3LDBC

Structure of jmjd6 complexd with alpha-ketoglutarate and fab fragment.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
210
Chain Sequence
QIQLQESGPGLVTPSQSLTLTCSVTGDSITSYHWSWIRQFPGKKLEWMGYIYNSGGTDYNPSLKSRVSITREISRNQLFLQLNSVTTEDTATYYCARRDYGTYYFDYWGQGTMVTVSSATTTAPSVYPLAPNTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional arginine demethylase and lysyl-hydroxylase JMJD
publication title Interaction of JMJD6 with single-stranded RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ldbC01
3MLVH 2D31A 4QEGA 2G5BB 3EAKA 1FYTD 1MF2L 3LVEA 2ZCLL 1CDIA 1PEZA 2XWBB 1J0YA 4NSKB 4H0IA 2VXUL 4OKVA 2X5PA 3H9HB 4JRYA 1UM4L 3RZCB 5HGBA 2ZUUA 3C6LB 5E6IA 43CAA 3MYJB 4LPXA 2EE6A 5H2BB 3KYKL 4PRHE 3IVKA 6FABL 4P23A 3SKJL 4S1DC 4HKJB 4P4KA 1R3HB 5F21B 3LOWA 1UWEH 3VXTA 3O9WC 3QDGB 3B83A 2FR4A 3FQUA 1ZK9A 2YS4A 4JPWL 2PW2A 4UIKL 4Z7QE 1RUPH 4F15B 1HQRB 4XNZC 1OSZB 1PJ9A 4HLZH 1EEQA 4TNVK 2NNAB 4RMRA 3EDFA 1MVUB 1D9KA 4OLUL 1OY3B 5FHAH 2H32B 4BFIA 1JL8A 1JTOA 3AB0B 4X99A 3UJTL 4KUCF 4OV5A 1A6UL 5J0BA 4AL8H 1LO3H 1MJUL 4X98A 1QVOA 1S9YA 2V9TA 3GO1L 3ARRA 5F7YC 1N0XL 2EXYD 1PX4A 3BFOA 4XMKL 4JFOB 1J05A 4JFHD 4OD3L 3ZZ1A 5ETUB 2HLFD 3ELAT 1XH3A 5F7DB 1UEMA 4U7KA 4LLVA 5FYLD 3INUH 4G42B 5FGRA 4BSVB 4LCCB 1RD6A 2JJVA 2OZ4A 2JTDA 5E94A 4G8FA 4R3SB 5DMKB 4G8GB 2H26A 2WWKO 1QFOA 1I9EA 4NRZB 1T2QH 4BZYA 3HNTL 4XP9L 3MRMB 1I3UA 1YMMB 4GMTH 4RNRB 2DBLL 2WIIA 4JY6A 4MNGA 1CXHA 1A5FH 2EDOA 3SE4C 4M3JA 5EZLA 3OB0H 4FQXC 4JFDB 4AG4H 1NFIB 4G9DB 4F3FA 4JAMB 2WM0A 2ORBH 3ARTA 1K8DB 3PGCB 3SGJA 1CL7H 1JGEA 4NPYB 2J1KA 5IFHH 3LD8B 4FFWC 4CU6A 1HHGA 3VRIA 5EOCH 5FUCC 1NANH 1T5XB 2QSTA 4LFHD 5TQ2H 3RVXC 2J7LA 2X44D 5FECA 1JPGA 1IT9L 3B9KC 5LGHH 2FGWH 4BJLA 1NBYB 3E3QC 3FFCE 1KIUA 1J0KA 5D70H 2VDLH 2KZWA 2N7BA 4LVOB 4AMKL 4N0CC 2BVEA 1YYMH 3M1BB 3IKKA 3QRGL 4PJDE 1TZHA 2PR4L 5EC1B 1KG0A 4FQHA 5T1DH 4RAUA 3GBMH 2JCCA 2LQRA 1R3IH 2PO6B 3HG1D 5LGJA 4KTDL 4A6YH 5E99L 3TO4A 1JUFB 4H0GA 5JZ7C 4QKXB 3VD5A 4X6CA 3L3KB 3TPUA 1TTFA 4LSUH 5KSUA 2QTEA 5IHZB 1MVFA 3ZKXB 1RIHL 2OX5A 2WMPA 5I6XB 4PJ7A 1ZGLM 2CLZB 5BOZG 4LLYB 3BDYL 3JZ7A 1GOGA 3ROOB 3PWUA 2AK4A 3RVWC 4I13B 4GS7C 3LH2H 3SGKC 3F7VA 3MRRB 5IMOA 1FNGA 5GS3A 3R0MA 1X5GA 2AXGA 3I50L 5DWUH 4OJFH 4WEBH 1A8JH 5TE6H 2EIBA 5E0QA 2L7UA 1J1XH 2NY1C 1G9NH 3T4AB 5D7IA 2B8OT 3FQTB 4PV8B 4X0KB 3PWVB 1MLBB 4DQOH 3ARPA 4M7LL 5E5UB 4MJIA 4I3RL 3PDDA 1YEJH 5DQJA 1J88A 4NFBA 3WKML 4DGIH 2C3VA 4JKWA 4B41A 4PGDB 2FX7L 5FK9B 5C0CB 1JNHA 1V3LA 2XY1A 4MJ2A 3TVMD 1AR2A 43C9A 3GRWA 4YFDB 5IWLC 4ZO8A 1YMHB 1N8ZB 1NCCL 3K8MA 3PDGA 3L3OB 5GS1B 2AJXH 1UH4A 2BCKA 4O51B 1OQXA 4KKBC 4FN0A 4WENB 4FZ8H 3RDTB 2OL3B 3MYZA 3QB7C 5DJ2B 1TZGL 4ZQKB 3QNYB 2ZOKB 1UA6H 4G6FD 1EX0A 4QRRD 2BHYA 1A1OA 4PFEA 5TDOA 5EZOL 3ROLB 5IM7A 1DVFB 4LLMB 4GRLA 1AR1D 5E70A 2A6JA 3P77A 4WWKD 1OCWL 3HAEA 4W4NA 3CFEA 4XCFL 4UTBH 1AKJB 1NC2B 3HLAA 2CLRA 3MMEA 5IEKB 3MA7B 4M00A 3PG2A 5FYLL 2X42A 4YH6A 3HC3H 1TIUA 5I30L 1RZ8B 2YSSB 3DECA 5CEZD 5KZCB 4M8QA 4YBQC 1CICC 1MFAH 4Y2DB 4Y4KB 5BJTA 2EC9T 5DD6B 3WNOA 2VXQL 1EH9A 1NGWB 4KROD 4N0UA 5I15H 4L4VB 4MQXC 1KIRB 5I75C 2F54E 3MRKA 1K4CA 3ARXA 1XR9B 4X6DB 3WHE1 2NXZC 5JW4M 2VZ3A 4FQCH 2W60A 5I73B 1FP5A 4BM7A 3QEQA 1U8OB 1J8HA 4HWBA 2I5YL 4JPIB 1FPTH 2QSQA 5C0BD 3W0WA 4YJZL 4CADB 5HHPA 3VA2C 4Z7WF 5FM5M 3VFUB 1A14H 3T65A 1QBLH 1DQTA 5FDYA 3RKPA 3L6FA 3IFNL 3LIZL 4QOKA 5CJOH 2ZKHL 5EBMA 1X5KA 3DBXB 3TBWB 3S5LA 1I9IH 5MP6H 5HHQA 3W39B 5CLWA 4GW1B 1KNOA 3SQBA 1AD0A 2CKBL 4O2EA 3VRJA 1HN1A 4YO0A 4PTTB 1IAIH 4RGNC 2FEEI 3VMOA 4RAVA 3FOLA 1I8LC 1MI5A 1UB6B 1TVHA 5IMLA 5IR1B 1LNUA 3QIBB 3PL6D 2GAZB 3BJ91 4Y5VB 1PKQB 4P2OC 3MGTB 4L29A 5GGUA 2BNUA 3FT4B 1WBZA 4QRPB 5KVMC 1JHKL 2ITDA 5GIRA 1AC6A 4GAJL 1A4JB 5DEFB 4EOWH 2NY2B 1GZQB 1VGEL 3TIEA 1JGLH 1IILE 3REVB 1A6TA 1MY7A 4M6MH 4HIXL 4ZYKB 4PBWD 2EYTA 1ZMYA 4JFEB 3UZEA 1H15A 3LS5L 4NZDA 3CX5J 3W2DL 5IVXB 2GTWA 4J4PA 2BJML 4HS8H 4Y4HD 4UDUA 5IFAL 2OMNA 2IQAB 1P6FA 4MJ6B 1RIUH 1OAKL 2R4RL 2XPGB 1EXUA 3BO8B 3O8XD 5JO5A 2J6EA 4G5ZL 1ZA6A 4RA0C 5TE4L 1A3LH 2VLJA 3AREB 3QDJB 5L8LB 4NN7B 1OTTC 1WT5C 3WEXA 1W0YT 2X09A 3MRDA 5DYOA 5E6IC 2JKXA 2ZWLT 4JO3H 1JWSA 4KZDH 1V7NH 4U1GB 5FOJA 4Y5XC 1MCRA 3ZKND 3VG0L 1BFOA 5DK3A 4QHUA 4RMVA 4FRWA 4U1SB 3WL9B 1F4WL 4KVCH 3KPSA 2CR3A 1JNNH 2Q86B 5JW4R 3TA3C 5BS0D 1HHJB 4ZNCD 4Z7VA 3QCUH 4JKMA 2OQJA 4Q2ZA 4UUJA 5ELIA 2Y4SA 2E9BA 2CR6A 3SKOA 1OSZA 5F8RC 4I77H 4B53A 4Q7DA 2OK0L 4YGVA 5JORA 4HWEL 4EXPX 1XGTB 1UCTA 4LVEA 4KGLA 5EU3A 1DN0B 2BRRL 2EKSB 1UH2A 4HD9A 2OJEA 4JVWA 1BQLL 1GGCL 4MA7L 5H35B 8CGTA 4GBXD 3Q6GL 4WI3A 2VZOA 4JLRA 4U6YB 1A4KB 3M45A 4GAYB 2X05A 3E8UL 3I6LD 5FXCH 3JWDL 2IAMA 4HT1H 3VE0B 4XPFH 3EIFA 1RJYA 4PJ8C 5CEZL 4MA8H 3T1FB 2ENYA 4ODHL 3GSVA 3X11A 4Z7WE 5LVEA 2ICEA 4BH8A 3L9RA 1EVTC 5F9DC 2P48B 2ADIB 2R1WA 4QRTA 3PP4L 4F7PB 3R06A 4AK1A 5DMYA 4OF6A 1FNSH 3RL1B 1CZ8H 3VU2A 1BQSA 1RV6X 5FYKE 3CFIC 4APQC 3UYOD 5CEXB 4M43L 1IKNA 1Q94A 1RZFH 1BJMA 1N64L 1OTUD 5I1KH 4XC1H 2BMKA 4HW6A 4J1UB 5JHLH 4F7CB 3ZMRA 1KF9B 4DGVH 2EDDA 3CAFA 4XH2B 4N1EA 4L9DA 3EYSH 5D1QD 3O4LB 3U0WH 3O6LL 5D7LE 3CFBB 4UMGA 4Y88A 4YDVA 4JJHA 5BQ7A 1B4JL 2HTKD 2ENSA 3KLAB 3MNWB 1RK0A 3FCTB 1BM3L 3O4OC 1M7DB 5FYJE 4NQXB 1BGXH 3WIFB 2GJ6A 1IBGH 1FNEB 1J1OL 2R29L 3LEXB 1CGUA 4HUXA 1RY7B 4QYOB 5K9JL 3OKDA 4K3DH 3BKCL 2C3HA 4HS3A 5CBEA 1CFTA 1SYVB 5I8CA 1PSKL 3D3VB 1CYGA 4LPWA 2FH6A 4E5XB 3TNMB 4M7LT 3VD7A 4HCRA 2HJFA 2D7PA 3N1QC 1SM3H 2PO6A 1OW0A 3QI9D 1ZHBB 4FXKB 3VXUA 1W0VA 4YGAB 3NCJH 2AJ3B 5CZVH 4H1LA 3SKNB 5CGYC 4FQQB 3LKQB 1P4IL 5INDB 5C2BH 3QEHB 3HS0A 1JTPA 1QSEB 4E0RA 1C5BH 3OR7B 3F6IA 3QXUA 4HXBL 1T1ZA 2CUMA 2ILLA 1C5DB 4M7ZB 4YC2B 1MH5A 4U4BA 1Y6KR 3MXWH 5DQDH 1ZE3C 1FO0L 3EO9L 3C60B 3BIAX 2XRAH 4JZOA 5HY9B 5I66A 1KIPB 3WNKA 5AZ2L 5AG8A 4NWUH 4DN3L 4FHBD 3K4AA 1Y0LB 5IB1B 1Q9OA 4JG1H 4PJBE 4PJFB 1K8IB 4H25B 1S7UB 1YEIH 1A0QH 2O26U 3RNKB 2NPLX 4N1HB 5I19L 1F6LL 3SGDI 4EI5D 1I3RA 4LCWA 3T2QA 4OGAD 3MJ6A 5DHXB 4ZXBC 5B38A 1QKZH 5C0GB 3IDNB 1DBBH 3ZTNH 3MJ8A 2FRGP 1G9MH 3P0GB 2FSEB 4I4WA 5GS0L 3GSQB 4DJMA 4A6YB 1ITCA 3FRUA 3BPLC 1HXYB 3U2SB 2CXKA 4MAYD 2Q20A 4YHOL 4WO4A 1ADQH 4WW1B 2ZUQB 3U79A 1F2XK 2UUDK 2EC8A 4LQFH 4K3HA 5CJXC 4ZS6C 4QHKI 5T3XE 5DUBB 3L3OA 1YEKL 2WUBH 4JQVA 3PWPB 3KLSA 1YEDB 3EJYD 2FIRT 1NUGA 2V2XA 3V5DA 3ZO0A 3FRPA 1BJ1H 1XF4B 3IS0X 3QQNA 2VLRA 4XHQA 2EEBA 1XZ0A 2G75A 3BT2H 3ZDXF 4TSBL 5T1KA 1KOAA 4JY4A 4CN6A 5KVGH 3R4DA 1WLHA 1JFQH 4MLSA 3ROLA 4XP4L 3FB5B 1EBAA 4UI2A 3QNXA 4NM8H 4ZTOH 4LLMA 4RMUA 3BAEH 4NO5A 4RZCB 4D0BA 4PB9L 2R2EA 3O3EB 2KZ1B 4XHJD 2P5WE 5T33L 5CCKL 1OGAD 1U41A 1G6VK 3MV8E 1G7JA 3WIHH 4KXZH 3SOBH 4KDWA 3RL2A 1NLBL 3KLHC 5SWSB 2JIXD 4KMTH 4WUUB 4YBHA 4PG9B 2ATPA 4ELMA 4HC1H 4Y2DA 3VWKB 1GCFA 3VWJB 5KAQG 1CGYA 3BW9A 3M17A 5EOTB 2DWEA 2NY3D 1D5MA 1Q0XL 1RJZA 3IDUA 2NY0D 2VQTA 4LEOA 2EEDA 4NQSB 3HB3C 2Y07H 4ODSL 1EEUA 4Z78A 3VXRE 2NXYD 5JXAL 1WEJL 1MHCB 4YXLL 4Z95H 2YUXA 2WNGA 2D4DA 3BSZH 4OFVA 3O2VH 1RVFL 1BOYA 2AJYL 3DGGA 1G7IA 5I17B 3E6HB 4XWGL 5D2NB 4P3CH 1INEL 5ITFA 1GC1L 5H94A 4DKDC 4K3GA 1K4DA 4FQ1L 4PJCF 2PYEB 2P5EE 1FE8H 4XBGA 3HNSL 4WI8A 3GNMH 4FFVC 1A6AB 4KMLB 2EH8L 3V4VH 2GJZB 2MQ3A 4JJ5A 4KJYA 2F9BT 4MVBD 5EU6A 3S88L 2ZZUT 1QRNE 1JK8B 3E6FB 2GITB 1AHWB 2ARJA 4TRPL 4W6YB 3RHWK 1W72H 4OLVH 2BX5A 4LNRA 1OGTB 4UV4H 1UB6A 4OTXL 1S9WB 4MXQC 4UQ3A 4GH7B 1VENA 2UZIL 5DJYB 3M8OH 2QV2A 5C0JB 4Y5VA 2EO1A 3L3GB 5DVMA 5DMIL 3RA7L 1KPVB 3VXMB 2AJZB 1I75A 1UZ8B 1FZOA 3QA3A 2DIBA 5TGBA 3B43A 1P4BL 5FB8A 5IW1A 1A4JA 1VB9A 5D7JD 5CLTA 5GGSA 3VXSA 3S37H 1NKRA 1R5IB 3GUTB 4KTYA 4TULH 1HOCB 4GUPB 4O5LH 5D2LA 5DRZA 1Q1JL 1HH9B 4S1QL 4QXUL 1PVHA 2CGRH 4M62L 4PJEB 3V6FA 3C5ZC 3D25A 3L7FB 5HPOA 3IDGB 2VXSH 4KAQH 4M93B 3NZHL 4LU5H 2GJJA 1OL0A 4X4YA 3HMWH 1YEEL 3LZFH 3QJHB 1AXTL 2XPGA 1OB1B 4YX2L 4PLKD 3NFPB 3C2SA 3MBED 1YUHB 2XQBH 4BFBD 3DYMA 4NKDA 2EDQA 3V8OA 3KWWB 3HE6D 1I8MA 1JF1A 3ZDXE 4H88L 5JA8B 3BP7B 4I0CC 3O6FC 3GIZL 4RFEB 3ZT7A 1MJJB 1Z3GL 1YNTA 1F11A 1QLRA 2MQ0A 4EIZC 1LE9A 4P59L 2X4SA 1QSFB 3GKWL 3P30H 4ZAKD 5ADOL 5GJTL 1GGIL 4OLYL 2A0LC 4U1SA 4AT6B 1KC5H 2BNRA 1BIIB 3O6MH 3DVNB 1UYWL 4DEPC 1NDGB 2OR8A 5HDOA 1I7ZA 4LLWA 1U3JA 5GRJH 2X4UA 3RVTD 5DJ8B 3RTQD 2A38A 4HF5L 2FB4L 1GZPB 4X6CF 1J1PH 2VLLA 4MB3A 1MUJA 5LG1A 1I1AD 1G6RL 4LQ1A 2GK0B 4Y5YB 4PJ7F 1Z9MA 4AEIL 1MCEA 4DKFL 1KJVA 2EKSA 4P5TB 3NA9L 3RWDA 3EYFA 1XIWB 4E41E 2A6IB 5D96B 1U58A 3JV0A 4ZPTA 4R6UA 3FHQA 1SY6L 3MO1B 2Y72A 3P9MB 1FNFA 1T03L 3MLYH 3NFNA 3C6SB 5JOFB 4GO6B 1DEEB 4ODWA 1REIA 3O3BA 4ZO6A 5FKAA 3GMRB 1QA9B 2W9EH 4OCWL 4K3JL 3FB7A 4NGHH 2Y9RT 4JDZA 5D7IF 2YUZA 4AIXA 4XNQA 3MLTB 1H3TA 1QLFA 4PJCE 2WW8A 5C7XH 3ABZA 4UDTB 1UADC 4PRHD 1A3RL 2Y7QB 2E5EA 1RZKC 1HXMA 1ZEAH 3ES6B 2NTFB 5IP4A 3CDGA 1K2DB 4LF3B 5A2FA 2GY7B 32C2B 5A1AA 1CFSA 4Y16B 2A83B 4NM4L 3G5VA 5IW6A 3CFJB 2ZOLA 5EIIB 3MRNB 2F74B 3FN0H 3O11A 5DJCB 3U30C 1AQDA 5HPMB 4JFXA 3EYOA 4U6VL 1X5JA 4XVSL 1JMZA 5F1IA 4D2NA 2VLKB 2VZTA 4J3OC 4BUHA 1DBMH 2LE9A 1FRGH 1MCKA 3O3DA 2AJUL 1CDBA 4CMHB 5DGRA 3EFFB 3O41B 3L3HB 3IFLL 3WE6A 1T1XB 2VISB 2VKWA 4HIIA 4M9OA 4TTDC 3KHQA 3AS2A 4XPGL 5C8JB 3G9VA 2NCMA 5DJAB 3GSOA 4MMZC 3SPVA 5DT1H 1MFCL 1ULVA 2Q8AH 4K2UL 4ENEC 3VFPB 5B39A 5F88A 1GGBL 1YC8A 3MXVL 2A74A 2GK2A 3BP5A 5CBAB 1F42A 2HMIC 4QHLA 1JGUH 5DEGB 1BLNB 4L3CB 3TNMA 3TNNA 4MNGE 5FM4A 3HMXL 4KQ4L 1DQML 4LNVA 4LSDA 4MDJB 4BH7B 5EZIL 3U0TA 3CC5B 4XMPH 2VLME 1BVZA 2V7HB 3P4NB 3T8XB 1EGJA 5ACLA 2YPKB 3HFMH 4N8VB 3O6KL 2VN4A 3D85A 1EVUA 3IAGC 3OSKA 1CGTA 5CD3B 1VFBA 5DS8B 3EOTL 4PJAB 4YDJA 4DTGH 2A6KA 3GSXA 2AJVH 4NZJA 4JY5H 2FEDD 3N06B 4P46D 4JFQB 5BRZA 5KVFH 3WXVH 5F3HB 5E7BA 3KHOA 2XV6B 1RUML 5F9WC 2APTA 5HI5D 1BHGA 3FFCD 3OKEA 1N59A 3V6ZA 4OUOA 1MEXH 3BZ4A 3SDDD 1MHEB 4KUZH 1SBSH 1T20B 4KROB 1OTSC 2VSDA 1KBGL 4WTZA 4ZO7A 4AEEA 1OARH 4EN3A 5I1IH 1CD9B 4U49A 1CLYL 4BSWA 1Y18B 2FSEA 3WHE0 2D03L 4IIQA 1OAUL 1NFKA 4P2RB 4PJ7E 1T3FA 4V2CB 2BHUA 2Q76A 5C0BB 1CK0L 2E7LC 2XFXA 1OAQL 4YR6B 3MOAH 4Y8DC 3BD5A 5L6YL 1HH6B 4NJAL 3RU8L 3F8UB 1D6VH 4LLAA 3ILQC 4NZUL 1SJHB 3BJLA 1YEDA 5E4IA 5IQ9B 2EXWD 4WWID 1B0RA 3DX6A 4WTZG 4ZNEE 5ID0B 1RUQL 2I60H 4P57A 5DMGC 4QTIH 2BSRA 5D7IE 2CDGB 2R0LL 4JZJC 4LLUA 3WS6C 4IOIB 2V2TB 5T1LA 3WFCL 4NNXB 5CKAA 5ILTL 5SX5H 1MRCH 2LVEA 1YY8A 1YJDC 2BVPB 4MJIE 2HTLC 1G7HB 1QBBA 2VDPL 3AVEA 3CLEH 1XF3B 5ISZB 3CXHK 1G7QB 1MHHB 2AKRA 3AMLA 4J3VA 3T0EB 1JHLH 1OAXH 2FBJL 4PRNB 2Z31D 2YEZA 3Q1SH 3BRFA 3V6BR 4P48A 4R97C 4YPGA 4S1SH 4D0DA 5FO8B 1M05B 1VEOA 5K33A 4RDQF 4WDIB 4MSWB 5KVDH 2VAAA 3LHPH 1NC4B 2I27N 5DJXB 1T0NA 1XCTB 4KUCD 3ILPA 1B0WA 2J8HA 1E4KA 1MLCB 3I02A 2VERN 5TDNA 4R96B 2DQHL 2VITB 4N8CL 3EO1A 1UWEL 3RKDD 4F33A 4MCZA 3RX8A 4NZTH 3RQ3A 4W4OA 4KY1L 4HAFA 4Q9RH 4GG6B 4Y4HB 4GAFB 1E28B 1LGVA 4X6BB 3H9SE 2ID5A 2QADB 2XWJA 4HK0B 3MR9A 2IALA 3O8XB 1NGXA 5B21A 1FYTA 3LKPB 3C5SB 5MEOB 5EWIH 2FATH 1MFDH 3VRLF 4OZIB 4YHIA 5C0DB 2Z91B 4I0KA 4JM2A 3RNQB 3V6OC 4U1IA 4BSJA 2NZIA 2R39A 1RUAH 3OG4B 3GMOA 2VXTH 3DVIA 2R9HD 3SDCB 4IDJH 1LQSR 4K8RD 1ZGLA 4PRBA 4HULB 1RMFH 5DHVA 1JP5A 3RIFK 4XBPB 4N0UE 3P9LB 2XXMB 1JK8A 2GITA 2BY3A 1FCGA 4XP6L 5EPMA 5EUKB 4Z0XB 5SWZB 5CMAA 1T2QL 3KPLA 1U8JA 1FN4B 4GKNA 1UWXK 3V2AR 1OGTA 1SJEA 3QEQE 4PGCA 1A5FL 3GMQB 4OLXL 1J8HE 4NDMA 3SO5A 2O5YL 2ITCA 3KS0J 3W0WE 3JV4A 4UTAH 1XF5A 4HGWA 5DUPH 1SEBA 1CL7L 3PHQB 3CFCH 1FAIH 1FL5B 5EOCL 3I3DA 3V7AG 4PJIB 1YEGL 4ZUSB 5TQ2L 3EOBA 4JB9H 3SDXE 5LGHL 5LKNA 1Q9WA 1R5IA 2Y6SD 1MQKH 2ZG3A 1HINH 1HOCA 4WI4A 4LIQE 3TGXA 4JFFE 3BEWA 1WCBB 1U36A 5ENWB 4U1NA 5GJSH 2DLFH 4DCQA 3B5TA 2RBLA 3IFPB 2LTQB 2AJSH 3UBXI 1C12A 5MENB 1FNLA 1MI5E 1ODAA 2VDOH 4B7LA 4HUVA 1R3IL 5KSVA 2Q7YA 1IJ9A 1IC5L 4NNPL 4Z7OF 1RHFA 2PKDA 2FECL 2W92A 3NAAL 1W72B 5DA0B 1U42A 2GSIB 2DQIH 4YBLC 3G08A 2FIKB 2X10A 4GRMB 3WNNA 4RFEA 1UT9A 5GGQL 5C9JB 1I4FB 1NBZA 3ZKQD 1Z9LA 3JXAA 2IFFH 4KK6C 4YK4B 3STZA 2NY7H 3KPPA 4AT6A 1BIIA 4BKLB 1IQDA 5D1XD 1M71B 4O00A 2XZAH 5JIHA 1BEYL 3S3SA 2JJUA 4IRSD 5FGCE 4K9EL 3EYQC 2LU3A 1M7IB 1YEFH 4OJFL 4HFUH 1OLLA 2P8PB 5E8EB 5TE6L 3NCCB 4FNLH 3MUZ1 1AJ7H 3ARBC 2VLJE 4KJWC 1DL7L 3CLFH 2X70B 1S7QA 5HYJB 3JWOC 3BGAA 2XICA 2NR6C 3HG1A 2E27L 4RBPH 3ZE1F 4R7DB 3QI9B 5KSAB 1OLZA 3QIWC 1JGDB 1KPUA 2DM4A 3RBSA 4YEFA 4DGIL 1CFQB 1VFAA 4OZ4A 1T7ZA 3G5YA 4Y1AB 4I8DA 3SY0B 3T3PE 3U4AA 4OZGA 3KPSE 5EBLB 4K23L 3VRLE 1CGSH 4KKNA 2OSLA 3GMNA 5D7KD 1QHOA 2H9GA 2PXYB 4Y4FC 3QUXC 4POYA 1A7QH 3S4SB 3F12B 1CD0A 1X5AA 2ZUVA 4FZ8L 1BECA 3G6JA 3WS3B 3DVFA 3F5WA 2YBRA 4WI6A 2VDMH 4QTHB 5HXMA 5D9SB 3LKSA 2YKLH 3QWRD 1TITA 1JRHI 3EHBD 5E8NB 4CRPA 2A83A 4UV7H 2HKHH 4HV8A 1RU9H 2R2CA 1A7OH 1S7SA 2C9AA 4XRCB 1NGQH 1S9VA 2HJKB 1UACH 4XAWH 1INQA 4QXGL 1KCLA 1SEQH 3EFFA 1NMAL 4NIKB 4MAYB 2MJWA 1WTGT 5C8JA 3FO9A 3B4NA 3MV9D 3TVMA 2VDKL 4TUJA 4D9RE 1YN6B 5BZWA 3UAJC 2HLAB 3DVGA 4CVZA 3U7AA 1A02N 2Y06H 4OLZH 5I15L 3J8F7 1JF6A 4NN5C 1U91A 3V9FA 2I25N 4S1DD 4M1DH 4WFEE 2RJMA 2A1WL 3K1KC 2Y23A 5FYKD 3EO0A 3N1FC 5T5FH 4QRRA 5I18H 1UM5L 5GRUH 5CSBA 5CSZB 3CC5A 2A9NH 3EOAB 2LU7A 4XP5H 1FPTL 4ELMF 1X3DA 1RIVH 3P4NA 1A9BB 1ZSDB 3L3DA 4LKXB 2YK1H 4Z7OE 5F7UA 4WWKA 1A14L 4O58L 4RAHA 3Q6FB 2B7DT 2MSPA 4NKIH 3BKJH 1ZT4A 1N26A 3ZE2F 4D3CH 5D7LD 1R3JB 3OJMB 4Q6IB 3VGDA 2GJ6E 5CGTA 3PABB 5CJOL 2UYLA 1OGAB 1KFAL 3MV01 2DQFB 5GRXG 3C8DA 3NVQA 2WBJB 5K9OA 4PG2C 2XNAA 3U0PB 5MP6L 1CE6B 5E56A 4OZFA 5D5MB 4EJ1C 5IJKC 5I74B 3SDYH 4EN3C 3CU7A 3MRBB 5BV7H 5JQ6H 4DFIA 4LPVA 1H5BA 2Z35A 3K2MC 2NXYB 5F89B 3D2UD 1VKXA 3WFDH 1FVDA 4N8VG 5HVGB 1CI5A 4OD1H 3SCMC 3VD3A 1O5DT 2B2XL 4FQXD 5CP7B 3ZE1E 4MDIA 2IWGA 1DUYA 5BO1H 2BNQE 3ESVF 4KRNA 4OM0H 3EBAA 3H3PH 2DMCA 3BZEA 2V17H 3MGAA 1RZJH 1ZT1B 2MOVA 5E1AB 4FFWD 3UC0H 4NKMB 1CQKA 2X4TA 2EE9A 3RVXD 4JQIL 2WINA 3B9KD 5I1HH 3BPOB 2E9WA 3FQXB 4X7DC 1VESA 1MCNA 4LCWE 3IDJA 3HC4L 1HHHB 1S7VB 4LLQA 3T2OA 2V2TA 5B4MC 1NAMH 2BOCB 4K71B 4YFLI 5IVZB 3BP6B 1A3LL 4N0CD 4WV1C 1TQCB 4DVBA 3WNMA 4EI6B 3PL6A 2N1KA 4HIJA 5LCVH 3GK8H 5D2LF 5CHNA 1I7RA 2QSCH 4LP4A 5E6YA 1FJ1A 1NMBH 4KZDL 5IG7B 5EBWB 7CGTA 3TIDB 4LVNB 5JPNB 3ZHKA 5JZ7D 1DQJA 1AY1H 5D7JB 1NMCC 4P2CG 1JNNL 4Q9BA 4X9GA 1DLFH 5L2JB 5I0DA 5EG6C 5F9JA 4HMDA 1IQWL 5I16A 1DQDL 4YDIL 4R4BB 3DV6B 2VLRE 4OCYL 3QFJD 3RVWD 3QCUL 1WBYA 5KANG 3KPQA 5TE7L 1XGUA 1YNLH 1MSPA 2CDEA 4Y4HA 4GG6A 1PD6A 3NPZB 1TCRB 1FO0A 4UIMB 3MJ9H 5F7MC 1A6WH 3HE7B 5DHYB 4HK0A 3RWFB 1Z0NA 4HIEB 3O8XA 1KIQB 2AQ3A 3HNVL 2NY1D 4MX7B 1D7FA 1OAYH 1I3GL 3FO2B 1ZT7B 4WI2A 4MNQB 4OZIA 1IEHA 3HE6B 2RQ8A 1CT8B 3PDOA 1AP2B 1FG2B 4ELME 5JOEA 4UOW1 3MV8D 3LB6C 4ISVA 4XPHL 5DI8B 2V2WA 5J57B 2JJTA 2AXFB 2VQ1B 1LDPL 3PNWA 3QUMH 3ZE2E 5DJZB 1ZHLB 4YDLB 1FL6B 3DGCR 5ANMB 1B9ZA 5BS0A 3KYOA 1XCQB 3VFOB 5DRXA 5B8CA 3HUJF 3O3AB 4P4RB 5BCAA 1MFBH 1X7QA 1DQQB 1KCVH 4DVRH 3KPMA 5HHNB 5KSBB 4N9GA 3X14A 4KKBD 3LV3B 3MRQB 1I1AB 4FQIH 5IK3B 1Q72H 5E2WH 4P9ML 3B6SB 4U2YA 1KUMA 5FO7B 8FABB 3MRCB 3HRZB 3UTSE 3W9DB 2UWEA 2M8XA 3KYMB 4GBXA 4NRXA 1I8KB 1UVQA 5JIIA 4I5BA 1AGDA 4LCYA 1LO4H 4PGEB 3I84A 4LCUA 5F1NA 1WTLA 3OGCA 4PREA 3V6OE 4EEEA 2P5ED 5SWQB 5DLML 1YDPA 3EKCA 2AI0L 4PR5B 2GFBB 1RHHB 3L5JA 1WFOA 3QYCA 3ULSA 3VFMB 4LASH 4K3DL 1PW3A 1V05A 3G5XB 4PRHB 3VDCA 4L9LA 3H0TB 4YBQD 1CICD 1T89C 2OTUB 3V0VB 2VDQL 5FYKH 3QXTA 5JDSA 5HYEA 4AIZA 5C3LD 1WVZA 2J8UA 4OBSA 3HPJB 4M7KH 2VE6A 4MQXD 1B0GB 3TN0C 3V52L 3ARDA 2Z93A 2ATKB 2A9MH 5IOPB 5ACMA 1HQ4A 2HVJB 2NXZD 2VAJA 3QJFA 3PIQB 5D1QA 3BGMA 3OAZH 5C2BL 3VXSE 1ACYH 5EU4B 5MERB 4XXCC 4IS6B 2OYPA 5A2KH 5D2LE 5FYJH 2NY4C 2HKFL 2YXFA 5DQDL 1JBJA 2WWMC 4ODUB 4XCYB 4NYLA 2ESVE 2OJZL 2HVKA 3C08H 3SBWA 3LRSB 4TUOA 2YD2A 3A6CL 5IF0A 3N1PC 4TNWF 1YEIL 4GKOA 2ADFH 2X70A 1GYAA 1RZGA 2JK5B 4Z76A 1QKZL 5CEYA 1DBBL 1TQBC 3ZTNL 1NBVH 3FMGH 4R7DA 3VJ6A 3G04A 5E00A 4RGND 1MIEH 3S35H 5IHUL 5DFVC 3QIUB 5T1MB 3LMJH 1U8KA 3MOBH 1YPZA 5IMMA 5IW3A 4WHTA 2AABL 1AGFB 4OD2B 5F7KC 5GISH 2YUVA 3BESR 4P2OD 5L0QC 5INCA 1FL3B 2CIKA 5ICZB 5DRWB 4G6KL 3QRFM 2BSTB 1EAPB 1N3NA 3QUZB 4U1MB 3DMMB 3V5HB 3TH4T 1FSKB 4P46B 1W8OA 2WUBL 4F58H 2PYFB 3RPIB 3QNZB 4WFHD 2DYPB 4RFOH 5K59E 4NQDD 1TCMA 3BT2L 3C5JB 3KXFE 5JW4N 1KTDA 1QFHA 4OLWH 1GHFL 5TDPA 1D5ZA 1BOGB 5KVGL 3NFSH 1T7YA 1JFQL 4EI5A 4Z7NE 3BZFA 3MLWH 4PJDB 3HUJE 2J4WL 2NY6C 3UTTB 5J6GB 4RGMB 1F13A 1NCDH 4NP4H 3W5NA 3QUYC 5E9DD 1T5WA 3S34L 2ERJB 4E41D 4PLJC 1OP3H 1BBJB 2HRPH 3MUHL 1P9MA 1T4KB 2ED7A 1OTTD 3BI9X 3IF1B 3WIHL 3SOBL 4WCYL 3C8HA 5FO9A 5E6ID 1F02I 5DD5H 3S4SG 3OXRA 5CILL 4NNYA 4HC1L 4L3EB 2Z8WC 4ODTH 5T3XH 3FTGB 3IRPX 3O2WH 1SHMA 2X4RA 4QHNA 3QULB 3ARFC 4JDVA 2WLZA 4JFZL 5SV3A 2ICWB 3CVIL 1UB5B 2Y07L 3TA3D 4X7CC 2DQCL 5CAYB 4WU7A 2HFGH 1C16A 1KCUL 1GGYA 3ARGC 3UJJL 4F37F 4JHAL 3BSZL 5HYSB 3B9VA 1AO7A 2NTSP 1UCBL 3CUPA 2Z4QB 2H6PA 3JV6B 2ZPKH 3A67H 4P3CL 1G6RA 4F9LA 1JV5A 1GXEA 4NZRH 1S5IH 1HSBA 1KV3A 4MWFB 4Q6IA 1FE8L 1HEZA 5GZOC 3TBYA 2YN5A 1SY6A 2YD6A 2ZCKH 1CCZA 1NJ9A 1X9QA 2JIXA 5I1DB 1IEAA 2NY5C 4PJ8D 3QCTH 3PGDB 3RWJB 1BF2A 1EEYA 3MCLH 1LP9A 2FWOB 4OV6F 1H5BC 4WFGE 4YFEA 1U8PA 4NBXB 1NFDF 5D93C 3VDAA 1W72L 4OLVL 4J3UA 4JM2F 3EZ8A 5DURB 4X80L 3QDHA 1Z0MA 4RQQA 1NDMB 3V4UH 2Y5EA 3PWNA 4KJPC 1CLOH 4P5KA 3M8OL 5ALBH 5IFJB 4APQD 2EYSA 2EE2A 3CCHB 4D0CB 2UY6A 2KKQA 3HA0A 4HSQA 5JR1H 3GMMA 5EO9A 4N0YH 4G3YH 5C07D 3WFHA 5E8OB 5BRZE 2X4QB 4Q6YA 1I1YB 1KEML 5E2UH 5C0AE 3S37L 3WDIA 1KB5H 3NH7H 3ARZA 3QO0A 4YLQT 1A1MA 4I18C 1UWGH 3U1SH 3UPCA 2L4OA 1R3LA 2CGRL 4WTWA 5K9QG 3TZVC 4ERSH 1MCJA 2IBGA 4HEME 2IAND 2BK8A 2P7TB 3TJHC 2C5DC 1CFNA 3LQMA 1PQZB 3LRHA 3BP6A 4F57H 5BV7B 2XQBL 2DIJA 3RWGA 5ERWA 1EBPA 2F54B 1QBAA 5T3ZE 2CH8A 4JN2A 3BIKB 3CK0H 3GMPA 5FGSA 5F7WC 3HMXA 4Y0GA 2CUHA 4S2SA 2XTJC 4XPAH 3WD5H 4PJ5E 1RUKH 4JPKH 4LHUA 1IM3A 3UP1A 2DQTH 1EO8H 2P8MA 5IUSA 3P30L 5EBWA 1DLHB 3GSNL 3MBXH 5E8PB 5F3BA 3BPNC 4PRPB 3T3MF 1KC5L 3O6ML 5CGYD 3BYYA 3IDIA 3O2DL 3GJFA 4IBLT 3RX5A 5FA4A 3DX8B 1U0QA 4ZFGH 1H9VA 3HC0B 1UJ3C 1LEIB 5IESH 5DQ9A 3EJZC 5GRJL 1AQKL 1WZKA 2QQKH 3IXTB 1E4WL 1JN6B 2MPAH 4NC0B 3NTCL 2R2BB 1GL4B 1U3HB 1MCWM 1A6PA 5TF1L 3MBEA 1NAMB 4L5FH 4MNHA 4LSPL 5FHBH 3RZCC 3SO3B 5GS0C 2VR9A 1VGKB 5KS9A 3T2PA 4LSTL 3HE6A 2YUWA 4ZXBD 3RVUC 3C6LC 3VD4A 2A73A 3DSFH 2R0WH 2CKNA 1KCSL 1FG2A 4ZAKA 1KENH 5HGDB 5C71A 4HIHB 3TBVB 3DUUA 1CGXA 4D8PA 1ZHLA 3MJ7A 1LILA 3PWLB 3VGEA 4ZS6D 1UXWB 3RTQA 3QXAB 4R0LA 1FVEA 1S9KC 1KPRB 5L2KA 3AB0C 1FYTE 3QISA 4OZGF 2DDQH 3LS4L 3H9SD 2ZCHH 2DQGL 1NFDE 3ECBB 4DN4L 4QGTA 3P4MB 1ZTXL 3W9DA 5BVPH 1NLDH 1MNUL 1MCSA 1LO2H 2F8OA 3PHOB 3GJEA 1T22B 5DSCA 5J9PB 3Q3GB 2EDKA 1JRHL 1FC1A 4HUWB 4PGEA 2X4OA 4MB5A 5ALCH 3G6JF 4LCIH 4R4FL 4LCCC 1PYWA 3C2AH 3WDHA 2DL2A 3OKOB 3AS3A 1I9JH 4TVSa 4MD5B 1QFUH 4OCMC 1PBYA 3KLHD 4PLNC 1YNKH 3ET9F 2FJGA 4Y19D 4PRHA 5KW9H 3QUMB 2F53D 1G7MA 3C9NB 1A6VL 1CXKA 3PJSB 3UJIH 3NBNA 4YZFF 3ARDC 1NEUA 3U9PL 1EJOH 1V7ML 2YPLB 3RWIA 1RURL 5F1KC 2BDNH 3TBSA 2D4FA 3QEQD 5HJ3A 3HB3D 3VXMA 2CD0A 3LD8C 1JPSH 4JRXE 4IRZH 1LVEA 1P7KB 1GC1C 1FZJB 2E7MA 4PJ9A 1TMCB 3MGOA 2C1PA 1KTLB 1MCFA 1ZXQA 1LE5B 1LK2A 4DTGL 3NABH 5C0FB 2AJVL 1CF8H 4JY5L 1MREH 5KVFL 4LVOC 5EOCJ 4HFWB 4JVPA 3WXVL 4IHOB 5FYLE 4C83B 4EVNB 1FIGH 5FFLA 2OZ4H 5FGBC 2YOCA 3T3ME 2IMNA 5GZNC 5F7NC 4FFVD 1MEXL 4JFFD 3CSBA 1BVKA 1SBSL 5EO0A 2DQUH 4LARL 1C7SA 1HKLH 1KLGA 3LQAH 2APVA 4P2QB 3UPRB 3AXLB 4ZODA 4L8CB 4YNYB 2Y5TB 2MHAB 4U3CA 5DVNA 2XKNB 5AEAA 4K94H 3D0VB 2VDRL 3W82A 1IMHC 5I6XC 4TSAL 3BXNA 3QEUB 4ZOAA 5T1MA 3PWJA 1GSMA 1R24A 4BQ8A 4MXQD 5DA4A 5HHMB 3GIVB 3MOAL 4JQXC 4LAJH 4JPVH 1FFNA 1IGML 4PJHA 5B3JF 5FKPA 1T0MB 1S7TA 1QFWH 3GHBL 4YUEH 5JXEC 3E0GA 1D6VL 3JTTB 5DJDB 4IRJA 1WZ1H 5F7EH 3IJSB 4YHYB 2C1OB 3I3EA 2MCPH 4HKBA 4LKCA 4BQBA 2I60L 3HZMB 2P42B 1G1CA 3FFCA 4QTIL 1C7TA 3EGSB 1ZKAA 4QRQA 3SDDA 4X7TA 3UTQA 3KPTA 1MRCL 2FGZA 4MHHI 3C5ZD 4PJXF 3GGWB 4TUKH 2VLJD 3QQ3A 2NLJA 3KR3L 3GKZA 4PPTA 2IF7A 3CLEL 3D2UB 3PXJA 3UDWA 5AZEH 1MRFL 1HHIA 1RFDH 4LLDA 3ZDZE 2A6DA 4HH9B 4OZGE 4LSQH 1L7TL 3MRFA 1WCQA 4OIAA 4AENA 4XT1C 2ZP0T 3WO3B 4I1NB 3QPQC 1LDSA 3W11C 4ZUUB 4ODXA 5GS1C 3O6FD 4KDTC 4AH2A 4JZNA 5EN2A 3QSKB 1OD7A 1BAFH 5D1ZB 5AUMB 3RDTC 1P4LA 4POUB 3G6JE 5HTSA 2A0LD 2HT3C 4JDTL 4I2XE 3K81A 4W70A 1ES0B 3FO1B 3HZKB 1UB5A 1DANU 3MODL 3V7MA 3D1MC 1DVFC 3FONA 5FIEA 3JUZA 4G8EB 3IJYB 2DD8L 3OJDB 1QYGH 1ZVSB 4ACPA 4G8IA 5JHDB 2NQCA 2P43B 3JV6A 2Y1VA 4YZFE 2FATL 1I1FB 2VIRB 4DUXA 5I76B 1A7NH 2I24N 2Z31A 2J5LB 3GRWH 2MWCA 4WUKH 3NMEA 4X4ME 3LQZA 1ZV5A 4XC3L 4Y4KC 4OQTA 2VXTL 5E8DH 4IDJL 5FDWB 1QG3A 2FYYB 1FV1A 1P2CA 2YHGA 3B9DA 5DTFB 2OM5A 4NQCB 4D9RD 4E42A 1HZHH 5C0RL 4GS7B 5C92A 5HYSG 5I73C 2Q6WA 1JZ2A 3GFUA 1S7WB 3QH3A 4MS8C 4WFED 5CS7A 3QXDB 3HAEH 4D0CA 1X4XA 4UTAL 4ONGL 1EZVX 3V0WL 3ULUC 3ZSTA 5DUPL 1KTKE 4XGZB 5BMFL 4WNQB 4PRIE 2YD4A 3CFCL 1U8IB 2AQ1A 15C8H 3H7BB 4DFHA 3PQYD 3RAJH 1F4YH 2CIIB 4MJ5A 4G80A 4Z77B 5CEZE 2P5WB 3SQOH 5ESVB 4N0FB 1HINL 1PGRB 1OD9A 2YC1B 3MCKA 3VFRA 1BBDH 2GUOA 2FHCA 5MEQB 2YRZA 4TOYL 2DLFL 1AGEA 4TTDD 2DOCA 4F8TA 5GGRB 3QUKA 3LKRA 5C09E 4ENED 2UWEF 3RY6C 1ORQA 4F7MA 3QIBC 3U9UA 1OT2A 5D72H 4MXVF 2HMID 3DX9A 1MJ7L 2AV7A 1ZLVK 1UC6A 1JPFA 3KJ6L 4HWBH 2PTTB 2DQIL 3VXRB 4PS4H 5KJRH 5DC9B 1T83A 1B6DA 1CN4A 3OKLA 5C0EA 2NY2C 3ZTJH 4O2CB 4PJXE 3CXDH 2LFGA 1CD1B 4R8WH 2NY7L 5E8PA 3HI6H 2CDFA 3HI5H 4NOFA 4G6AC 1ZS8A 2HJLB 4P5MB 1AXIB 3OKKB 4GLRI 3M07A 5EU7C 5J6HA 1PG7L 4YHKH 1BFVL 2BNQD 5E2TH 5SX5K 4WGVB 2XZAL 4O9HL 2J8UF 5EO1A 4LIQH 1KB5B 4OCNC 3CH1B 4HFUL 5FUZH 1CDCA 1IFHH 3QQ4A 3TBTB 4ZD3L 1MAMH 4JCLA 2G2RA 3AREC 4FTVD 1AJ7L 4ZSOB 4NN7C 3CLFL 4U0QB 1K5NB 1QRNB 3GSRB 3OXSA 3QZWB 4MB4A 2W38A 3DX7A 1OTSD 4CN4A 1KXTB 3TV3H 4JE4B 4LEXL 1D5BB 4U1GC 5GGTL 5I75B 2NW2B 4G6JL 3SE3A 3DROB 3CZFA 5J1AB 3U46B 3DO7B 4ZTPL 3KPRE 3CDFA 3GB7B 1CGSL 1ZOXA 2FX8L 3BQUB 1F97A 1U92B 4K7FA 4X9IA 5D1XA 4YWGL 4IRSA 5EORH 1EEZB 2XWTA 2X9YA 4QRSA 1J8KA 4HJGA 2VDML 3ILQD 4G43B 4TQEL 5FEBA 4L8SB 1YPZF 2GIYA 2J6EH 2YKLL 2R2HA 1FORH 2I9TA 3W5MA 4GG8B 3V0AC 5FOBB 5KN5A 1IKFL 4R7NA 4UV7L 2HKHL 5DMGD 5EULV 1HSAB 1D3CA 2R23B 2FX9H 3DRQA 3P4MA 1F4HA 1NGQL 3F7YB 1UACL 4NQEE 2HRLA 4L8BB 1HHKA 3CSYB 4FP8H 3DTXB 2HTLD 3MROB 2GSGA 1I7UA 3AU1B 3MUGB 1JCKA 5M7QA 1R5VB 3WFZA 1MWAL 3L5XH 3GI9H 2H2SC 1CXIA 3UZVB 1CG9B 2H1PH 2EH7H 4U2ZA 1AGCA 2IPTH 3RWCB 1KELH 4M4RA 4J6RH 1P7QA 3QDGE 4JHWH 1M6OB 5C0NC 4QY8A 1WV7T 2DQEH 4Z9KB 3OF6D 2B1HL 3FB6B 4M1DL 5H8DA 1E4XH 5DGQA 1K6QL 5T5FL 3QWRA 5CZXC 1FZKA 3BMVA 4F9PC 2D31B 4PJ9C 4DAGH 2UWEE 2A9NL 4UT9H 1II4E 4R26L 4XP5L 4FFZH 2CSPA 1RIVL 1CDJA 3WXWL 1WFNA 3I6LE 2YK1L 5HHXL 4OKVB 4MXVE 3Q2CA 3UTZA 1FZJA 4U1KA 3UTSD 4NKIL 3BKJL 4ZFZA 1LE5A 2AEWA 2DTMH 4N8PA 5HGBB 4OIIH 5E6IB 43CAB 3MV9A 4HG4K 4RRPG 3IVKB 3SDYL 4P23B 4NUGH 4Y5XB 1HKFA 4Z7WA 4CJ1A 4G8GE 5LAXA 4X7SL 4P4KB 2IEPA 4U6HA 1MJ8H 3VXTB 5A16A 3CIQA 2FR4B 3FQUB 1B4RA 2PW2B 2J8UE 2NX5D 1E6OL 1RZKH 3D69A 3QG7L 1QBML 3UX9B 3U7YL 1LHZA 4K7PY 3O9WA 3ULVL 3WFDL 4M6NL 3NACH 4OD1L 4UU9A 1OHQA 1BQHA 1RPQA 4BFIB 4M8VA 4X99B 4UAOC 4OV5B 1HYSC 3TO2A 1LP9F 4IRJC 3NCYS 3P0YH 4M7ZC 4YC2C 1CGVA 4X98B 1QVOB 3VMPA 1S9YB 5BO1L 3C60C 1H3VA 5D7LA 4OM0L 5LQBH 3H3PL 2V17L 3PP3H 2CJUL 1RZJL 1J05B 2H45A 5L9DH 4R4NC 4XBEH 1XH3B 4RBPK 1N0LA 1ZGLP 1FAKT 3RBGA 5I1HL 1Q9KA 2AEPH 4NKOA 2ESVD 4HCRH 4MXWH 3T0DA 2LAAA 4KV5F 1XT5A 1VEMA 1IC1A 5E94B 4G8FB 4YHNA 1NAML 1Q0YL 2BC4A 1VADA 1F8TH 2H26B 4GOSA 4R2GB 4QCIA 1N4XH 4F2MA 4H8WH 2VXVL 4H1LH 2WIIB 4U6XA 4JY6B 4MNGB 2X40A 5DEZA 3D2UA 1U93A 5EZLB 1YPZE 1V3JA 2R4SH 3GK8L 3V8CA 1EMTH 4NC1C 2QSCL 1CBVH 4F3FB 5FCSH 1NMBL 2WUCH 2ZUQC 3SE4A 4FQXA 4QT5A 2G9HA 3TT1L 1HNGA 1DDHA 3DUSA 1JGEB 2HAZA 2VC2H 1HHGB 3VRIB 1YZZA 5JW3L 4O2FA 4KK6D 4GKZA 3T04D 5FECB 5HYIA 1JPGB 1MRDH 2PF6A 5DD1L 5DXWA 5C1MB 1YNLL 2OS7A 3FO1A 3NCYP 3B9KA 1A6WL 1T21A 3OAYH 1G9NC 3EYQD 3H2WA 5MI0B 1TZHB 5A3IC 1KG0B 3KXFD 4FQHB 4PJBA 3VW3H 1S5HA 2JCCB 3X13A 5LGJB 1UGNA 1YJDL 5E2VH 3ARBD 3TO4B 3CSGA 4KJWD 1GAFL 4LSVH 3T77A 4ETQA 5C0CE 3T0AA 1U8NA 4G9FD 1G7PA 2NR6D 3J7HA 3BHBA 4X6CB 3TPUB 3MLRL 1XGQA 3QEGH 5C9KA 5KSUB 1P7HL 2W65A 3QIWD 3VWKC 3VWJC 4LSRH 3U7WL 1OSPL 3C8KA 3DETC 4PJ7B 3WYRA 5KBNC 4U1LA 3PWUB 4ZUWB 2AK4B 3IU4H 2ADGA 1FDLH 1R3KA 5D8JH 1NSNL 3F7VB 1BFSA 1N6UA 5IMOB 4OF3A 4LSSL 4ETYA 4HUUA 1FNGB 2AXGB 3QFJA 5GS2H 1MFBL 4NQVA 3SGKA 2YXMA 4Y4FD 5DK0A 3U4EA 3QUXD 1RULL 5I2IA 1AO7E 3DXAE 2F15A 2I07A 3EUUA 4FQIL 5HVHC 5GHWH 5D2NC 1IGTA 2XA8H 5D7IB 1KJ2A 3N85H 1MIMH 3A6BL 1ED3A 1G0DA 4WY7H 1ZANH 3QPXH 1OF2A 3NIFF 4GW5A 4MJIB 4ONFL 1CTNA 2M2DA 2VUYA 2CQVA 2ZUSA 5DQJB 2C3VB 4HHAA 3IETB 4X5WA 1JNHB 2QQNH 3L3JA 5IJVA 5E08H 43C9B 3MV8A 2B4CH 3QDME 1LP9E 1U3YA 3LKOA 4GKSA 1XF2A 4HUNB 4LASL 3BVNA 4YHZH 1CXFA 2BCKB 2ZUYA 4G6MH 5IWLA 25C8H 4QHMA 3WUWA 5LGKA 4M3KB 2FJHA 3UAJD 4WFGD 2IH1A 2HT4C 4UILH 4NHUA 4RCAA 3HZYA 2XQYK 4M7KL 3K4ZA 1A1OB 1GGTA 1DE4A 2GCYB 4M48H 4LVHB 5IM7B 1KULA 2A9ML 3FOMA 4YAQB 3MNZA 4GRLB 4O2CA 2C7UA 1AIFA 1CIDA 3P77B 2AGJH 3CD4A 1ACYL 3HAEB 4LHJB 3WHXA 3ZE0F 1ACZA 3CFEB 1Z5LA 4BQCA 4EUPA 1CLZH 2FNBA 1XGPA 3HLAB 5FYJL 2CLRB 3MMEB 2JELH 3MV7A 2P5EA 2QJDA 5C0AD 5HGAA 4M8QB 3NN8A 4M93C 4Z7QF 5I1EH 4CJ0A 1T6WA 5BJTB 4OI9A 4MA3A 4FABH 4N0UB 1CICA 2XIDA 4MCYA 1D5XA 3THMH 5BZDA 1DSFH 4EN3D 1WC7B 12E8H 1NBVL 3MRKB 1K4CB 3FMGL 3VH8A 3QXWA 5ICYA 2CK0H 3BKYH 2W60B 5EA0H 3QEQB 2HG5A 1J8HB 2NW2A 5JTWA 2AEQH 1AXSA 4HQQL 3W0WB 3UO1H 4PJ5D 5HHPB 4HJJH 3DIFA 1PAMA 1HWHB 3T65B 2HFEA 3SCMD 2VWEC 2RFXA 3L6FB 1Y6MR 4BZ2H 1S8DA 3DARA 4Y7MA 5EBMB 1A7RL 4F58L 5IVXE 5EU7E 3S5LB 5CJ5A 4KU1A 3WJLC 4U7MA 2UVEA 3LN9A 2R8SL 4MA1B 1SYSA 3QZWG 4Y5YC 5HHQB 5E1HB 1KNOB 1N2RB 4P5TC 1AD0B 1J0HA 1WBXA 4O2EB 1XIWC 4YXKH 5T1LD 3VRJB 4GG8A 5D96C 4YO0B 1CR9L 2D9CA 4FZEH 3ARUA 3QDJE 4KH2A 5AD0A 4PJHF 4RAVB 3FOLB 1MI5B 1TVHB 2Y36H 5IMLB 1LNUB 1NCDL 4NP4L 1TETH 5B4MD 4POZC 3NCEB 3VXQA 2R56H 4L29B 5ICXA 1I8LA 1SJXA 5GGUB 1NUNB 2BNUB 1WBZB 4OCSH 2YPVH 2ITDB 5GIRB 3UBXA 5DD5L 2YD3A 4P2OA 3TIEB 5AWNH 3NIFE 1HDMA 4UINH 1A6TB 3KJ4B 3GSNA 4X4XB 4AEFA 1N5AA 3P73A 2EYTB 4ODVL 1BREA 1CXEA 4HZLA 4ALAH 1H15B 2CO6B 1DBJL 3O2DA 3S8WA 2MNUA 4P0DA 4UDUB 4Y16C 5L2KE 5FGCB 2HFGL 5FV2A 4XNXH 4NQDA 1X5XA 4GSDL 3SGEI 5GXBB 4NC2B 1EXUB 5JO5B 1ZA6B 2NYYC 2VLJB 3VGGA 1ROWA 4PUBH 4JO1L 1K3IA 3WEXB 4X6FA 4JO4H 4CMHC 4U1JA 4HBCH 3D9AH 4KDVA 2YA0A 4NZRL 3MRDB 1S5IL 5E9DA 5C6WH 5DYOB 4JM2D 4E41A 1JWSB 1WT5A 3MFFA 4U0RB 1ERNA 4S11A 2O61A 1LEGA 2YMXL 1BFOB 4HXAH 4H20H 4QHUB 3E2HB 3HZVA 3U48A 3KPSB 3MRHA 5GRVL 2BRQA 3RJDA 3ZE0E 3MLPA 3MCLL 5L88H 2FL5A 1KB9J 4Y5XA 3LB6D 5HGHA 2VH5H 4Z7VB 4PJCA 4Q2ZB 2OQJB 4UUJB 5IKCA 3OAZK 5ACZA 3TA3A 2JB5H 3V4UL 3G6DH 3SKOB 1EA9C 2DLTA 1CFVH 1CLOL 5ALBL 35C8H 3TWCH 5HBBA 4YGVB 5JORB 2MFNA 1KCKA 5EU3B 2OJEB 1MF2H 2VQUA 3HPLA 3K46A 2ZCLH 1LO5A 5JR1L 4M1CC 4JLRB 4M61A 4JRXD 4N0YL 1DCLA 4K7PL 2IAMB 4G3YL 4ZFOL 3PGFH 5I8OL 1TJIH 1RJYB 3RY5A 2NMSA 1KB5L 2M1KA 3NH7L 1S3KL 1UWGL 4JN1H 1E27A 3BEVA 5DD0L 3GSVB 2RIKA 3X11B 2ICEB 4A2LA 4PJ8A 4BH8B 3L9RB 3KYKH 3RVVC 4KC3B 2R1WB 4QRTB 3SKJH 1MCQA 3R06B 1QFPA 1H0DA 1CDYA 4F7EB 3VFWA 4YPJA 4HJ0C 3QQ9C 4GQPH 1EHXA 1Q94B 2GW5A 1BD2D 2R1YA 5J13C 3VI3F 1EGJH 4XPAL 2BMKB 1IC7H 2BSSA 4APQA 3S7GA 1EO8L 5FUOH 4PJHE 3TN0D 3X3GH 1A6UH 4L1HA 1JZ4A 4I48A 4YDVB 5BQ7B 1LO0H 5C07A 1JI2A 1RK0B 1AI1H 1FBIL 3GO1H 4X83A 2GJ6B 3K8KA 4XMKH 5IESL 3OPZH 3AY4C 3UXFA 1QSZA 4XTRC 4OD3H 4JGMA 4XXDA 2NY4D 3T0VA 3RFZC 4HUXB 3OKDB 1OP3K 4HS3B 5CBEB 2B1AL 1CFTB 2WWMD 5I8CB 1YN7A 2IANA 3VD9A 2MPAL 3LRGA 1NGPH 5JNYA 3KNBA 5F7LB 2HJFB 1UXSA 2BVOA 3T0EC 1R6VA 5F93C 3HNTH 1FVCA 1G9MC 3CVHL 4XP9H 5FHBL 3S6CA 5T3ZH 3VXUB 3CNKA 1W0VB 3IKCA 3HI1A 5C0IA 4H1LB 3RGVA 2R0WL 2D0GA 4NC1E 1M7XA 1EFQA 1KENL 3WFBH 1L0XA 2Q7NA 3HS0B 4HX1A 4KRPB 4E0RB 4N5EC 3GDBA 5DFVD 4QGYA 5ID1A 4ZUWA 4S10A 1T1ZB 2ADJA 3PWPE 1QTYT 2X7LA 1MH5B 1EPFA 3EOYG 1IT9H 4JZOB 3QHZH 5I66B 2QADC 3CH8A 2V9QA 2EDLA 3EFDL 1Q9OB 2W1NA 1TVDA 4ZNEA 1YECL 3OHXA 3JSSA 3QRGH 5JW5A 5F9WB 1I3RB 2PR4H 2ZCHL 4LCWB 3TT3L 1CDHA 5L7XL 4D9QD 3WN5C 1NUDA 5B38B 2AV1A 4KTDH 5BVJA 3MJ8B 5E99H 1F6AA 1LO2L 4I4WB 1FH5H 1U8HA 1A7PH 5GRVK 2ARJQ 4XNMA 3FRUB 3OKNA 5ABDE 3SDCC 4ZXBA 1IL1A 2NY6D 5ALCL 3QFDA 3IETA 1JVKA 2E8ZA 3QUYD 4WO4B 5CGMA 4KI5C 3WJJC 3B2UC 4PLJD 3C2AL 1H8SA 1RIHH 3LN4A 3B8YA 2APXA 1JIBA 1I9JL 3BDYH 1QFUL 5JQHC 2P49B 1AD9A 2ZSWA 5E2JA 1IAOA 5GGVY 1YNKL 5KW9L 2APFA 1TZIA 5I8EB 1PZUB 2V2XB 3V5DB 5CJXA 2XZQH 2VLRB 2E8YA 2X6MA 1EJOL 1XZ0B 2G75B 3ARFD 3L7EA 3GM8A 5T1KB 4JY4B 3D6GA 3BE1L 2GCYA 4TSCH 3H9SA 5D2NE 4YAQA 4ZG1A 3QNXB 5MHSE 3ARGD 4JZJB 4M6OH 4HKZA 3OB8A 5F44A 4NO5B 2YRPA 4JG0H 4D0BB 2R2EB 3WKMH 4PRID 3VI3E 1JGVL 3VFGH 3NABL 3T08A 5HYFA 1G7JB 2I26N 2FX7H 5IB5A 3RL2B 5DHVH 4XP1L 2ATPB 2OZ4L 2LTQC 3WUZA 3D5OF 4ELMB 5GZOD 3KDMA 1EDQA 3BW9B 3M17B 3BWAA 4JR9H 1JNLL 5C3TA 2DWEB 1AGBA 4YIQA 2K9UA 1D5MB 3FT2A 2DQUL 1HKLL 4Y19A 1RJZB 2F53A 5C09D 4LEOB 4HH8A 2B5IB 4NRYA 1OTUC 3RUGA 4Z78B 1WC7A 1MAJA 2VL5A 5E24E 5FA3A 4YK4C 3HAEG 1IGIH 3IDXL 5EH1A 2VSCA 5EZOH 4HG4J 3DGGB 4PBVC 3RPKA 1G7IB 5IMKA 3OTTA 3UTPD 1P1ZA 4HMCA 1T7VA 5ITFB 5J89A 1IE5A 1OCWH 4JPVL 5H94B 2Q87A 2H8PA 3BUYA 1K4DB 4XBGB 4YUEL 1N5YH 2JJSC 5FYLH 3RWEA 2PW1A 3N50A 3SDXA 2FHFA 3WMSA 2MKLC 4JJ5B 4KJYB 4XNYH 4ZS7L 5EU6B 4JFFA 1N2RA 4J2XA 2C4FT 1VACA 3RWHA 5BXFA 5KSAC 2ARJB 5HVFB 2BVQA 5I9QB 3TZVD 1NPUA 3D39D 4LNRB 4P9HH 2OR7A 2C26A 3S36X 1L0YA 3TJHD 1VDGA 1PG7X 3WLBA 1F90H 4UQ3B 1Q8MA 3MJGX 5IEHA 5LXGH 2WQRA 4D94A 3ZTJG 2V5YA 4LSQL 1X5LA 3BH9A 3CZJA 4HS6A 3F7QA 1FZOB 3QA3B 1IM9D 2XTJD 5TGBB 2PXYC 5FB8B 5IW1B 1PEWA 1BP3B 4OF5A 3S5LG 3U36A 2DN7A 3GBNH 5GGSB 3VXSB 1BAFL 1DFBH 3KPRD 4WHDA 4KK9C 5DDHB 2VWEE 1IEBA 3LIZH 4X4XA 1FZMA 4IJ3B 4BELD 2CPCA 5D2LB 5DRZB 2BFVL 5C08D 1UG9A 4OGXH 1XGRA 2ICWJ 1RJCA 3QO1B 2R0KL 1NCWH 2IPKA 3V6FB 1MELA 2WLYA 3D25B 3EJZD 4NO0D 1I9RH 3HR5A 5ITBH 1FFOA 1TJHH 3JUYA 4OUUA 4X4YB 4NQUA 1QYGL 4LGRB 4TYUA 2QQQA 2WZPD 3I3BA 3C5ZA 1JWUA 5C6TH 5D6DC 1GOFA 4NKDB 2CO7B 1I8MB 4CVXA 1JF1B 1U95A 5F97E 5DMJB 3ZKMC 1ETZA 5SX4H 2X4PA 4JREB 4NQED 1NCBL 2EYRA 3GRWL 1YNTB 1F11B 3RZCD 3IGAA 1QLRB 1UKTA 5GS0D 1LE9B 2X4SB 4Y89A 1FYHB 3QHTC 3D87B 4Q0XL 2DJ4A 5D7KE 3RVUD 3C6LD 4X8XA 3O6FA 3TFKC 1NCAH 1FCCA 2QSVA 2BNRB 4RISH 3QAZB 4PJBF 1LD9B 4YHPB 3KG5A 2QBWA 4HUKB 1W0WA 4RDQG 1I7ZB 4LLWB 3BD4A 2X4UB 3IU3A 3QDGD 4NO2A 4H26B 4K3EH 2BJMH 3OAUL 2HH0L 3Q5TA 2VLLB 2YZ1A 4WI7A 1CD8A 4ONOA 1A1NA 5JIKA 1MUJB 4DGYL 4HPOL 1OAKH 1J87A 5JOPE 2R4RH 1U8QA 3OKMA 4G5ZH 1KJVB 3OZ9L 3RWDB 2ZUTA 5TE4H 3EYFB 1U58B 4ZPTB 4HZAA 3WFEL 4KRMB 4XVJH 4MD4A 2KL6A 3NFNB 2D7MA 2WBJC 4ELKA 4ODWB 3O3BB 3BOVA 5ADPL 1F4YL 3MV9E 4IMLA 4XCNA 5FKAB 2RCSH 4PV9A 1P5UA 3SQOL 5EOQL 1PFCA 1RZIA 4PLOB 3VG0H 3F6LA 3DOSA 3FB7B 4PYGA 5GRYA 1S78C 4JDZB 2NY5L 4XNQB 1MWAA 2EO9A 1QLFB 1SBBA 1XR8A 1QACA 2W9DH 3F58L 4G8GD 1HXMB 4XPBH 4F7EA 3CDGB 3MSPA 4CMMA 4OT1L 1YMMD 1CL7I 3DYOA 4E9LA 2AXHA 5AYQA 3LSOA 1CFSB 5IW6B 3G5VB 5KJRL 4JFDD 1NANI 3ARDD 4HWEH 2ZOLB 2FZ3B 1X5HA 5IIEB 2BRRH 1VSCA 3CXDL 3O11B 1BQLH 4MA7H 3O45A 3Q6GH 2F19L 1AQDB 5DZLA 4JFXB 3EYOB 4O4YH 5F1IB 1KEGL 1B88A 3E8UH 3O3DB 3JWDH 3WIIL 3PQYA 4GXVL 3WE6B 4YHKL 5CEZH 4HIIB 2C4XA 1KJ3H 4OZFH 2C3XA 3BPOC 1KACB 3P11H 3GSOB 3SPVB 4ODHH 4FS0A 2FJFA 2YWZA 5B39B 3GI8L 5F88B 5JA9A 4K71C 2FECI 3H8NA 2A74B 1MAML 4FMKA 3BP5B 4KK5C 4QHLB 4AYFA 3PP4H 1LK3L 4IMKC 5AYUH 3TNNB 5GZND 2V9RA 1N7MH 3CFDA 1U8MA 1UKQA 3RGVC 1KJMA 4M43H 3IDYB 2DQJL 4NN5B 1N64H 4LVNC 4P2RE 4P2YA 4QRUA 3U0TB 2FO1A 1IC4L 3S3JA 2N7AA 2NW3A 4PB0L 2CXGA 1YYLH 3BH8A 3D85B 3UEZA 4F7TB 1B4JH 3ETBF 1VFBB 4YDJB 2A6KB 3GSXB 5FUCE 2BNQA 1BM3H 5BRZB 5DO2C 5EORL 2BOBA 3HE7C 2EC9U 5JXED 2DAVA 1IAKA 3G5ZA 2KH2B 3E3QE 3OKEB 1N59B 3V6ZB 2J6EL 3BZ4B 1IGJA 1JPST 4FTVA 4EQ2A 3L5WA 3MUY1 1U8LA 4H1LG 2FX9L 4EN3B 2E7HA 1F3JA 2V7NA 1QZ1A 4BSWB 2HN7A 4EBQH 1WSST 4FP8L 4IIQB 1T3FB 5JIPA 5C0CD 2Q76B 4PJ5B 1JZ8A 4FXLA 2XFXB 4OCLC 3CDYA 1P4IH 4YDLC 1NGZA 2FD6L 3TEUA 3GI9L 2N4IA 2QLVB 2EH7L 3ORJA 4HGMA 4J23A 3QPQD 4HXBH 3W11D 4J6RL 2E7LA 3QFJE 3GSWA 4JHWL 3EO9H 1FO0H 4M5ZL 5I8EA 1B0RB 2EEAA 2FHBA 3DX6B 3IXAA 3RDTD 5AZ2H 4P57B 2HT3D 4LDLB 3LKNB 2BSRB 5B38G 1E4XL 4HWNA 4LLUB 1BX2A 2YD5A 3IJHB 5T1LB 1U9KA 1ZWIA 5GGVL 5JPMA 1AO7D 3DXAD 5I19H 1YY8B 2DLIA 2C3GA 1DVFD 2Z92A 2Q3ZA 3WS6A 4JZJA 4YDKL 3L3IA 3MA9L 2AKRB 4KHTL 2YEZB 1AKJD 4HWZA 1NC2D 3I75A 4YPGB 4D0DB 3MZGB 4ZPVA 1EO5A 3MREA 4G7YL 3BN9C 3RIAF 2VAAB 2F5BH 1SMAA 1CDGA 3I6GA 1T0NB 1B2WL 3ILPB 1ITBB 4Y4KD 3FRPG 3QDMD 2E7CA 4NUGL 3I02B 5TDNB 4DKEL 3KPOA 1G84A 5SWZE 1YEKH 3EO1B 1T1WA 4F33B 4MCZB 3AS0A 1A9EA 4XCEA 2IQ9L 2D9QB 3BRGC 1RSFA 2VDNH 3QCVL 4L4VD 1KLUA 3OF6A 4WU5A 4GRWH 1EHNA 3I85A 3EW3B 2XWJB 3MR9B 4TSBH 2IALB 4Q58C 4C56A 1NGXB 2OLDA 2AERT 5I8KL 3FB8A 1K9TA 1FYTB 4OSUH 2WK2A 4HLJA 1NEZA 1NFDB 4OCRL 4MS8D 1ZA3A 4YHIB 3VXNA 2HFFA 4JM2B 4J8RA 4PB9H 3UTSA 3MV7E 4ORGA 3ULUD 2J88L 3LPWA 4U1IB 3K8LA 5LQBL 5CCKH 3FQNA 4URTB 3GMOB 1H3WM 5J8OA 1L7IH 5JW4Q 2D0FA 5L9DL 3CMGA 1IAII 1GIGH 2XG4A 5CINL 1ZGLB 3V6OA 4PRBB 1RJLA 4Q74A 3VXPA 5DHVB 5DK2A 2AEPL 4MMXC 3ME0A 3F7RA 1N6QH 4FQ2L 4UZGA 2W0FA 1GPOH 5EPMB 1F8TL 1N4XL 1URLA 5CMAB 3KPLB 3C09B 1U8JB 2NX5A 4H8WL 1ND0A 4GKNB 2VJXA 3QIUC 1CTOA 1SJEB 1FHGA 4PGCB 3K4DA 1NEZG 4NDMB 2IBBA 4PP2A 4DOHE 3QIBD 5JXAH 2ITCB 3VG9B 2R4SL 1GVIA 1EMTL 4FXGA 1CBVL 3JWNC 4LHUD 3JV4B 1RVFH 4EIGB 1WAAA 1DUZA 1XF5B 2AJYH 4HGWB 4QRPD 2IH3B 1WGOA 4X9HA 4TVPD 4K07A 1SEBB 5JUEL 4J3XA 3QUZC 2F8VA 3DMMC 4XWGH 3VCLA 1INEH 1FSKC 1BQUA 2NY2D 1XF1A 3EOBB 5DDHA 3HNSH 3FN9A 1Q9WB 3NA4A 4PTUB 4Z8FL 4G6AD 1JWMA 5LBSL 4JFED 4LGPB 3VFNA 3BEWB 3QO1A 4U1NB 2O5ZL 4KKCC 1VPOH 4DCQB 1OOAA 1CXLA 2EH8H 2ESVA 3S88H 5J4MA 4RGMC 5D4QA 1C12B 1GRWA 4EDXA 4HUVB 3A6OA 4PGBA 4TRPH 2ERJC 5KSVB 2Q7YB 5E2VL 4RGNE 3ARED 3QDJD 1KSRA 4U3XA 2UZIH 3G08B 3LEYH 1D6EB 1GOHA 5DMIH 4M5YH 3RA7H 1NBZB 1MFEH 3PE9A 4LSRL 1YQVL 3STZB 5HVWA 5IB4A 1P4BH 3KPPB 3FL7A 3N9GH 3VFSA 3MCG1 3LN5A 2DKUA 4UT6L 2DQDH 1PY9A 3IU4L 1LD9A 1FDLL 1IQDB 5IB3A 3P4LA 4YHPA 2OL3L 3X3FL 4WFHE 4NQDE 4I0PA 1W8NA 1Q1JH 4S1QH 4QXUH 5ESQA 1IGCL 2NY4B 4NT6A 2DKMA 4H26A 4M62H 4PJGA 1UQSA 4OM1L 5L2KD 1KCRL 5GHWL 3NZHH 2XA8L 4D9LH 1S7QB 2R0ZL 1YEEH 3N85L 3KXFA 4PRDA 5CD5C 1AXTH 4YX2H 3HG1B 2D7TL 5E9DE 3QG6A 4WY7L 4WHCA 3ARBA 1ZANL 3TYGH 2QKIA 1F3RB 3HUJA 1KPUB 3L95A 1VFAB 3RGHA 4G9FA 4H88H 3SKMA 1JF5A 3FQRB 3LDBB 4OZ4B 3G5YB 3GIZH 2QQNL 3DV4A 3QIWA 1BZ7A 4OZGB 4P59H 3GKWH 4XPTH 5ADOH 1GGIH 2ZNXA 5K93A 1UM6H 2OSLB 3GMNB 1R0AH 4TPRL 2H9GB 4YHZL 3KPNA 1UYWH 3AFLA 5L0QB 4Z7UF 1F3DH 2H2SD 25C8L 3OBAA 1T2JA 3F62A 3G6JB 3B5GA 3F5WB 1BVLA 4UILL 4RMQA 2YBRB 4CNIA 4Y4FA 3QUXA 5A2JH 2FB4H 3LKSB 5C0ND 3JVGC 4AEHH 5IQ7H 4M48L 1G6RH 3PP3K 4YFLF 1I7TA 4U33A 4AEIH 5EUOA 4HV8B 2FZ3A 5IIEA 1S7SB 3NCBB 3ULUL 4NN6B 3QWOA 5CZXD 2EDEA 1FNHA 1S9VB 3O4LD 4PJ9D 3SJVA 1SY6H 3EYVA 1PZ5A 1T03H 4PY7A 1INQB 5M95B 2JELL 1A3QA 3FO9B 3TVMB 3MLZL 5KSBF 2PN5A 4TUJB 4XCCH 4K3JH 5I1EL 3OR6A 5BZWB 5J12C 3WV0A 3DVGB 4CVZB 3W9EA 5BV7C 4MQ7A 4NWTL 1S7XA 3D3VD 1A3RH 4K7PX 1U91B 3GSUA 4WFFE 3DO3A 5KG9A 1FFPA 2KUTA 12E8L 2I9LA 5E4EB 5JLZA 3CDCA 3ULVC 2DWDA 3EO0B 4G6FB 2ZUXA 3OJ2C 4QRRB 5EA0L 1LWRA 3AUVA 4TVPL 4NM4H 2AEQL 2QQLH 3O0RL 3UO1L 3L3DB 3OX8A 3K2UH 5C07E 4X9BA 4WWKB 1QSED 3DHMA 5CIPA 4U6VH 1ZT4B 4OGYH 4F7TA 3OAYK 2Y25A 5KANI 4OFYD 4PRIB 5B39G 2UYLB 5GRZA 2AJUH 1HYSD 1RZJC 4IRJD 3PV6A 3V5KA 4HAGA 3RUGF 4ZFOA 4XPGH 2CMRH 5F1SA 5K9OB 3C60D 2XNAB 5C0AA 1J7VR 3RJQB 4OZFB 1A6ZA 2IANE 3T2NL 1U3HC 1GGBH 3I6KA 4ZUTA 4QXWA 4R4ND 3MXVH 4PG2A 3MRJA 2R69L 1CGWA 4FZEL 5IJKA 3HMXH 1H5BB 4Z18A 1FQ9C 2Z35B 2Y36L 5HDBF 4BQ6A 1DQMH 1TETL 5IBTL 4OBRA 2SEBA 1VKXB 2F5AL 2DJSA 1FVDB 1WZMA 1XFPA 3LCYA 3SDXF 3H42H 1B3JA 4AQOA 5TH2A 4PJ5A 3GJFH 3FN3A 1TNMA 4MDIB 1DUYB 3SCMA 2EZ0C 4DWHA 3EOTH 1T1YA 3BZEB 2A77L 5I1JL 2FH8A 2VMFA 1A7BA 1RQ5A 3PWPD 2WIMA 3MRPA 4ALAL 1MY5A 5LWYH 2X4TB 1OWRM 3TCXA 1JHTA 3QBTB 1RUMH 2WINB 4XX1G 3SDAA 4XNXL 5GPRA 3LKNA 3IDJB 3IJHA 4LLQB 2XI9A 4PRAA 3MLVL 4Z7UE 2GQHA 4M7JH 2BY2A 4KXZI 4DVBB 4MNQE 4ONHA 3PUCA 2LVCA 4MD0A 5A3ID 3D9AL 3PL6B 4HIJB 5CHNB 5GRWA 1I7RB 5DD3H 3CVHA 1FJ1B 4WV1A 4MAUH 4WJ5A 1MCPH 1MCBA 4OAWA 1OAQH 5SWSD 1DQJB 2X4NA 4WUUD 1QUNA 4RIRA 1P5VA 5BW7C 3TF7C 4ZUVA 5GSVA 5ANME 3VWKD 3KPRB 4NJAH 3OG6B 3VWJD 5F9JB 2CLVA 2Q8BH 5JMOC 5I16B 2VH5L 1OWWA 1WBYB 3KPQB 5KSBE 5F72S 1XGUB 2CDEB 4KFZC 1FO0B 1RUPL 1RUQH 3G6DL 4QF1A 2ED8A 2B0SH 1TXKA 2R0LH 5I1GH 3S96A 4GMSH 3WFCH 2R1XB 2GT9A 5FHAL 3T3PF 5ILTH 3NIGF 2VZSA 4UBDC 1U3ZA 3P2TA 4AL8L 2VDPH 2VZ1A 1NFDA 3AM8C 5MHSD 1LO3L 3ZLQC 1MCIA 4AQ1B 4Z6AT 2X41A 4X6EA 3R1GH 4Q9CA 3PGFL 1TJIL 4NQEB 2FBJH 1NH6A 2D0HA 2PYED 3D0LA 3PDOB 5IROC 4JN1L 3ZT6A 3NZ8A 4OFIA 4MGXA 3ZT5A 1FFQA 3CFKB 4ISVB 5IVOA 2V2WB 5CWSA 4MLIA 3PHSA 3INUL 3PNWB 3AAZA 4Y19E 2GTZB 2F53E 5BS0B 3FFDA 2DQHH 3KYOB 2QR0A 3RUGE 4N8CH 5DRXB 3ZL4H 5B8CB 1EIBA 4PY8J 1X7QB 1HI6A 4KY1H 4L1DA 3BWUC 3KPMB 2W9LA 4GMTL 4N9GB 3X14B 5ESAA 2YA2A 2HT4D 1EGJL 1SMOA 4NUJA 4Q97A 1HCFX 4GRWB 4AG4L 2J3SA 1IC7L 1YY9C 2VYRE 2ORBL 5HHOE 3VXMD 5EU5A 5FUOL 2IH3A 2UWEB 4GBXB 3X3GL 4NRXB 5HDBE 1UVQB 4JRXA 3GMLA 3RY4A 1QQDA 5IFHL 4I5BB 1AGDB 1LO0L 4NO3A 4JGJA 4LCYB 3U4BH 4AM0A 4LCUB 4YHYC 4N90D 2P8LA 5F1NB 1AI1L 3OGCB 4PREB 1RK1A 4YE4H 1SQ2N 1KT2A 4UQ2A 2FGWL 3EYUH 3OPZL 4M1GH 4LPUA 1YDPB 4PTUA 3BN3B 3EJJX 1IGYA 4CU8A 4N68A 5D70L 5K9KA 2DMKA 2VUOA 2VDLL 2W07A 3ULSB 2UY7A 1BZ9A 1YYML 4KZEH 4GW4A 1Z2KA 2V6HA 3NGBB 4L9LB 1NGPL 4XP6H 5T1DL 3GBML 4ORZC 5JDSB 4AIZB 4AZ8A 4A6YL 1Q9LA 5T3ZL 2J8UB 3MNVA 1T89A 4OLXH 4BZ1H 2VE6B 1BD2A 1U6AH 2O5YH 3BPCA 3ARDB 1D6EA 2FO4A 2Z93B 1HQ4B 3WLWC 4LSUL 3QJFB 5D1ZC 3WFBL 1QSFD 5D1QB 3BGMB 3TN0A 2G60H 3T0BA 2E6QA 2IBZY 3U82B 5F7HA 3REWA 4H5SA 4U1HB 4M4PA 4I0PC 3LH2L 1YEGH 4L8DA 1A2YA 2XZZA 1WWAX 4NYLB 3QHZL 5DWUL 4JFYA 4XXCA 3MLUH 2HVKB 2ZSVA 4WEBL 2HFTA 4TUOB 5IF0B 5IB2A 5HDQH 4CW1A 1J1XL 3ULVF 1G9NL 4DZ8A 2EDNA 1LMKA 3UTTE 1RZGB 1FGNH 2GYSA 4Z76B 3LEVH 5CEYB 1ZLUH 4P5TD 3P4OA 2CKBA 4DQOL 1IC5H 4NNPH 1XIWD 3WCYA 2J5LC 3VJ6B 3G04B 4OZHA 1FH5L 1A7PL 3NAAH 4FQLH 3OMZA 1YEJL 5E00B 3L1OH 4XZUA 3VFTA 4B0MM 1U8KB 1YPZB 3FQRA 5IMMB 5GGQH 3GZKA 4WHTB 4LFHG 3NIGE 1RZ7H 4POZD 1LEKA 5F6HJ 1X5YA 4L3EE 1C08A 5FF6B 5INCB 2CIKB 4ZFFB 2XKUA 1N3NB 4HKXA 1P7QD 1WWBX 2AJXL 3BDBA 3TM6A 1BEYH 4A2MA 4K9EH 4XVUC 1NCUA 4I2XA 2XZQL 5FAAA 4CDGC 5E5MA 1IZKA 3B9AA 1UA6L 1KTDB 1RI8A 3WO4C 5TDPB 1D5ZB 1OP9A 4Y16D 4EI5B 4TSCL 1MCCA 1DL7H 3BZFB 5JOPD 4M6OL 2E27H 4WW2A 5DJ6A 4U7SA 4JG0L 3FT3A 1T5WB 2NYYD 4M02A 2VLKD 4OQTH 4LBEA 4OFKA 4UTBL 3VFGL 1G7LB 3MRLA 3SGDH 5K9QI 1KYOK 3CGTA 3STLA 4UB0H 4X8JA 5FO9B 3QUYA 2RR3A 3MACH 3HC3L 4EKXA 4K23H 3OXRB 4HPYH 4X4MA 4NNYB 9CGTA 1MFAL 3OB0K 4TNWK 1TVBB 4BUGA 2X4RB 4JR9L 1QR1B 1INDH 4QHNB 4QXTA 4DW2H 4JFPA 4JDVB 3MLXH 4GQ9H 5CKGA 4WU7B 1C16B 1IAIM 2YD1A 3KYAA 3ARFA 3O9WD 4FQCL 2X2YA 1IGIL 3AMKA 1AO7B 3DXAB 3CUPB 2H6PB 5D7SH 3ARGA 3P0VH 3OJVC 5IV2A 1G6RB 1JV5B 5J11B 3PQYE 1QBLL 1HSBB 3STBA 5HYQA 1HEZB 4PRIA 4U31A 1N5YL 2UZYB 4QXGH 3TBYB 4M1CD 4K8RH 1NMAH 1NJ9B 1X44A 1R5WA 2JIXB 2ZJSH 3FQWA 3U6RB 1I9IL 1IEAB 2VDKH 1EEYB 1DN2A 3QDMB 4XNYL 1LP9B 4JKLA 1U8PB 2NY3B 1NGYA 3RI5F 1IAIL 2NY0B 1I8IA 5C09A 3RVVD 5KTEH 5CUSH 2BVYA 4P9HL 1SVCP 4RQQB 3H9ZA 1UENA 1F90L 3PWNB 2A1WH 4P5KB 1TPXB 5LXGL 3ULVE 1UM5H 1CVSC 2EYSB 4WI9A 3QDAA 3C87A 4HJ0D 3QQ9D 3TCLA 2IFGA 4P2RD 4ZOEA 2H3NA 4PRPE 3GMMB 3BQUC 4HDIA 5EO9B 5J1TC 4X5XA 5IT2H 4O58H 4PJXA 4QWWC 4YQXH 4EOWL 1JGLL 3GBNL 3WFHB 3TH2T 2XN9E 1DFBL 3H6JA 5GSRB 3TH3T 4OZFG 1MCHA 4M6ML 4DZBA 1KFAH 5IBUG 3SDAC 3QO0B 1A1MB 4RX4D 4L8SC 4OGXL 4ZDHA 2BXYA 1X5FA 1R3LB 3IDMA 4HS8L 1NCWL 2FLRT 3BYTA 4FTVE 4P99A 1J12A 1L6ZA 4P3WA 1S9XB 1WAAF 4I18A 4F37K 1I9RL 5F6IB 5ITBL 1RIUL 4XTRD 5DRNA 1TJHL 5F7FA 1CFNB 3KYNA 3ZDYF 3TZVA 3NIDF 3BP4A 1EHAA 3D39A 5C6TL 5EFIA 2P44B 2DBJA 3RWGB 3T4YA 5ERWB 4JN2B 5ISZD 3GMPB 1CE1H 4S2SB 3T0ED 4P3DA 4TNVF 4LHUB 1IM3B 4JO3L 4Z5RA 2P8MB 1V7NL 1L0QA 1M1SA 5EC2A 2B2XH 3HCVA 3JTSA 1IM9A 5F3BB 4LHQB 1QRKA 1JNJA 1ZHKA 2BERA 3IFOB 5HHVH 1NCAL 1JMXA 4KVCL 2HWZH 1NC4D 4RISL 3IDIB 3L5IA 3GJFB 4S0SD 3KPRA 5FA4B 1XEDA 3V95A 4N5ED 5DC4B 5DQ9B 2APWA 2VABA 5C08A 1HCVA 3ZYJA 3MRIA 4K3EL 4OI7A 1S7RA 1UJ3A 2O5XH 3BGFC 4JQIH 4L4TE 4NO0A 3H9YA 3HC4H 2QADD 3VXOA 3T09A 4I77L 4V1DA 1HILA 2R1XA 4Q9QH 2G5BA 2RB8A 4IOSD 3MBEB 3DJ9A 4MNHB 4C4KO 2XWBA 4XVJL 4NSKA 5KS9B 2YZ8A 2X89D 3H9HA 4HT1L 2A73B 4XPFL 2WBKA 4NQEA 1OQOA 3NPSB 1T0PB 2RCSL 4MA8L 4OLEA 5D6CB 3RZCA 1J10A 4PJGF 4S0TD 4ZAKB 2IG2H 1EFXD 4P23C 3SDCD 3CFKA 3C6LA 1FIEA 1HIMH 3MYJA 5K59F 3DUUB 4P4KC 5H2BA 3L5HA 4OF7A 3UZQA 4D8PB 4KI5D 3TP4A 3B2UD 3QXVA 2GTZA 3MJ7B 4LDEB 5J3HC 1IQWH 2W9DL 1DQDH 4HKJA 4YDIH 4Z7NF 1R3HA 1JPTH 4OCYH 4XPBL 1FNSL 3RTQB 3QDGA 5SWZD 2YPLE 1CZ8L 1D9KC 5TE7H 4R0LB 4C56E 1FVEB 3Q5YA 1HQRA 5L2KB 1RZFL 4YHLH 2NNAA 3K80A 4AJ0A 3QT2A