3LDHA

A comparison of the structures of apo dogfish m4 lactate dehydrogenase and its ternary complexes
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
329
structure length
329
Chain Sequence
TALKDKLIGHLATSQEPRSYNKITVVGCDAVGMADAISVLMKDLADEVALVDVMEDKLKGEMMDLEHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCLKELHPELGTDKNKQDWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCLVIGWVIGQHGDSVPSVWSGMWDAKLHKDVVDSAYEVIKLKGYTSWAIGLVVSNPVDVLTYVAWKGCSVADLAQTIMKDLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNNGISHCNIVKMKLKPDEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the structures of apo dogfish M4 lactate dehydrogenase and its ternary complexes.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase
molecule keywords LACTATE DEHYDROGENASE
total genus 71
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1974-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3ldhA02
4BKRA 1NX6A 3RC1A 1MG5A 5ER6A 1GFSA 3KZVA 2Y05A 3PFFA 4PCVA 3RUFA 3DAGA 2DBVO 3V1UA 3JYQA 1C0LA 3QLJA 4XJTA 4D0RA 1PGJA 1TXGA 1W73A 3FNFA 3HADA 4FGWA 5G0WA 3OJFA 3NDRA 2DTXA 3HN7A 1H6DA 4MKZA 3X2EA 5HS6A 1QXSA 1X13A 4FPXA 1VE9A 2DAPA 3NJ8A 4ZQGA 1IOLA 4D43A 2QRLA 4OQYA 2F00A 3WMXA 2VQ3A 2B4TO 4I9HA 1EK5A 4YQZA 1KERA 3F6YA 1B26A 2Q1SA 1ZUD1 2W98A 2ZQZA 2EGHA 4FQ8A 5L7TA 3AK4A 4DQUA 2QRKA 3KYDB 4PLYA 3AY3A 4XX0A 3RCBA 3VAZA 4JBIA 2AEMA 4YAKA 4CLHA 2O3RA 3PVZA 3RUCA 2NVUA 3U0BA 5G2OA 4BQPA 2X5OA 3HWRA 3TRIA 4LVCA 2Y0DA 1ADFA 3UW3A 3Q11A 2WEKA 1SNYA 5EJ2A 3V8BA 1OC4A 4ZGWA 4DC0A 1F14A 1GCUA 4ZD6A 2X0IA 2D0IA 4NIMA 1OBFO 4CMIB 3P19A 2H5LA 4CQLB 4ESOA 4CQMA 3EMKA 3K6JA 2HDHA 1X0XA 3PHLA 5IN4A 4NFSA 2Y93A 4J1SA 4BMVA 4DXHA 5DOZA 2GYYA 1P1KA 1M75A 3PDUA 1QLJA 5B12A 4CM9A 1EZ4A 2Y66A 4OHUA 4CM9D 5I7EA 3LQFA 3MCVA 4BO6A 4D3DA 1HT0A 1Y5RA 1HDXA 1Z74A 4Q3BA 2PWZA 3IJPA 2YV3A 3HN2A 3NRCA 4YT4A 3EY4A 2ZYDA 5A02A 3QV1A 4E5KA 2OOSA 3ZHBA 4CUZA 1E7RA 1UH5A 2EKLA 2WD7A 3T4EA 3U9LA 4ID9A 4A2CA 2BELA 3VOSA 3U09A 3LT2A 3GDFA 3JYLA 2Y1DA 2G82A 2FZWA 1EVJA 4FDAA 4C4OA 4OSOA 3DWFA 1XU9A 1ZJYA 3MWEB 4L74A 2BI8A 2J3KA 3Q0EA 4DA9A 4J0EA 3L9WA 5JPIA 1NNUA 3RASA 2B69A 3JQ9A 4KP7A 3F4BA 3P5SA 4CLDA 5JCXA 1YOVB 2A92A 2PH3A 4DPLA 1PQWA 5U9CA 3E9MA 2H63A 3WTBA 3IC5A 4CV1A 1FXSA 1LRJA 1T4BA 1E7QA 4ZQEA 2I99A 2JFFA 2DLDA 4S1VA 4CJXA 5IDWA 4WLFA 6LDHA 1QV7A 4BO2A 5CPFA 2GLXA 3QWIA 4GH5A 4IY1A 4C7JA 3SLGA 3PIDA 1V0JA 3PQFA 3I9MA 5GZ1A 4TVBA 3U4DA 1DC4A 4PZDA 4QTZA 3UN1A 1B15A 2RAFA 4WKGA 1ZMTA 4Y8VA 3KUXA 1VJ0A 4L73A 4XYLA 1TI7A 3EVTA 5F1KA 4B3IA 4YJHB 1I36A 3JTMA 2RIRA 4NBVA 1DIRA 1DRUA 4YAGA 1H2BA 2Y1GA 3FHLA 4WLOA 2EHDA 3ANLA 1V6AA 4H16A 1YONA 3KOUA 4E32A 4E5MA 3C1AA 3TNLA 3QY9A 3LC2O 3BAZA 3EYWA 3JD4A 3HHPA 3W4JA 1SO8A 3TQHA 1BSVA 1PS8A 5THKA 2XAAA 1DB3A 1YB5A 4D79A 1GZ3A 2WE7A 3NTOA 1MFPA 3GC6A 2BGMA 4E2WA 4YYZA 3BXXA 1PL6A 2O3SA 3VZQA 4KQXA 1WW8A 4ALMA 3F4LA 1PJBA 3ZWMA 5BSFA 2Q99A 1PJTA 3OSUA 4CM5A 3OJLA 3MWDB 3D4PA 2SCUA 1P74A 3EZLA 3K9QO 1O89A 3MJCA 2IXBA 4RPKA 3WG9A 3KV3O 1XR3A 1XWFA 3LU1A 1ONNA 3SVTA 4Z0HO 2OBYA 3H9QA 3HE3A 1WZIA 2CD9A 3UXYA 3PFWO 5IDQA 3B70A 2ZQYA 2RH8A 2A4KA 3DAPA 3JQAA 4AJNA 2JD0A 3NTRA 3CPSA 1Q7GA 1E3EA 3DMTC 2PKQP 2VT3A 5JS6A 1DSSG 2WMDA 3L6OO 8LDHA 3ZV3A 4EDFA 4PRLA 2Y0EA 1ZK4A 4DBZA 4BGUA 4GKBA 4EEZA 3WYEA 4O63O 5CAEA 8ADHA 2NACA 3NUGA 2JCXA 1U4SA 1G0OA 1DIAA 4CM8A 3HJAA 1GDHA 1GPJA 1HXHA 1VRWA 2FPGA 3I52A 3GVPA 2X1HA 1YBMA 4R16A 1Z73A 3CZMA 5H81A 1WVGA 2EP7A 5DBFA 5JLAA 4BNKA 1LSUA 1E7SA 4W82A 1T24A 1K2WA 1PL8A 5AXBA 2DFDA 1H5QA 2ZYAA 5DCUA 4CMBA 1BMDA 4DC1A 4YCAA 4YDRA 1D3AA 2YUTA 1F0YA 4Q3NA 3A28A 3F47A 1HDZA 3HB4X 3IS3A 3ONFA 2RBEA 3MTGA 1JKJA 3HZZA 4RDHA 3HB5X 5LC1A 2AQ8A 1J49A 2AG5A 4FFOA 1TLTA 4RF3A 1ZXBA 2JD2A 2UYYA 2B35A 5HA5A 4E4YA 4ZJUA 3AU9A 4XYMA 3D5QA 3V2GA 1PR9A 1QMGA 4FN4A 5LDGA 3WYCA 1GUZA 4L4SA 3LT0A 3V5NA 1HDOA 3WNVA 1K89A 5MDHA 1UP7A 4PLZA 5EQFA 4RZIA 1JAYA 3ZWAA 1GEEA 3P2YA 4JGBA 3FNHA 5K0ZA 5KVCA 2HMVA 2FZEA 2HJSA 3ENNA 3GRPA 4OJNA 1MXFA 3GF4A 2C82A 5L4NA 3L4BA 1NHGA 4NK5A 3ETDA 3IUSA 4J90A 4B8WA 4FIZA 3F9IA 1Y8RA 3C8MA 1PQPA 3KM0A 4ND5A 4DUPA 4AJLA 1R4NA 1E7YA 1RM4A 3DQPA 3GGPA 1EK6A 4WJZA 1T25A 3JQDA 2O7SA 1NWHA 5KJEA 3W8FA 4HUJA 3RQSA 4XRGA 1XIVA 2BFAA 4I08A 2O4CA 1U8XX 1M6WA 4EI2A 1P77A 3GPDG 4ROSA 1Q7BA 3ZGYA 2WTBA 3LK7A 5F1PA 2DC1A 4U6SA 4AJKA 4BNZA 1LRKA 2FRDA 3FTPA 3O38A 3C7CB 1IPFA 2B5VA 1C1DA 3GZNB 3DB2A 1NQOA 3DDNA 3GMSA 3BMOB 4TQGA 5JCJA 2C2YA 3C85A 4CLOA 3ZWWA 1PL7A 4CM3A 3TF5A 1KEVA 4FJ0A 4ALIA 4K1LA 2VHYA 4GBJA 5A5FA 3ZWYA 5G4KB 2ZTMA 3QQPA 4ALLA 5IJZA 1V35A 3NV9A 2VOJA 1YGYA 4XA8A 5I7SA 3M2TA 1YB4A 1RM5A 3ETEA 4DGSA 2GN6A 1LRLA 1H6AA 1BDBA 1NQ5A 5CFZA 2BFOA 3TJRA 1UP6A 1ZZEA 1I3NA 1PGQA 3WGHA 2DQ4A 4B4VA 1B3RA 5A9TA 4W7HA 3AI2A 1Y1PA 4M89A 2AQKA 4PFJA 3ZDFA 1QSGA 3VC7A 1ISIA 5L9AA 2I3GA 4HNHA 4PLCA 3I5MA 4JJFA 1ZMOA 5TJHA 1Y8RB 3IUPA 4TRMA 3WGZA 3TFOA 2VWQA 1GY8A 3WGQA 1FMCA 3C1TA 1GCOA 3H3FA 4UUNA 3RUDA 1EUDA 1EQUA 3UCXA 4IXTA 2X9NA 4JCOA 4ND3A 3LDHA 2NWQA 3HDHA 4MIEA 2ZIZA 4FFMA 2P4QA 4P8RA 1Z7BA 3PWZA 1ZH8A 4D41A 3V2HA 1E7WA 4UVDA 5FF9A 3VVCA 5IG2A 1ZJZA 1NHWA 2VZ8A 1YOVA 3VH2A 1T26A 2E4AA 1TA4A 2Q49A 3LZ6A 1UZLA 3K92A 4WK6A 2VYND 3RVDA 3S2GA 3ULKA 3I3OA 5G0VA 1BXZA 2NU7A 2NU6A 2GGSA 3CE6A 4U8GA 4DL9A 3KYCB 4JNKA 4MVJD 2X0NA 1E1MA 1DOHA 3B20A 3FF4A 2J3IA 1BTOA 4UUMA 4WLNA 1B8PA 1UDBA 4J1QA 4DWVA 5CDTA 4RVFA 4ZVVA 1YQXA 1ZK0A 5DP1A 3RWBA 2AE2A 3L4SO 3BMNA 4KUHA 1ADCA 5A9RA 5I9LA 4BQRA 1MX3A 1V9LA 3ZN2A 4YRDA 2YFHA 3U4HA 4RVUA 3VPXA 1XGKA 1C1DB 1JAXA 5A4DA 4A03A 4L4RA 4CMEA 3ONDA 3TFQA 1H0KA 1LJ8A 4GAEA 4TKMA 4BGIA 1GQYA 3PTZA 5FI5A 3M1LA 3QHAA 4R4JA 5ES3A 5JXWA 5TS3A 4NFYA 4NHEA 1UR5A 4OSPA 3ZWOA 4IDDA 5C5IA 5JMWA 5COBA 4E5PA 1I30A 3RC9A 4EGFA 3PRJA 4YA6A 2E6UX 3LC1O 1PEDA 1LNQA 3U62A 3WYBA 2DPGA 3UHAA 2UV8A 4MVJE 3QVOA 1R0SA 3WICA 5T64A 3DZHA 2J8ZA 3KHUA 4BVAA 3VKUA 1I01A 1MC4A 1JW9B 5CHEA 2OMEA 5L51A 3UICA 3WIEA 3HQ4O 3BTVA 1QG6A 3I4FA 4AJ4A 4J4TA 5IXYA 4J0FA 2VRCA 4CMCA 5HBRA 1MA0A 4GLOA 2O4UX 3K73O 4P4LA 1LDYA 2HK9A 2X58A 5A06A 2IE0A 4TMFA 2NQTA 3H3JA 4OGWA 3PLRA 5HM8A 3V1TC 4LW8A 1ENZA 1SOVA 4EITA 4BO1A 1JDJA 1UZMA 2HCTA 3AOEC 3L6DA 2C54A 2X0JA 4P4GA 2IZZA 1CF2O 2GO1A 3QIVA 2YQ4A 2V65A 3OH8A 4YRAA 3W8DA 5A3JA 5HWSA 3H8VA 5IZCC 2VWGA 4YB8A 2ZKLA 4J4HA 4ALKA 1XDWA 3DOJA 2DBRA 1CIVA 2PZMA 4F46A 2Y99A 3FBGA 1MG0A 4BNIA 1JLLA 5TJ9A 5BSHA 4BKPA 1V3VA 1UXJA 2EEZA 3ASVA 3QVTA 3VZPA 1LDNA 3PGXA 5JO0A 1SB8A 1A5ZA 1WXDA 5DBIA 3FWNA 4CM1A 5CEEA 3R0IA 1C3VA 4R3WA 1IL0A 2QX7A 3ST7A 2DBQA 5JYDA 1KBZA 1EE9A 3GUYA 2ZTVA 4J16A 9LDBA 2BMAA 1XELA 2IRWA 3ZWPA 4RPJA 1JQBA 2BLLA 4I8XA 1R0KA 4E5YA 3ROKA 3Q9NA 4IQ8A 1PX0A 3GRKA 4GVLA 1PS9A 4EEXA 2ZATA 4P38A 1P33A 5FWNA 2WWRA 1Q1NA 3JQAB 3JD0A 3K30A 3QA9A 1A9YA 1NPTO 2VYNA 1NFRA 4TZKA 2Z5LA 4JP2A 1HE3A 2Y1OA 1UAYA 4XDYA 3VH3A 1ZNQO 1P1FA 3D3WA 4N7RA 4CMKA 2YJZA 3HG7A 3IOYA 3OA2A 4J9VA 4WUVA 2P9GA 1KY5A 1PQUA 1O9BA 1WDMA 1O0SA 2XF8A 3ZWNA 1R0LA 5DNAA 4LSWA 5DZSA 4U6QA 1SZJG 2H9IA 2VUTA 3W4IA 4B3HA 1YQDA 2NV6A 4D3SA 4JBGA 5BSGA 2WE8A 1NQAO 2AQHA 4XB1A 1ENOA 2J3HA 1KVTA 1IPEA 3AI1A 1CEQA 4OOFA 3INTA 1HDRA 3TWOA 2VTDA 1SBYA 3QWAA 4KQWA 4DTIA 4D3FA 1LSOA 3ZHZA 4NBUA 2Y0CA 3IAHA 3WBFA 1PSDA 1OAAA 4JX8A 4NJMB 5KJCA 3QRWA 4HXYA 1YO6A 1BXKA 3OIDA 3AM5A 5AXCA 1R4NB 4ND4A 2C59A 2VUUA 5J23A 1ZEJA 4Y6PA 4MJLA 4MP3A 5KVQA 5ER9A 4R3NA 1PWZA 4W9NA 1ZW1A 4E31A 4CV0A 2DBZA 4N5NA 1Q0LA 1DJQA 1YJ8A 3BTUA 5AQ1A 4ZN6A 4GX0A 1N5DA 3S1LA 4CL8A 1L1FA 3M2PA 1CQIA 1PJ4A 4KUGA 1F06A 4XRRA 3VKVA 3TL2A 5B4UA 5U4QA 4HNGA 3LT1A 1C0KA 5G0SA 3EHEA 1N1EA 1K5HA 1E6UA 1DFGA 1HDGO 3DFUA 1P0FA 1UDCA 4G2NA 4ND2A 1AGNA 1U3TA 1E92A 1LUAA 2YDYA 3S2IA 1C1XB 1DEHA 3GFGA 4WASA 4EJ6A 2X22A 4D44A 3CIFA 5HS4A 3CKYA 1RYEA 3JQFA 5IDXA 3CMCO 1FDWA 1EE2A 3IL2A 1I24A 3H5NA 4OOEA 3TOZA 2D1YA 4CLEA 1NQTA 2GDZA 4GSLA 1E3SA 3M1AA 4CQMD 3WWZA 4I5FA 3TZHA 3N58A 3ICPA 2OORA 5GZ6A 4BO3A 1DBVO 4RVDA 1XQ6A 2QYTA 4L8VA 1IHYA 3BTSA 5IF3A 4YWJA 2OUIA 4ZQBA 3WXBA 3WJ7A 4JN6B 3EW7A 1B7GO 7ADHA 2J5KA 1A72A 3SLKA 1E3IA 4BNVA 1M66A 3OMLA 5EIOA 3I9JA 4IDBA 1A9ZA 5ILOA 3NT5A 2VZ9A 3QVSA 3V2UA 5JW6A 1U3UA 2Q2VA 4CUKA 5KJFA 2O2SA 3ZNQA 3DZBA 3SBOA 3ZWCA 1JWAB 3GNQA 4D7AA 1TB4A 1YJQA 3G49A 1LC3A 4LCEA 1HWYA 3WX0A 1U3VA 1W8DA 3FI9A 5CEJA 3ZWVA 1NYTA 1H6BA 3CXRA 4GX1A 1N1GA 4HV4A 3GNTA 4B4WA 2HMTA 1B3BA 4BO7A 5AVOA 2Q3EA 4CMIA 1KY4A 3JQ6A 1Y7TA 3GNSA 1LLQA 3PZRA 2C2XA 5KVVA 1HL3A 5ITVA 4CLRA 3L6EA 3JSAA 2AEFA 3S2EA 3GA0A 3MJTA 4CR8A 2ZB3A 3E8XA 3DHYA 1OZAA 5TT0A 1B8UA 1PJQA 1IE3A 4NBRA 3K8ZA 4J91A 4NR0A 2GRAA 2C07A 2A9FA 5L53A 2YV2A 4XIYA 1QV6A 3W4KA 5H82A 2BKAA 1GQQA 1IZ0A 5IXSA 3IJRA 1EQ2A 1T1RA 4E12A 4J7UA 2JAPA 4OL9A 4R9RA 1O95A 2CF5A 4MVJG 5EN4A 5LCXA 4I9UA 5CEFA 5T5QA 1XG5A 4FFRA 1HYGA 4YPOA 4R1NA 4B7CA 2AE1A 2VN8A 3PGJA 1DIHA 1X14A 4GWKA 4JROA 4M49A 4XR9A 1BXGB 1IY8A 4YT8A 2GZ3A 1ADBA 4A27A 1NVGA 3BMQA 5TX7A 4BNGA 1NPYA 2EJWA 1ULSA 3W8EA 3MJEA 4DYDA 3NTQA 1K0UA 4WOJA 2BGKA 4F45A 4O1MA 5T8KC 4DMLA 1ARZA 3DBLA 1KC1A 3OIGA 4WECA 3RUEA 4BNMA 1H93A 1LTHR 4RORA 1DPGA 4PZCA 1XQ1A 5T6BA 4AJPA 1PS0A 1ZSVA 2JHFA 1U3WA 2HRZA 4IJWA 3T7EA 4CV2A 2H1SA 4RDIA 2GR9A 1PGPA 4FR5A 2NTJA 3JV7A 2Y68A 1F12A 1LLUA 3HDYA 3NT2A 3Q3CA 3Q2KA 2VRCD 2G76A 3AUAA 5C7IO 2ET6A 3E5MA 4PVDA 1BGVA 1I2CA 4MPDA 4DVJA 3TZKA 2QG4A 3KB6A 1V3UA 2R6JA 2VYVD 4PLWA 4PVCA 3TZQA 3UAGA 4B3JA 1BRMA 3U5TA 1D8AA 2GN9A 3JCZA 4L4XA 1HLDA 5JDCC 3UF0A 1JKFA 4HP8A 4PG4A 4AL4A 1IB6A 1SC6A 3Q1LA 4WCFA 2J6IA 3JQ8A 4E6PA 1Y9AA 1E77A 2R00C 3DMTA 1ISMA 3C7AA 3RBVA 3TN7A 1DAPA 4F3YA 3H9EO 4RPGA 1J4AA 1Z6ZA 1PJ2A 3A9WA 3JYOA 3X2FA 2FMUA 1LX6A 3RFXA 1O8CA 3PJGA 2O50A 3IMFA 2TMDA 4FJ1A 3FNEA 2ZB4A 4X54A 1RM0A 1H9BA 1AUPA 3ITKA 3F1LA 1NM5A 1DDOA 4LSMA 2OO5A 1UZNA 5CDSA 2D3TA 2LDBA 2WDZA 4J1NA 3WQQA 3H7AA 5JNLA 4DIOA 4LISA 2NTNA 4RPLA 3DR3A 3TZCA 4BNUA 4IMPA 1I2BA 4NBTA 1QYWA 1L7EA 4YRBA 1E7MA 3RUIA 3HFGA 1VJTA 3M6IA 1M6HA 4RVSA 1JA9A 4Q3CA 2FHSA 5I9NA 1OFGA 1FDTA 3BTOA 4HFJA 4OH1A 2V6FA 1PGOA 4YTEA 4PLTA 5EINA 2V6BA 1OI7A 1GR0A 3KYDA 3N7UA 3DFZA 4K28A 4IGEA 4ZA2A 3VPHA 2I9PA 4R68A 3CMMA 2G0TA 3E9QA 1K6XA 3I9KA 4QO8A 2X5KO 4FB5A 2Q4BA 3JD3A 3ZCXA 1C0IA 3AU8A 3Q2IA 2NU8A 3VZSA 2X5JO 4CM4B 3DO5A 7MDHA 2JAHA 3GG9A 5BNFA 1QKIA 3ABIA 1DXYA 3HSKA 3QVXA 1P1IA 4DYVA 2QZ9A 3B1KA 3NKLA 4IDAA 4JP3A 4DPMA 2QZZA 3ITDA 3IDSA 4NK4A 1UP4A 3OICA 4WLEA 2O7QA 1U7TA 4KMSA 5DF1A 4A7PA 4MOWA 4TRRA 2JKVA 3ROPA 1MGOA 4U7WA 4E5NA 3PXXA 3L9XA 3DBLB 3ZU5A 1WWKA 1VL6A 2I3AA 4TSKA 3F3SA 1QP8A 3GH3A 3AM3A 5TC4A 2UUOA 1EDOA 1PGNA 1BVUA 3MJ4A 5DT9A 3BMCB 3H9UA 1NAHA 5KCZA 4IUYA 1Y8QB 1NP3A 1I3MA 3EK2A 4J2HA 1RJWA 1VI2A 2NTVA 2Q46A 5KJ6A 5COAA 1HSOA 3BA1A 2CVQA 3H6KA 3GAZA 2EKPA 2X8LA 3GQVA 1CERA 1YVEI 1ZXLA 2BFPA 1DHRA 5F1OA 2VT2A 1P1HA 1E3LA 1QYDA 3BHMA 3G1UA 3GVIA 4OQZA 4YAJA 1U7HA 2QHXA 3ZWBA 2CDBA 1LU9A 2EW8A 2UDPA 2VNSA 3GMDA 3WIDA 3ZV5A 3MJSA 3RC2A 4LMRA 4AFNA 5BNTA 3EGOA 4XQCA 3WS7A 1ZVMA 2HU2A 2HSDA 4RL6A 4GPD1 1U9JA 4TROA 1QR6A 1ZFNA 3KYBA 4XYEA 1ZSNA 1WLYA 1FDUA 1PU2A 1AE1A 1GZ4A 1S7CA 1Z82A 4OYRA 3FPCA 4GGPA 3RKRA 4G65A 2EF1A 1NBOA 1XU7A 3CTMA 1YB1A 1CWUA 2CSUA 2X7HA 4IS2A 4K9DA 3K31A 5ENDA 5DBGA 4ALNA 5IZCA 4BIIA 2DVMA 2GCGA 1ML3A 4LVUA 4XZ3A 1HYEA 1LSJA 2W2KB 1VL0A 3GLQA 3TSCA 2EKQA 1R4MB 4R9SA 4NFHA 1K6JA 3RBXA 5A04A 1PZFA 4XQGA 3UH1A 3L0DA 2EGGA 1G6KA 4HFMA 4UEOA 4BO5A 1VKNA 4MVJA 1Q2XA 1XKQA 4K6CA 3OQ1A 4B79A 4GX2A 4J7CA 1V3TA 4E13A 4Z9FA 5C7OO 5MGBA 5C37A 2QYSA 5COQA 3CUKA 4IJVA 4WLVA 2B5WA 4YXFA 2ZCUA 2YHIB 3NJ4A 3JQ9C 4AICA 4CQMB 4MKRA 5THQA 1F8GA 5EMHA 1O94A 4EJMA 4YT5A 1HSZA 3E6AA 4HADA 4M8SA 1YRLA 2O3TA 4ONEA 4AJHA 2VTEA 2DUUA 3RC7A 4B4UA 2YQ5A 1TVEA 3NGLA 1LDEA 1PR3A 3T4XA 1PJ3A 5JDIC 2JCVA 3LYLA 4QSMA 5DP2A 5BSEA 2E82A 2OHXA 4XB2A 1GV1A 4D0SA 3C3XA 1CDOA 2EP5A 4QFDA 3L77A 4IDCA 3ENKA 2VCYA 3OEYA 3OEWA 5CDYA 3F1KA 2A94A 4J43A 1ISGA 4IM7A 3ASUA 4BS9A 4AJJA 2PY6A 3ZNOA 1KIFA 2QRJA 4R1UA 4TZTA 4RCVA 3BHJA 2GZ1A 3PYXA 3R3JA 2NUAA 2J5RA 2JD1A 3G1TA 3QE3A 1Y8QA 1K3TA 1I8TA 3NGXA 4RQUA 4RV9A 1LXCA 2G5CA 3G0OA 4QUKA 3TZ6A 3JQ7B 5G4KA 2XPCA 4I5DA 4Z3DA 2EV9A 4YJDA 1A27A 4IDEA 3MJVA 3RU7A 3O8QA 5I7FA 2E49A 2X4GA 2HO5A 3DZKA 3G3EA 4BUCA 4IIVA 2I66A 3BZUA 4UEKA 1H2HA 1ZCJA 4Z9YA 3ORFA 5KKCA 2IYPA 3I83A 1VSVA 4KTVE 4PG6A 4BB5A 3D7LA 3U4CA 3DONA 3RI3A 2CMDA 5A5EA 1XHLA 5JY6A 1EVIA 3AW9A 4E0BA 6ADHA 2CF6A 2B4RO 4NJMA 4XR4A 3AFNA 5TSDA 2FY8A 2B36A 5IFLA 3PJDA 2Q1WA 1FK8A 1BG6A 5JC8A 5JY1A 1E1LA 1EUZA 4ZHSA 3ZW8A 1G1AA 2OBNA 4Z9XA 4BOYA 5HTOA 1FDVA 3DOCA 3BMQB 3MEQA 3OQ6A 4YJGB 5LDHA 3GVXA 1B14A 4R1SA 1QLHA 3AWDA 3KLMX 1HLPA 3GOHA 1LDGA 2X9GA 3PZBA 2PZLA 4OXKA 4PGFA 4R54A 1GYPA 2DTEA 1I3KA 2JL1A 3IKVA 4MVJF 5L7YA 1AN9A 5JMPA 5L45A 4IXWA 1C14A 3B6ZA 3WGOA 1GYRA 4MDHA 3KSZO 1ZIDA 5KIAA 4MP6A 4JBHA 1YL7A 3ZH2A 1BW9B 2OFPA 1P0CA 1YWGO 4LN1A 5F21A 1VPDA 1KOLA 1Q0HA 4ZRNA 3GN2A 3DBRB 3VDQA 2VHZA 2W2LD 3AY7A 3DZJA 4O59O 4JQCA 4CPDA 4DLBA 3NDIA 4LK3A 2PH5A 2D2IA 3F5QA 4MIYA 2FPIA 2YZ7A 1EMDA 2D5AA 5JBIA 1E3JA 1KVSA 2C5EA 1F17A 3DEYX 4CM7A 3AY6A 2Q1TA 1NR7A 3I9NA 2VWHA 4QECA 3DAFA 1RKXA 4XGIA 5F3RA 3UUWA 4JJIA 1LQTA 2D5CA 5A05A 4YVFA 4ZICA 1LSSA 2DM6A 4RF5A 3A1NA 3I9LA 4OKNA 4RGBA 5CPBA 3KETA 2PNFA 2ZTUA 1WAMA 4JLWA 3S8MA 1N92A 4E2ZA 1KVRA 2VNAA 1BW9A 4G81A 1E1NA 1LLDA 3DBHB 3TL3A 4CR7A 5JE8A 1DAOA 3EC7A 1VLLA 3CSDA 3QJ5A 1E5LA 4II2A 3CINA 1A71A 5JDCA 2HK8A 3FR7A 4UVGA 3DHNA 3RU9A 3VTZA 4RF4A 1WMBA 2OZPA 4WGGA 3OJEA 2DU8A 2AG8A 5BT9A 4YJFA 4OXNA 3OHSX 4K26A 1MB4A 1J5PA 2B4QA 3TOXA 1R15A 1DC6A 2GN4A 3ANMA 1D7OA 2RHCA 2VYVA 3ADPA 1EUCA 1GQ2A 3KBOA 3OJ0A 4QO7A 4TKLA 4CMGA 2PZJA 3H5RA 2WYVA 5TIIA 1P44A 1XYGA 3GDGA 1I3LA 3WLEA 5DOVA 1N9GA 5T57A 2GPTA 3ZU4A 2NU9A 4PZEA 1WP4A 3BMCA 1XA0A 1H9AA 3PYLA 4ZQHA 4PG7A 1K6IA 3O03A 4IBOA 1NVTA 4W4TA 3N74A 2B83A 4BNFA 4NZ9A 9LDTA 3EZYA 4FOSA 1P31A 2HRBA 1UXGA 3RJ5A 4CMHA 1HETA 1NVMB 4HKTA 1WZEA 5ENVA 1MP0A 1R12A 2FSVA 4K6FA 3D1LA 3GUCA 1Y81A 2GN8A 3UKOA 4F6CA 2Q45A 1ISJA 1SAYA 4QFCA 3Q6IA 1PIWA 4GLLA 3UVEA 4MKXA 4FOOA 4DRYA 4BO4A 1CETA 1I32A 4JJGA 1U2DA 5EERA 1E6WA 2BGLA 4CUJA 1ZSYA 4Z0PA 2POQX 1WDKA 5IDYA 5A9SA 2QQ5A 1R16A 1P1JA 4HY3A 1VKOA 1N9GB 1E5QA 5TT1A 1IHXA 2E37A 3LF2A 4XQ9A 5DDIP 5TF4A 3JQFC 4U0KA 4RF2A 4KWIA 4HBGA 2DPHA 2GF2A 2P9EA 4NQZA 3K2BA 1HYHA 2UVDA 1U1IA 4DIBA 5JDIA 2JCYA 3EUWA 4J2OA 2IEDA 2Q1UA 3LSYA 4A5OA 2X86A 5KVSA 4GVXA 4J9UE 4FGSA 1JVSA 2IDZA 3DL2A 5AYVA 4BMSA 4BO0A 4GSKA 3KEQA 4MVJH 3MTJA 4GMFA 3VPSA 1M76A 2UUPA 3QP9A 2W2KA 2BF7A 4FS3A 2PD3A 2FR1A 1PJLA 1JU9A 1YDWA 3U49A 2VZ0A 1PZGA 1DFIA 1P9LA 5K6AA 1DJNA 4OM8A 4BO9A 5B4TA 2YHIA 4XDZA 4IS3A 4KWHA 4BKQA 4Q3EA 3HUDA 2C5AA 1TT5B 4R5HA 3DBHA 3PYMA 4FFLA 2IZ1A 3CZRA 1T2AA 1MFZA 1X7HA 2EG9A 1BWSA 4HWKA 3S2FA 3ZU3A 4D46A 4IDFA 2NLOA 2EIHA 1I5RA 2AA3A 5CDGA 2NM0A 1E0DA 4D42A 4KZPA 3PPIA 1I10A 3NDJA 4GWGA 4B4OA 3IIEA 1EFLA 1LLCA 3RUHA 1T2CA 1OC2A 1XLTA 2HJRA 3KSDO 2AMFA 5TQVA 4M1QA 3GGGA 1O6ZA 4RZHA 3P7MA 4OAQA 1EFKA 3RIHA 3HFSA 2ZYGA 3AUSA 4MVJM 1W6UA 3O8QB 1PZHA 3RKUA 2CNBA 3JQAD 2WD8A 2CDAA 1EEHA 2Q2WA 3W6UA 5EL0A 5JO9A 2F1KA 5TLSA 3I1JA 2TMGA 4WCDA 3V1YA 3VDRA 1O5IA 3U4IA 1Y5MA 3PWKA 4Q3AA 5G0TA 3DZIA 2GSDA 5TGDA 2B37A 3P2OA 1DRVA 1ID1A 3FNGA 1T2FA 4FBGA 2Q2QA 4JIGA 3OETA 2VHVA 3RD5A 2DUWA 1CJCA 4CODB 2DKNA 5JFOA 4BKUA 2JJYA 3H2SA 3WFJA 5A1TA 3UCEA 4Z3KA 3FBTA 5L4LA 2H6EA 2J5QA 3VHRA 2C0CA 4RQTA 4Y67A 1GUFA 2EW2A 3OJOA 1ADGA 4UREA 4DLAA 4RPHA 4PIVA 1AHIA 2BHLA 1JN0A 1HZJA 2A35A 2FPPA 2ZJ0A 4N54A 3DTYA 3PWSA 3PDJA 4KOAA 1U28A 1UXHA 4R5MA 4GL4A 2HMUA 1B2LA 3WLFA 5A03A 2CDCA 4XEHA 3JQBA 1EVYA 1GYQA 5TRTA 1FF9A 4IDGA 1X7GA 1LEHA 1N7GA 2B0JA 4AJIA 4DMMA 1SB9A 4BNYA 4Y9DA 4PG8A 3H4VA 4AJ1A 2HLPA 1BXGA 4P22A 4QX6A 4WNIA 4MP8A 1HEUA 4ZRMA 1LQUA 4MINA 4O0LA 2EXXA 2Q4EA 3GPIA 5FI3A 1HTBA 2IZ0A 4FD3A 1GD1O 1HDYA 1TT5A 4YJHA 4E2XA 3G79A 1I0ZA 4L9RA 4RLSA 5JSFA 1Q7CA 4WCFC 3SC6A 4CV3A 1UXKA 4KDFA 5K9ZA 5BNIA 2CVOA 1P1RA 3B1FA 3ANNA 3PI7A 4I5GA 5FEUA 1X1TA 2ZJ1A 1GZ6A 1GADO 5F5NA 1FJHA 3GEGA 1B0AA 1DO8A 4EUFA 1N7HA 1QORA 1AHHA 4L0QA 3VH1A 1JWBB 4GGOA 1NWCA 1KETA 5L3ZA 3WJAA 4Z6KA 4IQ0A 4OKIA 2ZCVA 3RUAA 3VPGA 4CLXA 1NFQA 1Z45A 4KDEA 1LDBA 1NXQA 3D5TA 1DLJA 4GMGA 4H3VA 4LMPA 3I23A 4UUOA 3VH4A 5T67A 3BYZA 1VSUA 2RHRA 1GAEO 3DTTA 1X15A 4WCFB 2X23A 1XCBA 1M67A 3F46A 4S3MA 3AI3A 3O26A 1OMOA 4H7PA 4WEQA 4XYBA 3E18A 4A10A 5KNLA 1D1TA 4ITUA 4CQLA 3FPLA 4RJTA 5FFFA 1H6CA 4A73A 3GFBA 4DQVA 3KEOA 3R6DA 3RROA 5JAQA 1C1XA 3AJRA 3IQDB 4IJUA 1CQJA 2VWPA 4NBWA 2HKIA 4I5EA 5DN9A 3RBZA 2I65A 4O5OA 4NNJA 2RH4A 3COSA 2EJVA 3PLNA 3LT4A 4TRNA 4YEDA 3ZHXA 4ALJA 2P68A 5L7WA 2EERA 3JQ8B 3ZNPA 1Y9EA 1YQGA 3ROQA 4UVHA 2NVUB 4U5QA 3ZHYA 1MXHA 4PLVA 5ICSA 3JYNA 2WM3A 4IZIA 2PV7A 1PJCA 4OIMA 2QIOA 4E33A 1R6DA 4OMUA 3GR6A 1CYDA 2P5UA 4FC7A 1U8FO 2PTGA 1DC3A 2HK7A 3GY0A 3S55A 3QWBA 1ULUA 2BRUA 2HMWA 3FTNA 4NU5A 3AOGA 2BI7A 4XGKA 3PIIA 1KEWA 1N8KA 5EQDA 4RVGA 3FSRA 2O48X 1A7KA 4BNTA 1VC2A 4DLLA 3NX4A 2DTDA 1SMKA 3E5RA 3FWZA 5H83A 3ONEA 5B37A 1XSEA 3A06A 4II3A 4IQGA 4XQEA 2BFMA 4CMJA 3DZGA 3C1OA 3W6ZA 4CM4A 1JKIA 3K5PA 2FR0A 1YDEA 1MUUA 3PHJA 4J7XA 4M54A 4XIJA 3WDSA 1T2EA 4FSHA 4HFRA 5K6AC 4DREA 1F8FA 5KWEA 4L75A 1NPDA 3JQGA 2O3JA 3I4CA 1HE4A 1A4IA 3H9GA 1XEAA 2OXIA 3IKTA 3PQEA 2P5YA 4GI2A 1IULA 1SCUA 3GT0A 4DPKA 3OECA 4E2YA 3JQ7A 4KTTE 3DHEA 1H94A 5KOIA 2YY7A 1E3WA 1QYXA 3DXFA 5JCJD 2FR8A 2UAGA 4PLFA 2GNAA 3KTDA 1A7AA 4BGVA 3I9OA 5L4SA 4NPCA 5ITWA 4ND1A 4EZBA 5IZ4A 3Q9UA 4DBVO 3R3SA 3SXPA 1EVZA 1D1SA 1U4OA 2Y1EA 1P3DA 4HFNA 5CG2A 2FP4A 2GZ2A 4R69A 1T2DA 2HAEA 2GUGA 3PQDA 1Z75A 4M86A 2O3QA 1U2GA 3RFTA 4CR6A 2J3JA 3D4OA 4JXKA 3RSHA 1J0XO 1UXIA 4J6FA 4DIFA 5I8ZA 1GV0A 3MOIA 3F5SA 3MOGA 3C24A 1ZK1A 1LI4A 2FWMX 1NAIA 3JQCA 2PGDA 2WJPA 1KS9A 4XGNA 4GKVA 4W99A 3HDJA 4R41A 1KYQA 3K96A 4NJOA 4DQXA 4ZQFA 3VTFA 3O9ZA 4OXYA 3E48A 1SEPA 5T8KA 3QSGA 2NSDA 4E21A 2E48A 3CEAA 1X1EA 3OIFA 4PLPA 2FOIA 2I5PO 3GEMA 1HZZA 3ZZNA 5CG1A 1LBEA 3PK0A 4GX5A 1DC5A 1FDSA 3KLPX 1I2ZA 3GVHA 5I9MA 4BNXA 3ETGA 4NDNE 3PJEA 1HE5A 2C29D 4YJGA 3PHIA 5C7LO 1KEPA 3GVCA 2YYYA 3QW2A 3WOHA 3PJFA 4CM8B 4IPTA 2WYWA 5DULA 2D8AA 1DIGA 1KVUA 1PZEA 3EDMA 2IEBA 5C3MA 5U1PA 4BNNA 2PZKA 4CM6A 2Y1CA 4JK3A 1MV8A 1Y6JA 1DFHA 2VHXA 4BNJA 4YACA 3NT4A 1QYCA 5G0UA 1S6YA 1P45A 1GEGA 4KUEA 1ZK3A 2Z1MA 4BV8A 5DCYA 4BV9A 4URFA 3WGTA 4BNHA 3AFMA 3ZU2A 3ZW9A 2CVZA 5IAAA 2OP0A 4RO0A 3D0OA 3K2EA 3FRJA 3SJ7A 3LF1A 4W7IA 2G1UA 5A9SB 2XOXA 4BNWA 4EW6A 5CDUA 5ADHA 3SX2A 3UCFA 3QVWA 1N2SA 3LLSA 1BVRA 2I76A 2W90A 1KEUA 3WSVA 2HUNA 2Z1NA 2RCYA 3WR5A 2I6TA 1YBVA 3FR8A 3WBBA 1T1SA 2NADA 2C7GA 3ICCA 3D64A 4M87A 3OF2A 4UULA 2NVWA 2CUKA 2W4QA 3GZ4A 4N18A 4BNLA 1ZO8A 4UAGA 2P9CA 1A4UA 1RWBA 3GK3A 3OFSA 1SEVA 4W9NC 1JVBA 3INGA 5AXAA 3STHA 3WWYA 2X0RA 5L40A 2V7PA 2ZB8A 2GD1O 4A0SA 1LA2A 4ILKA 2AEJA 4IZHA 3JYPA 3R1IA 4H15A 1VM6A 2V6GA 3DBVO 3KYCA 5BR7A 2VHWA 4C7KA 5JC1A 4N5LA 1RM3A 3KO8A 4F6LA 4XD2A 5L95A 3U3XA 2VOEA 2D4AA 1NFFA 5JAMA 2PK3A 5F5LA 4Q9NA 2W8ZA 4L76A 2DFVA 4IIUA 1B16A 2IODA 2W2LA 1YS4A 3JD1A 2AHRA 1D4FA 4Q3DA 5GY7A 3AUTA 2VUSA 5GZ3A 3DC2A 3JD2A 4MO2A 2ZK7A 1ZK2A 5EPOA 4QXMA 2OP1A 5GMOA 4INAA 3HDQA 4P4NA 2Y1FA 5JYEA 1E6EA 1W4ZA 4YAIA 5FYDA 4B7UA 3SEFA 1V8BA 1GPDG 1TT7A 4XJSA 4AJ2A 4MIOA 1IYZA 1R37A 4BO8A 1RYDA 3BMNB 2PD4A 1C0PA 3RJ9A 1LDMA 1TEHA 3VVBA 4CLRB 5HRUA 3GEDA 2PA3A 3ZWXA 4WPGA 3WTCA 4AG3A 3IP3A 3H5AA 1HKUA 5I8WA 3VPFA 1QYVA 3IP1A 2G17A 3ZV4A 2NNLD 4UUPA 2X6TA 4FC6A 1KVQA 1PJSA 2FSSA 2I67A 4FJ2A 3GAFA 3OQBA 1HF3A 1YE3A 3OA0A 4AJEA 4E3ZA 1VL8A 2WD7B 2Z95A 1GTMA 1LC0A 4WOKA 1YKFA 2YW9A 3ZV6A 2PR2A 3KVOA 2WYUA 4A26A 1B8VA 3HNPA 5TNXA 3TPCA 1AXGA 4PRKA 5AOVA 3KXDA 3GHYA 1HRDA 1X0VA 5JAIA 2HMSA 3I6QA 2O23A 4LCJA 2IYOA 4D45A 1YL5A 4XWYA 4EUHA 2PFGA 4BGEA 1GUYA 1ZBQA 3A14A 3G17A 3LVFO 4B8ZA 4OO3A 3UGKA 5ILGA 2YFQA 1WPQA 3OBBA 3A4VA 2ILTA 5BQFA 4CMEC 4IJKA 3DMYA 3WNQA 1UJMA 2QW8A 3C7DB 3ROMA 4LGVA 1ONOA 3RAJA 3H65A 3UOGA 1ENPA 4BHTA 3KRTA 2CFCA 1UAGA 4J1TA 4WE3A 4CMAA 4NU6A 1EDZA 1IUKA 4AJOA 3PP8A 3GHHA 1RPNA 4PN3A 3O4RA 3PEFA 4CLOB 1PWXA 2O2YA 2BH9A 2R2GA 3FCOA 3WB9A 1VJ1A 1YXMA 2NVBA 2WSBA 4FW8A 4J3FA 4QQRA 3W1VA 1WMAA 2AXQA 3AUUA 1WDLA 1E3WB 4R51A 2CY0A 1NR1A 3EAGA 4LRTB 1R66A 3KSUA 3VZRA 2ZB7A 4U0JA 2O3UA 3DZFA 4QEDA 2X9VA 3NYWA 4WEOA 2AQIA 4R1TA 2PKQO 2YDXA 4I1IA 3WGGA 3OM9A 5KTKA 1CRWG 3UFXA 4WNCA 3JQGB 5G4LA 4XCVA 3H2ZA 4ZU3A 4YR9A 2DT5A 3GZNA 2P4HX 3BHIA 3LC7O 3FD8A 3LLVA 4BKOA 3WSWA 1Q0QA 1L7DA 3D3EA 5I7VA 3GN1A 4TVOA 4W6ZA 4YT2A 1UDAA 4NG5A 4EUEA 2Q50A 3E9NA 4RVHA 3D3WB 2PKRA 3FN4A 4YBZA 3PHGA 3SC4A 1M2WA 1EBFA 2VRBA 1ZEMA 3WMWA 4J49A 4BL5A 2JFHA 3T7CA 4GQAA 3I6IA 2YV1A 1BDMA 1U5CA 4TWRA 4XYGA 3WQRA 1IZ9A 1EBUA 2P91A 4NMHA 2PGJA 2ZTLA 4M55A 3AOEA 5EESA 2LDXA 3D4NA 1PTJA 1HE2A 1GU7A 1YBAA 2AW5A 4PLGA 1WNTA 5IN5A 3TDKA 3WGYA 2OL4A 2P2SA 2PD6A 3GG2A 3ZI0A 3GGOA 4EBFA 4Y98A 1DHTA 1OOEA 3E1KA 3INRA 4UEJA 3AM4A 2C20A 4HX5A 1ENYA 1NTOA 3MZ0A 1ZKMA 5AXDA 1I33A 4YJFB 4YAEA 1UUFA 5KKAA 4YQYA 4E30A 2GASA 3RFVA 1MC5A 3DBRA 4CL3A 1SOWA 4MVJP 4Z0TA 1Z7EA 4IINA 1GL3A 4J4BA 2R00A 4UVEA 1T4DA 1R4MA 1AXEA 3BIOA 2C7VA 3L4BC 3B1JA 3QWFA 4PLHA 2PLAA 4AVYA 4Y6SA 3EVNA 4R01A 4NI5A 4QT0A 4Q39A 3ADOA 2JFGA 3E03A 2BD0A 4BMNA 2FN7A 3PHHA 5ICMA 2HQ1A 1BHSA 1YH3A 1ISFA 5CP8A 4LRSB 2YHUA 3DOOA 4RLHA 3NAQA 4B7XA 1E1KA 2Y67A 4PG5A 5B4VA 1QRRA 1KC3A 1YL6A 3QWHA 4IGFA 4WLUA 5KJ1A 3JQBC 2XXBA 1JTVA 2GERA 2EWMA 2V6MA 4EJ0A 2PGLA 5DCWA 2CZCA 3OP4A 4FCCA 5B1YA 4FFNA 3WFIA 1ISHA 3ZNNA 1X7DA 4MVJI 1DIBA 5A3VA 4XKJA 4FFPA 5JAZA 1ORRA 4IMRA 3NEPX 3JQEA 4NH4A 2D59A 3E82A 3H9JA 1J6UA 3GDOA 2XXJA 4UVIA 1DRWA 4I9NA 4N5MA 3L07A 1SPXA 4O6VA 4TRJA 1G0NA 1W0CA 2OGUA 4G5HA 2IXAA 4EYEA 3ON5A 2NQ8A 1ONPA 1HDCA 1MLDA 3CH6A 4Y6RA 2JHGA 3SJUA 4BB6A 1NASA 3BMOA 3WGIA 1U5AA 3WQSB 1DLIA
chains in the Genus database with same CATH superfamily
1PR2A 1JHAA 2GN2A 3LBAA 3LBFA 3RVBA 3RC1A 1WBBA 1DQSA 1MG5A 2V5AA 3GFFA 1CUWA 1DXHA 3IKMB 3KE9A 3KZOA 5LNK1 3QOFA 1JFVA 3QLJA 4FYHA 5KDLA 3DP9A 2G70A 4D0RA 4JT4A 5FR1A 1ODFA 2BUBA 4MRPA 5BQ5A 3LBIA 3N59A 5JNSA 1MEOA 1FJGB 2HLDA 1JFFB 4IOMA 4LXTA 4FPXA 5B6PA 1TUGA 1L5QA 1VE9A 2QJFA 3NJ8A 4WZAE 2IY7A 5K0FA 2JHPA 2K2WA 4ZT7A 3TB6A 1GTL1 4YRIA 3FM9A 4I1YA 2QRLA 5HQTA 3M3PA 1UBCA 4Y2VA 5KJFA 3BJZA 2QUAA 5IBQA 2NU8B 5JMOA 2FFBA 3OPYB 1GZSA 2FFJA 2PQ0A 4QGGA 2B4TO 1P75A 1EK5A 4YQZA 1KERA 1B26A 1NBEA 2J41A 2Q1SA 2QLMA 2GB4A 2WC1A 2PO7A 3OPNA 1H4TA 4LDPA 4A36A 4FQ8A 2C00A 2DUJA 3X1ZA 3AK4A 1OYWA 2VP2A 1AO0A 1VE3A 4RGQA 2NTEA 3U44A 3O9MA 3AY3A 3KV1A 3U3DA 2NXCA 3VAZA 3GFSA 2GAJA 1JTFA 1HKHA 1H1TA 1KFCB 1Z6YA 3IT1A 2O3RA 1ZIYA 3EGVA 3PVZA 4JBLA 2F3RA 1RJFA 1G59A 4QGBA 2A6PA 2AXEA 1NC3A 3HWRA 4UM5A 2Y0DA 4PO1A 4M0EA 4YDQA 3ZUPA 4KE7A 1E18A 2ZM5A 2RGRA 2WEKA 5BRJA 4JYCA 4MIKA 1SUWA 1W36D 1VDZA 4XW2A 2X0IA 5CH5A 3DUWA 3A04A 4CMIB 2AYXA 2FE4A 3O92A 1W88B 3ZQUA 5CA1A 4S05A 4TLMB 5EOVA 1JEYA 4N3GA 1Z25A 2PJUA 1MABA 4R2WA 3P9NA 3EMKA 3SSOA 3DE2X 5FBKA 2REQA 3IR6A 3PHLA 3TJZA 5IN4A 3HM2A 3EPHA 2XUQA 1F48A 4E3WA 1XZLA 3C3CA 3P9YA 3NCHA 3IAAA 4RAOA 5LU9A 1G6OA 2ZFUA 5CM2Z 4QU5A 4AT1A 1QLJA 1F4PA 3MYYA 1MOZA 1EZ4A 1NP6A 1N2EA 4LPKA 4D3DA 3FYUC 1BAPA 4JLPA 4UU0A 5C2JB 4RHCA 3CF6R 3IJPA 3U7IA 1ZNZA 3GEBA 4OI0A 4YT4A 1JIQA 1OXVA 2OOSA 3ZHBA 4CUZA 1E7RA 1NI3A 1UH5A 3U9LA 4G84A 5K20A 5EA2A 1BE0A 2VYQA 2CXQA 3PGA1 2BELA 2NO7A 4A0FA 1JAZA 4H4DA 4QQKA 4RD3A 1F8UA 4D9CA 4UW9A 2FEWB 2FGKA 3GDFA 1U63A 1JHXA 2QGZA 4E1VA 1GPYA 3O84A 2BKVA 4GBED 5AI5A 3UWDA 1KH3A 2XNKA 3CNBA 3ESXA 4V2IA 1XWIA 3ZGNA 4A6EA 5JBNA 2XKKA 2BI8A 3PPYA 2PDAA 1B4DA 3QBTA 4GLFA 1WSDA 1AF7A 2HD4A 4PFSA 5JPIA 2VJNA 2QRGA 1S4MA 3PUJA 2ZRHA 1E20A 2D4HA 2JGAA 4KP7A 1ZVQA 2W58A 5A4KA 2CLDX 2VDOB 1YOVB 4JMPA 4KPUB 3UJ8A 2ZUWA 4EG8A 1E60A 3DLIA 5JXGA 1E6CA 3WTBA 4CV1A 1FXSA 1LRJA 1T4BA 5LUBA 3T54A 2B30A 4BIMA 2JFFA 1WF6A 4CHGA 1TA9A 2F3UA 4S1VA 4Y6LA 4CJXA 5D01A 4NYJQ 1QV7A 2AWOA 3HGTA 4FCWA 2OA0A 3H2JA 2UXBB 3T8YA 2C0PA 1JZTA 2PVSA 2LR0A 1B00A 2JBHA 3PIDA 3PQFA 5H4GA 1SUIA 1YUNA 4H7JA 5D5QA 1YR8A 1ZIXA 4QUJA 1A1VA 3D02A 4G1EB 4PZDA 4JV5B 4QTZA 3LAWA 2RAFA 2C96A 2BGTA 1ZMTA 4WCVA 1UPAA 1XDBA 3IX7A 4NENA 4XYLA 3UT6A 4WBNB 1TI7A 5K8UA 5KO2A 1G9XA 5CD1A 2ZZNA 1BE6A 3MHPA 1WW3A 1Z36A 4LZJA 4OLBA 1PUXA 3MSCA 1F2UB 2RIRA 4KGDA 1DIRA 3MTEA 4H7DA 4V0QA 1RC1A 2L2QA 1JDBC 2QB5A 4F6RA 2EHDA 1V6AA 3TD6A 3LPAA 3I28A 4FVTA 3WNDA 4QM7A 3FWYA 4DJDC 4X64B 1G291 5JANA 3TNLA 3P4UA 5EKSA 3EYWA 3I04M 4ZCMA 3TQHA 1BSVA 1P7ZA 1PS8A 1KGDA 2JK0A 3Q3VA 3UAVA 3ZDRA 4EB8A 2XAAA 1DB3A 1YB5A 1LJUA 3QITA 4WOBA 2J33A 2CBXA 4CKWB 5ERGB 1MFPA 3GC6A 4JBXA 4BVFA 3R5XA 5HX7A 3W9BA 2APJA 3R3UA 3N86A 1T6ZA 4MAFA 1NBMA 1E9DA 2AKAB 2AEEA 4ALMA 4KQXA 2A5JA 1IUOA 3VNSA 5DSZA 5L45A 5K3FB 1W1UA 4M2LA 5BSFA 4HAWA 3OSUA 1BMQA 4RY8A 4F5YA 3BWEA 3D4PA 1QHHB 1P74A 1Q11A 3KHTA 4RPKA 4EKYA 2IXBA 5TQJA 1MRSA 2ZAMA 2I1LA 3WKEA 2YWFA 3KQVA 1G8JA 1R0BA 5CHYA 1M2HA 1ONNA 5ILQA 2NO9A 1KS2A 3PFKA 4P84A 4Z0HO 5CLFA 1ZRMA 1A04A 3CVJA 3HE3A 5IKPA 1DAHA 3UXYA 3OLYA 5EJ9A 2Q7XA 4JLKA 5IDQA 3B70A 3OIVA 1U0EA 1NLYA 3BWDD 4BKMA 4RTRA 2JFXA 3CPSA 2WU8A 5CRIA 2VT3A 1E2DA 5IVDA 2WMDA 4BECA 4EWLA 4YP1A 3GFVA 4OYYA 4TXNA 4EYOA 4H0CA 1QIEA 3TW8A 3ZV3A 3GA7A 5CFPA 8LDHA 2JBAB 4EI7A 2XX3A 4LYEA 4EA7A 1X8JA 4DBZA 4BGUA 4GKBA 1CJMA 4ZC8A 1JPNA 5CAEA 1NV9A 2E5FA 2NACA 1ZW6A 4YMIA 1U2TA 2PRIA 4KFTA 3NUGA 1NVXQ 1U4SA 2ZIVB 1G0OA 2FPIB 1R0ZA 1HXHA 2WHRA 2X3YA 2RAPA 2FPGA 4N40A 1PNTA 10MHA 2VDLB 1ZQ9A 1N2HA 2P2GA 3KXKA 4YLGA 4ZYXA 3LGAA 2FFAA 2I2WA 5CCBA 3Q6MA 1Q3TA 2ZYRA 1ZIPA 3DEKA 3B5JA 1E8DA 1T0IA 1MPXA 2DUMA 3A9RA 2G04A 3EQ9A 4FBMA 3HMQA 3KS9A 4BNKA 2ISQA 2B1QA 1RADA 2BR4A 1J39A 3DVSX 4XJXA 3NM4A 4CKXA 1QBKC 4YMTA 2XQFA 1E9AA 2DFDA 3G9XA 2R1TB 2AW3A 3CIOA 3JWIA 1ZI9A 2LPMA 3O2SB 2AR7A 4Q01A 4YCAA 5GV8A 1CDEA 3RU2A 4CG1A 3TLYA 3DLHA 2DLNA 3ONWA 4OGGA 1J8VA 3ER9A 1ORIA 4URVR 1USUA 1J2TA 2JRLA 2W2VA 3ONFA 3PVSA 5CUQA 5BMVF 3HB5X 5CVTA 1GZ5A 4KBGA 5IHPA 2AG5A 4FFOA 4A8PA 1TLTA 4RF3A 1ZXBA 2CN1A 2JD2A 3QFCA 1QE5A 2C84A 4ZJUA 5HE9A 5LMNB 2GPNA 4PZYA 3V2GA 1QMGA 4LWQA 3Q72A 3WYCA 5MDHA 1D9XA 1HDOA 3DFMA 3OAAA 1UP7A 4PLZA 3OZCA 3PL5A 5EQFA 4C6HA 1RMYA 4CEJB 4EGAA 1QGOA 1GEEA 4WSOA 2WG1A 1S2NA 2HJSA 2O5RA 2OBBA 1JZSA 3ENNA 4X84A 1Q3KA 4AMYA 3FUWA 4ETMA 2VEDA 3LWBA 4OJNA 1BU8A 1I7LA 2WUWE 2QP4A 2F1IA 1PD0A 2H1WA 3DBIA 5LXTF 4UHKA 1J24A 4BB9A 2ODWA 3IA7A 1NHGA 3P2EA 4MYRA 3ETDA 1ZH2A 4J90A 4FCTA 4PHFA 3TW8B 1M2JA 1C9EA 3FJOA 2C9CA 1PQPA 3GRZA 3L6BA 4HWOA 4I4CA 4JOBA 3SF0A 4ND5A 4EG0A 4DUPA 1KBQA 1Y3DE 2PL5A 4Y2PA 1YV9A 3DNFA 1U1CA 3GGPA 1EK6A 1X1DA 5GJVC 2PXHA 4MCIA 1NLFA 1E2HA 3IAS1 1FFBA 1GZVA 2JGIA 2VDMB 2WHEA 3EGWA 4KWTA 4URYR 2Q9UA 4U9IS 2UZ3A 1TPZA 1FL9A 3WDMA 3VR6A 3IUYA 1XIVA 2BFAA 4U4AA 2FWJA 1O97D 3ZGYA 3ZGVA 4BWYA 2WTBA 3HB1A 3LK7A 4KFCA 2IZ5A 4X8LA 4AJKA 3R7FA 2XDQA 3UV3A 4UOZA 2O1SA 4W63A 5LP6A 2CNOA 4NBSA 4I1RA 4E11A 3FYTA 5H9VA 3DDNA 1K4YA 1TMGE 3BQNB 3FB1A 2FFRA 2JFWA 4Q4DA 2VQ6A 1CRLA 1PWEA 4CBVA 4QASA 3OEEA 3TF5A 2SECE 1KEVA 2DPYA 4FJ0A 4UE2A 3B6IA 1TM5E 5K3CA 2VHYA 2C3YA 5I9SA 4ALIA 1MQSA 1V96A 4LFBB 1HFWA 4H7HA 2ZTMA 1YCFA 1P60A 4ALLA 3PGLA 1ESNA 3PA6A 1V5EA 3QMVA 3N28A 1T6NA 5EHNA 1YGYA 2J9YB 1KXJA 3U1BA 4EG4A 4OHCA 4E09A 1U8EA 2R9VA 3E7WA 4R9NA 4KQ1A 5TQ2B 5K0BA 3JZAA 3L0CA 1OZHA 1RM5A 1VMKA 3ETEA 3JR3A 1P2UA 3QE4A 4RY0A 1XTUA 4ZVUA 1FDIA 3ZI7A 1BDBA 1NQ5A 5JWOA 2QE7A 2HREA 4KC0A 3VNQA 4EQZA 2GDJA 1CU1A 1WHTB 1B3RA 5HKAA 4AMUA 5A9TA 3IUEA 1X87A 3CNHA 3OE7D 1V26A 4IO1A 4PFJA 4V0MA 1MV5A 1NYLA 1ISIA 4JVSB 2RGEA 3E0QA 1P1CA 3TI9A 2NZ2A 3FDZB 1ZMOA 1RTKA 4TRMA 1A8QA 5K8VA 3EDCA 1LWOA 3NRBA 1GY8A 3IR7A 4C7XA 4ZAWA 3RNLA 3C1TA 3KWFA 1O95C 3B82A 2X9NA 4KVGA 5D3MA 1RXIA 4WOCA 2NWQA 3H1PA 3HDHA 1NGSA 3INYA 3LHSA 1K5PA 2FKNA 3TW6A 1XDUA 1TMKA 1ZH8A 4BQFA 4D41A 3QELB 5CTAA 4H35A 3VYRB 2QL5A 1E7WA 4I2NA 3WDLA 4DA0A 3TK1A 2F4VB 5E6UB 3HA2A 1VOTA 1ESCA 4JEIA 3BAFA 3GIWA 3VVCA 4A16A 4BYGA 4D82A 4ERXA 1AMUA 2E4AA 1PVVA 1CS0A 3CZPA 5LMUB 1PK9A 2VYND 3S2GA 1TO6A 3L1VA 3SWWA 4H4CA 2GGSA 3CE6A 5DLPA 5JECA 3KYCB 2G1AA 4M0UA 1RWVA 1QYRA 1JALA 2G4VA 4OI1A 1EZZA 2ABWA 3IVGA 3MMSA 5AI8A 3FF4A 1UBMS 1EI9A 2F90A 3I5AA 4XGRA 4A1OA 4AYXA 3K6SA 3SU8A 1SKUA 1YZNA 5ECYA 4RVFA 4EVIA 4Y1EA 2NPFA 4R0NA 2FMKA 4WA7A 1YU6A 2AE2A 2AUMA 2KBFA 1KSFX 1J99A 1DAMA 2Y0BA 1YJBA 3GLSA 3RAGA 3H2BA 3QZUA 1PKEA 2XAUA 1ZUHA 4HR7A 4YRDA 2R7KA 3OD1A 1ADYA 3IKJA 1ISSA 3PJRA 2O8EA 4CG3A 1FS4A 4CGZA 2OBLA 3G0HA 4B2LA 2DHRA 5CURA 2NO0A 1Q7RA 5CJ2A 3OZGA 4KXFB 4BGIA 3UB3A 4HB0A 4PTLA 4X6UA 3E7XA 2ODEA 2RHDA 3C4QA 2HL6A 4FGUA 3ONNA 3BBPA 4YFVA 2AOUA 4KIWA 3M1LA 1WZCA 2RGCA 1F51E 1O58A 2A67A 4KWEA 1C3LA 5ES3A 2VDPB 1I0IA 1UR5A 4GWLA 3LHFA 1JXMA 1Z39A 5HG0A 1FFXA 2P2ZA 2VT7A 3E58A 4KYIB 3ZHTA 2NU9B 2YRXA 3L8ZA 4AWXA 1X7ZB 2VJBA 1NW9B 3R77A 4JVLA 2FSHA 3LCRA 1QGUB 3HL4A 5TEVA 4NS1A 4BE9A 4E5PA 2WU3A 1V5GA 1I30A 1ZL2A 3D6AA 3I2JA 3NHMA 3RSLA 3JVVA 4P4SB 1VFNA 4YA6A 1PV2A 1LV8A 5LFAA 1G64A 3LC1O 3ED1A 1NUSA 1PEDA 1T36A 2HRDA 3TQRA 3L8HA 3WYBA 1VB5A 3C8HA 2QNRA 2WYOA 3NEAA 2UV8A 1SJ9A 1WABA 3EQ2A 1F7VA 1XD8A 3O91A 3U37A 4EL0A 2ZR8A 2J8ZA 4R3UC 2A1TR 5BSVA 4I6EA 1YI1A 1MC4A 5C8YF 2XDYA 3EXFB 5CHEA 5DCLA 3TTXA 4QTYA 4N6OA 3A4MA 4BATA 3WIEA 2WJ4A 4FZJA 1X3LA 3I4FA 1K06A 1QG6A 4CT5A 3REQB 2E4WA 1RAAA 3M6FA 1EFCA 4RFLA 5IXYA 4ETNA 2ZBFA 3QFHA 2Q3DA 5HBRA 4GLOA 2C5HA 1E2GA 2I22A 3CZ4A 1SG9A 3K73O 4TX1A 3VJKA 5I48A 2X58A 3RS8A 5A06A 1UWCA 3DKVA 4TMFA 1QH8B 3PLRA 3HYSA 2I1VB 4G26A 3V1TC 1SHLA 3M5PA 3T5MA 3I5XA 2X42A 2YUIA 2VDWB 1CF2O 2GO1A 3N0TA 3AFOA 2QXTA 3O3CA 3HRIA 4MUJA 1ODLA 3RTAA 3T06B 3KL2A 2YQ4A 3W2IA 3OH8A 4YRAA 2QTFA 2C1XA 3R41A 1BGWA 2CHQA 5A3JA 5IZCC 1EGHA 3BERA 4ALKA 3I5YA 2PS1A 1CF4A 4F46A 4LQCA 3MD9A 2GBFA 1MG0A 1PI3A 4BNIA 3KKOA 3ANSA 5DTEA 3WQHA 2FB9A 3A3KA 1UXJA 3LUPA 3QVTA 3SZLA 1T6YA 1X7YA 2ADFA 3WNBA 4KX3A 3WLJA 5B7GA 5GGXA 5JAPA 1A5ZA 4MQEA 1HTWA 3GI1A 2XVAA 3QELA 4CM1A 3LBHA 4NYMR 3R0VA 3QQ5A 1KAHA 1C3VA 2QVYX 2QQFA 2QX7A 4NMXB 3VV3A 1JDTA 3VMFA 1W36C 4EHNA 2FUG6 5H5JA 2VKQA 2RKWA 4J16A 4WUTA 3ZE0B 1QTNA 2AG1A 1XELA 4PXAA 4Q3KA 5EHGA 3N07A 1J0EA 2BLLA 3TE6A 1JDVA 3I37X 3VU9A 1UEJA 1Z62A 4PV7A 4UBIA 3AXSA 1HZZC 3RIYA 2ZATA 1P33A 3K30A 1JQDA 3JQAB 3QA9A 4P7KA 1FDOA 2JEYA 1NPTO 3WLAA 1RI5A 3PENA 1DO2A 1HH4A 5K0LA 4EI9A 5JFGA 1HE3A 3FVVA 2PVCA 4ME6A 1IWPB 1DKLA 1SC4A 1UWVA 3SE7A 4ZZ3A 1SZPA 4XDYA 5IC4A 1USVA 3HUFA 5F76A 1FNNA 2WFZA 4MV4A 4N7RA 4UTOA 4M8KA 1MABB 1P39A 2Q5IA 2YJZA 2Z3ZA 3G2MA 3G89A 3HG7A 2ZE6A 4FDTA 4MWDA 4WUVA 3N0XA 4CNQA 3K9GA 2UUCB 1VKHA 3DWEX 1O9BA 5ARBA 2IH5A 5EJFA 1WDMA 4GOMD 2AL7A 4CNBA 3ZWNA 1VCMA 3JRXA 2FQXA 3EB9A 1FUIA 4JS0A 1NOJA 4L78A 3MINB 5DZSA 5EMJA 4U6QA 1E64A 1SZJG 1CUZA 1L5MA 2H9IA 4EG6A 5LLDA 1XXHE 4I5IA 2OHVA 2PRJA 3LUAA 4D3SA 4EHAA 5H68A 3U6KA 2FRXA 2Z09A 3G13A 1M0WA 1OREA 5E6SA 2J0UB 4NL4H 1KEZA 7YASA 2F6RA 2GBLA 1Q91A 3H1GA 2XZTA 5C1PA 4RTOA 4TKVB 4XB1A 3AI1A 1P4GA 1G21E 4FIDA 1IG3A 2I4OA 3INTA 3TWOA 1DZIA 4PQEA 3ZXUB 1U04A 3KD3A 4MR9B 4A8JB 3QYJA 1Q21A 3CUUA 3ZHVA 3T52A 2Y0CA 1SXJC 3WBFA 1I5EA 1PSDA 1QHEA 1OAAA 3KB1A 4NE9A 2IPNA 4CDRA 3OT1A 2HUPA 4GP9A 3CVUA 5KJCA 1ZUNB 2Q0HA 5TB5A 2FU5C 4X7MA 4NNPA 2JEZA 3M3DA 1U7UA 1ODTC 2Z3WA 5AXCA 4QDKA 1ZEJA 4Y6PA 2UUAB 2P78A 1YIOA 4IW3B 1PWZA 2MTBA 5C1BA 2F2TA 4Y2GA 3G6KA 1D1PA 1ZW1A 2QGFA 4YRQA 4CV0A 4E31A 4X0EA 1JX6A 3K7EA 4N5NA 2EVWX 3NCTA 1RYFA 1S9DA 5HQ3B 1OI4A 2L17A 5CVUA 4BWGA 1NJ1A 2QX4A 3D7MA 1Y6GA 1HM5A 2DWOA 4ZYLA 1F06A 3GJ7A 3HXTA 3CVXA 4JVMA 3QU5A 4JBWA 2BGGA 3WGVA 3TRHA 1W2HA 3YASA 3LT1A 3VNAA 4EDHA 2N3ZA 1C0KA 1I1OA 3HUEA 3Q8WA 1IVSA 2HNKA 2DKFA 2MSDB 5BSTA 4EMSA 1RCTE 1U0BB 4KXVA 1F8XA 1DFGA 1E99A 1M72A 3DFUA 4JX9A 5K3DA 3GGCA 3ESCA 4ND2A 1AGNA 1ANKA 1FFDA 3CZQA 1E92A 1JPJA 1DEHA 3PUHA 1BA2A 2C8KA 1GSIA 1WUIS 4YCDA 5CXSA 2AOTA 1O94C 4D44A 5EMLA 3RYCB 3CKYA 3CMCO 4IEFB 2GRUA 1I24A 3IBFA 4OOEA 4EOGA 1QB8A 2D1YA 2B7CA 3AILA 2PKXA 1LVUA 1YMVA 2BWJA 2Q0SA 4GSLA 4X41A 5HIIA 3ECAA 3WKCA 2CT8A 3N58A 3O3MB 3ICPA 4WXYB 4B4KA 3TEFA 5GZ6A 4BO3A 5CXQA 4D8WA 3P9SA 2Q3HA 3K9WA 3GJ8A 4FINA 1SQ0A 2QYTA 2XQIA 1M6VA 4IV0A 4K9QA 4D4JA 3CLRD 4L8VA 4ZYZA 2RI1A 2IKSA 1CP2A 4ABYA 4D3YA 4YWJA 3WXBA 4WMLA 5B64A 1QAOA 3Q4GA 4Q0MA 5D7BA 3WJ7A 1CLEA 3EW7A 3AVPA 4LFCB 3TX2A 2J5KA 1A4XA 1I9GA 1OTYA 4HT3B 1DKPA 3UJCA 2XGGA 1IJFA 4EQ6A 3I9JA 4DG8A 4MRSA 2Z30A 5BR4A 1A9ZA 1K2VN 2OLKA 2VZ9A 3UJDA 3JVEA 1U3UA 2C4KA 2G3YA 2VSNA 5KHLB 1WB5A 2O2SA 1K7XB 3C70A 1ZD4A 1A8PA 4WFIA 3NHAA 5DHPA 1IXZA 3ZNQA 4DIKA 3U7GA 4NSNA 1FU4A 1EX9A 2GD2A 3GNQA 1YJQA 3G49A 3W06A 4FMDB 4D7AA 3CH7A 3CCCA 2VJOA 4DLVA 3PPWA 1C50A 3LXXA 3ELUA 3LXRA 5E7IA 2WYIA 4KGXA 5JS2A 1L7PA 4KQ2A 4PCLA 3UJ7A 4BBJA 5M04A 2JI7A 1T1IA 1NKSA 3KD2A 1H6BA 3CXRA 4F72A 5DX1A 5KSPA 4LI3X 4ZK2A 2ZVPX 4YN3A 1A8SA 3PV0A 4FLMA 2Q3EA 2RH9B 1RHUA 4RKQA 2RE8A 2H1OA 4N48A 4CMIA 5CA1B 3JQ6A 2AZTA 1MRNA 5LXTA 3BFJA 3GNSA 2C2XA 4YDHB 2EWWA 3DM5A 1N4DA 4FD2A 3SS9X 4EPTA 4A8JC 1XU4A 3JSAA 4KG7A 4CR8A 1UK7A 3GA0A 2HRRA 3MJTA 4C01A 2OFOA 3E8XA 4RQAA 3DHYA 1OZAA 1VIAA 4E4TA 1IE3A 1OZ0A 2Y6UA 4G23A 4D4MA 4I55F 2GRAA 2C07A 3BE5A 5L53A 4MUIA 3A36A 4OF4A 4DTCA 1QV6A 4AS3A 4OXRA 3TMAA 2FSPA 3W4KA 3WRYA 3UJNA 1YTUA 4D99A 2BKAA 2WHQA 3HV0A 1ACJA 1EQ2A 3FZGA 3T95A 2PLFA 2BIFA 3WVNA 4R9RA 1DO0A 4G4JA 3MCTA 4B82A 2CF5A 4MVJG 4MQMA 1T8UA 3E3NA 4I9UA 5T5QA 3SC2A 3AKZA 4Z4HA 5HJ2A 4G85A 4IJMA 1HYGA 4B7CA 1C9YA 4BVBA 1Y4UA 3PGJA 5IX8A 3IQXA 1OWPA 4G5GA 3N7TA 1IY8A 4ZVMA 1J9GA 3T99A 1FUEA 5A7HA 3KJZA 3TIIA 4YT8A 1Q12A 1OB5A 1AZSC 2IBMA 4KO4S 1DRJA 3F3KA 1CUGA 1GL6A 5ETJA 2E0IA 3W8EA 2PVPA 4TV8A 3GU3A 5FL7D 4CCSA 2XDAA 3DEAA 4AKTA 1TTTA 1UBUS 1ZHHA 3WYGA 2QBYB 1OFUA 2B8EA 2GVNA 3OIGA 4LI0A 3ZE2B 1JR4A 1H93A 2C78A 4K9LA 4RORA 4MS3B 3TIFA 1DPGA 2CNWA 4DUGD 1VLZA 4ZAZA 1PS0A 1ZSVA 2WQZA 3HKBB 5LP1A 5E1DA 4AAYA 1L4MA 1VZ3A 4EO9A 1MDBA 4EFDA 2J7PA 3RIGA 1ZGCA 1PGPA 2GR9A 4AP5A 1KSJA 2BMWA 1UINA 2Y68A 3VR2D 5B3AA 4UTVA 4RTPA 1I9CA 3NT2A 3F5MA 1MB0A 2QXUA 5AOBA 5KNCA 5AKHA 1BGVA 3H86A 2ZVDA 1T3ZA 4MPDA 4WFQA 2ZUUA 4JQYA 1NJ8A 4MQ4A 4F3RA 5JZMA 4HLCA 3P0JA 1V3UA 1OLUA 3ND8A 4M1YA 2ZLBA 4MGIR 1G18A 4PLWA 4PVCA 1FOEB 3TZQA 4B3JA 1BRMA 2VPYA 5FBHA 2I8CA 3P94A 1AX9A 4QPNA 4NTZA 4PGHA 4NVRA 4HP8A 3MCZA 1AKUA 1IB6A 1SC6A 2XQJA 3I04A 1PR0A 4IDOA 2IHYA 2J6IA 3IEVA 1A9SA 4E6PA 1P4RA 2FKAA 2QVLA 3SEZA 1FPMA 5FWXB 4AKIA 1E77A 3BMXA 1CUSA 4MAAA 4O29A 4TV9B 3AP1A 1Z8NA 1U3CA 1YR6A 4G2TA 2K4MA 4C3ZA 4DMFA 2ZUVA 3QKRA 4O33A 1J4AA 1C9NA 1Z6ZA 3HWX1 1PJ2A 4Q6WA 2K5UA 3JYOA 1NZDA 5EJ8A 3DW3X 5BXYA 4DMUB 1O8CA 4JWTA 4D80A 1T91A 3S8EA 1JIKA 5A0TA 1XDDA 4IG4A 4FOPA 3T9BA 1J2UA 3X1XA 1RZRD 1AUPA 1E61A 4LY3A 1YC2A 3DDHA 1CY4A 3SZRA 2R8RA 2HWUA 4M7OA 4PSUA 4EEKA 821PA 4LSMA 3H75A 2OO5A 3A8TA 3HDGA 4KR0A 4B2IA 1G8MA 2D3TA 1E1QD 2FPKA 4QPCA 3VR3A 3R5KA 1T3SA 1JXQA 3H7AA 5JNLA 3FVQA 5ALGA 3VVLA 3NDBB 2J9FA 1RIFA 5EWJB 1P9RA 2IY9A 3PPXA 2NTNA 2L0XA 1GTVA 1ZGAA 3OO0A 4LISA 5AW2A 4YRJA 1VXOA 4RPLA 1UKZA 3P96A 4IMPA 1Z0KA 1PV1A 4ZAXA 2JAUA 2XA9A 4DIDA 4YRBA 1E7MA 2AZ4A 3RUIA 2ZUDA 3CX4A 3ZDQA 2NZJA 1ULHA 2UYHA 4KITB 4QTTB 1JU3A 1M6HA 1O6GA 1A9TA 2ECKA 1E3QA 1JA9A 2H2WA 2JBAA 2V0CA 4LHWA 1K1EA 1OFGA 1FDTA 1ICEA 3K15A 1VHQA 3AR5A 4X92A 3ADBA 3CSUA 1XPRA 1O4VA 3R7BA 5ED0A 2V6BA 1GR0A 3PVCA 2VP9A 3KYDA 1WXXA 4DC9A 1QCCA 3DFZA 1L1RA 3N7UA 1DCKA 3B6KA 4IGEA 3CN7A 3R3YA 4K28A 4QYIB 3ROGA 3VPHA 1T2NA 5K2OA 2UXDB 4KDCA 4KRFA 1HLFA 4QO8A 3MTIA 3PFCA 5KNCH 2Q4BA 3GRAA 4I9FA 1C0IA 3R5HA 5HKKD 1I80A 3DLAA 4DR6B 1Y4DE 2KHZA 2ONYA 2OXRA 1XDZA 3BXHA 1T13A 2JAHA 4FLFA 3DE6X 1XEXB 4QG3A 1W4LA 3W8NA 4I7EA 2P3LA 4WXHA 5D51S 3HSKA 2ZJZA 4OB7A 4YPVA 2OVBA 3DEJA 2QZ9A 1JBQA 4FWBA 5FYQA 2LCIA 1UP4A 2FP4B 2R6DA 3HCBA 3MSXA 1XZKA 3E1SA 3HVUA 3KDAA 2O7QA 4WLEA 4QM6A 1T1GA 4A7PA 4RACA 1SHJA 2RGNA 2I55A 4TRRA 1DKOA 1Y6QA 3PXXA 3L9XA 3L04A 2ZIWB 4TSKA 1JI3A 3ZZUA 1LK0A 5JSZA 1GFIA 4GDMA 2XVXA 4UHBA 2ORYA 2WFLA 3F3SA 4GYKA 4AO7A 1QP8A 1PF7E 3GLKA 3AM3A 5TC4A 1WUYA 3NOXA 3TTTA 1Z33A 1SXIA 2AJBA 4PYMA 3HDVA 2BY4A 3ZJVA 3R3WA 3R6LA 2FI1A 2VNJA 2C8VA 4RA6B 1IVYA 1M1XB 1U2RA 1W4RA 3BMCB 3H9UA 4ARSA 4YRZA 1XZMA 3WJ2A 1YAJA 2C2MA 4BLVA 1FVFA 3BGVA 1OKKA 4OKSA 4RK4A 2P90A 2QU8A 4ZYUA 1F38A 1WSAA 2PWAA 3DB1A 5E0OA 2MSLA 5E1BA 5CITA 4DDVA 5KHOC 1RJWA 2NMVA 2NTVA 3FYDA 5BMVB 1RPAA 5COAA 5JI3E 3TVTA 4R81A 4ZI7A 3GAZA 3G59A 1OIWA 1C4KA 2X8LA 3BJMA 2PX5A 1RR6A 1EQAA 1PHPA 3O0DA 3MWYW 1KAQA 3K0CC 1QYDA 3BHMA 1K92A 3DKKA 3FSGA 5CJJA 2AZXA 2CDBA 2VNSA 2B78A 1IAVA 2H9YA 3GMDA 1Z5UA 3C5HA 1R0XA 2ZSIA 1AUXA 2Q3FA 3IURA 4NU8X 1H23A 1SXPA 5DBEX 4XQCA 3WS7A 1ZP6A 2ZBPA 1RYYA 4B71A 2HSDA 2PX4A 2AD5A 3FSEA 5E2BA 5M2QA 4HXGA 3E15A 3O4HA 4BC1A 2PGIA 3WBKA 1Q0PA 1UIRA 3O90A 2PKCA 2RJOA 4N3NA 5E9AA 1TJPB 1ZFNA 3CGWA 3KYBA 3PEYA 1WLYA 4OSEA 1J8FA 4NAUA 3IPCA 4HWTA 2QXYA 4GGPA 1W581 3A05A 2EF1A 1NBOA 1FMFA 1V25A 3PB3A 4K9DA 3JRNA 2X7HA 2XWBF 2ZAIA 4IS2A 1A95A 1GTG1 4F86A 4KQJA 2VL7A 3QJYA 3UG6A 4BIIA 2DVMA 3LCUA 4EG7A 2HYDA 3JY6A 1HYEA 1O3YA 2W2KB 1R4MB 4NFHA 2G72A 1SBNE 1H22A 2HIGA 2OV8A 3TINA 2FVXA 4RDCA 4AUEA 5A04A 5BN1A 2PSJA 2WAAA 5LD2B 1V3QE 2DQYA 1G6KA 4UEOA 1Z0FA 5I7UA 4W5RA 4BO5A 1LD3A 1YDGA 1FUYB 4K6CA 3WGJA 2NP6A 1F6DA 3OZFA 3CNOA 3NAMA 4DIUA 2B5OA 1MQ8B 5C7OO 5MGBA 4WLVA 5B2FA 3IJ5A 1OD6A 5CH3A 3GUVA 3QEMB 4ID3A 3SHWA 1JQEA 3UMGA 3HHEA 3R5JA 3JQ9C 3HXQA 4MKRA 3GFOA 5EMHA 4EJMA 4DSNA 5JJIA 1QC5A 2CXUA 3MN1A 4DB4A 2V6JA 1XBTA 3FGOA 4S1PA 4ZGBA 3C74A 3IIIA 1UKVY 2DUUA 1GSOA 1DEOA 2NT3A 2CLHB 1HQYE 2NVOA 2XUPA 2CYAA 2YQ5A 3O8DA 4MLPA 1TIBA 1LDEA 4JB2A 3T4XA 1QFXA 3D3QA 4YI3A 4R9UC 2G4LA 3P4XA 4PC3A 3RHSA 3T3GA 2D3WA 2HIAA 4J3JA 2A3RA 3LI2A 4OHZA 4QWWA 4WADA 2E82A 2PYZA 1GV1A 2P7IA 4D0SA 1CDOA 3DT6A 1KWGA 4IIHA 1X1QA 2ZYUX 4IDCA 5LYJB 1Z2EA 1IJBA 3OEYA 1V95A 1MX1A 3BRWA 3OEWA 1I7NA 3CJTA 4QE3A 2TS1A 2VP3A 5LM3A 4H6VA 4M8NE 4RD6A 3A3OA 4C0SA 1W5EA 3AGQA 4EY5A 3R9XB 1V8ZA 4JFAA 5FTLA 3ASUA 1J9EA 4AJJA 4RA9A 3K8QA 4R1UA 1MIOB 4TZTA 3TG8A 1M1YA 4RCVA 1GZUA 2OCKA 3B38A 4LJ9A 4AXXA 2GZ1A 5DRYA 2DWPA 4YASA 1KYYA 4OXIA 2SCUB 2JD1A 3G1TA 3ICVA 5AOCA 3RH0A 4GKJB 4H60A 1MVOA 1RIIA 2JGDB 3AF3A 3FKSD 3LE8A 1I8TA 5E0KB 2WVGA 1J8YF 1LXCA 1US8B 2G5CA 4Z4FA 1VIYA 3TZ6A 3EMVA 1KRHA 1DKUA 1K6EA 1WB4A 3EULA 2EV9A 2W8BA 4NH0A 5IT5A 4IDEA 2DF8A 3NUZA 3WGLA 3O8QA 1TO1E 4D9HA 1RQLA 1JIIA 2AI3A 2Q8NA 5E6SB 3QLUC 4GFDA 4B5LA 1RLUA 3KQPA 5ICGA 4A3SA 5CIYA 1WTCA 5LIRA 4UEKA 3BZUA 1BEEA 5KX5B 4Z9YA 2YJTD 4KRYA 4ATNA 3DGFC 4PX3A 2IYPA 2C8JA 3LCMA 2GYWA 4G4IA 1XTBA 4KTVE 3J80A 2PIDA 1FB5A 4FZRA 3U4CA 3DONA 1K08A 1MEEA 3LX4A 2CMDA 3QXCA 4MR9A 3RI3A 1E4VA 3TS1A 1E66A 1EP3B 2ZGVA 4PZ9A 1R5BA 3AW9A 2G9UA 4E0BA 2YV5A 6ADHA 3BSSA 4ZCLA 2B4RO 1YHYA 3AJ9A 3UZUA 3ZCTA 4KO2S 5TSDA 3ETNA 5CDHA 1FNMA 2HPVA 2B36A 2YWHA 3VR5D 1QC5B 1GOTA 1ZXXA 2OXCA 1TCAA 3ZDXB 3N6RA 1FFWA 2PQ6A 3ZW8A 2OBNA 4ZHSA 5JCZA 4YCJA 5HTOA 1IZYA 3BMQB 5AESA 3D6JA 3MMPA 4OBBA 5FJIA 5LDHA 1NXSA 1DJOA 1B14A 2C98A 5INTA 1GDTA 1TAHA 1HLPA 3GOHA 3KLMX 2X9GA 4R54A 2PZLA 3KALA 3WB1A 1O1YA 2EJCA 2ZI3A 3EIOA 4U7TB 3W2TA 4M8LA 2EFEB 1G5FA 1W75A 1KDZA 1YAHA 4IXWA 1NBIA 1U65A 1XD2A 3B6ZA 4TKZA 3WGOA 4H1UA 1Q1EA 4MWZA 4S35A 3QK7A 5JLJA 3CLUD 4KR9A 2OV1A 3SOPA 5HM6A 2ATXA 1QJ4A 2IZ7A 3ZH2A 3M83A 1PNVA 2BKEA 4LN1A 5DK6A 5C80A 2H8KA 3ZXYA 1CVIA 3TJMA 1Q0HA 1EVQA 5THXA 4Q03A 2H0RA 3DBRB 2O2DA 3GN2A 3VDQA 2W2LD 1V37A 5JJCA 1D04A 3BSWA 4CPDA 4O4IB 5K1ZA 3NDIA 4REOA 2DHCA 2QN9A 1ZAKA 3DDCA 3E9ZA 2XE8A 3AB7A 3RTCA 1DEXA 2F64A 3UAWA 3U2QA 4JI7B 2WVAA 2YZ7A 4O4HF 4ZOAA 2PEYA 5FUVA 1FPQA 1RU3A 4CM7A 3DEYX 1YUBA 2CNDA 2GZSA 3I9NA 1C2TA 4QYXA 4MGEA 2NZWA 5IBRA 4HSEA 3I2IA 4DJEC 1BJTA 2FPRA 4XGIA 1B73A 3T3EA 1GCGA 3CWQA 2AH5A 2FK7A 4JJIA 5EP4A 5JVDB 3NHPA 5CIQA 1OI2A 2QQGA 1DQYA 2DM6A 1IONA 3H5OA 2VDVE 4MLDA 4KO1S 1BFKA 3CQ9A 4EW1A 4K0KB 2X8JA 3H83A 3OM8A 5D86A 5CPBA 5JUWA 1TZCA 3S8MA 3ZEIA 4X44A 3T9FA 3KEFA 1W34A 2AN3A 1UL1X 3MWFA 3ZY6A 4FHCA 2A0KA 3DBHB 3G2OA 1R8SA 5DM0A 3TFWA 1TUEA 1TK3A 4C3UA 1DELA 1TM3E 1Z5ZA 3CINA 3HBNA 5IM4A 5JDCA 2O1EA 3KJEA 3DD1A 1THZA 3ORQA 5L3QA 3KBBA 1MOQA 4QRDA 4WGGA 1SG0A 2DU8A 1U9YA 1R5JA 4JB3A 3RIMA 4U7GA 3TQIA 3V1MA 5K03A 2AG8A 4YUVA 1YVRA 5M29A 1EUQA 5A5DA 3IAUA 4POAA 4ZK6A 4C0QC 4DM4A 4MWEA 4K2HA 2LRHA 1B74A 1J5PA 1F8YA 1CUFA 2VDNB 3EG5A 4OHFA 4Z9AA 5AOAA 4C03A 1ZGBA 1AO3A 4MS4A 2P6MA 1DC6A 2GN4A 4M1ZA 3STUA 3VOAA 3ZYCA 2BKLA 2VYVA 3C0KA 3AYXB 2IOFK 5A4IS 1G7CA 1SQ5A 5ARCA 4V0KA 1B0PA 1FXWA 1FQKA 1Z5WA 2RH5A 1UT8A 1P4SA 3OM1A 2GCPA 1II8A 1KTVA 2CXPA 3O1JC 4RH1A 5K0CA 4L3VA 5JIBA 2GPWA 5TIIA 2AMJA 1JQAA 2WKRA 3V8MA 4RM3A 4G56A 4FGZA 3SNKA 1DWQA 3NXKA 1V6CA 4TTAA 5T57A 3TLKA 5C5CA 5FPPA 3SM3A 8GPBA 3U7QA 4DMHA 4O4LB 2R60A 2QRQA 1Q0ZA 3HCEA 4AX4A 4P0PB 1JEJA 4C4YA 3BQ9A 1K6IA 3EGXA 5BN3A 4XM0A 4RIFA 2X2EA 3N74A 2IBTA 2V7TA 4NZ9A 1FRFS 3EOBI 5BYAA 2PUEA 1M2FA 4CMHA 1KZ6A 2W00A 4AXBA 2R7MA 4RE6A 3H0CA 1MP0A 2CD7A 4Y2TA 3V9AA 1I4LD 3DO6A 4A0QA 2ZT7A 5CNIA 1Y81A 3KEMA 1FP6A 4U7JA 4F6CA 1XVTA 2FSVC 1BO6A 4QFCA 4U5XA 2WM2A 5EKTA 1N6HA 2GNOA 4GLLA 3TQQA 1JL3A 4TM8A 4EKDA 4UFOA 1LS1A 2E55A 4YLEA 1J0AA 3OPYA 1CETA 1WY5A 2PPVA