3LDDA

High resolution open mthk pore structure crystallized in 100 mm k+ and further soaked in 99 mm na+/1 mm k+.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPRTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Novel insights into K(+) selectivity from high-resolution structures of an open K(+) channel pore.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
total genus 31
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lddA00
2JK5C 5EBMC 3FB8C 4GX2A 4R6ZA 2K1EA 3ASNC 3R65A 1R3KC 3OUSA 3SPHA 4BW5A 3K06A 3UM7A 3X2QC 2Q68A 4H37A 2EIMC 4MW8A 2QTOA 2X6BA 4PA7A 4HZ3A 5CBHA 3T4DA 4G28B 3PJSK 3RVYA 5J9PC 4J9ZB 3ASOC 1R3JC 5EC1C 3BEHA 5B3SC 4MVMA 5BZBA 2HFEC 1OCRC 3AG2C 5EK0A 1J95A 3SJQC 3SYQA 3LUTB 4P30A 4MVOA 3T2MA 4WFGA 3E89A 4EKWA 1ZWIC 4WFHA 2EIJC 3STLC 3VOUA 4KFMA 1V54C 3F7VC 3OUFA 2Q6AA 2DYSC 4RUFA 1R3LC 2WLKA 3AG4C 1LNQA 4UUJC 3UKMA 2BOBC 3K04A 3SYPA 4G27B 4PA3A 4ZBMA 2WLLB 4LBEC 3WG7C 4F4LA 4PDLA 4MSWC 4XDJA 3E8BA 4X89A 3SPGA 4MVRA 4WFFA 4PDVA 3E8FA 5EC2C 5EBWC 4QNHB 2ITCC 2ITDC 2HVKC 1S5HC 3RBZA 2H8PC 3AG1C 4JTAB 2A9HA 2DYRC 1JVMA 1XL4A 1M56C 4GX1A 4MW3A 2AHZA 2WLLA 4PDRA 4R8CA 1ORQC 2Q69A 2QKSA 4DXWA 2X6AA 2R9RB 3OGCC 4MVUA 3E8HA 3SPIA 2DWDC 3F7YC 3KG2A 2EINC 4I9WA 5E1AC 4P9PA 1R3IC 4HYOA 3OR6C 3K03A 2WLIB 4LP8A 4X88A 2HVJC 3LDDA 1G4YB 2ZXWC 3ABMC 3SPJA 2WLHA 4GX0A 4JTDB 3ZJZA 2W0FC 4H33A 1KKDA 5CBGA 3RVZA 1K4CC 4P9OA 3FB7C 2ZD9A 2DWEC 3E86A 4J9YB 3F5WC 4JTCB 4MS2A 2IH1C 3ABKC 2ATKC 4MTFA 3LDEA 2Q67A 2HJFC 2WLIA 3LNMB 2X6CA 3ZRSA 1V55C 4QE7A 4WFEA 3EFFK 4MVZA 2HG5C 4RUEA 4PA6A 4TWKA 3AG3C 4OXSA 3T1CA 4R50A 4MVSA 3K08A 4MTOA 3E8GA 4XDLA 4CBCA 2WLJA 4QE9A 5B1AC 3LDCA 4X8AA 3T4ZA 2OCCC 3STZC 3SYAA 1QLEC 1K4DC 2EILC 2KB1A 3GB7C 5EBLC 5KUKA 3K0DA 1M57C 3FB5C 3RW0A 4XDKA 4PA9A 3SYOA 3E83A 3K0GA 2BOCC 4GX5A 4RO2A 1P7BA 2P7TC 3IGAC 3IFXA 2EIKC 3OR7C 4LCUC 1OCOC 2AHYA 4RAIA 1XL6A 3JYCA 3ABLC 2Y69C 2A79B 2WLNA 4PDMA 3TETA 1OCCC 2YEVA 5KUMA 5IY5C 2IH3C 3TCUA 4R7CA 3SYCA 4MVQA 3FB6C 3SPCA 5CBFA 2A0LA 2NLJC 1BL8A 4P2ZA 3HPLC 4MTGA 4PA4A 2WLMA 5B1BC 1OCZC
chains in the Genus database with same CATH superfamily
3K5NA 4BIOA 4ZIBA 1FYJA 3ML0A 1BHBA 2ZCEA 4J41A 3O65A 1H2NA 4PI0A 3PJSK 4J9ZB 5LOVB 2Q0OC 3QO8A 3T1HB 5C8YB 5K1PA 4LF7B 1HNXO 4WF9V 3L73H 3NXSA 3K57A 5LOVA 1VQ4V 4X1IB 3G6BA 1S72V 4X20B 3CCVV 4DW0A 2R70A 4DR6B 4F4LA 5JQGB 1VQKV 1OV9A 4PDVA 3ZHRA 4X1IA 3AG1C 1FFTB 4YIPA 3CC2V 4X20A 1SQFA 1AJQA 2Q69A 4R8CA 5JQGA 4X62B 1XILA 4E2LA 1YITV 5CB4B 4QPKA 1FJGB 3JATA 4YJ3B 5L3GA 3JD2A 2ZIOA 2LQTA 2Q8VA 2X7RB 3W7UA 1LUVA 1IURA 1IBLO 5CB4A 1M93A 3JSLA 4DV5B 1MABG 5BMVB 4YJ3A 2UUBB 2CAZC 2OTLV 4DRXB 4QE7A 4MVZA 2PI5A 2A7WA 3T1YO 1AILA 3CRRA 4DYLA 4DR1O 2MK3A 4DRXA 1FPOA 4J7KA 3ZCCA 2GSMB 1K33A 2OTJV 2EINB 2VWJA 3B40A 2CUGA 4DV7O 2ZXWB 2WLNA 2OT5A 5IYBO 2JGUA 5LBQA 3OT7A 3DSQA 5B1OA 3QVNA 1V55B 3DC6A 3H9VA 5KMGB 1NJIW 5JWPA 5IE9A 4LF6O 3R65A 4OGQB 4FVMA 1KD1W 4OPAA 3CCSV 1JX9A 5CMUA 5H6RA 5KMGA 5GTIZ 3ASOC 1JPXA 3OAAG 4B7KA 2Y69B 4ASUG 2QWRB 3VOUA 3JCZA 1KC8W 2PUSA 3DXRB 1KECA 3K58A 1BZKA 4NXNB 1YTFB 4LR3A 1S5JA 3K04A 4NB5A 4B3RB 3L72H 4IYHA 4MVRA 3DXRA 3IJ4A 1MZFA 2ITCC 2AHZA 1ORQC 1IDSA 2VRZA 3SR2C 5CN0A 1HNZO 3FX7A 4F6RB 3FAVB 3JD1A 4TV9B 1XMOO 2XUMA 1IXMA 4GZRB 4PI2A 4X88A 2ZM6B 1W0KG 1U97A 4DW1A 4F6RA 3FAVA 4TV9A 3F5WC 3PN1A 4JI1B 2Q9LA 1VEWA 2P06A 4DV1B 1XMOB 1WNSA 1B3QA 4JF3A 2YUAA 1M4UA 2IBZH 5K1XA 1K34A 5AG2A 4X8AA 3SYAA 3CX5F 2ZQMA 3JD0A 2UUCB 1PD3A 4LCUC 1LUWA 4N23A 1SQXH 1K5QA 1YJ9V 3MDSA 5HFMA 3ABLC 3UCSC 5LA6B 1F7YA 1SZTA 3D3QA 5CBFA 5D5PA 4PA4A 3JAWB 1U96A 4Q6GA 3RFRA 1JOYA 5LA6A 2EBOA 1L1FA 1E1QG 3APQA 2Q0AA 5EC1C 3UT5B 2UXBB 3LSSA 3CJHB 1XEQA 2EIJC 4H44B 2HEPA 1Q6HA 2QWOB 1N33O 4HNAB 3L70H 1N4CA 2DMXA 1Y4MA 3CJHA 4JYAB 2WLLB 4UCUA 3WG7C 1PPJH 3MAQA 2YICA 1Y66A 3OFNG 4JI7B 4DV0O 2A9HA 2JRIA 2M6YA 2WLLA 4GYCB 3ZHVA 1VQ8V 5JVDB 3S3WA 2E5LB 4TUYA 1VF6C 3CWBH 1RPRA 3OR6C 5JVDA 1E1RG 1NR7A 1R6NA 4X9QA 2ZE7A 2DWEC 1DLBA 2R9IA 2HJFC 2B5UA 3ZRSA 3H1KH 2BTQB 4CBCA 3JARB 1M56B 5LP6B 2OCCC 2P6JA 2QE7G 4HBNA 2HP8A 2IU0A 1IBKB 2VQEB 2YXYA 3G80A 4DUYO 5L3CA 4LF5O 2BTQA 3JARA 3IGAC 1I5XA 5LP6A 4CC5A 2M7WA 2A79B 3W7WA 3BY6A 2KG7B 4Q20A 4JI0B 3WB0A 2XHBA 3G71V 4KHPO 2IU3A 1S0VA 2DQ0A 1OCZC 2KG7A 2Y4TA 1IX9A 3QO7A 2YXLA 4BW5A 1YTFD 1VQ6V 4YHHO 5CBHA 2FTKA 4D7SA 1JJ2U 4YXWG 3VQVA 3T2MA 2LP7A 1H8EG 5IDJA 5LGUA 2LW7A 3AG7A 4D6TH 4KFMA 4DUZB 3IC7A 1R3LC 3JD4A 5JCOA 4FLZA 2RQ6A 4UB6Z 3FKSG 1OJHA 4W4KA 1VQMV 1BGYH 1YSCA 2VQFB 1YZBA 4JI4B 4JI2O 4LNUB 2P4KA 1ZLZA 2FYUH 4PDRA 1FAFA 3E22B 4LFBO 2ARHA 4LNUA 3KG2A 4DV2B 5IYCO 1WP8A 4LP8A 3E22A 1IVSA 1TUBB 3ABMC 3ZJZA 2E76B 3CXCU 3JCUZ 3RVZA 4J9YB 2QKAA 1TGOA 4I9QA 1XHZA 1TUBA 2OIGA 3O9OA 5KHIA 3AG3C 2F93B 3AG1B 4FK5C 4XDLA 3JASB 1ZTEA 3B4SA 3D36C 1VMGA 3JASA 5KAFZ 3OR7C 1XMQO 3IC9A 4MTXA 4FPPA 3IAYA 3A2FA 4B3TB 4TQDA 3I55V 3CC4V 2QTSA 4JI8O 1NBMG 1OZ0A 1Q6IA 2JK5C 4R6ZA 2LJ2A 4IL6Z 3ABTA 1R3KC 3OUSA 4LFCB 1L0NH 3ETQA 2Q68A 4X65O 1HDJA 2QTOA 4PA7A 4EEQA 4J7JA 5JJJB 3BEHA 4MVMA 4AHCA 1ENVA 1XNRB 3U0ZA 2V4DA 3SYQA 2EX3A 4B7EA 3CRCA 4JV5O 3RN4A 3JAKB 1W0JG 2QSAA 3EXAA 5LMUO 4DR2O 2GTSA 2G38A 1RSOB 1SQPH 1LNQA 2LW1A 2BOBC 5EIBD 4X66O 4BIZA 2XAGA 3KCXA 2PYLA 5C93A 4DV4O 1RSOA 1Q90D 4B3SB 3E35A 1JVMA 1AR5A 3B77A 2EZPA 5LMUB 4DR2B 4UCSA 3ASOB 5D5QA 4FM1A 4DR3O 3F7YC 3DTUB 5TISZ 3J7AU 4FIPC 4I0XB 4GCZA 3SPJA 2WLHA 1QU7A 1J5EB 2AZ2A 4XBFA 2EJRA 2IH1C 2ATKC 4I0XA 1SA0B 4WFEA 3EFFK 4DR5O 1Y6XA 1ZAUA 2UXCO 1SA0A 3K5LA 1GM8A 1K97A 4PV1B 4MT8A 1M57C 3RW0A 5LXTB 4Z1VA 2K9PA 5H6QA 4OX9B 3B09A 2YIAA 3THOA 2IJJA 5LHGA 3KCYA 5L3EA 3ZBHA 1M9NA 5LXTA 1QQCA 1VP7A 2PF4E 2IH3C 1HWYA 4UVBA 3RYIB 4YY3O 2A0LA 4FLWA 2Z0AA 4JAUA 1BSMA 2ZR2A 2P5OA 2QM8A 2HR3A 3MHHC 3RYIA 1YJWV 1KBHA 1S76D 2QR4A 1SS3A 3P30A 2RDCA 3LNNA 4MVOA 3ABLB 1NTZH 3TK1A 2N05A 1PM9A 2Q6AA 3U10A 2WLKA 3T1HO 1GN4A 3BHPA 4FM2A 2ADPA 4ZBMA 1GH6A 2QM7A 4LF7O 4MSWC 2RN9A 1H2KA 1IXBA 4L8JA 2L35A 2OCHA 4JTAB 1Q8IA 4I4TB 2GBOA 1WA8B 4QIWF 4DR6O 3I56V 3W7XA 2F66C 3CEIA 3ZX6A 2R9RB 3OGCC 4W4LA 1BQZA 1DF5A 4PELA 4X1YB 2LFRA 4LWSB 4I4TA 1W2BU 1R3IC 1WA8A 2EIJB 5B1NA 4X62O 3ZHTA 4JZ2A 2ODMA 4FFKA 5C8YA 2XT9A 1FJGO 4GX0A 3VQYA 3B8NA 5CBGA 1K4CC 4X1YA 4LWSA 1COWG 3FD9A 3F5TA 1HW7A 1PNLA 5IYDO 3WG7B 2OWOA 2UUAB 3BABA 3ZIAG 4DV5O 1F4MA 2R72A 3RYCB 4QPJA 4NR1A 2UUBO 3E8GA 1SESA 1K73W 4DR7B 2H3OA 1WPBA 3T4ZA 2JDIG 5IJ0B 1HP8A 2ZT9B 2YSUB 3CMAV 5LHHA 3RYCA 2JJ2G 1NZ6A 1SZXA 1Q6UA 3E83A 2P7TC 4TQFA 3OGIB 3H1LH 2YIBA 5BMVA 2C2AA 1VF6A 4MVQA 5A9GA 1P49A 2HKOA 2LGQA 1H38A 5FL7G 5FPOA 3DC5A 4L87A 4GKKB 2OCCB 4WBNB 3K06A 3GVMA 1AI4A 1W59A 3HKEB 1V9PA 4IYIA 2Q7EA 4UCRA 4UV8A 1D2DA 5J9PC 3ZS8C 1QNMA 2VS0A 4FLVA 5GTHZ 2AZ0A 3CRQA 3AG2C 4WBNA 4UVCA 3HKEA 4C7UA 2F4VB 4FLUA 2ETNA 3VQWA 3CD6V 1GRJA 2UXDB 4CH4A 3R66A 1NT2B 4G27B 1OCZB 1EZVH 2EULA 1H2LA 3SPGA 2YXHA 2HHHB 1I08A 1HR0B 1SQVH 4NXNO 1VQPV 2PZSA 4B3RO 3CYOA 2QKSA 3WB2A 4Z2WA 4FZ1A 3QG5A 1FKAO 3CCRV 1NKDA 2JEXA 3NR7A 4JI3B 1RPOA 4ZOLB 3CRMA 2HVJC 1G4YB 3B8MA 1BCCH 4JTDB 1WP7A 3ZN1A 4MTFA 3ZMVA 4ZOLA 2Q67A 2CGNA 2X6CA 2ZM6O 1YVWA 4ZKIA 2WSSG 4PA6A 4R50A 4MTOA 4RQFA 2JGDB 3LSUA 5B1AC 4JI1O 4DV6B 1SQQH 1QLEC 5EBLC 1YIJV 4U7OA 4DV1O 1ZL8B 2JGDA 2BOCC 1VARA 1K7DA 3ABMB 2O57A 1ZL8A 1XDCA 1KKCA 5FPRA 3FYIB 2UUCO 2D2CB 1QLNA 1X59A 1MMMA 5B1BC 4D7TA 4A5UB 5IWAB 2NR5A 1WB8A 3AG3B 1SETA 1TAEA 2LGWA 4GX2A 5LHIA 1KB9F 2Q4PA 3CE2A 1AP5A 4GLXA 3H1HH 2EIMC 4PD4F 2X6BA 1K92A 5J2UB 4DV3B 1OCRC 5B3SB 3OE7G 4K0KB 2PGGA 4U7NA 2UXBO 4AQYB 3KKYA 1CP9A 1P84F 4PDLA 2OIEA 4CH6A 3JAWA 2B1GA 3JALB 2KSDA 3QNEA 4JYAO 1AI7A 1N8RW 1JA8A 3JALA 5LMNB 4JI7O 5A2QN 5E1AC 3UT5A 4JI6B 3K03A 1YDXA 1JMKC 1TUEB 2CE4A 2E5LO 3FB7C 1DGSA 2YIBD 3CB2A 3TGUH 1XI1A 4HNAA 1WN7A 4K8ZA 4FZ0A 2WLJA 2RJZA 5IT9N 3GB7C 4NYKA 3QF7A 2ZNIA 3SYOA 3K0GA 4GX5A 1KP3A 1MG1A 3H1JH 3RYHB 3L71H 1MZEA 2QWPB 4TV8B 4RAIA 4GKJB 1IBKO 2VQEO 1ZSPA 2XTAA 3W7SA 1IBMB 1OCCC 2P4VA 3RYHA 2GV9A 3OTOB 2CTWA 1XHXA 4TV8A 4P2ZA 1BL8A 1I94O 3HPLC 4FJCC 1UPGA 3OM3B 1PNKA 1AI6A 4O4IB 4JI0O 4LF9B 1M90W 4J80A 1M57B 3K9SA 2ADQB 4O4IA 5BXZA 1P7GA 1I94B 4TOIA 2YC0A 3K5OA 5BY1A 1YHQV 1TVKB 2F43G 2QDOA 5DEDA 4X64B 1GN6A 2VWKA 1G8MA 3APOA 4G2KA 3MD0A 2QWQB 3BRCA 1TVKA 5L3FA 2FL4A 3SYPA 1CXZB 2P90A 3E8BA 4DUZO 1R1BA 3B2EE 5EBWC 2QGNA 2IW5A 2N74A 1GM7A 3SJAC 2IJIA 3TXSA 2VQFO 1Q43A 2EZOA 4JI4O 1I5YA 5FLXN 1NI8A 2DWDC 1OHHG 4HYOA 5H5NA 4UCTA 1M1KW 1NVPB 2W0FC 2YI8A 1Z5WA 4JTCB 5KLVH 1Y67A 4DV2O 1VQLV 4JAAA 3ICXA 3BCCH 5B5EZ 3H01A 2DW4A 3HR0A 2KB1A 1YCIA 3FB5C 5CA1B 5CA0B 3BPZA 2JJ1G 3ZRXA 2AHYA 1B06A 2MW2B 4CC6A 2BE3A 1K5SA 5CA1A 5CA0A 5IY5C 2DJVA 1EN6A 1BT8A 1JFFB 3N2GB 3M7MX 4B3TO 1XOUA 5JJEB 3SPHA 1PV0A 3G6EV 1HNWB 3K59A 1JFFA 2XAFA 3UQ8A 1N36B 3N2GA 1QBZA 3EHBB 1AR4A 3AK3A 1K9MW 5B3SC 1M5IA 2NNUA 4LFCO 1Q86W 1SQGA 1EFRG 4EB6B 4EKWA 2FKXA 1WJZA 2UU9B 4WFBV 2IM9A 1V54C 3OUFA 1N0JA 2ZE5A 2CGOA 1XNRO 3CRAA 4UUJC 4EB6A 5LYJB 4LBEC 1FXVA 2XAJA 4B08A 1RM1B 4X89A 5ITZB 1Q3EA 3G4SV 2YS8A 3ABUA 3C90A 1XBLA 5LYJA 4GX1A 4I55B 5E79Z 5ITZA 4DK1A 4JYYA 2JS3A 3VBBA 3AG2B 4JZGA 4O2AB 4B3SO 2B9ZA 4I9WA 4I55A 4QGPA 1BE3H 5KX5B 3J81N 2GDSA 1D5NA 1GAXA 4P9OA 3E86A 4O2AA 1K8AW 3JAKA 3LDEA 4O2BB 1Q7YW 3D8CA 5KX5A 5IYZB 2XOKG 1J5EO 1F23A 2CTRA 2XAHA 2CK3G 4O2BA 1O9HA 1N32B 5IYZA 4DR4B 3M99B 4RO2A 3BA8A 2EIKC 1NR1A 1OCOC 1URFA 2Y0PA 2YDEA 2ZDIC 3ZRWB 4OX9O 4R7CA 3BFRA 3SPCA 4H13B 3A0HZ 2NLJC 2WLMA 3G67A 5EYPB 3FB8C 3ZRWA 4JYCA 5B1AB 2ZR3A 1GN3A 4KL1A 2GTAA 1QLEB 1SERA 1GO3F 5EYPA 3RVYA 1QVFU 1FFXB 2RMKB 1R6TA 2JIZG 2QJ1A 4WFGA 4HAMA 5H9CA 2BTOA 1S77D 1BMFG 1FFXA 4JASA 4JI5B 3VQXA 5B1BB 4X1KB 1N34B 2B1IA 4UB8Z 3ETGA 4WFFA 4FLXA 1R73A 1XREA 1NVPD 5EC2C 1T5EA 3RGBA 5IJ9B 1FS0G 5BR8B 2EIMB 4UCVA 1VQOV 2DYRC 2F23A 5KHJA 2QM4A 3JSNA 4X1KA 4EFBA 1Q82W 4ZI7B 4MVUA 1OCRB 4NXMB 1UJWB 5IJ9A 2LO1A 4LF8B 4LF4B 1N0NA 4ZI7A 2YIDA 2ZINA 4MS2A 1H2GA 2WAMA 3L75H 4RUEA 4OXSA 4QJFB 3K79A 3K08A 2XAQA 3WU2Z 2A3QA 3STZC 4DK0A 1I7FA 3ZHQA 2UUAO 4B3MB 2ZE6A 2E74B 1EN4A 2Y0IA 5KA5A 3AK1A 4DR7O 1PL4A 2N04A 3ETEA 1XL6A 2LFSA 1VF5B 4CZZA 3SYCA 2P67A 1F51A 1LR1A 4OPHA 2UXNA 3ASNC 3K3WA 2JVDA 1KQSU 3X2QC 4H37A 3CXHF 4MW8A 3JATB 2YI9A 3T4DA 1HNXB 5IJ0A 1R3JC 3BA9A 4GKKO 3LUTB 3TXQA 1FXHA 1OCCB 3OD4A 4GUNA 1PKXA 2KQXA 1PL0A 1RM1C 1X4TA 3AG4C 3UKMA 2F4VO 4PA3A 3ZMZA 4KXRA 4E4EA 4RWUA 2HVKC 1AP6A 2F95B 3RBZA 5B66Z 2UXDO 5DM6V 4BWAA 1WAZA 1EZJA 1IBLB 3CCJV 1L0LH 4IIJB 1TA8A 2DOSA 3E8HA 3SPIA 2HHHO 1HR0O 1YJNV 1US6A 2HJDA 1KUQA 4WFAV 5HFLA 1MOFA 3ZMUA 1FD9A 4IIJA 5L3BA 3FYEB 3T1YB 1ROPA 1FXKC 4O4JB 4JI3O 3ABKC 1ZX3A 4DR1B 4IGGA 5LGNA 2BCCH 4I7ZB 4TWKA 4O4JA 4J7ZA 4YJ2B 5KA6A 4DV7B 1NS1A 2EILC 3E2EA 5KUKA 3A0BZ 1THZA 2YEVB 1H8HG 1CPYA 2CDYA 4CS2A 3I5DA 3CS5A 3IFXA 4DV6O 1S3JA 4YJ2A 5JH7B 2IJKA 3CHXA 3TETA 2QEXV 2YEVA 5KUMA 1MSWD 1NTMH 4LF6B 3CCLV 5JH7A 2WWWA 1Z2GA 3ZHUA 5EBMC 4UXNA 1G1XB 5JJNB 1GN2A 2CTQA 3L74H 1VQ7V 3S3XA 1MA1A 3CP1A 1VIBA 3P3NA 4HZ3A 5IWAO 5BZBA 1QVGU 1J95A 2W6IG 4LFAO 5IY5B 2D3OW 3HKDB 3C3TA 3ZN0A 2DYSC 4J11A 1Q5OA 4RUFA 4DV3O 3RWRD 2RCVA 4ABMA 2FMLA 4K0KO 4PJ0Z 1KMIZ 1HNZB 3HKDA 4LFAB 5EZYB 3E8FA 2FB5A 3M8AA 3OTFA 4AQYO 3DGEA 4FM0A 4MW3A 4AILC 1PNMA 5KHHA 1Q81W 3FFQA 2R9AA 5EZYA 3D36A 4K3AA 3BVOA 3RYFB 3BAAA 1IZ3A 4GT1A 5KAIZ 5J2UA 3WB1A 2WLIB 1AR1B 1V54B 1B04A 4ICGA 3OEHG 2OYQA 3RYFA 5LMNO 1K3EA 2ZE8A 2ZD9A 4JI6O 4N21A 2WLIA 2V7QG 2HG5C 3T1CA 1GMGA 4MVSA 3U11A 3AK2A 2JS5A 1VQNV 3GWKC 1K4DC 2V1DA 3K0DA 4O4HB 2Z5UA 1PP9H 2ILMA 2P22C 3CMEV 1S5LZ 4ZHQB 1SRYA 1AROP 3JYCA 2PI4A 4PDMA 4TSFG 1JR9A 1GTOA 4O4HA 1YF2A 1NU1H 2Z3YA 2PYJA 4ZHQA 4GKJO 4FLYA 4EFEA 1IBMO 2K1EA 3JAMN 3OTOO 3SJCC 4BAYA 4CS4A 4G28B 2Q73A 3KZIZ 4TUYB 1AI5A 2EIKB 4LF9O 5EK0A 1N33B 1OCOB 2KKWA 3N27A 4JPRA 3QO5A 3STLC 5F2VO 4WCEV 1YEWA 1GKFA 1KU9A 1P4RA 1QR8A 4DV0B 4X64O 5GONB 4NVPA 2ZDIA 3WFVA 2QWNB 1QCEA 1S5HC 1AB3A 3HKBB 3OEEG 5GONA 1MSDA 5GW7A 4DXWA 3OW2U 3EVKA 2QA4V 1WPXA 3HKBA 2QKCA 2EINC 4JYBA 2E3CA 1JQ0A 1R6KA 2L6LA 2ZXWC 1H2SB 4J42A 1V55C 3D3IA 2NN4A 4DUYB 1QR9A 4LF5B 2X0LA 4I5SA 1GM9A 4I50B 2DYRB 4NKGB 2IJHA 2ZKOA 2DN9A 2W6JG 5CA3A 2ZNJA 4UV9A 4I50A 1BHAA 3N2KB 2Y48A 1XUQA 2HLDG 1GK9A 1Y76B 4PHZA 1NH2B 1DTOA 1BS3A 1L8DA 3CSXA 4KHPB 1QHTA 1VQ9V 2Y69C 2AW9A 1XNQO 1UFIA 3H1IH 3TCUA 2RNBA 3N2KA 2A06H 1Y76A 1AJPA 1O9GA 4MTGA 4AI8A 4YHHB 4FMTA 2W0XA 3K5MA 2EJ7A 2CH7B 1XNQB 3Q4HB 3UM7A 4JGSA 3TJTA 1G6UA 3RT3C 5DN6G 3UO3A 3JD3A 3OMIB 1MNGA 2CH7A 1HNWO 3Q4HA 2WPDG 4P30A 1RP3B 1N36O 1SF9A 4BIUA 4FFBB 1ZWIC 4H0LB 3F7VC 4K8XA 2UXXA 4JI2B 3ZRVA 3ZMTA 3C3SA 2PY5A 3ZHSA 4FFBA 2UU9O 4CH5A 3A8TA 4LFBB 3SJBC 4LH6A 1Y74B 3ASNB 4QNHB 2ITDC 4LC1A 2H8PC 3X2QB 3P32A 3CCQV 4U3FH 5J2TB 1NTKH 1Y74A 2XASA 1JCHA 1B6QA 1JJOA 3ETDA 5J2TA 1VQ5V 4UFZA 3ZEDA 5DECA 2F1MA 1SKVA 3CPWU 4KP4A 1KKDA 4KUMA 2WA4A 1F4NA 2PTMA 3AG4B 1XQ8A 3K9AA 3OMAB 3HKCB 2ZIMA 1DK1A 4J10A 1SC5B 3LNMB 2Q7GA 4UCOA 2DE0X 2GHYA 4QE9A 3HKCA 1I0HA 3LDCA 1D5AA 4JAVA 1XMQB 4RQEA 3GWOA 2JEUA 4NTXA 4XDKA 5FNVB 3UO2A 1E79G 1AVMA 1P7BA 2H94A 2DQ3A 1WLEA 2WA3A 4JI8B 1N32O 4DR4O 3P3PA 5FNVA 1WB7A 1FXKB 1SQBH 2CTPA 3ABKB 3SDLA 4X65B 4TT3G 3CCEV 1FXKA 4Z1MG 3SGIA 3MHSC 4LH7A 2EILB 5KHKA 1NQTA 4JV5B 2Y4UA 2XNDG 2HFEC 3L9DA 3SJQC 3OMNB 2E75B 1A32A 1AJNA 4UVAA 3E89A 4X66B 5EIBC 1H2MA 4WFHA 3W7TA 3CCUV 4FLTA 4NTYA 1ZUQA 4DV4B 4CS3A 4XDJA 4IHJB 4DR3B 4NTWA 1EN5A 4YIOA 4JI5O 1VF7A 4K35A 5LL6Y 1XL4A 1M56C 5LP6C 4F6EA 4BW9A 4IHJA 3AEIA 1N34O 2X6AA 5KHGA 3LSQA 3ZMSA 5BR8O 4U3JB 4P9PA 3LDDA 3HB3B 4DR5B 5H2FZ 5L3DA 2DYSB 4H33A 3J80N 2GUZB 4NXMO 4LF8O 1YI2V 4U3JA 2UXCB 4LF4O 1NH2D 1Z5VA 2AGAA 1KP2A 2BSKB 1DF4A 4O4LB 2Q5ZA 3QTCA 2GUZA 4CH3A 5LGTA 2BSKA 4IT5A 4O4LA 1RFYA 4PA9A 2Q7HA 3CC7V 1BQ0A 3CCMV 1KYOF 4YY3B 1CEZA 3A0RA 4B3MO 5JCOC 1YXBA 4DO2A 2AXTZ 3FB6C 1EBOA 1EM1A 4BR6A
chains in the Genus database with same CATH topology
1AI6A 2JK5C 4UXNA 5EBMC 4R6ZA 3ABTA 1R3KC 3ML0A 3OUSA 1BHBA 1VQ7V 1M90W 2Q68A 2QTOA 1M57B 3CP1A 4PA7A 4HZ3A 3PJSK 4J9ZB 3BEHA 4MVMA 5BZBA 1ENVA 1QVGU 1J95A 2W6IG 3QO8A 3SYQA 1YHQV 2F43G 1G8MA 5IY5B 4WF9V 2D3OW 3ZN0A 4G2KA 3NXSA 2DYSC 1W0JG 3MD0A 4RUFA 1VQ4V 1LNQA 5L3FA 1S72V 2BOBC 3CCVV 3SYPA 4BIZA 4F4LA 2XAGA 2P90A 3E8BA 1VQKV 4PDVA 3E8FA 5EBWC 5C93A 3AG1C 2IW5A 1FFTB 3CC2V 3DGEA 3E35A 1JVMA 1GM7A 4MW3A 1PNMA 3B77A 1AJQA 2EZPA 2Q69A 4R8CA 2IJIA 4E2LA 1YITV 3ASOB 4QPKA 1Q81W 2EZOA 3D36A 1I5YA 5L3GA 3JD2A 2DWDC 3DTUB 3F7YC 4GT1A 2X7RB 1OHHG 3W7UA 4HYOA 4FIPC 2WLIB 1M1KW 1AR1B 1V54B 1MABG 4GCZA 3SPJA 1NVPB 2WLHA 3OEHG 2W0FC 4XBFA 2OTLV 1K3EA 2EJRA 2ZD9A 4JTCB 2IH1C 2ATKC 4N21A 2WLIA 1VQLV 4QE7A 4WFEA 2V7QG 3EFFK 2HG5C 4MVZA 3T1CA 1GMGA 4MVSA 2PI5A 1VQNV 2MK3A 3H01A 2DW4A 1GM8A 1K4DC 1K97A 2KB1A 2V1DA 3K0DA 4MT8A 1M57C 3FB5C 3RW0A 3ZCCA 2GSMB 5H6QA 2Z5UA 1K33A 2JJ1G 2EINB 2OTJV 3CMEV 2IJJA 5LHGA 3ZRXA 1SRYA 1AROP 2AHYA 5L3EA 2ZXWB 3JYCA 1M9NA 2PI4A 2WLNA 2OT5A 5IYBO 4PDMA 1K5SA 4TSFG 1GTOA 5IY5C 2IH3C 5LBQA 2Z3YA 1HWYA 4UVBA 2A0LA 5B1OA 1V55B 4JAUA 2ZR2A 2QM8A 2HR3A 1NJIW 3MHHC 2K1EA 3R65A 3SPHA 3G6EV 1KD1W 4BAYA 3CCSV 1JX9A 2XAFA 5CMUA 1YJWV 5H6RA 1S76D 1QBZA 4G28B 3EHBB 1K9MW 3ASOC 5B3SC 3P30A 1AI5A 2EIKB 2NNUA 1JPXA 5EK0A 1OCOB 1Q86W 3OAAG 4MVOA 3ABLB 3TK1A 2Y69B 1EFRG 4ASUG 4EKWA 4JPRA 3QO5A 3STLC 3VOUA 4WFBV 3JCZA 1KC8W 1V54C 3OUFA 4WCEV 1GKFA 2Q6AA 1KECA 2WLKA 1P4RA 1YTFB 1QR8A 4UUJC 3K04A 4ZBMA 2QM7A 2ZDIA 4LBEC 1FXVA 2XAJA 4MSWC 3WFVA 4X89A 3G4SV 1RM1B 4MVRA 2ITCC 3ABUA 1QCEA 1S5HC 4JTAB 3OEEG 4GX1A 5GW7A 2AHZA 4QIWF 1ORQC 3I56V 4DXWA 5CN0A 3W7XA 3OW2U 2R9RB 3OGCC 2QA4V 3VBBA 3AG2B 3JD1A 1DF5A 4PELA 1WPXA 2LFRA 2EINC 4I9WA 1W2BU 1IXMA 1R3IC 2EIJB 5B1NA 4JYBA 4X88A 1JQ0A 1R6KA 2ZXWC 4GX0A 1W0KG 3B8NA 5CBGA 1K4CC 4P9OA 1COWG 3E86A 3F5WC 1PNLA 1K8AW 5IYDO 3WG7B 3LDEA 1Q7YW 3ZIAG 1V55C 1F4MA 3D3IA 4QPJA 4JF3A 2XOKG 1QR9A 3E8GA 2X0LA 4I5SA 1GM9A 1F23A 2DYRB 1SESA 2XAHA 1K73W 1K34A 2CK3G 4X8AA 3T4ZA 2JDIG 3SYAA 3CMAV 2YSUB 5LHHA 2IJHA 2ZQMA 2JJ2G 2W6JG 5CA3A 3M99B 3E83A 3JD0A 4RO2A 4UV9A 1BHAA 2Y48A 2P7TC 2HLDG 1PD3A 1GK9A 2EIKC 4LCUC 1NH2B 1NR1A 4N23A 1OCOC 1DTOA 1K5QA 1YJ9V 5HFMA 3ABLC 1VQ9V 2Y69C 2ZDIC 3ZRWB 3TCUA 1SZTA 4R7CA 2C2AA 4MVQA 3SPCA 1AJPA 5CBFA 2HKOA 2NLJC 4MTGA 4PA4A 2WLMA 1H38A 1JOYA 5FL7G 3FB8C 4FMTA 3ZRWA 4JYCA 2EBOA 5B1AB 2ZR3A 4L87A 2OCCB 3K06A 3UM7A 1AI4A 4JGSA 1QLEB 1L1FA 1GO3F 1SERA 5DN6G 4UV8A 1E1QG 3JD3A 3RVYA 5J9PC 1QVFU 5EC1C 3OMIB 3AG2C 2JIZG 2WPDG 4P30A 3LSSA 4UVCA 4WFGA 4HAMA 4BIUA 1ZWIC 5H9CA 2EIJC 1S77D 1BMFG 3F7VC 3CD6V 2UXXA 4JASA 3ZRVA 3ZMTA 5B1BB 1Y4MA 4G27B 1OCZB 2WLLB 3WG7C 3SPGA 2B1IA 3ETGA 4WFFA 1NVPD 1R73A 3ASNB 5EC2C 4QNHB 1Y66A 3OFNG 2ITDC 4LC1A 2H8PC 3X2QB 1FS0G 2EIMB 1VQPV 2A9HA 3P32A 1VQOV 2DYRC 3CCQV 2WLLA 3CYOA 2QKSA 1VQ8V 1Q82W 4MVUA 2XASA 1OCRB 1UJWB 1NKDA 2JEXA 3CCRV 1JCHA 1B6QA 1RPOA 3ETDA 1RPRA 3OR6C 1VQ5V 2HVJC 1G4YB 1E1RG 3B8MA 1NR7A 3CPWU 1R6NA 4JTDB 4KP4A 1KKDA 4KUMA 1F4NA 3AG4B 3K9AA 2DWEC 3ZN1A 3OMAB 1DLBA 2R9IA 4MS2A 4MTFA 3ZMVA 1H2GA 2HJFC 2Q67A 2WAMA 3LNMB 2B5UA 2X6CA 3ZRSA 4ZKIA 2WSSG 4RUEA 4PA6A 4OXSA 4QJFB 2GHYA 3K79A 4R50A 3K08A 4MTOA 4RQFA 2XAQA 4CBCA 4QE9A 5B1AC 1M56B 3LDCA 2OCCC 3STZC 2P6JA 2QE7G 4JAVA 1QLEC 4RQEA 5EBLC 3GWOA 2IU0A 1YIJV 2JEUA 4U7OA 4XDKA 5L3CA 2BOCC 1E79G 1P7BA 1I5XA 2H94A 3IGAC 5KA5A 2DQ3A 1WLEA 1K7DA 3ETEA 1XL6A 2M7WA 3ABMB 2A79B 3W7WA 3BY6A 2LFSA 4Q20A 3FYIB 4CZZA 1FXKB 1QLNA 3SYCA 3ABKB 3G71V 2P67A 1F51A 2IU3A 4TT3G 5B1BC 1S0VA 2DQ0A 1OCZC 3AG3B 1SETA 4GX2A 5LHIA 3CCEV 1FXKA 4Z1MG 2UXNA 3ASNC 3K3WA 1KQSU 3QO7A 4BW5A 3MHSC 1YTFD 3X2QC 4H37A 4MW8A 2EIMC 2EILB 1VQ6V 2X6BA 1NQTA 5CBHA 3T4DA 2FTKA 1K92A 1R3JC 2XNDG 1JJ2U 2HFEC 1OCRC 4YXWG 3SJQC 3LUTB 3OMNB 3T2MA 1AJNA 5B3SB 2LP7A 1H8EG 4UVAA 3E89A 3OE7G 5IDJA 5LGUA 1FXHA 4WFHA 3CCUV 3W7TA 1OCCB 4KFMA 1PKXA 3IC7A 4U7NA 1PL0A 1R3LC 3JD4A 1RM1C 3AG4C 3UKMA 3FKSG 1CP9A 4PA3A 3ZMZA 4PDLA 4XDJA 1VQMV 1YSCA 2B1GA 2HVKC 3RBZA 5DM6V 3QNEA 1XL4A 1M56C 1AI7A 4PDRA 1EZJA 3AEIA 3CCJV 2X6AA 3LSQA 3ZMSA 3E8HA 3SPIA 1N8RW 1YJNV 3KG2A 5E1AC 4P9PA 4WFAV 5HFLA 5IYCO 3K03A 4LP8A 3LDDA 1MOFA 3HB3B 3ZMUA 3ABMC 1TUEB 3ZJZA 5L3DA 2DYSB 4H33A 5L3BA 3CXCU 3RVZA 3FYEB 1YI2V 3FB7C 4J9YB 1ROPA 1FXKC 3ABKC 1NH2D 5LGNA 1KP2A 1DF4A 4TWKA 3AG3C 3AG1B 4FK5C 4XDLA 2WLJA 5KA6A 5LGTA 3E2EA 2EILC 3GB7C 5KUKA 1THZA 2YEVB 4PA9A 3SYOA 3CC7V 1H8HG 1CPYA 3K0GA 1KP3A 4GX5A 3CCMV 1MG1A 3IFXA 3OR7C 1CEZA 1S3JA 3A0RA 4RAIA 4MTXA 4FPPA 2IJKA 3W7SA 3TETA 1OCCC 2YEVA 5KUMA 4DO2A 2QEXV 1MSWD 3CCLV 3I55V 3CC4V 3FB6C 1EBOA 1NBMG 1OZ0A 4P2ZA 1BL8A 3HPLC 2WWWA 4FJCC 3OM3B 1PNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JK5 C;  5EBM C;  3FB8 C;  4GX2 A;  4R6Z A;  2K1E A;  3ASN C;  3R65 A;  1R3K C;  3OUS A;  3SPH A;  4BW5 A;  3K06 A;  3UM7 A;  3X2Q C;  2Q68 A;  4H37 A;  2EIM C;  4MW8 A;  2QTO A;  2X6B A;  4PA7 A;  4HZ3 A;  5CBH A;  3T4D A;  4G28 B;  3PJS K;  3RVY A;  5J9P C;  4J9Z B;  3ASO C;  1R3J C;  5EC1 C;  3BEH A;  5B3S C;  4MVM A;  5BZB A;  2HFE C;  1OCR C;  3AG2 C;  5EK0 A;  1J95 A;  3SJQ C;  3SYQ A;  3LUT B;  4P30 A;  4MVO A;  3T2M A;  4WFG A;  3E89 A;  4EKW A;  1ZWI C;  4WFH A;  2EIJ C;  3STL C;  3VOU A;  4KFM A;  1V54 C;  3F7V C;  3OUF A;  2Q6A A;  2DYS C;  4RUF A;  1R3L C;  2WLK A;  3AG4 C;  1LNQ A;  4UUJ C;  3UKM A;  2BOB C;  3K04 A;  3SYP A;  4G27 B;  4PA3 A;  4ZBM A;  2WLL B;  4LBE C;  3WG7 C;  4F4L A;  4PDL A;  4MSW C;  4XDJ A;  3E8B A;  4X89 A;  3SPG A;  4MVR A;  4WFF A;  4PDV A;  3E8F A;  5EC2 C;  5EBW C;  4QNH B;  2ITC C;  2ITD C;  2HVK C;  1S5H C;  3RBZ A;  2H8P C;  3AG1 C;  4JTA B;  2A9H A;  2DYR C;  1JVM A;  1XL4 A;  1M56 C;  4GX1 A;  4MW3 A;  2AHZ A;  2WLL A;  4PDR A;  4R8C A;  1ORQ C;  2Q69 A;  2QKS A;  4DXW A;  2X6A A;  2R9R B;  3OGC C;  4MVU A;  3E8H A;  3SPI A;  2DWD C;  3F7Y C;  3KG2 A;  2EIN C;  4I9W A;  5E1A C;  4P9P A;  1R3I C;  4HYO A;  3OR6 C;  3K03 A;  2WLI B;  4LP8 A;  4X88 A;  2HVJ C;  3LDD A;  1G4Y B;  2ZXW C;  3ABM C;  3SPJ A;  2WLH A;  4GX0 A;  4JTD B;  3ZJZ A;  2W0F C;  4H33 A;  1KKD A;  5CBG A;  3RVZ A;  1K4C C;  4P9O A;  3FB7 C;  2ZD9 A;  2DWE C;  3E86 A;  4J9Y B;  3F5W C;  4JTC B;  4MS2 A;  2IH1 C;  3ABK C;  2ATK C;  4MTF A;  3LDE A;  2Q67 A;  2HJF C;  2WLI A;  3LNM B;  2X6C A;  3ZRS A;  1V55 C;  4QE7 A;  4WFE A;  3EFF K;  4MVZ A;  2HG5 C;  4RUE A;  4PA6 A;  4TWK A;  3AG3 C;  4OXS A;  3T1C A;  4R50 A;  4MVS A;  3K08 A;  4MTO A;  3E8G A;  4XDL A;  4CBC A;  2WLJ A;  4QE9 A;  5B1A C;  3LDC A;  4X8A A;  3T4Z A;  2OCC C;  3STZ C;  3SYA A;  1QLE C;  1K4D C;  2EIL C;  2KB1 A;  3GB7 C;  5EBL C;  5KUK A;  3K0D A;  1M57 C;  3FB5 C;  3RW0 A;  4XDK A;  4PA9 A;  3SYO A;  3E83 A;  3K0G A;  2BOC C;  4GX5 A;  4RO2 A;  1P7B A;  2P7T C;  3IGA C;  3IFX A;  2EIK C;  3OR7 C;  4LCU C;  1OCO C;  2AHY A;  4RAI A;  1XL6 A;  3JYC A;  3ABL C;  2Y69 C;  2A79 B;  2WLN A;  4PDM A;  3TET A;  1OCC C;  2YEV A;  5KUM A;  5IY5 C;  2IH3 C;  3TCU A;  4R7C A;  3SYC A;  4MVQ A;  3FB6 C;  3SPC A;  5CBF A;  2A0L A;  2NLJ C;  1BL8 A;  4P2Z A;  3HPL C;  4MTG A;  4PA4 A;  2WLM A;  5B1B C;  1OCZ C; 
#chains in the Genus database with same CATH topology
 3K5N A;  4BIO A;  4ZIB A;  1FYJ A;  3ML0 A;  1BHB A;  2ZCE A;  4J41 A;  3O65 A;  1H2N A;  4PI0 A;  3PJS K;  4J9Z B;  5LOV B;  2Q0O C;  3QO8 A;  3T1H B;  5C8Y B;  5K1P A;  4LF7 B;  1HNX O;  4WF9 V;  3L73 H;  3NXS A;  3K57 A;  5LOV A;  1VQ4 V;  4X1I B;  3G6B A;  1S72 V;  4X20 B;  3CCV V;  4DW0 A;  2R70 A;  4DR6 B;  4F4L A;  5JQG B;  1VQK V;  1OV9 A;  4PDV A;  3ZHR A;  4X1I A;  3AG1 C;  1FFT B;  4YIP A;  3CC2 V;  4X20 A;  1SQF A;  1AJQ A;  2Q69 A;  4R8C A;  5JQG A;  4X62 B;  1XIL A;  4E2L A;  1YIT V;  5CB4 B;  4QPK A;  1FJG B;  3JAT A;  4YJ3 B;  5L3G A;  3JD2 A;  2ZIO A;  2LQT A;  2Q8V A;  2X7R B;  3W7U A;  1LUV A;  1IUR A;  1IBL O;  5CB4 A;  1M93 A;  3JSL A;  4DV5 B;  1MAB G;  5BMV B;  4YJ3 A;  2UUB B;  2CAZ C;  2OTL V;  4DRX B;  4QE7 A;  4MVZ A;  2PI5 A;  2A7W A;  3T1Y O;  1AIL A;  3CRR A;  4DYL A;  4DR1 O;  2MK3 A;  4DRX A;  1FPO A;  4J7K A;  3ZCC A;  2GSM B;  1K33 A;  2OTJ V;  2EIN B;  2VWJ A;  3B40 A;  2CUG A;  4DV7 O;  2ZXW B;  2WLN A;  2OT5 A;  5IYB O;  2JGU A;  5LBQ A;  3OT7 A;  3DSQ A;  5B1O A;  3QVN A;  1V55 B;  3DC6 A;  3H9V A;  5KMG B;  1NJI W;  5JWP A;  5IE9 A;  4LF6 O;  3R65 A;  4OGQ B;  4FVM A;  1KD1 W;  4OPA A;  3CCS V;  1JX9 A;  5CMU A;  5H6R A;  5KMG A;  5GTI Z;  3ASO C;  1JPX A;  3OAA G;  4B7K A;  2Y69 B;  4ASU G;  2QWR B;  3VOU A;  3JCZ A;  1KC8 W;  2PUS A;  3DXR B;  1KEC A;  3K58 A;  1BZK A;  4NXN B;  1YTF B;  4LR3 A;  1S5J A;  3K04 A;  4NB5 A;  4B3R B;  3L72 H;  4IYH A;  4MVR A;  3DXR A;  3IJ4 A;  1MZF A;  2ITC C;  2AHZ A;  1ORQ C;  1IDS A;  2VRZ A;  3SR2 C;  5CN0 A;  1HNZ O;  3FX7 A;  4F6R B;  3FAV B;  3JD1 A;  4TV9 B;  1XMO O;  2XUM A;  1IXM A;  4GZR B;  4PI2 A;  4X88 A;  2ZM6 B;  1W0K G;  1U97 A;  4DW1 A;  4F6R A;  3FAV A;  4TV9 A;  3F5W C;  3PN1 A;  4JI1 B;  2Q9L A;  1VEW A;  2P06 A;  4DV1 B;  1XMO B;  1WNS A;  1B3Q A;  4JF3 A;  2YUA A;  1M4U A;  2IBZ H;  5K1X A;  1K34 A;  5AG2 A;  4X8A A;  3SYA A;  3CX5 F;  2ZQM A;  3JD0 A;  2UUC B;  1PD3 A;  4LCU C;  1LUW A;  4N23 A;  1SQX H;  1K5Q A;  1YJ9 V;  3MDS A;  5HFM A;  3ABL C;  3UCS C;  5LA6 B;  1F7Y A;  1SZT A;  3D3Q A;  5CBF A;  5D5P A;  4PA4 A;  3JAW B;  1U96 A;  4Q6G A;  3RFR A;  1JOY A;  5LA6 A;  2EBO A;  1L1F A;  1E1Q G;  3APQ A;  2Q0A A;  5EC1 C;  3UT5 B;  2UXB B;  3LSS A;  3CJH B;  1XEQ A;  2EIJ C;  4H44 B;  2HEP A;  1Q6H A;  2QWO B;  1N33 O;  4HNA B;  3L70 H;  1N4C A;  2DMX A;  1Y4M A;  3CJH A;  4JYA B;  2WLL B;  4UCU A;  3WG7 C;  1PPJ H;  3MAQ A;  2YIC A;  1Y66 A;  3OFN G;  4JI7 B;  4DV0 O;  2A9H A;  2JRI A;  2M6Y A;  2WLL A;  4GYC B;  3ZHV A;  1VQ8 V;  5JVD B;  3S3W A;  2E5L B;  4TUY A;  1VF6 C;  3CWB H;  1RPR A;  3OR6 C;  5JVD A;  1E1R G;  1NR7 A;  1R6N A;  4X9Q A;  2ZE7 A;  2DWE C;  1DLB A;  2R9I A;  2HJF C;  2B5U A;  3ZRS A;  3H1K H;  2BTQ B;  4CBC A;  3JAR B;  1M56 B;  5LP6 B;  2OCC C;  2P6J A;  2QE7 G;  4HBN A;  2HP8 A;  2IU0 A;  1IBK B;  2VQE B;  2YXY A;  3G80 A;  4DUY O;  5L3C A;  4LF5 O;  2BTQ A;  3JAR A;  3IGA C;  1I5X A;  5LP6 A;  4CC5 A;  2M7W A;  2A79 B;  3W7W A;  3BY6 A;  2KG7 B;  4Q20 A;  4JI0 B;  3WB0 A;  2XHB A;  3G71 V;  4KHP O;  2IU3 A;  1S0V A;  2DQ0 A;  1OCZ C;  2KG7 A;  2Y4T A;  1IX9 A;  3QO7 A;  2YXL A;  4BW5 A;  1YTF D;  1VQ6 V;  4YHH O;  5CBH A;  2FTK A;  4D7S A;  1JJ2 U;  4YXW G;  3VQV A;  3T2M A;  2LP7 A;  1H8E G;  5IDJ A;  5LGU A;  2LW7 A;  3AG7 A;  4D6T H;  4KFM A;  4DUZ B;  3IC7 A;  1R3L C;  3JD4 A;  5JCO A;  4FLZ A;  2RQ6 A;  4UB6 Z;  3FKS G;  1OJH A;  4W4K A;  1VQM V;  1BGY H;  1YSC A;  2VQF B;  1YZB A;  4JI4 B;  4JI2 O;  4LNU B;  2P4K A;  1ZLZ A;  2FYU H;  4PDR A;  1FAF A;  3E22 B;  4LFB O;  2ARH A;  4LNU A;  3KG2 A;  4DV2 B;  5IYC O;  1WP8 A;  4LP8 A;  3E22 A;  1IVS A;  1TUB B;  3ABM C;  3ZJZ A;  2E76 B;  3CXC U;  3JCU Z;  3RVZ A;  4J9Y B;  2QKA A;  1TGO A;  4I9Q A;  1XHZ A;  1TUB A;  2OIG A;  3O9O A;  5KHI A;  3AG3 C;  2F93 B;  3AG1 B;  4FK5 C;  4XDL A;  3JAS B;  1ZTE A;  3B4S A;  3D36 C;  1VMG A;  3JAS A;  5KAF Z;  3OR7 C;  1XMQ O;  3IC9 A;  4MTX A;  4FPP A;  3IAY A;  3A2F A;  4B3T B;  4TQD A;  3I55 V;  3CC4 V;  2QTS A;  4JI8 O;  1NBM G;  1OZ0 A;  1Q6I A;  2JK5 C;  4R6Z A;  2LJ2 A;  4IL6 Z;  3ABT A;  1R3K C;  3OUS A;  4LFC B;  1L0N H;  3ETQ A;  2Q68 A;  4X65 O;  1HDJ A;  2QTO A;  4PA7 A;  4EEQ A;  4J7J A;  5JJJ B;  3BEH A;  4MVM A;  4AHC A;  1ENV A;  1XNR B;  3U0Z A;  2V4D A;  3SYQ A;  2EX3 A;  4B7E A;  3CRC A;  4JV5 O;  3RN4 A;  3JAK B;  1W0J G;  2QSA A;  3EXA A;  5LMU O;  4DR2 O;  2GTS A;  2G38 A;  1RSO B;  1SQP H;  1LNQ A;  2LW1 A;  2BOB C;  5EIB D;  4X66 O;  4BIZ A;  2XAG A;  3KCX A;  2PYL A;  5C93 A;  4DV4 O;  1RSO A;  1Q90 D;  4B3S B;  3E35 A;  1JVM A;  1AR5 A;  3B77 A;  2EZP A;  5LMU B;  4DR2 B;  4UCS A;  3ASO B;  5D5Q A;  4FM1 A;  4DR3 O;  3F7Y C;  3DTU B;  5TIS Z;  3J7A U;  4FIP C;  4I0X B;  4GCZ A;  3SPJ A;  2WLH A;  1QU7 A;  1J5E B;  2AZ2 A;  4XBF A;  2EJR A;  2IH1 C;  2ATK C;  4I0X A;  1SA0 B;  4WFE A;  3EFF K;  4DR5 O;  1Y6X A;  1ZAU A;  2UXC O;  1SA0 A;  3K5L A;  1GM8 A;  1K97 A;  4PV1 B;  4MT8 A;  1M57 C;  3RW0 A;  5LXT B;  4Z1V A;  2K9P A;  5H6Q A;  4OX9 B;  3B09 A;  2YIA A;  3THO A;  2IJJ A;  5LHG A;  3KCY A;  5L3E A;  3ZBH A;  1M9N A;  5LXT A;  1QQC A;  1VP7 A;  2PF4 E;  2IH3 C;  1HWY A;  4UVB A;  3RYI B;  4YY3 O;  2A0L A;  4FLW A;  2Z0A A;  4JAU A;  1BSM A;  2ZR2 A;  2P5O A;  2QM8 A;  2HR3 A;  3MHH C;  3RYI A;  1YJW V;  1KBH A;  1S76 D;  2QR4 A;  1SS3 A;  3P30 A;  2RDC A;  3LNN A;  4MVO A;  3ABL B;  1NTZ H;  3TK1 A;  2N05 A;  1PM9 A;  2Q6A A;  3U10 A;  2WLK A;  3T1H O;  1GN4 A;  3BHP A;  4FM2 A;  2ADP A;  4ZBM A;  1GH6 A;  2QM7 A;  4LF7 O;  4MSW C;  2RN9 A;  1H2K A;  1IXB A;  4L8J A;  2L35 A;  2OCH A;  4JTA B;  1Q8I A;  4I4T B;  2GBO A;  1WA8 B;  4QIW F;  4DR6 O;  3I56 V;  3W7X A;  2F66 C;  3CEI A;  3ZX6 A;  2R9R B;  3OGC C;  4W4L A;  1BQZ A;  1DF5 A;  4PEL A;  4X1Y B;  2LFR A;  4LWS B;  4I4T A;  1W2B U;  1R3I C;  1WA8 A;  2EIJ B;  5B1N A;  4X62 O;  3ZHT A;  4JZ2 A;  2ODM A;  4FFK A;  5C8Y A;  2XT9 A;  1FJG O;  4GX0 A;  3VQY A;  3B8N A;  5CBG A;  1K4C C;  4X1Y A;  4LWS A;  1COW G;  3FD9 A;  3F5T A;  1HW7 A;  1PNL A;  5IYD O;  3WG7 B;  2OWO A;  2UUA B;  3BAB A;  3ZIA G;  4DV5 O;  1F4M A;  2R72 A;  3RYC B;  4QPJ A;  4NR1 A;  2UUB O;  3E8G A;  1SES A;  1K73 W;  4DR7 B;  2H3O A;  1WPB A;  3T4Z A;  2JDI G;  5IJ0 B;  1HP8 A;  2ZT9 B;  2YSU B;  3CMA V;  5LHH A;  3RYC A;  2JJ2 G;  1NZ6 A;  1SZX A;  1Q6U A;  3E83 A;  2P7T C;  4TQF A;  3OGI B;  3H1L H;  2YIB A;  5BMV A;  2C2A A;  1VF6 A;  4MVQ A;  5A9G A;  1P49 A;  2HKO A;  2LGQ A;  1H38 A;  5FL7 G;  5FPO A;  3DC5 A;  4L87 A;  4GKK B;  2OCC B;  4WBN B;  3K06 A;  3GVM A;  1AI4 A;  1W59 A;  3HKE B;  1V9P A;  4IYI A;  2Q7E A;  4UCR A;  4UV8 A;  1D2D A;  5J9P C;  3ZS8 C;  1QNM A;  2VS0 A;  4FLV A;  5GTH Z;  2AZ0 A;  3CRQ A;  3AG2 C;  4WBN A;  4UVC A;  3HKE A;  4C7U A;  2F4V B;  4FLU A;  2ETN A;  3VQW A;  3CD6 V;  1GRJ A;  2UXD B;  4CH4 A;  3R66 A;  1NT2 B;  4G27 B;  1OCZ B;  1EZV H;  2EUL A;  1H2L A;  3SPG A;  2YXH A;  2HHH B;  1I08 A;  1HR0 B;  1SQV H;  4NXN O;  1VQP V;  2PZS A;  4B3R O;  3CYO A;  2QKS A;  3WB2 A;  4Z2W A;  4FZ1 A;  3QG5 A;  1FKA O;  3CCR V;  1NKD A;  2JEX A;  3NR7 A;  4JI3 B;  1RPO A;  4ZOL B;  3CRM A;  2HVJ C;  1G4Y B;  3B8M A;  1BCC H;  4JTD B;  1WP7 A;  3ZN1 A;  4MTF A;  3ZMV A;  4ZOL A;  2Q67 A;  2CGN A;  2X6C A;  2ZM6 O;  1YVW A;  4ZKI A;  2WSS G;  4PA6 A;  4R50 A;  4MTO A;  4RQF A;  2JGD B;  3LSU A;  5B1A C;  4JI1 O;  4DV6 B;  1SQQ H;  1QLE C;  5EBL C;  1YIJ V;  4U7O A;  4DV1 O;  1ZL8 B;  2JGD A;  2BOC C;  1VAR A;  1K7D A;  3ABM B;  2O57 A;  1ZL8 A;  1XDC A;  1KKC A;  5FPR A;  3FYI B;  2UUC O;  2D2C B;  1QLN A;  1X59 A;  1MMM A;  5B1B C;  4D7T A;  4A5U B;  5IWA B;  2NR5 A;  1WB8 A;  3AG3 B;  1SET A;  1TAE A;  2LGW A;  4GX2 A;  5LHI A;  1KB9 F;  2Q4P A;  3CE2 A;  1AP5 A;  4GLX A;  3H1H H;  2EIM C;  4PD4 F;  2X6B A;  1K92 A;  5J2U B;  4DV3 B;  1OCR C;  5B3S B;  3OE7 G;  4K0K B;  2PGG A;  4U7N A;  2UXB O;  4AQY B;  3KKY A;  1CP9 A;  1P84 F;  4PDL A;  2OIE A;  4CH6 A;  3JAW A;  2B1G A;  3JAL B;  2KSD A;  3QNE A;  4JYA O;  1AI7 A;  1N8R W;  1JA8 A;  3JAL A;  5LMN B;  4JI7 O;  5A2Q N;  5E1A C;  3UT5 A;  4JI6 B;  3K03 A;  1YDX A;  1JMK C;  1TUE B;  2CE4 A;  2E5L O;  3FB7 C;  1DGS A;  2YIB D;  3CB2 A;  3TGU H;  1XI1 A;  4HNA A;  1WN7 A;  4K8Z A;  4FZ0 A;  2WLJ A;  2RJZ A;  5IT9 N;  3GB7 C;  4NYK A;  3QF7 A;  2ZNI A;  3SYO A;  3K0G A;  4GX5 A;  1KP3 A;  1MG1 A;  3H1J H;  3RYH B;  3L71 H;  1MZE A;  2QWP B;  4TV8 B;  4RAI A;  4GKJ B;  1IBK O;  2VQE O;  1ZSP A;  2XTA A;  3W7S A;  1IBM B;  1OCC C;  2P4V A;  3RYH A;  2GV9 A;  3OTO B;  2CTW A;  1XHX A;  4TV8 A;  4P2Z A;  1BL8 A;  1I94 O;  3HPL C;  4FJC C;  1UPG A;  3OM3 B;  1PNK A;  1AI6 A;  4O4I B;  4JI0 O;  4LF9 B;  1M90 W;  4J80 A;  1M57 B;  3K9S A;  2ADQ B;  4O4I A;  5BXZ A;  1P7G A;  1I94 B;  4TOI A;  2YC0 A;  3K5O A;  5BY1 A;  1YHQ V;  1TVK B;  2F43 G;  2QDO A;  5DED A;  4X64 B;  1GN6 A;  2VWK A;  1G8M A;  3APO A;  4G2K A;  3MD0 A;  2QWQ B;  3BRC A;  1TVK A;  5L3F A;  2FL4 A;  3SYP A;  1CXZ B;  2P90 A;  3E8B A;  4DUZ O;  1R1B A;  3B2E E;  5EBW C;  2QGN A;  2IW5 A;  2N74 A;  1GM7 A;  3SJA C;  2IJI A;  3TXS A;  2VQF O;  1Q43 A;  2EZO A;  4JI4 O;  1I5Y A;  5FLX N;  1NI8 A;  2DWD C;  1OHH G;  4HYO A;  5H5N A;  4UCT A;  1M1K W;  1NVP B;  2W0F C;  2YI8 A;  1Z5W A;  4JTC B;  5KLV H;  1Y67 A;  4DV2 O;  1VQL V;  4JAA A;  3ICX A;  3BCC H;  5B5E Z;  3H01 A;  2DW4 A;  3HR0 A;  2KB1 A;  1YCI A;  3FB5 C;  5CA1 B;  5CA0 B;  3BPZ A;  2JJ1 G;  3ZRX A;  2AHY A;  1B06 A;  2MW2 B;  4CC6 A;  2BE3 A;  1K5S A;  5CA1 A;  5CA0 A;  5IY5 C;  2DJV A;  1EN6 A;  1BT8 A;  1JFF B;  3N2G B;  3M7M X;  4B3T O;  1XOU A;  5JJE B;  3SPH A;  1PV0 A;  3G6E V;  1HNW B;  3K59 A;  1JFF A;  2XAF A;  3UQ8 A;  1N36 B;  3N2G A;  1QBZ A;  3EHB B;  1AR4 A;  3AK3 A;  1K9M W;  5B3S C;  1M5I A;  2NNU A;  4LFC O;  1Q86 W;  1SQG A;  1EFR G;  4EB6 B;  4EKW A;  2FKX A;  1WJZ A;  2UU9 B;  4WFB V;  2IM9 A;  1V54 C;  3OUF A;  1N0J A;  2ZE5 A;  2CGO A;  1XNR O;  3CRA A;  4UUJ C;  4EB6 A;  5LYJ B;  4LBE C;  1FXV A;  2XAJ A;  4B08 A;  1RM1 B;  4X89 A;  5ITZ B;  1Q3E A;  3G4S V;  2YS8 A;  3ABU A;  3C90 A;  1XBL A;  5LYJ A;  4GX1 A;  4I55 B;  5E79 Z;  5ITZ A;  4DK1 A;  4JYY A;  2JS3 A;  3VBB A;  3AG2 B;  4JZG A;  4O2A B;  4B3S O;  2B9Z A;  4I9W A;  4I55 A;  4QGP A;  1BE3 H;  5KX5 B;  3J81 N;  2GDS A;  1D5N A;  1GAX A;  4P9O A;  3E86 A;  4O2A A;  1K8A W;  3JAK A;  3LDE A;  4O2B B;  1Q7Y W;  3D8C A;  5KX5 A;  5IYZ B;  2XOK G;  1J5E O;  1F23 A;  2CTR A;  2XAH A;  2CK3 G;  4O2B A;  1O9H A;  1N32 B;  5IYZ A;  4DR4 B;  3M99 B;  4RO2 A;  3BA8 A;  2EIK C;  1NR1 A;  1OCO C;  1URF A;  2Y0P A;  2YDE A;  2ZDI C;  3ZRW B;  4OX9 O;  4R7C A;  3BFR A;  3SPC A;  4H13 B;  3A0H Z;  2NLJ C;  2WLM A;  3G67 A;  5EYP B;  3FB8 C;  3ZRW A;  4JYC A;  5B1A B;  2ZR3 A;  1GN3 A;  4KL1 A;  2GTA A;  1QLE B;  1SER A;  1GO3 F;  5EYP A;  3RVY A;  1QVF U;  1FFX B;  2RMK B;  1R6T A;  2JIZ G;  2QJ1 A;  4WFG A;  4HAM A;  5H9C A;  2BTO A;  1S77 D;  1BMF G;  1FFX A;  4JAS A;  4JI5 B;  3VQX A;  5B1B B;  4X1K B;  1N34 B;  2B1I A;  4UB8 Z;  3ETG A;  4WFF A;  4FLX A;  1R73 A;  1XRE A;  1NVP D;  5EC2 C;  1T5E A;  3RGB A;  5IJ9 B;  1FS0 G;  5BR8 B;  2EIM B;  4UCV A;  1VQO V;  2DYR C;  2F23 A;  5KHJ A;  2QM4 A;  3JSN A;  4X1K A;  4EFB A;  1Q82 W;  4ZI7 B;  4MVU A;  1OCR B;  4NXM B;  1UJW B;  5IJ9 A;  2LO1 A;  4LF8 B;  4LF4 B;  1N0N A;  4ZI7 A;  2YID A;  2ZIN A;  4MS2 A;  1H2G A;  2WAM A;  3L75 H;  4RUE A;  4OXS A;  4QJF B;  3K79 A;  3K08 A;  2XAQ A;  3WU2 Z;  2A3Q A;  3STZ C;  4DK0 A;  1I7F A;  3ZHQ A;  2UUA O;  4B3M B;  2ZE6 A;  2E74 B;  1EN4 A;  2Y0I A;  5KA5 A;  3AK1 A;  4DR7 O;  1PL4 A;  2N04 A;  3ETE A;  1XL6 A;  2LFS A;  1VF5 B;  4CZZ A;  3SYC A;  2P67 A;  1F51 A;  1LR1 A;  4OPH A;  2UXN A;  3ASN C;  3K3W A;  2JVD A;  1KQS U;  3X2Q C;  4H37 A;  3CXH F;  4MW8 A;  3JAT B;  2YI9 A;  3T4D A;  1HNX B;  5IJ0 A;  1R3J C;  3BA9 A;  4GKK O;  3LUT B;  3TXQ A;  1FXH A;  1OCC B;  3OD4 A;  4GUN A;  1PKX A;  2KQX A;  1PL0 A;  1RM1 C;  1X4T A;  3AG4 C;  3UKM A;  2F4V O;  4PA3 A;  3ZMZ A;  4KXR A;  4E4E A;  4RWU A;  2HVK C;  1AP6 A;  2F95 B;  3RBZ A;  5B66 Z;  2UXD O;  5DM6 V;  4BWA A;  1WAZ A;  1EZJ A;  1IBL B;  3CCJ V;  1L0L H;  4IIJ B;  1TA8 A;  2DOS A;  3E8H A;  3SPI A;  2HHH O;  1HR0 O;  1YJN V;  1US6 A;  2HJD A;  1KUQ A;  4WFA V;  5HFL A;  1MOF A;  3ZMU A;  1FD9 A;  4IIJ A;  5L3B A;  3FYE B;  3T1Y B;  1ROP A;  1FXK C;  4O4J B;  4JI3 O;  3ABK C;  1ZX3 A;  4DR1 B;  4IGG A;  5LGN A;  2BCC H;  4I7Z B;  4TWK A;  4O4J A;  4J7Z A;  4YJ2 B;  5KA6 A;  4DV7 B;  1NS1 A;  2EIL C;  3E2E A;  5KUK A;  3A0B Z;  1THZ A;  2YEV B;  1H8H G;  1CPY A;  2CDY A;  4CS2 A;  3I5D A;  3CS5 A;  3IFX A;  4DV6 O;  1S3J A;  4YJ2 A;  5JH7 B;  2IJK A;  3CHX A;  3TET A;  2QEX V;  2YEV A;  5KUM A;  1MSW D;  1NTM H;  4LF6 B;  3CCL V;  5JH7 A;  2WWW A;  1Z2G A;  3ZHU A;  5EBM C;  4UXN A;  1G1X B;  5JJN B;  1GN2 A;  2CTQ A;  3L74 H;  1VQ7 V;  3S3X A;  1MA1 A;  3CP1 A;  1VIB A;  3P3N A;  4HZ3 A;  5IWA O;  5BZB A;  1QVG U;  1J95 A;  2W6I G;  4LFA O;  5IY5 B;  2D3O W;  3HKD B;  3C3T A;  3ZN0 A;  2DYS C;  4J11 A;  1Q5O A;  4RUF A;  4DV3 O;  3RWR D;  2RCV A;  4ABM A;  2FML A;  4K0K O;  4PJ0 Z;  1KMI Z;  1HNZ B;  3HKD A;  4LFA B;  5EZY B;  3E8F A;  2FB5 A;  3M8A A;  3OTF A;  4AQY O;  3DGE A;  4FM0 A;  4MW3 A;  4AIL C;  1PNM A;  5KHH A;  1Q81 W;  3FFQ A;  2R9A A;  5EZY A;  3D36 A;  4K3A A;  3BVO A;  3RYF B;  3BAA A;  1IZ3 A;  4GT1 A;  5KAI Z;  5J2U A;  3WB1 A;  2WLI B;  1AR1 B;  1V54 B;  1B04 A;  4ICG A;  3OEH G;  2OYQ A;  3RYF A;  5LMN O;  1K3E A;  2ZE8 A;  2ZD9 A;  4JI6 O;  4N21 A;  2WLI A;  2V7Q G;  2HG5 C;  3T1C A;  1GMG A;  4MVS A;  3U11 A;  3AK2 A;  2JS5 A;  1VQN V;  3GWK C;  1K4D C;  2V1D A;  3K0D A;  4O4H B;  2Z5U A;  1PP9 H;  2ILM A;  2P22 C;  3CME V;  1S5L Z;  4ZHQ B;  1SRY A;  1ARO P;  3JYC A;  2PI4 A;  4PDM A;  4TSF G;  1JR9 A;  1GTO A;  4O4H A;  1YF2 A;  1NU1 H;  2Z3Y A;  2PYJ A;  4ZHQ A;  4GKJ O;  4FLY A;  4EFE A;  1IBM O;  2K1E A;  3JAM N;  3OTO O;  3SJC C;  4BAY A;  4CS4 A;  4G28 B;  2Q73 A;  3KZI Z;  4TUY B;  1AI5 A;  2EIK B;  4LF9 O;  5EK0 A;  1N33 B;  1OCO B;  2KKW A;  3N27 A;  4JPR A;  3QO5 A;  3STL C;  5F2V O;  4WCE V;  1YEW A;  1GKF A;  1KU9 A;  1P4R A;  1QR8 A;  4DV0 B;  4X64 O;  5GON B;  4NVP A;  2ZDI A;  3WFV A;  2QWN B;  1QCE A;  1S5H C;  1AB3 A;  3HKB B;  3OEE G;  5GON A;  1MSD A;  5GW7 A;  4DXW A;  3OW2 U;  3EVK A;  2QA4 V;  1WPX A;  3HKB A;  2QKC A;  2EIN C;  4JYB A;  2E3C A;  1JQ0 A;  1R6K A;  2L6L A;  2ZXW C;  1H2S B;  4J42 A;  1V55 C;  3D3I A;  2NN4 A;  4DUY B;  1QR9 A;  4LF5 B;  2X0L A;  4I5S A;  1GM9 A;  4I50 B;  2DYR B;  4NKG B;  2IJH A;  2ZKO A;  2DN9 A;  2W6J G;  5CA3 A;  2ZNJ A;  4UV9 A;  4I50 A;  1BHA A;  3N2K B;  2Y48 A;  1XUQ A;  2HLD G;  1GK9 A;  1Y76 B;  4PHZ A;  1NH2 B;  1DTO A;  1BS3 A;  1L8D A;  3CSX A;  4KHP B;  1QHT A;  1VQ9 V;  2Y69 C;  2AW9 A;  1XNQ O;  1UFI A;  3H1I H;  3TCU A;  2RNB A;  3N2K A;  2A06 H;  1Y76 A;  1AJP A;  1O9G A;  4MTG A;  4AI8 A;  4YHH B;  4FMT A;  2W0X A;  3K5M A;  2EJ7 A;  2CH7 B;  1XNQ B;  3Q4H B;  3UM7 A;  4JGS A;  3TJT A;  1G6U A;  3RT3 C;  5DN6 G;  3UO3 A;  3JD3 A;  3OMI B;  1MNG A;  2CH7 A;  1HNW O;  3Q4H A;  2WPD G;  4P30 A;  1RP3 B;  1N36 O;  1SF9 A;  4BIU A;  4FFB B;  1ZWI C;  4H0L B;  3F7V C;  4K8X A;  2UXX A;  4JI2 B;  3ZRV A;  3ZMT A;  3C3S A;  2PY5 A;  3ZHS A;  4FFB A;  2UU9 O;  4CH5 A;  3A8T A;  4LFB B;  3SJB C;  4LH6 A;  1Y74 B;  3ASN B;  4QNH B;  2ITD C;  4LC1 A;  2H8P C;  3X2Q B;  3P32 A;  3CCQ V;  4U3F H;  5J2T B;  1NTK H;  1Y74 A;  2XAS A;  1JCH A;  1B6Q A;  1JJO A;  3ETD A;  5J2T A;  1VQ5 V;  4UFZ A;  3ZED A;  5DEC A;  2F1M A;  1SKV A;  3CPW U;  4KP4 A;  1KKD A;  4KUM A;  2WA4 A;  1F4N A;  2PTM A;  3AG4 B;  1XQ8 A;  3K9A A;  3OMA B;  3HKC B;  2ZIM A;  1DK1 A;  4J10 A;  1SC5 B;  3LNM B;  2Q7G A;  4UCO A;  2DE0 X;  2GHY A;  4QE9 A;  3HKC A;  1I0H A;  3LDC A;  1D5A A;  4JAV A;  1XMQ B;  4RQE A;  3GWO A;  2JEU A;  4NTX A;  4XDK A;  5FNV B;  3UO2 A;  1E79 G;  1AVM A;  1P7B A;  2H94 A;  2DQ3 A;  1WLE A;  2WA3 A;  4JI8 B;  1N32 O;  4DR4 O;  3P3P A;  5FNV A;  1WB7 A;  1FXK B;  1SQB H;  2CTP A;  3ABK B;  3SDL A;  4X65 B;  4TT3 G;  3CCE V;  1FXK A;  4Z1M G;  3SGI A;  3MHS C;  4LH7 A;  2EIL B;  5KHK A;  1NQT A;  4JV5 B;  2Y4U A;  2XND G;  2HFE C;  3L9D A;  3SJQ C;  3OMN B;  2E75 B;  1A32 A;  1AJN A;  4UVA A;  3E89 A;  4X66 B;  5EIB C;  1H2M A;  4WFH A;  3W7T A;  3CCU V;  4FLT A;  4NTY A;  1ZUQ A;  4DV4 B;  4CS3 A;  4XDJ A;  4IHJ B;  4DR3 B;  4NTW A;  1EN5 A;  4YIO A;  4JI5 O;  1VF7 A;  4K35 A;  5LL6 Y;  1XL4 A;  1M56 C;  5LP6 C;  4F6E A;  4BW9 A;  4IHJ A;  3AEI A;  1N34 O;  2X6A A;  5KHG A;  3LSQ A;  3ZMS A;  5BR8 O;  4U3J B;  4P9P A;  3LDD A;  3HB3 B;  4DR5 B;  5H2F Z;  5L3D A;  2DYS B;  4H33 A;  3J80 N;  2GUZ B;  4NXM O;  4LF8 O;  1YI2 V;  4U3J A;  2UXC B;  4LF4 O;  1NH2 D;  1Z5V A;  2AGA A;  1KP2 A;  2BSK B;  1DF4 A;  4O4L B;  2Q5Z A;  3QTC A;  2GUZ A;  4CH3 A;  5LGT A;  2BSK A;  4IT5 A;  4O4L A;  1RFY A;  4PA9 A;  2Q7H A;  3CC7 V;  1BQ0 A;  3CCM V;  1KYO F;  4YY3 B;  1CEZ A;  3A0R A;  4B3M O;  5JCO C;  1YXB A;  4DO2 A;  2AXT Z;  3FB6 C;  1EBO A;  1EM1 A;  4BR6 A; 
#chains in the Genus database with same CATH homology
 1AI6 A;  2JK5 C;  4UXN A;  5EBM C;  4R6Z A;  3ABT A;  1R3K C;  3ML0 A;  3OUS A;  1BHB A;  1VQ7 V;  1M90 W;  2Q68 A;  2QTO A;  1M57 B;  3CP1 A;  4PA7 A;  4HZ3 A;  3PJS K;  4J9Z B;  3BEH A;  4MVM A;  5BZB A;  1ENV A;  1QVG U;  1J95 A;  2W6I G;  3QO8 A;  3SYQ A;  1YHQ V;  2F43 G;  1G8M A;  5IY5 B;  4WF9 V;  2D3O W;  3ZN0 A;  4G2K A;  3NXS A;  2DYS C;  1W0J G;  3MD0 A;  4RUF A;  1VQ4 V;  1LNQ A;  5L3F A;  1S72 V;  2BOB C;  3CCV V;  3SYP A;  4BIZ A;  4F4L A;  2XAG A;  2P90 A;  3E8B A;  1VQK V;  4PDV A;  3E8F A;  5EBW C;  5C93 A;  3AG1 C;  2IW5 A;  1FFT B;  3CC2 V;  3DGE A;  3E35 A;  1JVM A;  1GM7 A;  4MW3 A;  1PNM A;  3B77 A;  1AJQ A;  2EZP A;  2Q69 A;  4R8C A;  2IJI A;  4E2L A;  1YIT V;  3ASO B;  4QPK A;  1Q81 W;  2EZO A;  3D36 A;  1I5Y A;  5L3G A;  3JD2 A;  2DWD C;  3DTU B;  3F7Y C;  4GT1 A;  2X7R B;  1OHH G;  3W7U A;  4HYO A;  4FIP C;  2WLI B;  1M1K W;  1AR1 B;  1V54 B;  1MAB G;  4GCZ A;  3SPJ A;  1NVP B;  2WLH A;  3OEH G;  2W0F C;  4XBF A;  2OTL V;  1K3E A;  2EJR A;  2ZD9 A;  4JTC B;  2IH1 C;  2ATK C;  4N21 A;  2WLI A;  1VQL V;  4QE7 A;  4WFE A;  2V7Q G;  3EFF K;  2HG5 C;  4MVZ A;  3T1C A;  1GMG A;  4MVS A;  2PI5 A;  1VQN V;  2MK3 A;  3H01 A;  2DW4 A;  1GM8 A;  1K4D C;  1K97 A;  2KB1 A;  2V1D A;  3K0D A;  4MT8 A;  1M57 C;  3FB5 C;  3RW0 A;  3ZCC A;  2GSM B;  5H6Q A;  2Z5U A;  1K33 A;  2JJ1 G;  2EIN B;  2OTJ V;  3CME V;  2IJJ A;  5LHG A;  3ZRX A;  1SRY A;  1ARO P;  2AHY A;  5L3E A;  2ZXW B;  3JYC A;  1M9N A;  2PI4 A;  2WLN A;  2OT5 A;  5IYB O;  4PDM A;  1K5S A;  4TSF G;  1GTO A;  5IY5 C;  2IH3 C;  5LBQ A;  2Z3Y A;  1HWY A;  4UVB A;  2A0L A;  5B1O A;  1V55 B;  4JAU A;  2ZR2 A;  2QM8 A;  2HR3 A;  1NJI W;  3MHH C;  2K1E A;  3R65 A;  3SPH A;  3G6E V;  1KD1 W;  4BAY A;  3CCS V;  1JX9 A;  2XAF A;  5CMU A;  1YJW V;  5H6R A;  1S76 D;  1QBZ A;  4G28 B;  3EHB B;  1K9M W;  3ASO C;  5B3S C;  3P30 A;  1AI5 A;  2EIK B;  2NNU A;  1JPX A;  5EK0 A;  1OCO B;  1Q86 W;  3OAA G;  4MVO A;  3ABL B;  3TK1 A;  2Y69 B;  1EFR G;  4ASU G;  4EKW A;  4JPR A;  3QO5 A;  3STL C;  3VOU A;  4WFB V;  3JCZ A;  1KC8 W;  1V54 C;  3OUF A;  4WCE V;  1GKF A;  2Q6A A;  1KEC A;  2WLK A;  1P4R A;  1YTF B;  1QR8 A;  4UUJ C;  3K04 A;  4ZBM A;  2QM7 A;  2ZDI A;  4LBE C;  1FXV A;  2XAJ A;  4MSW C;  3WFV A;  4X89 A;  3G4S V;  1RM1 B;  4MVR A;  2ITC C;  3ABU A;  1QCE A;  1S5H C;  4JTA B;  3OEE G;  4GX1 A;  5GW7 A;  2AHZ A;  4QIW F;  1ORQ C;  3I56 V;  4DXW A;  5CN0 A;  3W7X A;  3OW2 U;  2R9R B;  3OGC C;  2QA4 V;  3VBB A;  3AG2 B;  3JD1 A;  1DF5 A;  4PEL A;  1WPX A;  2LFR A;  2EIN C;  4I9W A;  1W2B U;  1IXM A;  1R3I C;  2EIJ B;  5B1N A;  4JYB A;  4X88 A;  1JQ0 A;  1R6K A;  2ZXW C;  4GX0 A;  1W0K G;  3B8N A;  5CBG A;  1K4C C;  4P9O A;  1COW G;  3E86 A;  3F5W C;  1PNL A;  1K8A W;  5IYD O;  3WG7 B;  3LDE A;  1Q7Y W;  3ZIA G;  1V55 C;  1F4M A;  3D3I A;  4QPJ A;  4JF3 A;  2XOK G;  1QR9 A;  3E8G A;  2X0L A;  4I5S A;  1GM9 A;  1F23 A;  2DYR B;  1SES A;  2XAH A;  1K73 W;  1K34 A;  2CK3 G;  4X8A A;  3T4Z A;  2JDI G;  3SYA A;  3CMA V;  2YSU B;  5LHH A;  2IJH A;  2ZQM A;  2JJ2 G;  2W6J G;  5CA3 A;  3M99 B;  3E83 A;  3JD0 A;  4RO2 A;  4UV9 A;  1BHA A;  2Y48 A;  2P7T C;  2HLD G;  1PD3 A;  1GK9 A;  2EIK C;  4LCU C;  1NH2 B;  1NR1 A;  4N23 A;  1OCO C;  1DTO A;  1K5Q A;  1YJ9 V;  5HFM A;  3ABL C;  1VQ9 V;  2Y69 C;  2ZDI C;  3ZRW B;  3TCU A;  1SZT A;  4R7C A;  2C2A A;  4MVQ A;  3SPC A;  1AJP A;  5CBF A;  2HKO A;  2NLJ C;  4MTG A;  4PA4 A;  2WLM A;  1H38 A;  1JOY A;  5FL7 G;  3FB8 C;  4FMT A;  3ZRW A;  4JYC A;  2EBO A;  5B1A B;  2ZR3 A;  4L87 A;  2OCC B;  3K06 A;  3UM7 A;  1AI4 A;  4JGS A;  1QLE B;  1L1F A;  1GO3 F;  1SER A;  5DN6 G;  4UV8 A;  1E1Q G;  3JD3 A;  3RVY A;  5J9P C;  1QVF U;  5EC1 C;  3OMI B;  3AG2 C;  2JIZ G;  2WPD G;  4P30 A;  3LSS A;  4UVC A;  4WFG A;  4HAM A;  4BIU A;  1ZWI C;  5H9C A;  2EIJ C;  1S77 D;  1BMF G;  3F7V C;  3CD6 V;  2UXX A;  4JAS A;  3ZRV A;  3ZMT A;  5B1B B;  1Y4M A;  4G27 B;  1OCZ B;  2WLL B;  3WG7 C;  3SPG A;  2B1I A;  3ETG A;  4WFF A;  1NVP D;  1R73 A;  3ASN B;  5EC2 C;  4QNH B;  1Y66 A;  3OFN G;  2ITD C;  4LC1 A;  2H8P C;  3X2Q B;  1FS0 G;  2EIM B;  1VQP V;  2A9H A;  3P32 A;  1VQO V;  2DYR C;  3CCQ V;  2WLL A;  3CYO A;  2QKS A;  1VQ8 V;  1Q82 W;  4MVU A;  2XAS A;  1OCR B;  1UJW B;  1NKD A;  2JEX A;  3CCR V;  1JCH A;  1B6Q A;  1RPO A;  3ETD A;  1RPR A;  3OR6 C;  1VQ5 V;  2HVJ C;  1G4Y B;  1E1R G;  3B8M A;  1NR7 A;  3CPW U;  1R6N A;  4JTD B;  4KP4 A;  1KKD A;  4KUM A;  1F4N A;  3AG4 B;  3K9A A;  2DWE C;  3ZN1 A;  3OMA B;  1DLB A;  2R9I A;  4MS2 A;  4MTF A;  3ZMV A;  1H2G A;  2HJF C;  2Q67 A;  2WAM A;  3LNM B;  2B5U A;  2X6C A;  3ZRS A;  4ZKI A;  2WSS G;  4RUE A;  4PA6 A;  4OXS A;  4QJF B;  2GHY A;  3K79 A;  4R50 A;  3K08 A;  4MTO A;  4RQF A;  2XAQ A;  4CBC A;  4QE9 A;  5B1A C;  1M56 B;  3LDC A;  2OCC C;  3STZ C;  2P6J A;  2QE7 G;  4JAV A;  1QLE C;  4RQE A;  5EBL C;  3GWO A;  2IU0 A;  1YIJ V;  2JEU A;  4U7O A;  4XDK A;  5L3C A;  2BOC C;  1E79 G;  1P7B A;  1I5X A;  2H94 A;  3IGA C;  5KA5 A;  2DQ3 A;  1WLE A;  1K7D A;  3ETE A;  1XL6 A;  2M7W A;  3ABM B;  2A79 B;  3W7W A;  3BY6 A;  2LFS A;  4Q20 A;  3FYI B;  4CZZ A;  1FXK B;  1QLN A;  3SYC A;  3ABK B;  3G71 V;  2P67 A;  1F51 A;  2IU3 A;  4TT3 G;  5B1B C;  1S0V A;  2DQ0 A;  1OCZ C;  3AG3 B;  1SET A;  4GX2 A;  5LHI A;  3CCE V;  1FXK A;  4Z1M G;  2UXN A;  3ASN C;  3K3W A;  1KQS U;  3QO7 A;  4BW5 A;  3MHS C;  1YTF D;  3X2Q C;  4H37 A;  4MW8 A;  2EIM C;  2EIL B;  1VQ6 V;  2X6B A;  1NQT A;  5CBH A;  3T4D A;  2FTK A;  1K92 A;  1R3J C;  2XND G;  1JJ2 U;  2HFE C;  1OCR C;  4YXW G;  3SJQ C;  3LUT B;  3OMN B;  3T2M A;  1AJN A;  5B3S B;  2LP7 A;  1H8E G;  4UVA A;  3E89 A;  3OE7 G;  5IDJ A;  5LGU A;  1FXH A;  4WFH A;  3CCU V;  3W7T A;  1OCC B;  4KFM A;  1PKX A;  3IC7 A;  4U7N A;  1PL0 A;  1R3L C;  3JD4 A;  1RM1 C;  3AG4 C;  3UKM A;  3FKS G;  1CP9 A;  4PA3 A;  3ZMZ A;  4PDL A;  4XDJ A;  1VQM V;  1YSC A;  2B1G A;  2HVK C;  3RBZ A;  5DM6 V;  3QNE A;  1XL4 A;  1M56 C;  1AI7 A;  4PDR A;  1EZJ A;  3AEI A;  3CCJ V;  2X6A A;  3LSQ A;  3ZMS A;  3E8H A;  3SPI A;  1N8R W;  1YJN V;  3KG2 A;  5E1A C;  4P9P A;  4WFA V;  5HFL A;  5IYC O;  3K03 A;  4LP8 A;  3LDD A;  1MOF A;  3HB3 B;  3ZMU A;  3ABM C;  1TUE B;  3ZJZ A;  5L3D A;  2DYS B;  4H33 A;  5L3B A;  3CXC U;  3RVZ A;  3FYE B;  1YI2 V;  3FB7 C;  4J9Y B;  1ROP A;  1FXK C;  3ABK C;  1NH2 D;  5LGN A;  1KP2 A;  1DF4 A;  4TWK A;  3AG3 C;  3AG1 B;  4FK5 C;  4XDL A;  2WLJ A;  5KA6 A;  5LGT A;  3E2E A;  2EIL C;  3GB7 C;  5KUK A;  1THZ A;  2YEV B;  4PA9 A;  3SYO A;  3CC7 V;  1H8H G;  1CPY A;  3K0G A;  1KP3 A;  4GX5 A;  3CCM V;  1MG1 A;  3IFX A;  3OR7 C;  1CEZ A;  1S3J A;  3A0R A;  4RAI A;  4MTX A;  4FPP A;  2IJK A;  3W7S A;  3TET A;  1OCC C;  2YEV A;  5KUM A;  4DO2 A;  2QEX V;  1MSW D;  3CCL V;  3I55 V;  3CC4 V;  3FB6 C;  1EBO A;  1NBM G;  1OZ0 A;  4P2Z A;  1BL8 A;  3HPL C;  2WWW A;  4FJC C;  3OM3 B;  1PNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...