB 3E2HC 4GBXA 5GS1A 5EA0H 3MLUL 1BQHB 3LMJL 3OKKA 5B3JF 3BYYA 4D8PA 4FQXA 4JO2L 3G08A 1OTUD 1BJ1H 2AS5M 4JQVC 4XMLL 2VDMH 5D7IF 2OMNA 4HZAA 4NOFA 3B6SA 4KAQH 2DQIL 4Q74A 5KSAD 4RGOH 4MYWB 3CPLA 1TZIB 1SBSL 4XCYA 3KYNA 2YD2A 1UA6H 4PRAB 5CBAB 4ODHH 5CJBA 1MHCA 1X5GA 5K9OB 5D9SA 2BVYA 1MCPL 1RUQL 1YEKL 3DXAD 5DLMH 3EYQD 4OF8A 5C0JA 2CRYA 4ENED 5GGRA 1QPXA 5IBTH 1LE5B 3L3OA 4R2GD 2BZDA 1QFWH 1J88A 1WAAE 3C9NA 4TTDC 4WO4D 3WEXA 4MJ5A 6FABH 3BRDA 5FO8A 3WXVH 5IVXF 3O41A 3LRHA 4FZ8H 5JOFB 4N8CH 4LKCB 1ZTXL 4U33A 2OP4L 2QL1A 1JNNH 1I85C 1LP9B 4KI1A 4WFHD 3LKPB 2P43B 4X4YB 3LKRA 3T0AA 4K7FB 1BQSA 3NFPB 4MNHB 4HH8A 1FL3A 2LU7A 4HLZH 2A83B 2X89A 4P2QD 3V8OA 3QEQE 2EYRB 5E7FA 1MCOL 2D0GA 3OKYA 4MXWL 2FYYA 4NM4L 4UTAH 2FZ3A 2GITA 1DBJL 4PJHB 1KPRB 2YD1A 3H9SA 1QBLH 5E5MB 4PJHE 2Q86B 3QUMB 1SY6A 2EE2A 3TBTB 1AC6A 3S3SA 4CVWA 3ZTNH 4MA7H 4FQ2L 4X4XA 1GAFH 4V1DB 2FHCA 4GRWB 4X5XA 4NZUH 4PRDA 4TNVF 3VD3A 2WBKA 4H26A 4LP5A 1J1PL 3OZ9L 4GRWE 4Y8DC 4CNIB 3HMXA 3CX5K 3HPJB 3MBEB 3QPQC 4JFPB 5BRZE 4CAGA 4JRXD 4XPFL 4OCNC 5HPMA 2VXSH 4H0IA 5KSAA 32C2B 2Q6WB 3FN3A 5EBGA 3ISWA 4MD4A 4ODVL 1RJLA 4M4RA 2UWEF 4HUVB 3G9AB 3HZYA 4ZFFB 1GC1H 3PHOB 3QJFA 4R4BA 1MHHB 3ARTA 5C08B 4DUWA 2R23A 4LSTL 1KJ2L 4HDIA 4OD1L 4QXGH 4CVUA 1U6AL 5DJDB 3TYGH 5C08E 2KH2B 5CUSH 3D85B 1YMMA 2IANA 4Y4KB 1A3QA 3LS5L 3GBLA 2VZOA 5DJ2A 4UINL 4LLWA 5ELIA 3KPRB 2R0LL 4P3DB 3I84A 3OKMA 5GS1C 5JOEA 3MJ8B 3MJ6A 2GJ6E 3KPRE 4BUHA 4FQXC 2AJSL 3QEHA 1FNSH 3O9WC 3TNNA 4FQIL 1KELL 3D3VA 1AGBB 1DQDL 1T0NB 3T2PA 4EDXA 1HNGA 4RMSA 1EFXD 1ERNA 1UT9A 2JB5L 3B83A 2NY6D 4ODUB 4A6YA 3UJIH 3GSRB 1CBVH 2YUXA 3A67H 5C3TA 5GSVB 2EIZA 3LKQB 5HGDA 1QLEL 3BKYL 3HE6A 3L3GB 3QCUH 5E9DD 2VAJA 1I3VA 5D5MB 2AEQL 1GC1C 3GSNL 1SY6H 1MUJA 3GIVA 3W2DH 2OI9B 4APQD 3DWTA 4LL9A 4AEIL 1ZLUH 2EYSB 2GY7B 4GLRH 2E8ZA 4Y1AA 5IK3B 2VH5L 2PKDA 2DLGA 4PGDB 4P23B 5MEOB 3RKDC 3WFZA 1P6FA 4L3EB 4M3JA 2BVUA 5I8EA 4NQDE 5FKAA 2WSKA 4L3EE 4HXBL 4OM0H 2G9HA 1A2YB 5I0ZA 5DI8B 1B4RA 3FO2A 1OW0C 3BVNB 3VXOA