3LDCA

High resolution open mthk pore structure crystallized in 100 mm k+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Novel insights into K(+) selectivity from high-resolution structures of an open K(+) channel pore.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
total genus 31
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ldcA00
4MW3A 4BW5A 1S5HC 2KB1A 4HYOA 3LDEA 3WG7C 2DYRC 2YEVA 3F7YC 4UUJC 5B1BC 2BOCC 3RVZA 3AG1C 1R3KC 4XDLA 3ABKC 5CBFA 3OGCC 3E8GA 1P7BA 3E8BA 5CBHA 3OR6C 4MVUA 4X89A 2Y69C 3ASOC 1QLEC 3AG2C 3GB7C 4QE7A 2A0LA 2R9RB 2X6BA 5KUMA 4PA9A 3RW0A 1OCOC 2ITDC 4DXWA 2AHZA 4GX2A 4G28B 4GX5A 4PA3A 4X88A 4X8AA 2Q67A 4WFEA 3STLC 5BZBA 4MVOA 2BOBC 3E83A 3T4DA 4PA7A 4GX1A 4MVZA 5EBMC 2Q6AA 3BEHA 4R50A 4I9WA 4LP8A 4MW8A 2Q69A 2IH3C 3T1CA 2P7TC 5J9PC 2HVKC 4G27B 2WLJA 3K0GA 4JTDB 3SYOA 4CBCA 1R3JC 4KFMA 4PDLA 4WFGA 3JYCA 2WLLB 2H8PC 5EBLC 4PA4A 2IH1C 2K1EA 4GX0A 1G4YB 2NLJC 3IGAC 3SYCA 3KG2A 4EKWA 4MSWC 4MVSA 4JTCB 3K06A 4J9YB 4ZBMA 1OCCC 2WLIB 3RVYA 2HJFC 4F4LA 3FB7C 3E8FA 1KKDA 1M57C 4P30A 4QE9A 3VOUA 4MVMA 1ORQC 3ABLC 4WFHA 3ABMC 2DYSC 1BL8A 3FB5C 4JTAB 4J9ZB 1XL6A 3SYAA 4QNHB 3PJSK 5EK0A 3AG4C 3LDDA 3LNMB 4MVQA 1XL4A 4WFFA 5EBWC 4LBEC 3STZC 3X2QC 4MTFA 2EIKC 1R3IC 2WLIA 4RUFA 4MS2A 3OR7C 3TCUA 2WLHA 3EFFK 2QKSA 2DWDC 3LDCA 3T4ZA 3R65A 2X6CA 3SPIA 1OCZC 3K0DA 4XDJA 4RAIA 3ZRSA 1JVMA 2OCCC 3E89A 4MTGA 4MVRA 1OCRC 3FB6C 4H33A 2QTOA 3RBZA 4RUEA 4H37A 2WLNA 2X6AA 2ITCC 3E8HA 3FB8C 1J95A 2ATKC 4TWKA 1V55C 3UM7A 3E86A 4P2ZA 4R7CA 3ASNC 4PDVA 1M56C 5IY5C 1LNQA 3K04A 2EILC 3AG3C 3OUSA 4MTOA 3LUTB 4RO2A 2A79B 2WLLA 4R6ZA 2HG5C 1K4CC 5CBGA 2HVJC 1V54C 2WLKA 3SPJA 3ZJZA 3K03A 3OUFA 2JK5C 3SPCA 3SYQA 3HPLC 4PDRA 4P9PA 3T2MA 4XDKA 3UKMA 1R3LC 2AHYA 4P9OA 3F5WC 2Q68A 5EC2C 2W0FC 4PA6A 3SPGA 1ZWIC 3SJQC 2DWEC 5B1AC 3SYPA 2ZD9A 4PDMA 5EC1C 2WLMA 2EIMC 4OXSA 3SPHA 5B3SC 4LCUC 3IFXA 5E1AC 5KUKA 1K4DC 2A9HA 2EIJC 4HZ3A 3F7VC 3K08A 3TETA 2HFEC 2EINC 2ZXWC 4R8CA
chains in the Genus database with same CATH superfamily
4HYOA 5FNVA 4UCTA 3LDEA 4LNUB 2GV9A 1U97A 2P4KA 1AR5A 1OJHA 3UCSC 3W7SA 2B1GA 4DUYO 1F4MA 4X88A 2UU9B 4AILC 4GT1A 5ITZA 4JYYA 3J7AU 2ZE5A 3CE2A 3TGUH 3LSSA 1MZEA 1NQTA 4I9QA 1GN6A 4O2AA 2B9ZA 4I9WA 5JVDA 4DV2O 3SYOA 1WNSA 2CH7B 3ZIAG 3AK1A 1SQBH 4OPAA 5EZYA 5B5EZ 4YJ2B 2QWPB 3SYCA 5LOVB 1NH2D 4TUYB 3CRMA 2UUBB 5JJEB 2HR3A 4J9YB 2ZM6B 4F4LA 4RQEA 3JAKB 1KKDA 2F4VB 4DR6O 4EB6A 1DK1A 4JYAO 2D2CB 2QEXV 4B3MB 2JJ1G 4MTFA 4JI5B 3RFRA 4XBFA 3T1YB 4FLUA 4GCZA 1WB8A 1TUBA 3A2FA 2JEUA 1DF4A 3LSQA 4QIWF 4H37A 5LP6A 5FL7G 1PD3A 5CA0B 2ILMA 1JCHA 1YXBA 1K33A 2YSUB 1XI1A 4LF5B 4JI0O 1V54B 3SJBC 4F6RA 3Q4HB 3K03A 1GTOA 1HDJA 1NR1A 1ROPA 4P9OA 1XNRB 2P67A 2ZD9A 5EC1C 3RYHB 3UT5A 4I0XB 5IJ9A 3HKBB 1XHZA 2R9AA 4YJ3B 4FIPC 4IGGA 2KB1A 1Y76A 4J7JA 4PELA 3JAMN 3AG1C 4JGSA 4J11A 2LFSA 3SJCC 4J7ZA 1VQ8V 4NR1A 1N0JA 4U7NA 1G1XB 3RW0A 2AHZA 2PI4A 3P32A 4DV5B 1XNQO 4UFZA 2HHHO 2GTSA 4WCEV 3U11A 2F93B 3KZIZ 2XAQA 3OMAB 2QA4V 4CH5A 3H1HH 2F43G 5L3BA 2R9IA 2IJIA 4O4JA 5LYJB 2H8PC 4JI4O 5A2QN 4DR5O 5CN0A 4GYCB 3CCVV 5A9GA 1NJIW 2HJFC 4BIOA 3JALB 4E2LA 1BL8A 4JTAB 5DM6V 4DV7B 2LW7A 4LF6O 2QKCA 2OYQA 2RMKB 3X2QC 4UVAA 3CC2V 1F7YA 3FX7A 1R3IC 4MS2A 4ZIBA 3EXAA 4DV0O 3D36A 5J2UB 2F66C 4TV9A 5LBQA 5IE9A 1KECA 1IBLB 4O4LA 1H2GA 1K4CC 4FM0A 3TXSA 1VQ5V 1VQMV 2UU9O 2YXHA 2OIGA 3LSUA 2JEXA 3JD2A 4JZ2A 3GVMA 3SYPA 1UFIA 4JI7B 1M90W 1SQXH 2JGDB 4FFBB 4NXNB 2YI8A 3CSXA 4UCOA 4LF7O 2IU3A 2EBOA 2PF4E 5FPRA 4YXWG 1HNZO 4DUZB 1B6QA 2QKAA 3ASOB 3DXRA 3GB7C 1Y67A 2L6LA 1H2MA 1OCOB 1W0JG 4I50A 1XUQA 4IIJB 2JDIG 3CP1A 4BIZA 3K9AA 4NTXA 4B08A 2P7TC 5CA1B 1QCEA 1TAEA 2OWOA 4CH4A 1L8DA 5AG2A 1BCCH 1SQFA 1ZL8A 3JATA 2VQFB 1JR9A 3RT3C 3IGAC 2OTJV 3KG2A 4MVSA 3CCJV 1Q6IA 2AGAA 4CC6A 4UB8Z 4X66B 2DYSC 4J9ZB 1E79G 4JI1O 2ZR2A 1K9MW 4LFCO 1OHHG 2EIKC 2OT5A 2RQ6A 1KC8W 2ZE8A 4X20A 1R6KA 1HWYA 1ZAUA 3FYEB 4CS4A 3RYCA 3E86A 3KCYA 4LFBB 2IJJA 3OE7G 4RO2A 1SF9A 4Z1VA 2WLLA 1IX9A 4U3JA 1XQ8A 4I7ZB 2N74A 3CEIA 1QLEB 4QPJA 2EIMC 4X62O 4F6EA 3IFXA 4O4IA 4CH6A 2GBOA 3QO8A 3H1KH 4JI2B 2RN9A 1IBKB 3TETA 2HFEC 2ZXWC 3P3NA 3ETQA 1GH6A 4ZI7B 1JOYA 1EBOA 2BOCC 5LA6B 1SRYA 4NYKA 4K0KO 1SQQH 3JAWB 3E8BA 3OR6C 4L8JA 2N04A 5GTHZ 3AG2C 4X1IA 2A0LA 4LFAO 4MT8A 2PTMA 1P49A 5IWAB 3C3TA 4PA9A 2Q67A 4WFEA 5C8YA 2XT9A 2PUSA 2QR4A 1BHAA 2HKOA 4JI3B 4FLXA 1HNWO 5H2FZ 2P22C 3G67A 2NNUA 5LXTB 4UV9A 3ABTA 1IBLO 2XAHA 4JYCA 2PY5A 3ZMUA 3FKSG 1NI8A 2YIBD 2IH1C 2K1EA 4D7TA 4DV4B 4BAYA 1RPRA 1FS0G 1KMIZ 1NBMG 3VOUA 1SC5B 2ZIOA 4MVMA 4GKKO 1ORQC 5LMNO 3SYAA 3ZN1A 1QU7A 3AG4C 4KP4A 1XL4A 1WP8A 5GONB 3IAYA 2WLHA 4KUMA 3CX5F 4XDJA 1S76D 3UO2A 2QTOA 2X6AA 3E2EA 4Z2WA 4U3FH 2LP7A 4R7CA 1KP2A 5IY5C 3G71V 2V4DA 1WP7A 1QR9A 4PHZA 5DECA 2ADPA 5KX5B 1RM1C 1CXZB 3BFRA 4PJ0Z 1GN2A 1NVPB 2MW2B 4DUYB 2YIDA 4I55A 2R72A 1PL0A 3CCLV 4JAVA 4LCUC 1SQGA 3F7VC 2VQFO 4DV2B 4R8CA 4MW3A 4QJFB 1S5HC 3OEHG 3WG7C 1NH2B 2UUCO 3AG1B 3P30A 1PKXA 2LGQA 3ABKC 3OGCC 3FAVB 2Y69C 4FM2A 1H2SB 4DR6B 2KG7B 4JYAB 5JH7B 3D8CA 4G28B 2JS3A 1BQZA 3E83A 4O2BA 3T4DA 4PA7A 5JCOA 1TUEB 1NTZH 1DTOA 1JFFA 2FL4A 5LP6C 4LFBO 3T1CA 3B4SA 5B1NA 3I5DA 1ZUQA 1EFRG 2GHYA 1L0LH 1ZX3A 2ZNIA 3JYCA 5EBLC 4DR2O 1XBLA 1KU9A 4CC5A 4JI0B 3QTCA 3AK2A 3ZMSA 2CH7A 1VQ6V 1SQPH 3X2QB 3LDDA 4RQFA 4WFFA 4LBEC 3IC7A 1KP3A 3L9DA 3AK3A 3LDCA 2CGNA 3SPIA 1XDCA 4FM1A 4JI8B 4B3SB 3FD9A 2YEVB 5LL6Y 1WA8B 4DRXA 2Z0AA 2Q7GA 1VQLV 3CMAV 3C90A 3ZBHA 5FLXN 1N33O 2EULA 2XAFA 1O9HA 1IXMA 3OUFA 5LGNA 2AHYA 3DSQA 1GM8A 3B09A 3ML0A 2EJ7A 1XNQB 2HHHB 4OXSA 4BIUA 2RDCA 5KUKA 2DOSA 2M6YA 1MA1A 3CPWU 2EIJC 1BT8A 3S3WA 3G80A 3K08A 5LMUO 3MHHC 2EINC 4EFBA 3HKCA 4TV8A 2WA3A 5GW7A 3JARB 1H2LA 2Q8VA 1URFA 1YZBA 1Q43A 4DR5B 4YJ3A 1GM7A 1DF5A 3ZRWB 2Q9LA 1QLEC 1WJZA 3BRCA 5KUMA 4EFEA 3CRQA 4LF6B 2KQXA 4GX2A 2E75B 2W6IG 2WSSG 5JQGB 1F51A 1P84F 3ZRVA 5EBMC 4DV0B 3OD4A 3QVNA 2CGOA 3OTOO 5D5QA 1R3JC 1WB7A 2LGWA 1Q7YW 1WPXA 4JASA 5IYCO 3K57A 4EKWA 4MSWC 4JTCB 3B77A 1YJWV 2WLIB 1NVPD 3K59A 2DYSB 3ZEDA 4YY3O 4DO2A 4ZOLA 2WA4A 3LNMB 4B3RO 2DE0X 2EIKB 3B8NA 3STZC 4JAUA 1FXKA 3JALA 2X6CA 1OCZC 1SA0A 3HKEB 1JVMA 3N2KB 4LF7B 5EYPB 2G38A 3ASNC 3AG3C 1HNZB 2ZNJA 1AI4A 5K1XA 3G4SV 2EJRA 1GKFA 1AI7A 1A32A 3SYQA 3LNNA 4XDKA 2D3OW 4PA6A 3UQ8A 5C93A 3DGEA 3CXCU 4JV5O 2EIMB 3CXHF 4FPPA 4J10A 2GDSA 2PI5A 1D5AA 2ZXWB 5IDJA 3AEIA 4CS3A 3N27A 4ICGA 3ETDA 1PP9H 1LUVA 1JQ0A 4NTWA 2GUZA 5CBHA 3AG2B 2ARHA 1HP8A 1YJ9V 1Q6HA 1HR0O 2BTQB 4WBNA 3D3QA 3E22A 1BQ0A 4JI1B 5JJJB 4PA3A 4LFCB 1FFXA 4JI8O 1LR1A 4B3SO 1B3QA 1IBMO 3M99B 5JWPA 1N0NA 4H44B 1TVKA 4PI0A 4WFGA 4N21A 1PM9A 4D6TH 1QHTA 4UCRA 1OCCC 3RVYA 1B04A 1VF7A 1GN4A 4BWAA 1QBZA 3AG4B 4OGQB 4GKJO 2E5LO 1M1KW 5KHJA 3K9SA 5KA5A 4X62B 2RCVA 1Q86W 3ZN0A 4DV1B 1H38A 5FNVB 4FLZA 4IYIA 4N23A 3SGIA 4MTGA 4MVRA 4RUEA 3CD6V 1VQPV 4DR4O 5IY5B 1FPOA 4JI6O 4PV1B 1NR7A 3APOA 3GWKC 1KYOF 1YTFD 4K0KB 2YUAA 1RM1B 1I08A 1NS1A 3ZJZA 4IYHA 4PDRA 3CCEV 2LW1A 4LFAB 5E79Z 3HR0A 4PD4F 3CS5A 5B1AC 4OX9O 4KHPO 4DR3O 1MZFA 2Y4UA 5JVDB 4X65O 2DMXA 5IYZA 4DR7O 1HNWB 4MTXA 2H3OA 1I94O 1AI5A 4CZZA 1XEQA 3WG7B 5EZYB 4BW5A 1JJOA 1B06A 1IVSA 4OPHA 1TA8A 1RSOA 5KMGA 3ABKB 3RYFA 5KAFZ 4FLTA 4EB6B 1AP6A 2Y69B 4DV3O 2CTWA 1F23A 3OM3B 1W59A 4GKKB 4LC1A 2GSMB 5L3FA 5LMNB 5KHGA 3W7UA 1LUWA 1X4TA 3DTUB 4X9QA 5H9CA 1TUBB 2UXBO 3QF7A 4LF9O 4QPKA 1R6NA 3OFNG 5LP6B 1Y74A 4X1KA 1KUQA 3N2GB 2AW9A 3I56V 1FXHA 4PA4A 2O57A 2MK3A 5CMUA 3K5LA 3HB3B 5H5NA 5LXTA 2Y0PA 2EZPA 1FYJA 2QWNB 2ZE6A 2ZT9B 1GM9A 2ZCEA 2JS5A 2QTSA 5IJ9B 5CA3A 4FZ1A 4RUFA 3HKDA 3OR7C 3WFVA 3K5OA 1YITV 3OW2U 1N32O 4X1YA 1Y76B 4W4KA 2Z3YA 5BY1A 4J42A 4FLVA 2BCCH 3U0ZA 3FYIB 1YDXA 4TWKA 2UUCB 2X7RB 4DR1O 1SQVH 1RFYA 1ENVA 4KL1A 3KKYA 2XUMA 3T2MA 2ZIMA 4FVMA 3TK1A 1R3LC 1P7GA 1W2BU 5JCOC 3ZCCA 2K9PA 4WF9V 3QNEA 1WAZA 2EIJB 2A9HA 1AJNA 1COWG 2EINB 4LH7A 2BSKB 4O4JB 3ETEA 1Q81W 1GAXA 2XAGA 4DR2B 3RVZA 2UUAB 4FJCC 3BHPA 1WPBA 1XILA 2DN9A 1GN3A 1DLBA 4KXRA 2X6BA 4LH6A 2ITDC 4DV1O 3FAVA 3JD4A 2E74B 2Y4TA 3ZHQA 1AR1B 4LF4O 1RPOA 4GZRB 4FMTA 3MDSA 3JASA 2KG7A 1ZTEA 3ZHTA 1Q6UA 4IHJA 1N33B 1FKAO 4CH3A 5IT9N 2CTPA 1BGYH 2QSAA 1QVFU 3TJTA 4QNHB 1AILA 1VQ9V 3K5NA 2Q7HA 3PJSK 2EZOA 3JD3A 2LQTA 2LJ2A 2L35A 2P4VA 4B7KA 3CCSV 1OCZB 1NZ6A 3T4ZA 1MG1A 5B1OA 5LMUB 2UXXA 3EHBB 3RBZA 2P5OA 2WLNA 1N36O 1V55C 1VMGA 3ASNB 1VQKV 3AG3B 3RN4A 4JZGA 1AVMA 4I4TA 2UXDO 3RWRD 5CB4A 4L87A 4PI2A 4JF3A 1Z5WA 1L1FA 1GRJA 2W0FC 3SJQC 2WLMA 3L73H 4DK0A 1IDSA 1VF6A 5B3SC 3JCZA 3S3XA 1AJQA 5E1AC 1UJWB 4ZHQB 3BA8A 2FB5A 2OCHA 5L3CA 2W0XA 3OTOB 2PGGA 1ZL8B 3GWOA 3M8AA 2DYRC 3G6EV 1M4UA 2KSDA 2NN4A 4TQFA 3L74H 2YXLA 5L3GA 1OV9A 4GUNA 1SETA 1GO3F 3BCCH 3EVKA 3A8TA 2QM8A 1S3JA 4YHHO 1K3EA 3CCUV 4YY3B 3CJHB 2ZR3A 4X20B 4B3RB 1FXKC 1BE3H 3ZRXA 1YEWA 3ZRWA 4GX1A 2PYJA 2RJZA 4MW8A 3RYCB 1BS3A 4CBCA 5JQGA 2WLLB 3RYIA 2YIAA 4U3JB 1G4YB 2NLJC 4LNUA 3JSLA 1OCCB 1SZTA 3JSNA 3L72H 1I7FA 1M57C 3B8MA 2ADQB 1FAFA 1KKCA 2HLDG 1K8AW 2A3QA 2YS8A 3H1LH 2QM4A 4JV5B 1MMMA 2WLIA 1AR4A 1AI6A 3OAAG 2Q0OC 3R65A 3MHSC 4RAIA 2UUAO 4H33A 4DV6O 2ITCC 4O4HB 3BABA 5H6QA 3CRAA 5KHHA 1M56C 1R6TA 5K1PA 4LWSB 2QGNA 2EILC 3K04A 3BY6A 4X1IB 4DW1A 2QWRB 5IJ0B 2CAZC 4YJ2A 5LOVA 4TUYA 1PNKA 1QQCA 2VS0A 3T1HO 1HR0B 5C8YB 3JAKA 1H2KA 5B1AB 1ZWIC 4PDMA 2JRIA 5H6RA 1IBMB 3VQVA 4NTYA 2IM9A 2JJ2G 3L71H 4LF8B 1EN6A 5B1BC 3C3SA 3H1IH 5CA0A 4XDLA 1IURA 3E8GA 1XMOO 3J80N 2FMLA 2KKWA 1YVWA 3MD0A 3Q4HA 1RP3B 2CUGA 2R9RB 3VBBA 4GKJB 2E5LB 1V9PA 5BZBA 3KCXA 4MVOA 1YIJV 4FK5C 2Q6AA 4AQYO 5D5PA 5KAIZ 3RYHA 4DYLA 4I0XA 1JX9A 3K58A 3HKBA 3BVOA 4JTDB 3K0GA 3I55V 4DR4B 1VIBA 1WLEA 3SR2C 1YTFB 4JI6B 2ETNA 4UCUA 4UV8A 2YC0A 3E8FA 3R66A 1I0HA 3ABMC 5EIBD 4I55B 1KB9F 3D36C 4OX9B 4KHPB 3DC5A 2CE4A 4DR3B 4YIPA 3O9OA 5TISZ 2JIZG 4X65B 4DR7B 3OTFA 4A5UB 1I94B 2UXNA 1OCRC 1AJPA 2M7WA 1ZLZA 2XNDG 1S72V 1LNQA 4MTOA 5LYJA 3OMNB 5LHGA 5CBGA 4DV3B 4HNAB 2C2AA 3FFQA 1EZVH 1GK9A 3HPLC 2FTKA 3UKMA 4O2BB 1TGOA 2JGUA 2ZDIA 1M9NA 2XASA 2UXBB 4LF9B 1JFFB 2R70A 3BAAA 4J80A 1PV0A 1S0VA 3E35A 4TSFG 2FYUH 4K3AA 1S5JA 2Z5UA 5J2UA 2JVDA 4Q6GA 4FZ0A 3THOA 5CBFA 3W7WA 4MVUA 2YIBA 5EIBC 1XREA 3M7MX 3O65A 2UXCO 1MNGA 2XAJA 3APQA 3STLC 3K3WA 1AB3A 4DRXB 4R50A 3CMEV 3J81N 1VF5B 3CYOA 4W4LA 1N32B 2FKXA 2JGDA 2QWQB 4FFBA 5J9PC 4G27B 1Y4MA 2QWOB 4DR1B 5BR8O 2YXYA 3WB2A 4RWUA 3OEEG 3N2GA 4P30A 1HNXO 1KD1W 3SDLA 2IW5A 5LHHA 3H1JH 2RNBA 4IIJA 5HFLA 2YICA 3ZHUA 1PNMA 1BSMA 3HKCB 3L70H 4LF8O 4TV8B 4J41A 4WFAV 1I5XA 3ZRSA 3W7TA 2OCCC 3A0BZ 4UVCA 3FB6C 1D5NA 2HEPA 1THZA 3B40A 1V55B 1J95A 2ATKC 3UM7A 2CDYA 2IJKA 5CA1A 4JPRA 2Q73A 5J2TB 1VP7A 3OT7A 3H01A 2HG5C 1K7DA 3NR7A 2JK5C 4P9PA 1VQ7V 3DC6A 2QJ1A 2AZ0A 2ZINA 1Q82W 1I5YA 3SPGA 2DWEC 1BHBA 4HAMA 5BMVB 3WB1A 5B3SB 3F5TA 2ZKOA 4LF4B 1XMQB 4C7UA 3OGIB 1J5EO 1K4DC 1YCIA 4HZ3A 3L75H 1FXVA 2B1IA 2DYRB 4K8XA 4H0LB 2DQ3A 4E4EA 4UVBA 1MABG 1K5QA 1R3KC 2V1DA 5ITZB 2BSKA 3CRCA 2NR5A 2BE3A 4O2AB 5JJNB 4ZOLB 1FD9A 4FLWA 3K79A 1NU1H 3PN1A 1FXKB 5KHKA 4NXMO 2VQEO 2BOBC 1SA0B 1PL4A 1K92A 2PYLA 2F1MA 1DGSA 4PDLA 1N36B 2Q7EA 1UPGA 2HP8A 3RGBA 1K34A 4ZI7A 1AP5A 5LA6A 1NKDA 5DN6G 1M57B 2UXDB 3JAWA 2Q0AA 3ABLC 1CPYA 3QO7A 2W6JG 3ZX6A 4ASUG 3OMIB 1NTMH 1Q8IA 1L0NH 1IXBA 1VF6C 4FFKA 1YSCA 5HFMA 3JCUZ 1G6UA 2EX3A 3K0DA 2XTAA 3ZHVA 4UCSA 4F6RB 3E89A 3QG5A 3ZHSA 1S77D 4B3TB 1Z5VA 2GUZB 1M56B 2EILB 3H9VA 2UUBO 2A79B 2ZM6O 3UT5B 3SPJA 4WBNB 4TT3G 4G2KA 3E22B 2F4VO 4JAAA 1SZXA 1FFXB 4YHHB 2YI9A 3CCMV 2N05A 1K73W 4B3MO 2VWKA 4JI5O 4QGPA 1JJ2U 3T1YO 1TVKB 5GONA 4J7KA 1YI2V 5DEDA 1MSWD 4BW9A 2QM7A 5B1BB 3F7YC 3CHXA 4UUJC 2WAMA 2IJHA 1FFTB 2AZ2A 1PPJH 4ZHQA 1N34B 4LF5O 3BA9A 2GTAA 1W0KG 5KX5A 1XNRO 4DXWA 1KBHA 4MVZA 3BEHA 1QNMA 2VWJA 5BXZA 4LP8A 1FJGB 3ZMVA 3CJHA 4DV6B 4EEQA 5L3DA 5LGUA 1MSDA 3A0RA 1CP9A 3A0HZ 3CC7V 1BMFG 4UCVA 1SKVA 1U96A 1E1RG 1YF2A 5KLVH 3K5MA 3ABMB 3T1HB 3G6BA 3FB5C 3WU2Z 1XMQO 4MVQA 5EBWC 4DV5O 5IYZB 5JH7A 3ZMZA 2BTOA 4TV9B 3EFFK 1VQNV 2DWDC 4O4LB 5GTIZ 1OCRB 1E1QG 4X64B 5KHIA 1RSOB 1HW7A 1H2NA 5KMGB 3RYFB 1NTKH 4PDVA 3OUSA 4B7EA 4UXNA 2HJDA 1XMOB 1Y66A 1VQ4V 2HVJC 1V54C 2IBZH 4O4HA 2DW4A 3JD1A 2X0LA 4LWSA 4FLYA 2Q68A 3CRRA 4HBNA 4DV7O 3NXSA 2Y48A 1GMGA 2QE7G 2ZE7A 5IJ0A 1K5SA 2XOKG 5LHIA 1Y74B 4X1KB 4IL6Z 4AQYB 3VQYA 4TOIA 2OTLV 1ZSPA 4DK1A 3DXRB 2V7QG 2YEVA 3ABUA 3MAQA 1WA8A 4H13B 3W7XA 4I50B 3WB0A 4K35A 2QDOA 2P90A 4X89A 1F4NA 4QE7A 3IC9A 1WN7A 1O9GA 2A7WA 3CCQV 3HKDB 2F23A 4GX5A 4X8AA 4LR3A 3UO3A 4JI7O 1EN4A 4X1YB 3JATB 2XHBA 2DQ0A 4NXNO 4I5SA 4B3TO 3CB2A 4DW0A 2HVKC 1XOUA 1N4CA 4ZKIA 4DUZO 3JARA 1QVGU 3K06A 4ZBMA 2F95B 4ABMA 3FB7C 3ZS8C 4WFBV 4QE9A 3TXQA 1PNLA 4GLXA 2ZDIC 2Q4PA 2H94A 1SESA 1EN5A 1JA8A 1Q5OA 3SJAC 1VARA 3TCUA 1EM1A 2CK3G 2OIEA 2OCCB 3JD0A 1N34O 3FB8C 1SS3A 1H8EG 4TQDA 4P2ZA 5F2VO 1M93A 3AG7A 1IZ3A 1Q90D 1BZKA 4R6ZA 2A06H 4D7SA 1QLNA 4U7OA 5LGTA 4O4IB 4NVPA 1Q3EA 4X66O 2ODMA 2E76B 3CCRV 2ZQMA 1CEZA 4IT5A 2UXCB 1FJGO 4HNAA 3ICXA 3JASB 1Z2GA 5L3EA 1G8MA 1H8HG 1JMKC 2IU0A 2YDEA 3D3IA 3HKEA 4IHJB 3QO5A 3N2KA 1YHQV 1M5IA 5BR8B 5EYPA 1P7BA 4AHCA 1EZJA 3ASOC 5IYDO 3ZHRA 1HNXB 4Z1MG 1MOFA 1OCOC 1R73A 4NB5A 1NT2B 3VQXA 4X64O 5FPOA 5IYBO 4JI2O 4AI8A 2Q69A 2IH3C 1IBKO 3IJ4A 3U10A 2WLJA 2WWWA 2VRZA 4KFMA 4I4TB 3BPZA 4K8ZA 1KQSU 1JPXA 1XHXA 4GX0A 2Q5ZA 2WPDG 4CS2A 5CB4B 1US6A 2PZSA 3P3PA 2LO1A 2CTQA 2CTRA 1T5EA 3ABLB 1D2DA 2P06A 4WFHA 3CWBH 1S5LZ 1XL6A 5IWAO 1VQOV 5EK0A 2BTQA 1QR8A 4JI3O 2QKSA 1N8RW 1J5EB 3ZMTA 1YJNV 1VEWA 2Y0IA 3SPCA 3B2EE 1SERA 3E8HA 1X59A 2E3CA 4JYBA 1K97A 1Y6XA 4DV4O 2AXTZ 3LUTB 4JI4B 2WLKA 4YIOA 1P4RA 5B66Z 2DJVA 4Q20A 2B5UA 3F5WC 4BR6A 5EC2C 5J2TA 4NKGB 3VQWA 2P6JA 3CC4V 1OZ0A 4NXMB 2VQEB 4UB6Z 3SPHA 3ETGA 5KA6A 1AROP 2LFRA 1R1BA 3RYIB 5BMVA
chains in the Genus database with same CATH topology
4MW3A 2DYRB 1S5HC 4HYOA 3ETEA 3OEHG 4QJFB 3LDEA 3WG7C 1Q81W 1NH2B 2DQ3A 4UVBA 2XAGA 3AG1B 3RVZA 3P30A 1MABG 4FJCC 1PKXA 1K5QA 1R3KC 2V1DA 3ABKC 3OGCC 2Y69C 1DLBA 3K79A 2X6BA 3W7SA 2B1GA 2ITDC 1F4MA 4G28B 1FXKB 4X88A 4GT1A 3JD4A 2BOBC 3E83A 3LSSA 3T4DA 4PA7A 1AR1B 1K92A 1NQTA 1RPOA 4FMTA 1TUEB 4I9WA 1DTOA 3T1CA 5B1NA 3SYOA 4PDLA 1EFRG 2GHYA 3ZIAG 3JYCA 5EBLC 1K34A 1NH2D 3SYCA 2HR3A 4J9YB 5DN6G 1NKDA 4F4LA 1M57B 4RQEA 1KKDA 3ZMSA 3ABLC 1QVFU 1CPYA 3QO7A 2W6JG 1VQ6V 4QNHB 4ASUG 2QEXV 3OMIB 1VQ9V 3PJSK 3X2QB 3LDDA 4RQFA 4WFFA 4LBEC 2JJ1G 2EZOA 4MTFA 3IC7A 3JD3A 1KP3A 1YSCA 5HFMA 4XBFA 3CCSV 1OCZB 3LDCA 3T4ZA 3SPIA 4GCZA 1MG1A 3K0DA 5B1OA 2YEVB 2JEUA 1DF4A 3E89A 2UXXA 3EHBB 3LSQA 3RBZA 4QIWF 4H37A 2WLNA 1S77D 5FL7G 1PD3A 1V55C 3ASNB 1M56B 1VQLV 1VQKV 2EILB 1JCHA 3AG3B 3CMAV 1K33A 2YSUB 2A79B 1V54B 3SPJA 4TT3G 3K03A 2XAFA 3OUFA 1IXMA 4G2KA 4L87A 1GTOA 5LGNA 1NR1A 4JF3A 2AHYA 3CCMV 1ROPA 4P9OA 1GM8A 1L1FA 2W0FC 3SJQC 1K73W 2P67A 3ML0A 2ZD9A 5EC1C 2WLMA 4OXSA 4BIUA 5B3SC 1JJ2U 3JCZA 1UJWB 1AJQA 5E1AC 5KUKA 3CPWU 2EIJC 1YI2V 3K08A 5L3CA 3MHHC 4FIPC 2EINC 3GWOA 2KB1A 1MSWD 5GW7A 2DYRC 3G6EV 2QM7A 5B1BB 3F7YC 4UUJC 2WAMA 2IJHA 4PELA 1FFTB 5L3GA 3AG1C 4JGSA 1SETA 1GO3F 1GM7A 1DF5A 1W0KG 2LFSA 3ZRWB 2QM8A 1QLEC 1S3JA 1VQ8V 1K3EA 4U7NA 5KUMA 3CCUV 3RW0A 4DXWA 2AHZA 4GX2A 2PI4A 2ZR3A 3P32A 1FXKC 2W6IG 2WSSG 3ZRXA 4WCEV 1F51A 3ZRWA 3ZRVA 4GX1A 4MVZA 5EBMC 3BEHA 4LP8A 4MW8A 2XAQA 3ZMVA 3OMAB 2QA4V 4CBCA 1R3JC 5L3DA 5LGUA 2F43G 5L3BA 2R9IA 1CP9A 1WPXA 2IJIA 2H8PC 2WLLB 3A0RA 4JASA 1Q7YW 3CC7V 5CN0A 1G4YB 2NLJC 5IYCO 1BMFG 4EKWA 4MSWC 3CCVV 4JTCB 1OCCB 1SZTA 3B77A 1NJIW 1E1RG 1YJWV 2WLIB 2HJFC 1M57C 3B8MA 1NVPD 3ABMB 2DYSB 4E2LA 3FB5C 1BL8A 4JTAB 2HLDG 5DM6V 4DO2A 1K8AW 4MVQA 3LNMB 5EBWC 3X2QC 2EIKB 3STZC 3B8NA 4UVAA 3CC2V 1R3IC 2WLIA 3ZMZA 4MS2A 4JAUA 1AI6A 1FXKA 3OAAG 3EFFK 1VQNV 2DWDC 3R65A 2X6CA 3MHSC 1OCZC 4RAIA 1JVMA 1OCRB 3D36A 1E1QG 4H33A 2ITCC 5H6QA 5LBQA 1KECA 3ASNC 4PDVA 1M56C 3K04A 2EILC 3AG3C 3OUSA 1H2GA 1AI4A 4UXNA 3BY6A 1K4CC 1Y66A 1VQ4V 2HVJC 1V54C 3G4SV 2EJRA 1VQ5V 1GKFA 1VQMV 1AI7A 3SYQA 2DW4A 1PNKA 3JD1A 4XDKA 2X0LA 2D3OW 2JEXA 3JD2A 2Q68A 4PA6A 5B1AB 1ZWIC 5C93A 3DGEA 3NXSA 2Y48A 3SYPA 3CXCU 1GMGA 2QE7G 2EIMB 4PDMA 1K5SA 2XOKG 5H6RA 5LHIA 1M90W 4FPPA 2PI5A 2ZXWB 2OTLV 5IDJA 2JJ2G 3AEIA 2IU3A 2V7QG 2YEVA 3ABUA 3ETDA 2EBOA 1JQ0A 5B1BC 3W7XA 4YXWG 4XDLA 3E8GA 2P90A 1B6QA 5CBHA 3ASOB 4X89A 3MD0A 1F4NA 3AG2B 3GB7C 4QE7A 1YJ9V 2R9RB 1OCOB 1W0JG 3VBBA 3CCQV 4GX5A 4PA3A 4X8AA 2JDIG 5BZBA 3CP1A 4MVOA 1YIJV 4FK5C 2Q6AA 3M99B 2DQ0A 4I5SA 4BIZA 1JX9A 3K9AA 2P7TC 2HVKC 1QCEA 4JTDB 3K0GA 3I55V 1WLEA 4WFGA 1YTFB 4N21A 4ZKIA 3IGAC 2OTJV 3KG2A 4MVSA 3CCJV 1QVGU 4UV8A 3K06A 4ZBMA 1OCCC 3RVYA 3FB7C 3E8FA 4WFBV 4QE9A 1PNLA 1QBZA 3ABMC 2DYSC 2ZDIC 4J9ZB 2H94A 1SESA 3AG4B 1E79G 2ZR2A 1K9MW 1OHHG 1M1KW 2EIKC 2OT5A 5KA5A 1KC8W 1Q86W 3TCUA 3ZN0A 2JIZG 1H38A 1R6KA 2CK3G 1HWYA 3JD0A 2OCCB 3FYEB 4N23A 4MTGA 2UXNA 4MVRA 1OCRC 4RUEA 1AJPA 3FB8C 1VQPV 1H8EG 3CD6V 2M7WA 5IY5B 3E86A 4P2ZA 1NR7A 2IJJA 2XNDG 1S72V 1LNQA 4MTOA 3OE7G 4RO2A 1YTFD 2WLLA 4R6ZA 3OMNB 5LHGA 5CBGA 1RM1B 2C2AA 3ZJZA 1QLNA 4U7OA 5LGTA 1GK9A 3HPLC 4PDRA 3CCEV 2FTKA 3UKMA 3CCRV 2ZQMA 1CEZA 1QLEB 5B1AC 2ZDIA 4QPJA 1M9NA 2XASA 2EIMC 5L3EA 3IFXA 1S0VA 3QO8A 1G8MA 1H8HG 4MTXA 2IU0A 3E35A 4TSFG 3TETA 1AI5A 2HFEC 2ZXWC 4CZZA 3WG7B 4BW5A 3D3IA 3QO5A 1JOYA 1EBOA 2Z5UA 2BOCC 1YHQV 1SRYA 3ABKB 5CBFA 3W7WA 1P7BA 3E8BA 1EZJA 2Y69B 3OR6C 4MVUA 1F23A 3ASOC 5IYDO 3OM3B 3AG2C 2A0LA 4Z1MG 4LC1A 4MT8A 2GSMB 5L3FA 1MOFA 4PA9A 1OCOC 1R73A 3W7UA 2Q67A 4WFEA 2XAJA 3DTUB 3STLC 3K3WA 1BHAA 5H9CA 2HKOA 4QPKA 4R50A 1R6NA 5IYBO 3CMEV 3OFNG 2NNUA 2Q69A 2IH3C 3CYOA 3ABTA 4UV9A 2XAHA 4JYCA 5J9PC 4G27B 2WLJA 2WWWA 4KFMA 3I56V 1Y4MA 3ZMUA 3FKSG 1FXHA 4PA4A 1KQSU 2IH1C 1JPXA 2MK3A 5CMUA 2K1EA 4GX0A 3HB3B 4BAYA 1RPRA 2WPDG 1FS0G 2EZPA 1NBMG 3OEEG 4P30A 1GM9A 3ABLB 3VOUA 4MVMA 1KD1W 1ORQC 4WFHA 1XL6A 3SYAA 1VQOV 5EK0A 3ZN1A 2IW5A 3AG4C 4KP4A 5LHHA 1XL4A 1QR8A 5CA3A 4RUFA 3OR7C 3WFVA 2WLHA 5HFLA 2QKSA 4KUMA 1N8RW 1YITV 1PNMA 3ZMTA 3OW2U 1YJNV 4WFAV 4XDJA 1S76D 1I5XA 3ZRSA 3W7TA 2OCCC 4UVCA 3FB6C 2QTOA 2Z3YA 1THZA 3SPCA 2X6AA 1SERA 3E8HA 1V55B 3E2EA 1J95A 2ATKC 3FYIB 4TWKA 3UM7A 4JYBA 1K97A 2LP7A 2IJKA 4R7CA 1KP2A 5IY5C 2X7RB 4JPRA 3G71V 3LUTB 3H01A 1QR9A 1ENVA 2HG5C 2WLKA 1K7DA 1RM1C 1P4RA 2JK5C 3T2MA 4P9PA 1VQ7V 3TK1A 1NVPB 1R3LC 1Q82W 4Q20A 1I5YA 2B5UA 3F5WC 5EC2C 3SPGA 2DWEC 1W2BU 1BHBA 2P6JA 4HAMA 3CC4V 3ZCCA 1OZ0A 5B3SB 1PL0A 3SPHA 3CCLV 4JAVA 4LCUC 4WF9V 3QNEA 3ETGA 2EIJB 1K4DC 5KA6A 2A9HA 1AJNA 4HZ3A 1COWG 1AROP 2EINB 3F7VC 2LFRA 4R8CA 1FXVA 2B1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW3 A;  4BW5 A;  1S5H C;  2KB1 A;  4HYO A;  3LDE A;  3WG7 C;  2DYR C;  2YEV A;  3F7Y C;  4UUJ C;  5B1B C;  2BOC C;  3RVZ A;  3AG1 C;  1R3K C;  4XDL A;  3ABK C;  5CBF A;  3OGC C;  3E8G A;  1P7B A;  3E8B A;  5CBH A;  3OR6 C;  4MVU A;  4X89 A;  2Y69 C;  3ASO C;  1QLE C;  3AG2 C;  3GB7 C;  4QE7 A;  2A0L A;  2R9R B;  2X6B A;  5KUM A;  4PA9 A;  3RW0 A;  1OCO C;  2ITD C;  4DXW A;  2AHZ A;  4GX2 A;  4G28 B;  4GX5 A;  4PA3 A;  4X88 A;  4X8A A;  2Q67 A;  4WFE A;  3STL C;  5BZB A;  4MVO A;  2BOB C;  3E83 A;  3T4D A;  4PA7 A;  4GX1 A;  4MVZ A;  5EBM C;  2Q6A A;  3BEH A;  4R50 A;  4I9W A;  4LP8 A;  4MW8 A;  2Q69 A;  2IH3 C;  3T1C A;  2P7T C;  5J9P C;  2HVK C;  4G27 B;  2WLJ A;  3K0G A;  4JTD B;  3SYO A;  4CBC A;  1R3J C;  4KFM A;  4PDL A;  4WFG A;  3JYC A;  2WLL B;  2H8P C;  5EBL C;  4PA4 A;  2IH1 C;  2K1E A;  4GX0 A;  1G4Y B;  2NLJ C;  3IGA C;  3SYC A;  3KG2 A;  4EKW A;  4MSW C;  4MVS A;  4JTC B;  3K06 A;  4J9Y B;  4ZBM A;  1OCC C;  2WLI B;  3RVY A;  2HJF C;  4F4L A;  3FB7 C;  3E8F A;  1KKD A;  1M57 C;  4P30 A;  4QE9 A;  3VOU A;  4MVM A;  1ORQ C;  3ABL C;  4WFH A;  3ABM C;  2DYS C;  1BL8 A;  3FB5 C;  4JTA B;  4J9Z B;  1XL6 A;  3SYA A;  4QNH B;  3PJS K;  5EK0 A;  3AG4 C;  3LDD A;  3LNM B;  4MVQ A;  1XL4 A;  4WFF A;  5EBW C;  4LBE C;  3STZ C;  3X2Q C;  4MTF A;  2EIK C;  1R3I C;  2WLI A;  4RUF A;  4MS2 A;  3OR7 C;  3TCU A;  2WLH A;  3EFF K;  2QKS A;  2DWD C;  3LDC A;  3T4Z A;  3R65 A;  2X6C A;  3SPI A;  1OCZ C;  3K0D A;  4XDJ A;  4RAI A;  3ZRS A;  1JVM A;  2OCC C;  3E89 A;  4MTG A;  4MVR A;  1OCR C;  3FB6 C;  4H33 A;  2QTO A;  3RBZ A;  4RUE A;  4H37 A;  2WLN A;  2X6A A;  2ITC C;  3E8H A;  3FB8 C;  1J95 A;  2ATK C;  4TWK A;  1V55 C;  3UM7 A;  3E86 A;  4P2Z A;  4R7C A;  3ASN C;  4PDV A;  1M56 C;  5IY5 C;  1LNQ A;  3K04 A;  2EIL C;  3AG3 C;  3OUS A;  4MTO A;  3LUT B;  4RO2 A;  2A79 B;  2WLL A;  4R6Z A;  2HG5 C;  1K4C C;  5CBG A;  2HVJ C;  1V54 C;  2WLK A;  3SPJ A;  3ZJZ A;  3K03 A;  3OUF A;  2JK5 C;  3SPC A;  3SYQ A;  3HPL C;  4PDR A;  4P9P A;  3T2M A;  4XDK A;  3UKM A;  1R3L C;  2AHY A;  4P9O A;  3F5W C;  2Q68 A;  5EC2 C;  2W0F C;  4PA6 A;  3SPG A;  1ZWI C;  3SJQ C;  2DWE C;  5B1A C;  3SYP A;  2ZD9 A;  4PDM A;  5EC1 C;  2WLM A;  2EIM C;  4OXS A;  3SPH A;  5B3S C;  4LCU C;  3IFX A;  5E1A C;  5KUK A;  1K4D C;  2A9H A;  2EIJ C;  4HZ3 A;  3F7V C;  3K08 A;  3TET A;  2HFE C;  2EIN C;  2ZXW C;  4R8C A; 
#chains in the Genus database with same CATH topology
 4HYO A;  5FNV A;  4UCT A;  3LDE A;  4LNU B;  2GV9 A;  1U97 A;  2P4K A;  1AR5 A;  1OJH A;  3UCS C;  3W7S A;  2B1G A;  4DUY O;  1F4M A;  4X88 A;  2UU9 B;  4AIL C;  4GT1 A;  5ITZ A;  4JYY A;  3J7A U;  2ZE5 A;  3CE2 A;  3TGU H;  3LSS A;  1MZE A;  1NQT A;  4I9Q A;  1GN6 A;  4O2A A;  2B9Z A;  4I9W A;  5JVD A;  4DV2 O;  3SYO A;  1WNS A;  2CH7 B;  3ZIA G;  3AK1 A;  1SQB H;  4OPA A;  5EZY A;  5B5E Z;  4YJ2 B;  2QWP B;  3SYC A;  5LOV B;  1NH2 D;  4TUY B;  3CRM A;  2UUB B;  5JJE B;  2HR3 A;  4J9Y B;  2ZM6 B;  4F4L A;  4RQE A;  3JAK B;  1KKD A;  2F4V B;  4DR6 O;  4EB6 A;  1DK1 A;  4JYA O;  2D2C B;  2QEX V;  4B3M B;  2JJ1 G;  4MTF A;  4JI5 B;  3RFR A;  4XBF A;  3T1Y B;  4FLU A;  4GCZ A;  1WB8 A;  1TUB A;  3A2F A;  2JEU A;  1DF4 A;  3LSQ A;  4QIW F;  4H37 A;  5LP6 A;  5FL7 G;  1PD3 A;  5CA0 B;  2ILM A;  1JCH A;  1YXB A;  1K33 A;  2YSU B;  1XI1 A;  4LF5 B;  4JI0 O;  1V54 B;  3SJB C;  4F6R A;  3Q4H B;  3K03 A;  1GTO A;  1HDJ A;  1NR1 A;  1ROP A;  4P9O A;  1XNR B;  2P67 A;  2ZD9 A;  5EC1 C;  3RYH B;  3UT5 A;  4I0X B;  5IJ9 A;  3HKB B;  1XHZ A;  2R9A A;  4YJ3 B;  4FIP C;  4IGG A;  2KB1 A;  1Y76 A;  4J7J A;  4PEL A;  3JAM N;  3AG1 C;  4JGS A;  4J11 A;  2LFS A;  3SJC C;  4J7Z A;  1VQ8 V;  4NR1 A;  1N0J A;  4U7N A;  1G1X B;  3RW0 A;  2AHZ A;  2PI4 A;  3P32 A;  4DV5 B;  1XNQ O;  4UFZ A;  2HHH O;  2GTS A;  4WCE V;  3U11 A;  2F93 B;  3KZI Z;  2XAQ A;  3OMA B;  2QA4 V;  4CH5 A;  3H1H H;  2F43 G;  5L3B A;  2R9I A;  2IJI A;  4O4J A;  5LYJ B;  2H8P C;  4JI4 O;  5A2Q N;  4DR5 O;  5CN0 A;  4GYC B;  3CCV V;  5A9G A;  1NJI W;  2HJF C;  4BIO A;  3JAL B;  4E2L A;  1BL8 A;  4JTA B;  5DM6 V;  4DV7 B;  2LW7 A;  4LF6 O;  2QKC A;  2OYQ A;  2RMK B;  3X2Q C;  4UVA A;  3CC2 V;  1F7Y A;  3FX7 A;  1R3I C;  4MS2 A;  4ZIB A;  3EXA A;  4DV0 O;  3D36 A;  5J2U B;  2F66 C;  4TV9 A;  5LBQ A;  5IE9 A;  1KEC A;  1IBL B;  4O4L A;  1H2G A;  1K4C C;  4FM0 A;  3TXS A;  1VQ5 V;  1VQM V;  2UU9 O;  2YXH A;  2OIG A;  3LSU A;  2JEX A;  3JD2 A;  4JZ2 A;  3GVM A;  3SYP A;  1UFI A;  4JI7 B;  1M90 W;  1SQX H;  2JGD B;  4FFB B;  4NXN B;  2YI8 A;  3CSX A;  4UCO A;  4LF7 O;  2IU3 A;  2EBO A;  2PF4 E;  5FPR A;  4YXW G;  1HNZ O;  4DUZ B;  1B6Q A;  2QKA A;  3ASO B;  3DXR A;  3GB7 C;  1Y67 A;  2L6L A;  1H2M A;  1OCO B;  1W0J G;  4I50 A;  1XUQ A;  4IIJ B;  2JDI G;  3CP1 A;  4BIZ A;  3K9A A;  4NTX A;  4B08 A;  2P7T C;  5CA1 B;  1QCE A;  1TAE A;  2OWO A;  4CH4 A;  1L8D A;  5AG2 A;  1BCC H;  1SQF A;  1ZL8 A;  3JAT A;  2VQF B;  1JR9 A;  3RT3 C;  3IGA C;  2OTJ V;  3KG2 A;  4MVS A;  3CCJ V;  1Q6I A;  2AGA A;  4CC6 A;  4UB8 Z;  4X66 B;  2DYS C;  4J9Z B;  1E79 G;  4JI1 O;  2ZR2 A;  1K9M W;  4LFC O;  1OHH G;  2EIK C;  2OT5 A;  2RQ6 A;  1KC8 W;  2ZE8 A;  4X20 A;  1R6K A;  1HWY A;  1ZAU A;  3FYE B;  4CS4 A;  3RYC A;  3E86 A;  3KCY A;  4LFB B;  2IJJ A;  3OE7 G;  4RO2 A;  1SF9 A;  4Z1V A;  2WLL A;  1IX9 A;  4U3J A;  1XQ8 A;  4I7Z B;  2N74 A;  3CEI A;  1QLE B;  4QPJ A;  2EIM C;  4X62 O;  4F6E A;  3IFX A;  4O4I A;  4CH6 A;  2GBO A;  3QO8 A;  3H1K H;  4JI2 B;  2RN9 A;  1IBK B;  3TET A;  2HFE C;  2ZXW C;  3P3N A;  3ETQ A;  1GH6 A;  4ZI7 B;  1JOY A;  1EBO A;  2BOC C;  5LA6 B;  1SRY A;  4NYK A;  4K0K O;  1SQQ H;  3JAW B;  3E8B A;  3OR6 C;  4L8J A;  2N04 A;  5GTH Z;  3AG2 C;  4X1I A;  2A0L A;  4LFA O;  4MT8 A;  2PTM A;  1P49 A;  5IWA B;  3C3T A;  4PA9 A;  2Q67 A;  4WFE A;  5C8Y A;  2XT9 A;  2PUS A;  2QR4 A;  1BHA A;  2HKO A;  4JI3 B;  4FLX A;  1HNW O;  5H2F Z;  2P22 C;  3G67 A;  2NNU A;  5LXT B;  4UV9 A;  3ABT A;  1IBL O;  2XAH A;  4JYC A;  2PY5 A;  3ZMU A;  3FKS G;  1NI8 A;  2YIB D;  2IH1 C;  2K1E A;  4D7T A;  4DV4 B;  4BAY A;  1RPR A;  1FS0 G;  1KMI Z;  1NBM G;  3VOU A;  1SC5 B;  2ZIO A;  4MVM A;  4GKK O;  1ORQ C;  5LMN O;  3SYA A;  3ZN1 A;  1QU7 A;  3AG4 C;  4KP4 A;  1XL4 A;  1WP8 A;  5GON B;  3IAY A;  2WLH A;  4KUM A;  3CX5 F;  4XDJ A;  1S76 D;  3UO2 A;  2QTO A;  2X6A A;  3E2E A;  4Z2W A;  4U3F H;  2LP7 A;  4R7C A;  1KP2 A;  5IY5 C;  3G71 V;  2V4D A;  1WP7 A;  1QR9 A;  4PHZ A;  5DEC A;  2ADP A;  5KX5 B;  1RM1 C;  1CXZ B;  3BFR A;  4PJ0 Z;  1GN2 A;  1NVP B;  2MW2 B;  4DUY B;  2YID A;  4I55 A;  2R72 A;  1PL0 A;  3CCL V;  4JAV A;  4LCU C;  1SQG A;  3F7V C;  2VQF O;  4DV2 B;  4R8C A;  4MW3 A;  4QJF B;  1S5H C;  3OEH G;  3WG7 C;  1NH2 B;  2UUC O;  3AG1 B;  3P30 A;  1PKX A;  2LGQ A;  3ABK C;  3OGC C;  3FAV B;  2Y69 C;  4FM2 A;  1H2S B;  4DR6 B;  2KG7 B;  4JYA B;  5JH7 B;  3D8C A;  4G28 B;  2JS3 A;  1BQZ A;  3E83 A;  4O2B A;  3T4D A;  4PA7 A;  5JCO A;  1TUE B;  1NTZ H;  1DTO A;  1JFF A;  2FL4 A;  5LP6 C;  4LFB O;  3T1C A;  3B4S A;  5B1N A;  3I5D A;  1ZUQ A;  1EFR G;  2GHY A;  1L0L H;  1ZX3 A;  2ZNI A;  3JYC A;  5EBL C;  4DR2 O;  1XBL A;  1KU9 A;  4CC5 A;  4JI0 B;  3QTC A;  3AK2 A;  3ZMS A;  2CH7 A;  1VQ6 V;  1SQP H;  3X2Q B;  3LDD A;  4RQF A;  4WFF A;  4LBE C;  3IC7 A;  1KP3 A;  3L9D A;  3AK3 A;  3LDC A;  2CGN A;  3SPI A;  1XDC A;  4FM1 A;  4JI8 B;  4B3S B;  3FD9 A;  2YEV B;  5LL6 Y;  1WA8 B;  4DRX A;  2Z0A A;  2Q7G A;  1VQL V;  3CMA V;  3C90 A;  3ZBH A;  5FLX N;  1N33 O;  2EUL A;  2XAF A;  1O9H A;  1IXM A;  3OUF A;  5LGN A;  2AHY A;  3DSQ A;  1GM8 A;  3B09 A;  3ML0 A;  2EJ7 A;  1XNQ B;  2HHH B;  4OXS A;  4BIU A;  2RDC A;  5KUK A;  2DOS A;  2M6Y A;  1MA1 A;  3CPW U;  2EIJ C;  1BT8 A;  3S3W A;  3G80 A;  3K08 A;  5LMU O;  3MHH C;  2EIN C;  4EFB A;  3HKC A;  4TV8 A;  2WA3 A;  5GW7 A;  3JAR B;  1H2L A;  2Q8V A;  1URF A;  1YZB A;  1Q43 A;  4DR5 B;  4YJ3 A;  1GM7 A;  1DF5 A;  3ZRW B;  2Q9L A;  1QLE C;  1WJZ A;  3BRC A;  5KUM A;  4EFE A;  3CRQ A;  4LF6 B;  2KQX A;  4GX2 A;  2E75 B;  2W6I G;  2WSS G;  5JQG B;  1F51 A;  1P84 F;  3ZRV A;  5EBM C;  4DV0 B;  3OD4 A;  3QVN A;  2CGO A;  3OTO O;  5D5Q A;  1R3J C;  1WB7 A;  2LGW A;  1Q7Y W;  1WPX A;  4JAS A;  5IYC O;  3K57 A;  4EKW A;  4MSW C;  4JTC B;  3B77 A;  1YJW V;  2WLI B;  1NVP D;  3K59 A;  2DYS B;  3ZED A;  4YY3 O;  4DO2 A;  4ZOL A;  2WA4 A;  3LNM B;  4B3R O;  2DE0 X;  2EIK B;  3B8N A;  3STZ C;  4JAU A;  1FXK A;  3JAL A;  2X6C A;  1OCZ C;  1SA0 A;  3HKE B;  1JVM A;  3N2K B;  4LF7 B;  5EYP B;  2G38 A;  3ASN C;  3AG3 C;  1HNZ B;  2ZNJ A;  1AI4 A;  5K1X A;  3G4S V;  2EJR A;  1GKF A;  1AI7 A;  1A32 A;  3SYQ A;  3LNN A;  4XDK A;  2D3O W;  4PA6 A;  3UQ8 A;  5C93 A;  3DGE A;  3CXC U;  4JV5 O;  2EIM B;  3CXH F;  4FPP A;  4J10 A;  2GDS A;  2PI5 A;  1D5A A;  2ZXW B;  5IDJ A;  3AEI A;  4CS3 A;  3N27 A;  4ICG A;  3ETD A;  1PP9 H;  1LUV A;  1JQ0 A;  4NTW A;  2GUZ A;  5CBH A;  3AG2 B;  2ARH A;  1HP8 A;  1YJ9 V;  1Q6H A;  1HR0 O;  2BTQ B;  4WBN A;  3D3Q A;  3E22 A;  1BQ0 A;  4JI1 B;  5JJJ B;  4PA3 A;  4LFC B;  1FFX A;  4JI8 O;  1LR1 A;  4B3S O;  1B3Q A;  1IBM O;  3M99 B;  5JWP A;  1N0N A;  4H44 B;  1TVK A;  4PI0 A;  4WFG A;  4N21 A;  1PM9 A;  4D6T H;  1QHT A;  4UCR A;  1OCC C;  3RVY A;  1B04 A;  1VF7 A;  1GN4 A;  4BWA A;  1QBZ A;  3AG4 B;  4OGQ B;  4GKJ O;  2E5L O;  1M1K W;  5KHJ A;  3K9S A;  5KA5 A;  4X62 B;  2RCV A;  1Q86 W;  3ZN0 A;  4DV1 B;  1H38 A;  5FNV B;  4FLZ A;  4IYI A;  4N23 A;  3SGI A;  4MTG A;  4MVR A;  4RUE A;  3CD6 V;  1VQP V;  4DR4 O;  5IY5 B;  1FPO A;  4JI6 O;  4PV1 B;  1NR7 A;  3APO A;  3GWK C;  1KYO F;  1YTF D;  4K0K B;  2YUA A;  1RM1 B;  1I08 A;  1NS1 A;  3ZJZ A;  4IYH A;  4PDR A;  3CCE V;  2LW1 A;  4LFA B;  5E79 Z;  3HR0 A;  4PD4 F;  3CS5 A;  5B1A C;  4OX9 O;  4KHP O;  4DR3 O;  1MZF A;  2Y4U A;  5JVD B;  4X65 O;  2DMX A;  5IYZ A;  4DR7 O;  1HNW B;  4MTX A;  2H3O A;  1I94 O;  1AI5 A;  4CZZ A;  1XEQ A;  3WG7 B;  5EZY B;  4BW5 A;  1JJO A;  1B06 A;  1IVS A;  4OPH A;  1TA8 A;  1RSO A;  5KMG A;  3ABK B;  3RYF A;  5KAF Z;  4FLT A;  4EB6 B;  1AP6 A;  2Y69 B;  4DV3 O;  2CTW A;  1F23 A;  3OM3 B;  1W59 A;  4GKK B;  4LC1 A;  2GSM B;  5L3F A;  5LMN B;  5KHG A;  3W7U A;  1LUW A;  1X4T A;  3DTU B;  4X9Q A;  5H9C A;  1TUB B;  2UXB O;  3QF7 A;  4LF9 O;  4QPK A;  1R6N A;  3OFN G;  5LP6 B;  1Y74 A;  4X1K A;  1KUQ A;  3N2G B;  2AW9 A;  3I56 V;  1FXH A;  4PA4 A;  2O57 A;  2MK3 A;  5CMU A;  3K5L A;  3HB3 B;  5H5N A;  5LXT A;  2Y0P A;  2EZP A;  1FYJ A;  2QWN B;  2ZE6 A;  2ZT9 B;  1GM9 A;  2ZCE A;  2JS5 A;  2QTS A;  5IJ9 B;  5CA3 A;  4FZ1 A;  4RUF A;  3HKD A;  3OR7 C;  3WFV A;  3K5O A;  1YIT V;  3OW2 U;  1N32 O;  4X1Y A;  1Y76 B;  4W4K A;  2Z3Y A;  5BY1 A;  4J42 A;  4FLV A;  2BCC H;  3U0Z A;  3FYI B;  1YDX A;  4TWK A;  2UUC B;  2X7R B;  4DR1 O;  1SQV H;  1RFY A;  1ENV A;  4KL1 A;  3KKY A;  2XUM A;  3T2M A;  2ZIM A;  4FVM A;  3TK1 A;  1R3L C;  1P7G A;  1W2B U;  5JCO C;  3ZCC A;  2K9P A;  4WF9 V;  3QNE A;  1WAZ A;  2EIJ B;  2A9H A;  1AJN A;  1COW G;  2EIN B;  4LH7 A;  2BSK B;  4O4J B;  3ETE A;  1Q81 W;  1GAX A;  2XAG A;  4DR2 B;  3RVZ A;  2UUA B;  4FJC C;  3BHP A;  1WPB A;  1XIL A;  2DN9 A;  1GN3 A;  1DLB A;  4KXR A;  2X6B A;  4LH6 A;  2ITD C;  4DV1 O;  3FAV A;  3JD4 A;  2E74 B;  2Y4T A;  3ZHQ A;  1AR1 B;  4LF4 O;  1RPO A;  4GZR B;  4FMT A;  3MDS A;  3JAS A;  2KG7 A;  1ZTE A;  3ZHT A;  1Q6U A;  4IHJ A;  1N33 B;  1FKA O;  4CH3 A;  5IT9 N;  2CTP A;  1BGY H;  2QSA A;  1QVF U;  3TJT A;  4QNH B;  1AIL A;  1VQ9 V;  3K5N A;  2Q7H A;  3PJS K;  2EZO A;  3JD3 A;  2LQT A;  2LJ2 A;  2L35 A;  2P4V A;  4B7K A;  3CCS V;  1OCZ B;  1NZ6 A;  3T4Z A;  1MG1 A;  5B1O A;  5LMU B;  2UXX A;  3EHB B;  3RBZ A;  2P5O A;  2WLN A;  1N36 O;  1V55 C;  1VMG A;  3ASN B;  1VQK V;  3AG3 B;  3RN4 A;  4JZG A;  1AVM A;  4I4T A;  2UXD O;  3RWR D;  5CB4 A;  4L87 A;  4PI2 A;  4JF3 A;  1Z5W A;  1L1F A;  1GRJ A;  2W0F C;  3SJQ C;  2WLM A;  3L73 H;  4DK0 A;  1IDS A;  1VF6 A;  5B3S C;  3JCZ A;  3S3X A;  1AJQ A;  5E1A C;  1UJW B;  4ZHQ B;  3BA8 A;  2FB5 A;  2OCH A;  5L3C A;  2W0X A;  3OTO B;  2PGG A;  1ZL8 B;  3GWO A;  3M8A A;  2DYR C;  3G6E V;  1M4U A;  2KSD A;  2NN4 A;  4TQF A;  3L74 H;  2YXL A;  5L3G A;  1OV9 A;  4GUN A;  1SET A;  1GO3 F;  3BCC H;  3EVK A;  3A8T A;  2QM8 A;  1S3J A;  4YHH O;  1K3E A;  3CCU V;  4YY3 B;  3CJH B;  2ZR3 A;  4X20 B;  4B3R B;  1FXK C;  1BE3 H;  3ZRX A;  1YEW A;  3ZRW A;  4GX1 A;  2PYJ A;  2RJZ A;  4MW8 A;  3RYC B;  1BS3 A;  4CBC A;  5JQG A;  2WLL B;  3RYI A;  2YIA A;  4U3J B;  1G4Y B;  2NLJ C;  4LNU A;  3JSL A;  1OCC B;  1SZT A;  3JSN A;  3L72 H;  1I7F A;  1M57 C;  3B8M A;  2ADQ B;  1FAF A;  1KKC A;  2HLD G;  1K8A W;  2A3Q A;  2YS8 A;  3H1L H;  2QM4 A;  4JV5 B;  1MMM A;  2WLI A;  1AR4 A;  1AI6 A;  3OAA G;  2Q0O C;  3R65 A;  3MHS C;  4RAI A;  2UUA O;  4H33 A;  4DV6 O;  2ITC C;  4O4H B;  3BAB A;  5H6Q A;  3CRA A;  5KHH A;  1M56 C;  1R6T A;  5K1P A;  4LWS B;  2QGN A;  2EIL C;  3K04 A;  3BY6 A;  4X1I B;  4DW1 A;  2QWR B;  5IJ0 B;  2CAZ C;  4YJ2 A;  5LOV A;  4TUY A;  1PNK A;  1QQC A;  2VS0 A;  3T1H O;  1HR0 B;  5C8Y B;  3JAK A;  1H2K A;  5B1A B;  1ZWI C;  4PDM A;  2JRI A;  5H6R A;  1IBM B;  3VQV A;  4NTY A;  2IM9 A;  2JJ2 G;  3L71 H;  4LF8 B;  1EN6 A;  5B1B C;  3C3S A;  3H1I H;  5CA0 A;  4XDL A;  1IUR A;  3E8G A;  1XMO O;  3J80 N;  2FML A;  2KKW A;  1YVW A;  3MD0 A;  3Q4H A;  1RP3 B;  2CUG A;  2R9R B;  3VBB A;  4GKJ B;  2E5L B;  1V9P A;  5BZB A;  3KCX A;  4MVO A;  1YIJ V;  4FK5 C;  2Q6A A;  4AQY O;  5D5P A;  5KAI Z;  3RYH A;  4DYL A;  4I0X A;  1JX9 A;  3K58 A;  3HKB A;  3BVO A;  4JTD B;  3K0G A;  3I55 V;  4DR4 B;  1VIB A;  1WLE A;  3SR2 C;  1YTF B;  4JI6 B;  2ETN A;  4UCU A;  4UV8 A;  2YC0 A;  3E8F A;  3R66 A;  1I0H A;  3ABM C;  5EIB D;  4I55 B;  1KB9 F;  3D36 C;  4OX9 B;  4KHP B;  3DC5 A;  2CE4 A;  4DR3 B;  4YIP A;  3O9O A;  5TIS Z;  2JIZ G;  4X65 B;  4DR7 B;  3OTF A;  4A5U B;  1I94 B;  2UXN A;  1OCR C;  1AJP A;  2M7W A;  1ZLZ A;  2XND G;  1S72 V;  1LNQ A;  4MTO A;  5LYJ A;  3OMN B;  5LHG A;  5CBG A;  4DV3 B;  4HNA B;  2C2A A;  3FFQ A;  1EZV H;  1GK9 A;  3HPL C;  2FTK A;  3UKM A;  4O2B B;  1TGO A;  2JGU A;  2ZDI A;  1M9N A;  2XAS A;  2UXB B;  4LF9 B;  1JFF B;  2R70 A;  3BAA A;  4J80 A;  1PV0 A;  1S0V A;  3E35 A;  4TSF G;  2FYU H;  4K3A A;  1S5J A;  2Z5U A;  5J2U A;  2JVD A;  4Q6G A;  4FZ0 A;  3THO A;  5CBF A;  3W7W A;  4MVU A;  2YIB A;  5EIB C;  1XRE A;  3M7M X;  3O65 A;  2UXC O;  1MNG A;  2XAJ A;  3APQ A;  3STL C;  3K3W A;  1AB3 A;  4DRX B;  4R50 A;  3CME V;  3J81 N;  1VF5 B;  3CYO A;  4W4L A;  1N32 B;  2FKX A;  2JGD A;  2QWQ B;  4FFB A;  5J9P C;  4G27 B;  1Y4M A;  2QWO B;  4DR1 B;  5BR8 O;  2YXY A;  3WB2 A;  4RWU A;  3OEE G;  3N2G A;  4P30 A;  1HNX O;  1KD1 W;  3SDL A;  2IW5 A;  5LHH A;  3H1J H;  2RNB A;  4IIJ A;  5HFL A;  2YIC A;  3ZHU A;  1PNM A;  1BSM A;  3HKC B;  3L70 H;  4LF8 O;  4TV8 B;  4J41 A;  4WFA V;  1I5X A;  3ZRS A;  3W7T A;  2OCC C;  3A0B Z;  4UVC A;  3FB6 C;  1D5N A;  2HEP A;  1THZ A;  3B40 A;  1V55 B;  1J95 A;  2ATK C;  3UM7 A;  2CDY A;  2IJK A;  5CA1 A;  4JPR A;  2Q73 A;  5J2T B;  1VP7 A;  3OT7 A;  3H01 A;  2HG5 C;  1K7D A;  3NR7 A;  2JK5 C;  4P9P A;  1VQ7 V;  3DC6 A;  2QJ1 A;  2AZ0 A;  2ZIN A;  1Q82 W;  1I5Y A;  3SPG A;  2DWE C;  1BHB A;  4HAM A;  5BMV B;  3WB1 A;  5B3S B;  3F5T A;  2ZKO A;  4LF4 B;  1XMQ B;  4C7U A;  3OGI B;  1J5E O;  1K4D C;  1YCI A;  4HZ3 A;  3L75 H;  1FXV A;  2B1I A;  2DYR B;  4K8X A;  4H0L B;  2DQ3 A;  4E4E A;  4UVB A;  1MAB G;  1K5Q A;  1R3K C;  2V1D A;  5ITZ B;  2BSK A;  3CRC A;  2NR5 A;  2BE3 A;  4O2A B;  5JJN B;  4ZOL B;  1FD9 A;  4FLW A;  3K79 A;  1NU1 H;  3PN1 A;  1FXK B;  5KHK A;  4NXM O;  2VQE O;  2BOB C;  1SA0 B;  1PL4 A;  1K92 A;  2PYL A;  2F1M A;  1DGS A;  4PDL A;  1N36 B;  2Q7E A;  1UPG A;  2HP8 A;  3RGB A;  1K34 A;  4ZI7 A;  1AP5 A;  5LA6 A;  1NKD A;  5DN6 G;  1M57 B;  2UXD B;  3JAW A;  2Q0A A;  3ABL C;  1CPY A;  3QO7 A;  2W6J G;  3ZX6 A;  4ASU G;  3OMI B;  1NTM H;  1Q8I A;  1L0N H;  1IXB A;  1VF6 C;  4FFK A;  1YSC A;  5HFM A;  3JCU Z;  1G6U A;  2EX3 A;  3K0D A;  2XTA A;  3ZHV A;  4UCS A;  4F6R B;  3E89 A;  3QG5 A;  3ZHS A;  1S77 D;  4B3T B;  1Z5V A;  2GUZ B;  1M56 B;  2EIL B;  3H9V A;  2UUB O;  2A79 B;  2ZM6 O;  3UT5 B;  3SPJ A;  4WBN B;  4TT3 G;  4G2K A;  3E22 B;  2F4V O;  4JAA A;  1SZX A;  1FFX B;  4YHH B;  2YI9 A;  3CCM V;  2N05 A;  1K73 W;  4B3M O;  2VWK A;  4JI5 O;  4QGP A;  1JJ2 U;  3T1Y O;  1TVK B;  5GON A;  4J7K A;  1YI2 V;  5DED A;  1MSW D;  4BW9 A;  2QM7 A;  5B1B B;  3F7Y C;  3CHX A;  4UUJ C;  2WAM A;  2IJH A;  1FFT B;  2AZ2 A;  1PPJ H;  4ZHQ A;  1N34 B;  4LF5 O;  3BA9 A;  2GTA A;  1W0K G;  5KX5 A;  1XNR O;  4DXW A;  1KBH A;  4MVZ A;  3BEH A;  1QNM A;  2VWJ A;  5BXZ A;  4LP8 A;  1FJG B;  3ZMV A;  3CJH A;  4DV6 B;  4EEQ A;  5L3D A;  5LGU A;  1MSD A;  3A0R A;  1CP9 A;  3A0H Z;  3CC7 V;  1BMF G;  4UCV A;  1SKV A;  1U96 A;  1E1R G;  1YF2 A;  5KLV H;  3K5M A;  3ABM B;  3T1H B;  3G6B A;  3FB5 C;  3WU2 Z;  1XMQ O;  4MVQ A;  5EBW C;  4DV5 O;  5IYZ B;  5JH7 A;  3ZMZ A;  2BTO A;  4TV9 B;  3EFF K;  1VQN V;  2DWD C;  4O4L B;  5GTI Z;  1OCR B;  1E1Q G;  4X64 B;  5KHI A;  1RSO B;  1HW7 A;  1H2N A;  5KMG B;  3RYF B;  1NTK H;  4PDV A;  3OUS A;  4B7E A;  4UXN A;  2HJD A;  1XMO B;  1Y66 A;  1VQ4 V;  2HVJ C;  1V54 C;  2IBZ H;  4O4H A;  2DW4 A;  3JD1 A;  2X0L A;  4LWS A;  4FLY A;  2Q68 A;  3CRR A;  4HBN A;  4DV7 O;  3NXS A;  2Y48 A;  1GMG A;  2QE7 G;  2ZE7 A;  5IJ0 A;  1K5S A;  2XOK G;  5LHI A;  1Y74 B;  4X1K B;  4IL6 Z;  4AQY B;  3VQY A;  4TOI A;  2OTL V;  1ZSP A;  4DK1 A;  3DXR B;  2V7Q G;  2YEV A;  3ABU A;  3MAQ A;  1WA8 A;  4H13 B;  3W7X A;  4I50 B;  3WB0 A;  4K35 A;  2QDO A;  2P90 A;  4X89 A;  1F4N A;  4QE7 A;  3IC9 A;  1WN7 A;  1O9G A;  2A7W A;  3CCQ V;  3HKD B;  2F23 A;  4GX5 A;  4X8A A;  4LR3 A;  3UO3 A;  4JI7 O;  1EN4 A;  4X1Y B;  3JAT B;  2XHB A;  2DQ0 A;  4NXN O;  4I5S A;  4B3T O;  3CB2 A;  4DW0 A;  2HVK C;  1XOU A;  1N4C A;  4ZKI A;  4DUZ O;  3JAR A;  1QVG U;  3K06 A;  4ZBM A;  2F95 B;  4ABM A;  3FB7 C;  3ZS8 C;  4WFB V;  4QE9 A;  3TXQ A;  1PNL A;  4GLX A;  2ZDI C;  2Q4P A;  2H94 A;  1SES A;  1EN5 A;  1JA8 A;  1Q5O A;  3SJA C;  1VAR A;  3TCU A;  1EM1 A;  2CK3 G;  2OIE A;  2OCC B;  3JD0 A;  1N34 O;  3FB8 C;  1SS3 A;  1H8E G;  4TQD A;  4P2Z A;  5F2V O;  1M93 A;  3AG7 A;  1IZ3 A;  1Q90 D;  1BZK A;  4R6Z A;  2A06 H;  4D7S A;  1QLN A;  4U7O A;  5LGT A;  4O4I B;  4NVP A;  1Q3E A;  4X66 O;  2ODM A;  2E76 B;  3CCR V;  2ZQM A;  1CEZ A;  4IT5 A;  2UXC B;  1FJG O;  4HNA A;  3ICX A;  3JAS B;  1Z2G A;  5L3E A;  1G8M A;  1H8H G;  1JMK C;  2IU0 A;  2YDE A;  3D3I A;  3HKE A;  4IHJ B;  3QO5 A;  3N2K A;  1YHQ V;  1M5I A;  5BR8 B;  5EYP A;  1P7B A;  4AHC A;  1EZJ A;  3ASO C;  5IYD O;  3ZHR A;  1HNX B;  4Z1M G;  1MOF A;  1OCO C;  1R73 A;  4NB5 A;  1NT2 B;  3VQX A;  4X64 O;  5FPO A;  5IYB O;  4JI2 O;  4AI8 A;  2Q69 A;  2IH3 C;  1IBK O;  3IJ4 A;  3U10 A;  2WLJ A;  2WWW A;  2VRZ A;  4KFM A;  4I4T B;  3BPZ A;  4K8Z A;  1KQS U;  1JPX A;  1XHX A;  4GX0 A;  2Q5Z A;  2WPD G;  4CS2 A;  5CB4 B;  1US6 A;  2PZS A;  3P3P A;  2LO1 A;  2CTQ A;  2CTR A;  1T5E A;  3ABL B;  1D2D A;  2P06 A;  4WFH A;  3CWB H;  1S5L Z;  1XL6 A;  5IWA O;  1VQO V;  5EK0 A;  2BTQ A;  1QR8 A;  4JI3 O;  2QKS A;  1N8R W;  1J5E B;  3ZMT A;  1YJN V;  1VEW A;  2Y0I A;  3SPC A;  3B2E E;  1SER A;  3E8H A;  1X59 A;  2E3C A;  4JYB A;  1K97 A;  1Y6X A;  4DV4 O;  2AXT Z;  3LUT B;  4JI4 B;  2WLK A;  4YIO A;  1P4R A;  5B66 Z;  2DJV A;  4Q20 A;  2B5U A;  3F5W C;  4BR6 A;  5EC2 C;  5J2T A;  4NKG B;  3VQW A;  2P6J A;  3CC4 V;  1OZ0 A;  4NXM B;  2VQE B;  4UB6 Z;  3SPH A;  3ETG A;  5KA6 A;  1ARO P;  2LFR A;  1R1B A;  3RYI B;  5BMV A; 
#chains in the Genus database with same CATH homology
 4MW3 A;  2DYR B;  1S5H C;  4HYO A;  3ETE A;  3OEH G;  4QJF B;  3LDE A;  3WG7 C;  1Q81 W;  1NH2 B;  2DQ3 A;  4UVB A;  2XAG A;  3AG1 B;  3RVZ A;  3P30 A;  1MAB G;  4FJC C;  1PKX A;  1K5Q A;  1R3K C;  2V1D A;  3ABK C;  3OGC C;  2Y69 C;  1DLB A;  3K79 A;  2X6B A;  3W7S A;  2B1G A;  2ITD C;  1F4M A;  4G28 B;  1FXK B;  4X88 A;  4GT1 A;  3JD4 A;  2BOB C;  3E83 A;  3LSS A;  3T4D A;  4PA7 A;  1AR1 B;  1K92 A;  1NQT A;  1RPO A;  4FMT A;  1TUE B;  4I9W A;  1DTO A;  3T1C A;  5B1N A;  3SYO A;  4PDL A;  1EFR G;  2GHY A;  3ZIA G;  3JYC A;  5EBL C;  1K34 A;  1NH2 D;  3SYC A;  2HR3 A;  4J9Y B;  5DN6 G;  1NKD A;  4F4L A;  1M57 B;  4RQE A;  1KKD A;  3ZMS A;  3ABL C;  1QVF U;  1CPY A;  3QO7 A;  2W6J G;  1VQ6 V;  4QNH B;  4ASU G;  2QEX V;  3OMI B;  1VQ9 V;  3PJS K;  3X2Q B;  3LDD A;  4RQF A;  4WFF A;  4LBE C;  2JJ1 G;  2EZO A;  4MTF A;  3IC7 A;  3JD3 A;  1KP3 A;  1YSC A;  5HFM A;  4XBF A;  3CCS V;  1OCZ B;  3LDC A;  3T4Z A;  3SPI A;  4GCZ A;  1MG1 A;  3K0D A;  5B1O A;  2YEV B;  2JEU A;  1DF4 A;  3E89 A;  2UXX A;  3EHB B;  3LSQ A;  3RBZ A;  4QIW F;  4H37 A;  2WLN A;  1S77 D;  5FL7 G;  1PD3 A;  1V55 C;  3ASN B;  1M56 B;  1VQL V;  1VQK V;  2EIL B;  1JCH A;  3AG3 B;  3CMA V;  1K33 A;  2YSU B;  2A79 B;  1V54 B;  3SPJ A;  4TT3 G;  3K03 A;  2XAF A;  3OUF A;  1IXM A;  4G2K A;  4L87 A;  1GTO A;  5LGN A;  1NR1 A;  4JF3 A;  2AHY A;  3CCM V;  1ROP A;  4P9O A;  1GM8 A;  1L1F A;  2W0F C;  3SJQ C;  1K73 W;  2P67 A;  3ML0 A;  2ZD9 A;  5EC1 C;  2WLM A;  4OXS A;  4BIU A;  5B3S C;  1JJ2 U;  3JCZ A;  1UJW B;  1AJQ A;  5E1A C;  5KUK A;  3CPW U;  2EIJ C;  1YI2 V;  3K08 A;  5L3C A;  3MHH C;  4FIP C;  2EIN C;  3GWO A;  2KB1 A;  1MSW D;  5GW7 A;  2DYR C;  3G6E V;  2QM7 A;  5B1B B;  3F7Y C;  4UUJ C;  2WAM A;  2IJH A;  4PEL A;  1FFT B;  5L3G A;  3AG1 C;  4JGS A;  1SET A;  1GO3 F;  1GM7 A;  1DF5 A;  1W0K G;  2LFS A;  3ZRW B;  2QM8 A;  1QLE C;  1S3J A;  1VQ8 V;  1K3E A;  4U7N A;  5KUM A;  3CCU V;  3RW0 A;  4DXW A;  2AHZ A;  4GX2 A;  2PI4 A;  2ZR3 A;  3P32 A;  1FXK C;  2W6I G;  2WSS G;  3ZRX A;  4WCE V;  1F51 A;  3ZRW A;  3ZRV A;  4GX1 A;  4MVZ A;  5EBM C;  3BEH A;  4LP8 A;  4MW8 A;  2XAQ A;  3ZMV A;  3OMA B;  2QA4 V;  4CBC A;  1R3J C;  5L3D A;  5LGU A;  2F43 G;  5L3B A;  2R9I A;  1CP9 A;  1WPX A;  2IJI A;  2H8P C;  2WLL B;  3A0R A;  4JAS A;  1Q7Y W;  3CC7 V;  5CN0 A;  1G4Y B;  2NLJ C;  5IYC O;  1BMF G;  4EKW A;  4MSW C;  3CCV V;  4JTC B;  1OCC B;  1SZT A;  3B77 A;  1NJI W;  1E1R G;  1YJW V;  2WLI B;  2HJF C;  1M57 C;  3B8M A;  1NVP D;  3ABM B;  2DYS B;  4E2L A;  3FB5 C;  1BL8 A;  4JTA B;  2HLD G;  5DM6 V;  4DO2 A;  1K8A W;  4MVQ A;  3LNM B;  5EBW C;  3X2Q C;  2EIK B;  3STZ C;  3B8N A;  4UVA A;  3CC2 V;  1R3I C;  2WLI A;  3ZMZ A;  4MS2 A;  4JAU A;  1AI6 A;  1FXK A;  3OAA G;  3EFF K;  1VQN V;  2DWD C;  3R65 A;  2X6C A;  3MHS C;  1OCZ C;  4RAI A;  1JVM A;  1OCR B;  3D36 A;  1E1Q G;  4H33 A;  2ITC C;  5H6Q A;  5LBQ A;  1KEC A;  3ASN C;  4PDV A;  1M56 C;  3K04 A;  2EIL C;  3AG3 C;  3OUS A;  1H2G A;  1AI4 A;  4UXN A;  3BY6 A;  1K4C C;  1Y66 A;  1VQ4 V;  2HVJ C;  1V54 C;  3G4S V;  2EJR A;  1VQ5 V;  1GKF A;  1VQM V;  1AI7 A;  3SYQ A;  2DW4 A;  1PNK A;  3JD1 A;  4XDK A;  2X0L A;  2D3O W;  2JEX A;  3JD2 A;  2Q68 A;  4PA6 A;  5B1A B;  1ZWI C;  5C93 A;  3DGE A;  3NXS A;  2Y48 A;  3SYP A;  3CXC U;  1GMG A;  2QE7 G;  2EIM B;  4PDM A;  1K5S A;  2XOK G;  5H6R A;  5LHI A;  1M90 W;  4FPP A;  2PI5 A;  2ZXW B;  2OTL V;  5IDJ A;  2JJ2 G;  3AEI A;  2IU3 A;  2V7Q G;  2YEV A;  3ABU A;  3ETD A;  2EBO A;  1JQ0 A;  5B1B C;  3W7X A;  4YXW G;  4XDL A;  3E8G A;  2P90 A;  1B6Q A;  5CBH A;  3ASO B;  4X89 A;  3MD0 A;  1F4N A;  3AG2 B;  3GB7 C;  4QE7 A;  1YJ9 V;  2R9R B;  1OCO B;  1W0J G;  3VBB A;  3CCQ V;  4GX5 A;  4PA3 A;  4X8A A;  2JDI G;  5BZB A;  3CP1 A;  4MVO A;  1YIJ V;  4FK5 C;  2Q6A A;  3M99 B;  2DQ0 A;  4I5S A;  4BIZ A;  1JX9 A;  3K9A A;  2P7T C;  2HVK C;  1QCE A;  4JTD B;  3K0G A;  3I55 V;  1WLE A;  4WFG A;  1YTF B;  4N21 A;  4ZKI A;  3IGA C;  2OTJ V;  3KG2 A;  4MVS A;  3CCJ V;  1QVG U;  4UV8 A;  3K06 A;  4ZBM A;  1OCC C;  3RVY A;  3FB7 C;  3E8F A;  4WFB V;  4QE9 A;  1PNL A;  1QBZ A;  3ABM C;  2DYS C;  2ZDI C;  4J9Z B;  2H94 A;  1SES A;  3AG4 B;  1E79 G;  2ZR2 A;  1K9M W;  1OHH G;  1M1K W;  2EIK C;  2OT5 A;  5KA5 A;  1KC8 W;  1Q86 W;  3TCU A;  3ZN0 A;  2JIZ G;  1H38 A;  1R6K A;  2CK3 G;  1HWY A;  3JD0 A;  2OCC B;  3FYE B;  4N23 A;  4MTG A;  2UXN A;  4MVR A;  1OCR C;  4RUE A;  1AJP A;  3FB8 C;  1VQP V;  1H8E G;  3CD6 V;  2M7W A;  5IY5 B;  3E86 A;  4P2Z A;  1NR7 A;  2IJJ A;  2XND G;  1S72 V;  1LNQ A;  4MTO A;  3OE7 G;  4RO2 A;  1YTF D;  2WLL A;  4R6Z A;  3OMN B;  5LHG A;  5CBG A;  1RM1 B;  2C2A A;  3ZJZ A;  1QLN A;  4U7O A;  5LGT A;  1GK9 A;  3HPL C;  4PDR A;  3CCE V;  2FTK A;  3UKM A;  3CCR V;  2ZQM A;  1CEZ A;  1QLE B;  5B1A C;  2ZDI A;  4QPJ A;  1M9N A;  2XAS A;  2EIM C;  5L3E A;  3IFX A;  1S0V A;  3QO8 A;  1G8M A;  1H8H G;  4MTX A;  2IU0 A;  3E35 A;  4TSF G;  3TET A;  1AI5 A;  2HFE C;  2ZXW C;  4CZZ A;  3WG7 B;  4BW5 A;  3D3I A;  3QO5 A;  1JOY A;  1EBO A;  2Z5U A;  2BOC C;  1YHQ V;  1SRY A;  3ABK B;  5CBF A;  3W7W A;  1P7B A;  3E8B A;  1EZJ A;  2Y69 B;  3OR6 C;  4MVU A;  1F23 A;  3ASO C;  5IYD O;  3OM3 B;  3AG2 C;  2A0L A;  4Z1M G;  4LC1 A;  4MT8 A;  2GSM B;  5L3F A;  1MOF A;  4PA9 A;  1OCO C;  1R73 A;  3W7U A;  2Q67 A;  4WFE A;  2XAJ A;  3DTU B;  3STL C;  3K3W A;  1BHA A;  5H9C A;  2HKO A;  4QPK A;  4R50 A;  1R6N A;  5IYB O;  3CME V;  3OFN G;  2NNU A;  2Q69 A;  2IH3 C;  3CYO A;  3ABT A;  4UV9 A;  2XAH A;  4JYC A;  5J9P C;  4G27 B;  2WLJ A;  2WWW A;  4KFM A;  3I56 V;  1Y4M A;  3ZMU A;  3FKS G;  1FXH A;  4PA4 A;  1KQS U;  2IH1 C;  1JPX A;  2MK3 A;  5CMU A;  2K1E A;  4GX0 A;  3HB3 B;  4BAY A;  1RPR A;  2WPD G;  1FS0 G;  2EZP A;  1NBM G;  3OEE G;  4P30 A;  1GM9 A;  3ABL B;  3VOU A;  4MVM A;  1KD1 W;  1ORQ C;  4WFH A;  1XL6 A;  3SYA A;  1VQO V;  5EK0 A;  3ZN1 A;  2IW5 A;  3AG4 C;  4KP4 A;  5LHH A;  1XL4 A;  1QR8 A;  5CA3 A;  4RUF A;  3OR7 C;  3WFV A;  2WLH A;  5HFL A;  2QKS A;  4KUM A;  1N8R W;  1YIT V;  1PNM A;  3ZMT A;  3OW2 U;  1YJN V;  4WFA V;  4XDJ A;  1S76 D;  1I5X A;  3ZRS A;  3W7T A;  2OCC C;  4UVC A;  3FB6 C;  2QTO A;  2Z3Y A;  1THZ A;  3SPC A;  2X6A A;  1SER A;  3E8H A;  1V55 B;  3E2E A;  1J95 A;  2ATK C;  3FYI B;  4TWK A;  3UM7 A;  4JYB A;  1K97 A;  2LP7 A;  2IJK A;  4R7C A;  1KP2 A;  5IY5 C;  2X7R B;  4JPR A;  3G71 V;  3LUT B;  3H01 A;  1QR9 A;  1ENV A;  2HG5 C;  2WLK A;  1K7D A;  1RM1 C;  1P4R A;  2JK5 C;  3T2M A;  4P9P A;  1VQ7 V;  3TK1 A;  1NVP B;  1R3L C;  1Q82 W;  4Q20 A;  1I5Y A;  2B5U A;  3F5W C;  5EC2 C;  3SPG A;  2DWE C;  1W2B U;  1BHB A;  2P6J A;  4HAM A;  3CC4 V;  3ZCC A;  1OZ0 A;  5B3S B;  1PL0 A;  3SPH A;  3CCL V;  4JAV A;  4LCU C;  4WF9 V;  3QNE A;  3ETG A;  2EIJ B;  1K4D C;  5KA6 A;  2A9H A;  1AJN A;  4HZ3 A;  1COW G;  1ARO P;  2EIN B;  3F7V C;  2LFR A;  4R8C A;  1FXV A;  2B1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...