3LDWA

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase pvx_092040 with zoledronate and ipp bound
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
363
structure length
358
Chain Sequence
LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKNRINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYLDIFGDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase
publication title Molecular characterization of a novel geranylgeranyl pyrophosphate synthase from Plasmodium parasites.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 151
structure length 358
sequence length 363
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ldwA00
3WCLA 2Q58A 4H5DF 1N1BA 5JV1F 3LGZB 5IM1A 2Z4VA 5AFXA 4RXCA 5B0IA 1N24A 1UBYA 3Q30A 5DZ2A 3N1WF 1N22A 4GAXA 2E8UA 4HD1A 4P0VA 3KB9A 3LG5A 2J1PA 4JZXA 4F62A 3AQBB 4OKZA 5CG5A 4KPJA 5IK9A 1WL1A 2DH4A 1YYQA 5DJVF 3RMGA 5EASA 3LJIA 2VF6A 3WCDA 3BNXA 5EAUA 5HN8A 4LTZA 4KWDA 3RYEA 4KQ5A 3KRFB 5CG6A 4LIXA 1RQJA 3OABA 1VG6A 5ILYA 3ICMA 3S9VA 1HM7A 3WCJA 2E93A 4LZ0A 2Z4ZA 3ICZA 3VJAA 1N20A 4XQSF 3P8RA 5AHUB 2ZCSA 5B0MA 3SDVA 4OMHA 3VJ9A 3ZOUA 3WCMA 1VG4A 5JUZF 3N0GA 1RTRA 3Q2QA 2AETA 4KK2A 3ID0A 2E8VA 2AZJA 5JV2F 1EZFA 4LA5A 5DHKA 3AQCB 5IK6A 2I19A 4NFKF 2Z7IA 3OYRA 4EA0A 3WEHA 4OKMA 3LLWA 3ZCDA 5DGSF 2E95A 3APZA 3TC1A 1N1ZA 2PS7A 4LA6A 4LFEA 5IKHA 4KKMA 2ZCRA 2E91A 4WK5A 4KPDA 5DW7A 3P5RA 3QKCA 5E8HA 3DYHA 3WJOA 3G4DA 4NG6A 3N46F 2OPMA 1YJ4A 4KVWA 2F94F 3N5HF 4LFGA 5IMPA 2RAHA 3V66A 3P41A 3RYWA 2Z4XA 2E90A 2O1OA 3PH7A 3WCGA 3M02A 3LVSA 1WL2A 3ADZA 1WY0A 4E9UA 4KVIA 3LK5A 3ICKA 3OABB 4UMJA 5IKAA 5A0KA 5B0KA 5B0LA 3SDUA 1VG2A 2Z50A 3ICNA 3LZ9A 3N49F 1YV5A 3KRCA 3VJ8A 4RXEA 2P1CA 3KRAB 2FORA 1YHMA 5HNAA 3EFQA 4OMGA 1UBVA 3KROA 4DHDA 4JVJF 4KVYA 1WKZA 1WL0A 1FPSA 3ZMCA 3IPIA 5JV0F 5ILZA 3KRPA 4LPHF 3NPRA 3EGTA 5JA0F 3PYBA 3CKEA 4LXWA 2E94A 3ZL6A 3ASXA 5HN7A 2ZY1A 4DEMF 1JFGA 2E8TA 2PS5A 3V1XA 1YHLA 2AZLA 3WEIA 2OPNA 2ONGA 2Q9ZA 4LZ3A 4DXJA 1UBXA 4MC8A 4LPGF 3UCAA 5ERNA 1UBWA 3PKOA 5IL3A 5IVGA 2AZKA 2OA6A 2Z52A 5DIQF 3EZ3A 3WSAA 3MZVA 3LGKA 3M00A 5E8KA 3PYAA 4RXDA 5IN8A 5A0JA 4EA1A 5DJRF 1V4EA 3M9UA 3P8LA 4QPFA 4DWGA 3N6KF 4NKEA 3WEKA 5DGNF 1YYTA 4GP1A 1V4HA 3WCHA 4KFAA 2EWGA 3WEGA 4PVXF 5IK0A 3N3LF 3WCIA 3LEEA 2OGDA 5KSXF 4H5CF 3ACWA 3WE9A 3KROB 3N45F 3TFNA 5H9DA 3WCFA 4MC3A 3MAVA 3BNYA 2AELA 4LFVF 3KRPB 5A0IA 4RYPA 3WJNA 1DGPA 3VJDA 5ER8A 3LSNA 2F9KF 2ZEUA 1KIZA 4LLSA 4JXNA 2AEKA 2E4OA 4H5EF 3TFPA 1V4JA 3SDRA 3SDTA 3N0FA 3IBAA 3S4JA 3M0GA 1WL3A 5B02A 3NRIA 5EROA 2ZCQA 4F6VA 3W7FA 5C05A 3CP6A 3N1VF 3NPKA 3SAEA 5IL8A 4NKFA 2ZCOA 4P0WA 1WMWA 3WCBA 4KQUA 2Z78A 5B01A 4RXAA 3G4FA 2Q9YA 3LMDA 3TFVA 3TS7A 4LZCA 2F8ZF 3WEJA 5ILHA 4N9UA 1RQIA 2E8XA 2Q80A 5AYPA 2E8WA 5DGMF 4GP2A 2ZEVA 2E92A 4LUUA 3WCCA 4L2XF 3VJCA 4K10A 2F7MF 5ILDA 1YYUA 3N3DA 2F8CF 1V4KA 1N21A 4LTVA 4F6XA 3WCAA 2FTZA 4DI5A 3RBMA 4MC0A 2F92F 5AELA 3Q2ZA 3ACYA 4XQRF 5B0JA 3NF2A 5DHIA 5IMNA 3KBKA 4OGUA 5B03A 1YHKA 3AQ0A 4LOBA 3N5JF 2J1OA 4KQSA 4GA3A 3OACA 3KRCB 3KRAA 2H8OA 3QQVA 4KUXA 1N23A 1YYRA 3AE0A 5ILJA 3Q1OA 4EA2A 2J5CA 1YYSA 1HXAA 5ERMA 2Z7HA 3CC9A 4QXSF 1HM4A 4JYXA 4DZWA 4E9ZA 1KIYA 4PVYF 3ACXA 3SDQA 4KVDA 4NUAA 5I1UA 2ONHA 2F89F 4FP4A 3M01A 5DJPF 3WEFA 3DYGA 3VJEA 2Z4YA 2QISA 4ZQ8A 3LDWA 1VG3A 3DYFA 2PS6A 3WJKA 4E1EA 1YQ7A 5IMIA 3KRFA 4P0XA 5HN9A 2PS8A 3P5PA 1ZW5A 3ZMBA 4FJQA 1V4IA 4NFIF 4RNQA 3WSBA 2Z4WA 4NFJF 1HX9A 4JXYA 3LOMA 4LLTA 5E8LA 4Q23A 3V1VA 5B00A 3VJBA 5ILIA 3PDEA 1DI1A 4DWBA 2PS4A 1HXCA 1JFAA 5EATA 4N1ZF 1VG7A 4XQTF 4JZBA 3WC9A 3B7LA 1HXGA 5ILKA 3WCEA 1PS1A 3OACB
chains in the Genus database with same CATH superfamily
3WCLA 2Q58A 4H5DF 1N1BA 5JV1F 3LGZB 5IM1A 2Z4VA 5AFXA 4RXCA 5B0IA 1N24A 1UBYA 3Q30A 5DZ2A 3N1WF 1N22A 4GAXA 2E8UA 4HD1A 4P0VA 3KB9A 3LG5A 2J1PA 4JZXA 4F62A 3AQBB 4OKZA 5CG5A 4KPJA 5IK9A 1WL1A 2DH4A 1YYQA 5DJVF 3RMGA 5EASA 3LJIA 2VF6A 3WCDA 3BNXA 5EAUA 5HN8A 4LTZA 4KWDA 3RYEA 4KQ5A 3KRFB 5CG6A 4LIXA 1RQJA 3OABA 1VG6A 5ILYA 3ICMA 3S9VA 1HM7A 3WCJA 2E93A 4LZ0A 2Z4ZA 3ICZA 3VJAA 1N20A 4XQSF 3P8RA 5AHUB 2ZCSA 5B0MA 3SDVA 4OMHA 3VJ9A 3ZOUA 3WCMA 1VG4A 5JUZF 3N0GA 1RTRA 3Q2QA 2AETA 4KK2A 3ID0A 2E8VA 2AZJA 5JV2F 1EZFA 4LA5A 5DHKA 3AQCB 5IK6A 2I19A 4NFKF 2Z7IA 3OYRA 4EA0A 3WEHA 4OKMA 3LLWA 3ZCDA 5DGSF 2E95A 3APZA 3TC1A 1N1ZA 2PS7A 4LA6A 4LFEA 5IKHA 4KKMA 2ZCRA 2E91A 4WK5A 4KPDA 5DW7A 3P5RA 3QKCA 5E8HA 3DYHA 3WJOA 3G4DA 4NG6A 3N46F 2OPMA 1YJ4A 4KVWA 2F94F 3N5HF 4LFGA 5IMPA 2RAHA 3V66A 3P41A 3RYWA 2Z4XA 2E90A 2O1OA 3PH7A 3WCGA 3M02A 3LVSA 1WL2A 3ADZA 1WY0A 4E9UA 4KVIA 3LK5A 3ICKA 3OABB 4UMJA 5IKAA 5A0KA 5B0KA 5B0LA 3SDUA 1VG2A 2Z50A 3ICNA 3LZ9A 3N49F 1YV5A 3KRCA 3VJ8A 4RXEA 2P1CA 3KRAB 2FORA 1YHMA 5HNAA 3EFQA 4OMGA 1UBVA 3KROA 4DHDA 4JVJF 4KVYA 1WKZA 1WL0A 1FPSA 3ZMCA 3IPIA 5JV0F 5ILZA 3KRPA 4LPHF 3NPRA 3EGTA 5JA0F 3PYBA 3CKEA 4LXWA 2E94A 3ZL6A 3ASXA 5HN7A 2ZY1A 4DEMF 1JFGA 2E8TA 2PS5A 3V1XA 1YHLA 2AZLA 3WEIA 2OPNA 2ONGA 2Q9ZA 4LZ3A 4DXJA 1UBXA 4MC8A 4LPGF 3UCAA 5ERNA 1UBWA 3PKOA 5IL3A 5IVGA 2AZKA 2OA6A 2Z52A 5DIQF 3EZ3A 3WSAA 3MZVA 3LGKA 3M00A 5E8KA 3PYAA 4RXDA 5IN8A 5A0JA 4EA1A 5DJRF 1V4EA 3M9UA 3P8LA 4QPFA 4DWGA 3N6KF 4NKEA 3WEKA 5DGNF 1YYTA 4GP1A 1V4HA 3WCHA 4KFAA 2EWGA 3WEGA 4PVXF 5IK0A 3N3LF 3WCIA 3LEEA 2OGDA 5KSXF 4H5CF 3ACWA 3WE9A 3KROB 3N45F 3TFNA 5H9DA 3WCFA 4MC3A 3MAVA 3BNYA 2AELA 4LFVF 3KRPB 5A0IA 4RYPA 3WJNA 1DGPA 3VJDA 5ER8A 3LSNA 2F9KF 2ZEUA 1KIZA 4LLSA 4JXNA 2AEKA 2E4OA 4H5EF 3TFPA 1V4JA 3SDRA 3SDTA 3N0FA 3IBAA 3S4JA 3M0GA 1WL3A 5B02A 3NRIA 5EROA 2ZCQA 4F6VA 3W7FA 5C05A 3CP6A 3N1VF 3NPKA 3SAEA 5IL8A 4NKFA 2ZCOA 4P0WA 1WMWA 3WCBA 4KQUA 2Z78A 5B01A 4RXAA 3G4FA 2Q9YA 3LMDA 3TFVA 3TS7A 4LZCA 2F8ZF 3WEJA 5ILHA 4N9UA 1RQIA 2E8XA 2Q80A 5AYPA 2E8WA 5DGMF 4GP2A 2ZEVA 2E92A 4LUUA 3WCCA 4L2XF 3VJCA 4K10A 2F7MF 5ILDA 1YYUA 3N3DA 2F8CF 1V4KA 1N21A 4LTVA 4F6XA 3WCAA 2FTZA 4DI5A 3RBMA 4MC0A 2F92F 5AELA 3Q2ZA 3ACYA 4XQRF 5B0JA 3NF2A 5DHIA 5IMNA 3KBKA 4OGUA 5B03A 1YHKA 3AQ0A 4LOBA 3N5JF 2J1OA 4KQSA 4GA3A 3OACA 3KRCB 3KRAA 2H8OA 3QQVA 4KUXA 1N23A 1YYRA 3AE0A 5ILJA 3Q1OA 4EA2A 2J5CA 1YYSA 1HXAA 5ERMA 2Z7HA 3CC9A 4QXSF 1HM4A 4JYXA 4DZWA 4E9ZA 1KIYA 4PVYF 3ACXA 3SDQA 4KVDA 4NUAA 5I1UA 2ONHA 2F89F 4FP4A 3M01A 5DJPF 3WEFA 3DYGA 3VJEA 2Z4YA 2QISA 4ZQ8A 3LDWA 1VG3A 3DYFA 2PS6A 3WJKA 4E1EA 1YQ7A 5IMIA 3KRFA 4P0XA 5HN9A 2PS8A 3P5PA 1ZW5A 3ZMBA 4FJQA 1V4IA 4NFIF 4RNQA 3WSBA 2Z4WA 4NFJF 1HX9A 4JXYA 3LOMA 4LLTA 5E8LA 4Q23A 3V1VA 5B00A 3VJBA 5ILIA 3PDEA 1DI1A 4DWBA 2PS4A 1HXCA 1JFAA 5EATA 4N1ZF 1VG7A 4XQTF 4JZBA 3WC9A 3B7LA 1HXGA 5ILKA 3WCEA 1PS1A 3OACB
chains in the Genus database with same CATH topology
3WCLA 2Q58A 4H5DF 1N1BA 5JV1F 3LGZB 5IM1A 2Z4VA 5AFXA 4RXCA 5B0IA 1N24A 1UBYA 3Q30A 5DZ2A 3N1WF 1N22A 4GAXA 2E8UA 4HD1A 4P0VA 3KB9A 3LG5A 2J1PA 4JZXA 4F62A 3AQBB 4OKZA 5CG5A 4KPJA 5IK9A 1WL1A 2DH4A 1YYQA 5DJVF 3RMGA 5EASA 3LJIA 2VF6A 3WCDA 3BNXA 5EAUA 5HN8A 4LTZA 4KWDA 3RYEA 4KQ5A 3KRFB 5CG6A 4LIXA 1RQJA 3OABA 1VG6A 5ILYA 3ICMA 3S9VA 1HM7A 3WCJA 2E93A 4LZ0A 2Z4ZA 3ICZA 3VJAA 1N20A 4XQSF 3P8RA 5AHUB 2ZCSA 5B0MA 3SDVA 4OMHA 3VJ9A 3ZOUA 3WCMA 1VG4A 5JUZF 3N0GA 1RTRA 3Q2QA 2AETA 4KK2A 3ID0A 2E8VA 2AZJA 5JV2F 1EZFA 4LA5A 5DHKA 3AQCB 5IK6A 2I19A 4NFKF 2Z7IA 3OYRA 4EA0A 3WEHA 4OKMA 3LLWA 3ZCDA 5DGSF 2E95A 3APZA 3TC1A 1N1ZA 2PS7A 4LA6A 4LFEA 5IKHA 4KKMA 2ZCRA 2E91A 4WK5A 4KPDA 5DW7A 3P5RA 3QKCA 5E8HA 3DYHA 3WJOA 3G4DA 4NG6A 3N46F 2OPMA 1YJ4A 4KVWA 2F94F 3N5HF 4LFGA 5IMPA 2RAHA 3V66A 3P41A 3RYWA 2Z4XA 2E90A 2O1OA 3PH7A 3WCGA 3M02A 3LVSA 1WL2A 3ADZA 1WY0A 4E9UA 4KVIA 3LK5A 3ICKA 3OABB 4UMJA 5IKAA 5A0KA 5B0KA 5B0LA 3SDUA 1VG2A 2Z50A 3ICNA 3LZ9A 3N49F 1YV5A 3KRCA 3VJ8A 4RXEA 2P1CA 3KRAB 2FORA 1YHMA 5HNAA 3EFQA 4OMGA 1UBVA 3KROA 4DHDA 4JVJF 4KVYA 1WKZA 1WL0A 1FPSA 3ZMCA 3IPIA 5JV0F 5ILZA 3KRPA 4LPHF 3NPRA 3EGTA 5JA0F 3PYBA 3CKEA 4LXWA 2E94A 3ZL6A 3ASXA 5HN7A 2ZY1A 4DEMF 1JFGA 2E8TA 2PS5A 3V1XA 1YHLA 2AZLA 3WEIA 2OPNA 2ONGA 2Q9ZA 4LZ3A 4DXJA 1UBXA 4MC8A 4LPGF 3UCAA 5ERNA 1UBWA 3PKOA 5IL3A 5IVGA 2AZKA 2OA6A 2Z52A 5DIQF 3EZ3A 3WSAA 3MZVA 3LGKA 3M00A 5E8KA 3PYAA 4RXDA 5IN8A 5A0JA 4EA1A 5DJRF 1V4EA 3M9UA 3P8LA 4QPFA 4DWGA 3N6KF 4NKEA 3WEKA 5DGNF 1YYTA 4GP1A 1V4HA 3WCHA 4KFAA 2EWGA 3WEGA 4PVXF 5IK0A 3N3LF 3WCIA 3LEEA 2OGDA 5KSXF 4H5CF 3ACWA 3WE9A 3KROB 3N45F 3TFNA 5H9DA 3WCFA 4MC3A 3MAVA 3BNYA 2AELA 4LFVF 3KRPB 5A0IA 4RYPA 3WJNA 1DGPA 3VJDA 5ER8A 3LSNA 2F9KF 2ZEUA 1KIZA 4LLSA 4JXNA 2AEKA 2E4OA 4H5EF 3TFPA 1V4JA 3SDRA 3SDTA 3N0FA 3IBAA 3S4JA 3M0GA 1WL3A 5B02A 3NRIA 5EROA 2ZCQA 4F6VA 3W7FA 5C05A 3CP6A 3N1VF 3NPKA 3SAEA 5IL8A 4NKFA 2ZCOA 4P0WA 1WMWA 3WCBA 4KQUA 2Z78A 5B01A 4RXAA 3G4FA 2Q9YA 3LMDA 3TFVA 3TS7A 4LZCA 2F8ZF 3WEJA 5ILHA 4N9UA 1RQIA 2E8XA 2Q80A 5AYPA 2E8WA 5DGMF 4GP2A 2ZEVA 2E92A 4LUUA 3WCCA 4L2XF 3VJCA 4K10A 2F7MF 5ILDA 1YYUA 3N3DA 2F8CF 1V4KA 1N21A 4LTVA 4F6XA 3WCAA 2FTZA 4DI5A 3RBMA 4MC0A 2F92F 5AELA 3Q2ZA 3ACYA 4XQRF 5B0JA 3NF2A 5DHIA 5IMNA 3KBKA 4OGUA 5B03A 1YHKA 3AQ0A 4LOBA 3N5JF 2J1OA 4KQSA 4GA3A 3OACA 3KRCB 3KRAA 2H8OA 3QQVA 4KUXA 1N23A 1YYRA 3AE0A 5ILJA 3Q1OA 4EA2A 2J5CA 1YYSA 1HXAA 5ERMA 2Z7HA 3CC9A 4QXSF 1HM4A 4JYXA 4DZWA 4E9ZA 1KIYA 4PVYF 3ACXA 3SDQA 4KVDA 4NUAA 5I1UA 2ONHA 2F89F 4FP4A 3M01A 5DJPF 3WEFA 3DYGA 3VJEA 2Z4YA 2QISA 4ZQ8A 3LDWA 1VG3A 3DYFA 2PS6A 3WJKA 4E1EA 1YQ7A 5IMIA 3KRFA 4P0XA 5HN9A 2PS8A 3P5PA 1ZW5A 3ZMBA 4FJQA 1V4IA 4NFIF 4RNQA 3WSBA 2Z4WA 4NFJF 1HX9A 4JXYA 3LOMA 4LLTA 5E8LA 4Q23A 3V1VA 5B00A 3VJBA 5ILIA 3PDEA 1DI1A 4DWBA 2PS4A 1HXCA 1JFAA 5EATA 4N1ZF 1VG7A 4XQTF 4JZBA 3WC9A 3B7LA 1HXGA 5ILKA 3WCEA 1PS1A 3OACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCL A;  2Q58 A;  4H5D F;  1N1B A;  5JV1 F;  3LGZ B;  5IM1 A;  2Z4V A;  5AFX A;  4RXC A;  5B0I A;  1N24 A;  1UBY A;  3Q30 A;  5DZ2 A;  3N1W F;  1N22 A;  4GAX A;  2E8U A;  4HD1 A;  4P0V A;  3KB9 A;  3LG5 A;  2J1P A;  4JZX A;  4F62 A;  3AQB B;  4OKZ A;  5CG5 A;  4KPJ A;  5IK9 A;  1WL1 A;  2DH4 A;  1YYQ A;  5DJV F;  3RMG A;  5EAS A;  3LJI A;  2VF6 A;  3WCD A;  3BNX A;  5EAU A;  5HN8 A;  4LTZ A;  4KWD A;  3RYE A;  4KQ5 A;  3KRF B;  5CG6 A;  4LIX A;  1RQJ A;  3OAB A;  1VG6 A;  5ILY A;  3ICM A;  3S9V A;  1HM7 A;  3WCJ A;  2E93 A;  4LZ0 A;  2Z4Z A;  3ICZ A;  3VJA A;  1N20 A;  4XQS F;  3P8R A;  5AHU B;  2ZCS A;  5B0M A;  3SDV A;  4OMH A;  3VJ9 A;  3ZOU A;  3WCM A;  1VG4 A;  5JUZ F;  3N0G A;  1RTR A;  3Q2Q A;  2AET A;  4KK2 A;  3ID0 A;  2E8V A;  2AZJ A;  5JV2 F;  1EZF A;  4LA5 A;  5DHK A;  3AQC B;  5IK6 A;  2I19 A;  4NFK F;  2Z7I A;  3OYR A;  4EA0 A;  3WEH A;  4OKM A;  3LLW A;  3ZCD A;  5DGS F;  2E95 A;  3APZ A;  3TC1 A;  1N1Z A;  2PS7 A;  4LA6 A;  4LFE A;  5IKH A;  4KKM A;  2ZCR A;  2E91 A;  4WK5 A;  4KPD A;  5DW7 A;  3P5R A;  3QKC A;  5E8H A;  3DYH A;  3WJO A;  3G4D A;  4NG6 A;  3N46 F;  2OPM A;  1YJ4 A;  4KVW A;  2F94 F;  3N5H F;  4LFG A;  5IMP A;  2RAH A;  3V66 A;  3P41 A;  3RYW A;  2Z4X A;  2E90 A;  2O1O A;  3PH7 A;  3WCG A;  3M02 A;  3LVS A;  1WL2 A;  3ADZ A;  1WY0 A;  4E9U A;  4KVI A;  3LK5 A;  3ICK A;  3OAB B;  4UMJ A;  5IKA A;  5A0K A;  5B0K A;  5B0L A;  3SDU A;  1VG2 A;  2Z50 A;  3ICN A;  3LZ9 A;  3N49 F;  1YV5 A;  3KRC A;  3VJ8 A;  4RXE A;  2P1C A;  3KRA B;  2FOR A;  1YHM A;  5HNA A;  3EFQ A;  4OMG A;  1UBV A;  3KRO A;  4DHD A;  4JVJ F;  4KVY A;  1WKZ A;  1WL0 A;  1FPS A;  3ZMC A;  3IPI A;  5JV0 F;  5ILZ A;  3KRP A;  4LPH F;  3NPR A;  3EGT A;  5JA0 F;  3PYB A;  3CKE A;  4LXW A;  2E94 A;  3ZL6 A;  3ASX A;  5HN7 A;  2ZY1 A;  4DEM F;  1JFG A;  2E8T A;  2PS5 A;  3V1X A;  1YHL A;  2AZL A;  3WEI A;  2OPN A;  2ONG A;  2Q9Z A;  4LZ3 A;  4DXJ A;  1UBX A;  4MC8 A;  4LPG F;  3UCA A;  5ERN A;  1UBW A;  3PKO A;  5IL3 A;  5IVG A;  2AZK A;  2OA6 A;  2Z52 A;  5DIQ F;  3EZ3 A;  3WSA A;  3MZV A;  3LGK A;  3M00 A;  5E8K A;  3PYA A;  4RXD A;  5IN8 A;  5A0J A;  4EA1 A;  5DJR F;  1V4E A;  3M9U A;  3P8L A;  4QPF A;  4DWG A;  3N6K F;  4NKE A;  3WEK A;  5DGN F;  1YYT A;  4GP1 A;  1V4H A;  3WCH A;  4KFA A;  2EWG A;  3WEG A;  4PVX F;  5IK0 A;  3N3L F;  3WCI A;  3LEE A;  2OGD A;  5KSX F;  4H5C F;  3ACW A;  3WE9 A;  3KRO B;  3N45 F;  3TFN A;  5H9D A;  3WCF A;  4MC3 A;  3MAV A;  3BNY A;  2AEL A;  4LFV F;  3KRP B;  5A0I A;  4RYP A;  3WJN A;  1DGP A;  3VJD A;  5ER8 A;  3LSN A;  2F9K F;  2ZEU A;  1KIZ A;  4LLS A;  4JXN A;  2AEK A;  2E4O A;  4H5E F;  3TFP A;  1V4J A;  3SDR A;  3SDT A;  3N0F A;  3IBA A;  3S4J A;  3M0G A;  1WL3 A;  5B02 A;  3NRI A;  5ERO A;  2ZCQ A;  4F6V A;  3W7F A;  5C05 A;  3CP6 A;  3N1V F;  3NPK A;  3SAE A;  5IL8 A;  4NKF A;  2ZCO A;  4P0W A;  1WMW A;  3WCB A;  4KQU A;  2Z78 A;  5B01 A;  4RXA A;  3G4F A;  2Q9Y A;  3LMD A;  3TFV A;  3TS7 A;  4LZC A;  2F8Z F;  3WEJ A;  5ILH A;  4N9U A;  1RQI A;  2E8X A;  2Q80 A;  5AYP A;  2E8W A;  5DGM F;  4GP2 A;  2ZEV A;  2E92 A;  4LUU A;  3WCC A;  4L2X F;  3VJC A;  4K10 A;  2F7M F;  5ILD A;  1YYU A;  3N3D A;  2F8C F;  1V4K A;  1N21 A;  4LTV A;  4F6X A;  3WCA A;  2FTZ A;  4DI5 A;  3RBM A;  4MC0 A;  2F92 F;  5AEL A;  3Q2Z A;  3ACY A;  4XQR F;  5B0J A;  3NF2 A;  5DHI A;  5IMN A;  3KBK A;  4OGU A;  5B03 A;  1YHK A;  3AQ0 A;  4LOB A;  3N5J F;  2J1O A;  4KQS A;  4GA3 A;  3OAC A;  3KRC B;  3KRA A;  2H8O A;  3QQV A;  4KUX A;  1N23 A;  1YYR A;  3AE0 A;  5ILJ A;  3Q1O A;  4EA2 A;  2J5C A;  1YYS A;  1HXA A;  5ERM A;  2Z7H A;  3CC9 A;  4QXS F;  1HM4 A;  4JYX A;  4DZW A;  4E9Z A;  1KIY A;  4PVY F;  3ACX A;  3SDQ A;  4KVD A;  4NUA A;  5I1U A;  2ONH A;  2F89 F;  4FP4 A;  3M01 A;  5DJP F;  3WEF A;  3DYG A;  3VJE A;  2Z4Y A;  2QIS A;  4ZQ8 A;  3LDW A;  1VG3 A;  3DYF A;  2PS6 A;  3WJK A;  4E1E A;  1YQ7 A;  5IMI A;  3KRF A;  4P0X A;  5HN9 A;  2PS8 A;  3P5P A;  1ZW5 A;  3ZMB A;  4FJQ A;  1V4I A;  4NFI F;  4RNQ A;  3WSB A;  2Z4W A;  4NFJ F;  1HX9 A;  4JXY A;  3LOM A;  4LLT A;  5E8L A;  4Q23 A;  3V1V A;  5B00 A;  3VJB A;  5ILI A;  3PDE A;  1DI1 A;  4DWB A;  2PS4 A;  1HXC A;  1JFA A;  5EAT A;  4N1Z F;  1VG7 A;  4XQT F;  4JZB A;  3WC9 A;  3B7L A;  1HXG A;  5ILK A;  3WCE A;  1PS1 A;  3OAC B; 
#chains in the Genus database with same CATH topology
 3WCL A;  2Q58 A;  4H5D F;  1N1B A;  5JV1 F;  3LGZ B;  5IM1 A;  2Z4V A;  5AFX A;  4RXC A;  5B0I A;  1N24 A;  1UBY A;  3Q30 A;  5DZ2 A;  3N1W F;  1N22 A;  4GAX A;  2E8U A;  4HD1 A;  4P0V A;  3KB9 A;  3LG5 A;  2J1P A;  4JZX A;  4F62 A;  3AQB B;  4OKZ A;  5CG5 A;  4KPJ A;  5IK9 A;  1WL1 A;  2DH4 A;  1YYQ A;  5DJV F;  3RMG A;  5EAS A;  3LJI A;  2VF6 A;  3WCD A;  3BNX A;  5EAU A;  5HN8 A;  4LTZ A;  4KWD A;  3RYE A;  4KQ5 A;  3KRF B;  5CG6 A;  4LIX A;  1RQJ A;  3OAB A;  1VG6 A;  5ILY A;  3ICM A;  3S9V A;  1HM7 A;  3WCJ A;  2E93 A;  4LZ0 A;  2Z4Z A;  3ICZ A;  3VJA A;  1N20 A;  4XQS F;  3P8R A;  5AHU B;  2ZCS A;  5B0M A;  3SDV A;  4OMH A;  3VJ9 A;  3ZOU A;  3WCM A;  1VG4 A;  5JUZ F;  3N0G A;  1RTR A;  3Q2Q A;  2AET A;  4KK2 A;  3ID0 A;  2E8V A;  2AZJ A;  5JV2 F;  1EZF A;  4LA5 A;  5DHK A;  3AQC B;  5IK6 A;  2I19 A;  4NFK F;  2Z7I A;  3OYR A;  4EA0 A;  3WEH A;  4OKM A;  3LLW A;  3ZCD A;  5DGS F;  2E95 A;  3APZ A;  3TC1 A;  1N1Z A;  2PS7 A;  4LA6 A;  4LFE A;  5IKH A;  4KKM A;  2ZCR A;  2E91 A;  4WK5 A;  4KPD A;  5DW7 A;  3P5R A;  3QKC A;  5E8H A;  3DYH A;  3WJO A;  3G4D A;  4NG6 A;  3N46 F;  2OPM A;  1YJ4 A;  4KVW A;  2F94 F;  3N5H F;  4LFG A;  5IMP A;  2RAH A;  3V66 A;  3P41 A;  3RYW A;  2Z4X A;  2E90 A;  2O1O A;  3PH7 A;  3WCG A;  3M02 A;  3LVS A;  1WL2 A;  3ADZ A;  1WY0 A;  4E9U A;  4KVI A;  3LK5 A;  3ICK A;  3OAB B;  4UMJ A;  5IKA A;  5A0K A;  5B0K A;  5B0L A;  3SDU A;  1VG2 A;  2Z50 A;  3ICN A;  3LZ9 A;  3N49 F;  1YV5 A;  3KRC A;  3VJ8 A;  4RXE A;  2P1C A;  3KRA B;  2FOR A;  1YHM A;  5HNA A;  3EFQ A;  4OMG A;  1UBV A;  3KRO A;  4DHD A;  4JVJ F;  4KVY A;  1WKZ A;  1WL0 A;  1FPS A;  3ZMC A;  3IPI A;  5JV0 F;  5ILZ A;  3KRP A;  4LPH F;  3NPR A;  3EGT A;  5JA0 F;  3PYB A;  3CKE A;  4LXW A;  2E94 A;  3ZL6 A;  3ASX A;  5HN7 A;  2ZY1 A;  4DEM F;  1JFG A;  2E8T A;  2PS5 A;  3V1X A;  1YHL A;  2AZL A;  3WEI A;  2OPN A;  2ONG A;  2Q9Z A;  4LZ3 A;  4DXJ A;  1UBX A;  4MC8 A;  4LPG F;  3UCA A;  5ERN A;  1UBW A;  3PKO A;  5IL3 A;  5IVG A;  2AZK A;  2OA6 A;  2Z52 A;  5DIQ F;  3EZ3 A;  3WSA A;  3MZV A;  3LGK A;  3M00 A;  5E8K A;  3PYA A;  4RXD A;  5IN8 A;  5A0J A;  4EA1 A;  5DJR F;  1V4E A;  3M9U A;  3P8L A;  4QPF A;  4DWG A;  3N6K F;  4NKE A;  3WEK A;  5DGN F;  1YYT A;  4GP1 A;  1V4H A;  3WCH A;  4KFA A;  2EWG A;  3WEG A;  4PVX F;  5IK0 A;  3N3L F;  3WCI A;  3LEE A;  2OGD A;  5KSX F;  4H5C F;  3ACW A;  3WE9 A;  3KRO B;  3N45 F;  3TFN A;  5H9D A;  3WCF A;  4MC3 A;  3MAV A;  3BNY A;  2AEL A;  4LFV F;  3KRP B;  5A0I A;  4RYP A;  3WJN A;  1DGP A;  3VJD A;  5ER8 A;  3LSN A;  2F9K F;  2ZEU A;  1KIZ A;  4LLS A;  4JXN A;  2AEK A;  2E4O A;  4H5E F;  3TFP A;  1V4J A;  3SDR A;  3SDT A;  3N0F A;  3IBA A;  3S4J A;  3M0G A;  1WL3 A;  5B02 A;  3NRI A;  5ERO A;  2ZCQ A;  4F6V A;  3W7F A;  5C05 A;  3CP6 A;  3N1V F;  3NPK A;  3SAE A;  5IL8 A;  4NKF A;  2ZCO A;  4P0W A;  1WMW A;  3WCB A;  4KQU A;  2Z78 A;  5B01 A;  4RXA A;  3G4F A;  2Q9Y A;  3LMD A;  3TFV A;  3TS7 A;  4LZC A;  2F8Z F;  3WEJ A;  5ILH A;  4N9U A;  1RQI A;  2E8X A;  2Q80 A;  5AYP A;  2E8W A;  5DGM F;  4GP2 A;  2ZEV A;  2E92 A;  4LUU A;  3WCC A;  4L2X F;  3VJC A;  4K10 A;  2F7M F;  5ILD A;  1YYU A;  3N3D A;  2F8C F;  1V4K A;  1N21 A;  4LTV A;  4F6X A;  3WCA A;  2FTZ A;  4DI5 A;  3RBM A;  4MC0 A;  2F92 F;  5AEL A;  3Q2Z A;  3ACY A;  4XQR F;  5B0J A;  3NF2 A;  5DHI A;  5IMN A;  3KBK A;  4OGU A;  5B03 A;  1YHK A;  3AQ0 A;  4LOB A;  3N5J F;  2J1O A;  4KQS A;  4GA3 A;  3OAC A;  3KRC B;  3KRA A;  2H8O A;  3QQV A;  4KUX A;  1N23 A;  1YYR A;  3AE0 A;  5ILJ A;  3Q1O A;  4EA2 A;  2J5C A;  1YYS A;  1HXA A;  5ERM A;  2Z7H A;  3CC9 A;  4QXS F;  1HM4 A;  4JYX A;  4DZW A;  4E9Z A;  1KIY A;  4PVY F;  3ACX A;  3SDQ A;  4KVD A;  4NUA A;  5I1U A;  2ONH A;  2F89 F;  4FP4 A;  3M01 A;  5DJP F;  3WEF A;  3DYG A;  3VJE A;  2Z4Y A;  2QIS A;  4ZQ8 A;  3LDW A;  1VG3 A;  3DYF A;  2PS6 A;  3WJK A;  4E1E A;  1YQ7 A;  5IMI A;  3KRF A;  4P0X A;  5HN9 A;  2PS8 A;  3P5P A;  1ZW5 A;  3ZMB A;  4FJQ A;  1V4I A;  4NFI F;  4RNQ A;  3WSB A;  2Z4W A;  4NFJ F;  1HX9 A;  4JXY A;  3LOM A;  4LLT A;  5E8L A;  4Q23 A;  3V1V A;  5B00 A;  3VJB A;  5ILI A;  3PDE A;  1DI1 A;  4DWB A;  2PS4 A;  1HXC A;  1JFA A;  5EAT A;  4N1Z F;  1VG7 A;  4XQT F;  4JZB A;  3WC9 A;  3B7L A;  1HXG A;  5ILK A;  3WCE A;  1PS1 A;  3OAC B; 
#chains in the Genus database with same CATH homology
 3WCL A;  2Q58 A;  4H5D F;  1N1B A;  5JV1 F;  3LGZ B;  5IM1 A;  2Z4V A;  5AFX A;  4RXC A;  5B0I A;  1N24 A;  1UBY A;  3Q30 A;  5DZ2 A;  3N1W F;  1N22 A;  4GAX A;  2E8U A;  4HD1 A;  4P0V A;  3KB9 A;  3LG5 A;  2J1P A;  4JZX A;  4F62 A;  3AQB B;  4OKZ A;  5CG5 A;  4KPJ A;  5IK9 A;  1WL1 A;  2DH4 A;  1YYQ A;  5DJV F;  3RMG A;  5EAS A;  3LJI A;  2VF6 A;  3WCD A;  3BNX A;  5EAU A;  5HN8 A;  4LTZ A;  4KWD A;  3RYE A;  4KQ5 A;  3KRF B;  5CG6 A;  4LIX A;  1RQJ A;  3OAB A;  1VG6 A;  5ILY A;  3ICM A;  3S9V A;  1HM7 A;  3WCJ A;  2E93 A;  4LZ0 A;  2Z4Z A;  3ICZ A;  3VJA A;  1N20 A;  4XQS F;  3P8R A;  5AHU B;  2ZCS A;  5B0M A;  3SDV A;  4OMH A;  3VJ9 A;  3ZOU A;  3WCM A;  1VG4 A;  5JUZ F;  3N0G A;  1RTR A;  3Q2Q A;  2AET A;  4KK2 A;  3ID0 A;  2E8V A;  2AZJ A;  5JV2 F;  1EZF A;  4LA5 A;  5DHK A;  3AQC B;  5IK6 A;  2I19 A;  4NFK F;  2Z7I A;  3OYR A;  4EA0 A;  3WEH A;  4OKM A;  3LLW A;  3ZCD A;  5DGS F;  2E95 A;  3APZ A;  3TC1 A;  1N1Z A;  2PS7 A;  4LA6 A;  4LFE A;  5IKH A;  4KKM A;  2ZCR A;  2E91 A;  4WK5 A;  4KPD A;  5DW7 A;  3P5R A;  3QKC A;  5E8H A;  3DYH A;  3WJO A;  3G4D A;  4NG6 A;  3N46 F;  2OPM A;  1YJ4 A;  4KVW A;  2F94 F;  3N5H F;  4LFG A;  5IMP A;  2RAH A;  3V66 A;  3P41 A;  3RYW A;  2Z4X A;  2E90 A;  2O1O A;  3PH7 A;  3WCG A;  3M02 A;  3LVS A;  1WL2 A;  3ADZ A;  1WY0 A;  4E9U A;  4KVI A;  3LK5 A;  3ICK A;  3OAB B;  4UMJ A;  5IKA A;  5A0K A;  5B0K A;  5B0L A;  3SDU A;  1VG2 A;  2Z50 A;  3ICN A;  3LZ9 A;  3N49 F;  1YV5 A;  3KRC A;  3VJ8 A;  4RXE A;  2P1C A;  3KRA B;  2FOR A;  1YHM A;  5HNA A;  3EFQ A;  4OMG A;  1UBV A;  3KRO A;  4DHD A;  4JVJ F;  4KVY A;  1WKZ A;  1WL0 A;  1FPS A;  3ZMC A;  3IPI A;  5JV0 F;  5ILZ A;  3KRP A;  4LPH F;  3NPR A;  3EGT A;  5JA0 F;  3PYB A;  3CKE A;  4LXW A;  2E94 A;  3ZL6 A;  3ASX A;  5HN7 A;  2ZY1 A;  4DEM F;  1JFG A;  2E8T A;  2PS5 A;  3V1X A;  1YHL A;  2AZL A;  3WEI A;  2OPN A;  2ONG A;  2Q9Z A;  4LZ3 A;  4DXJ A;  1UBX A;  4MC8 A;  4LPG F;  3UCA A;  5ERN A;  1UBW A;  3PKO A;  5IL3 A;  5IVG A;  2AZK A;  2OA6 A;  2Z52 A;  5DIQ F;  3EZ3 A;  3WSA A;  3MZV A;  3LGK A;  3M00 A;  5E8K A;  3PYA A;  4RXD A;  5IN8 A;  5A0J A;  4EA1 A;  5DJR F;  1V4E A;  3M9U A;  3P8L A;  4QPF A;  4DWG A;  3N6K F;  4NKE A;  3WEK A;  5DGN F;  1YYT A;  4GP1 A;  1V4H A;  3WCH A;  4KFA A;  2EWG A;  3WEG A;  4PVX F;  5IK0 A;  3N3L F;  3WCI A;  3LEE A;  2OGD A;  5KSX F;  4H5C F;  3ACW A;  3WE9 A;  3KRO B;  3N45 F;  3TFN A;  5H9D A;  3WCF A;  4MC3 A;  3MAV A;  3BNY A;  2AEL A;  4LFV F;  3KRP B;  5A0I A;  4RYP A;  3WJN A;  1DGP A;  3VJD A;  5ER8 A;  3LSN A;  2F9K F;  2ZEU A;  1KIZ A;  4LLS A;  4JXN A;  2AEK A;  2E4O A;  4H5E F;  3TFP A;  1V4J A;  3SDR A;  3SDT A;  3N0F A;  3IBA A;  3S4J A;  3M0G A;  1WL3 A;  5B02 A;  3NRI A;  5ERO A;  2ZCQ A;  4F6V A;  3W7F A;  5C05 A;  3CP6 A;  3N1V F;  3NPK A;  3SAE A;  5IL8 A;  4NKF A;  2ZCO A;  4P0W A;  1WMW A;  3WCB A;  4KQU A;  2Z78 A;  5B01 A;  4RXA A;  3G4F A;  2Q9Y A;  3LMD A;  3TFV A;  3TS7 A;  4LZC A;  2F8Z F;  3WEJ A;  5ILH A;  4N9U A;  1RQI A;  2E8X A;  2Q80 A;  5AYP A;  2E8W A;  5DGM F;  4GP2 A;  2ZEV A;  2E92 A;  4LUU A;  3WCC A;  4L2X F;  3VJC A;  4K10 A;  2F7M F;  5ILD A;  1YYU A;  3N3D A;  2F8C F;  1V4K A;  1N21 A;  4LTV A;  4F6X A;  3WCA A;  2FTZ A;  4DI5 A;  3RBM A;  4MC0 A;  2F92 F;  5AEL A;  3Q2Z A;  3ACY A;  4XQR F;  5B0J A;  3NF2 A;  5DHI A;  5IMN A;  3KBK A;  4OGU A;  5B03 A;  1YHK A;  3AQ0 A;  4LOB A;  3N5J F;  2J1O A;  4KQS A;  4GA3 A;  3OAC A;  3KRC B;  3KRA A;  2H8O A;  3QQV A;  4KUX A;  1N23 A;  1YYR A;  3AE0 A;  5ILJ A;  3Q1O A;  4EA2 A;  2J5C A;  1YYS A;  1HXA A;  5ERM A;  2Z7H A;  3CC9 A;  4QXS F;  1HM4 A;  4JYX A;  4DZW A;  4E9Z A;  1KIY A;  4PVY F;  3ACX A;  3SDQ A;  4KVD A;  4NUA A;  5I1U A;  2ONH A;  2F89 F;  4FP4 A;  3M01 A;  5DJP F;  3WEF A;  3DYG A;  3VJE A;  2Z4Y A;  2QIS A;  4ZQ8 A;  3LDW A;  1VG3 A;  3DYF A;  2PS6 A;  3WJK A;  4E1E A;  1YQ7 A;  5IMI A;  3KRF A;  4P0X A;  5HN9 A;  2PS8 A;  3P5P A;  1ZW5 A;  3ZMB A;  4FJQ A;  1V4I A;  4NFI F;  4RNQ A;  3WSB A;  2Z4W A;  4NFJ F;  1HX9 A;  4JXY A;  3LOM A;  4LLT A;  5E8L A;  4Q23 A;  3V1V A;  5B00 A;  3VJB A;  5ILI A;  3PDE A;  1DI1 A;  4DWB A;  2PS4 A;  1HXC A;  1JFA A;  5EAT A;  4N1Z F;  1VG7 A;  4XQT F;  4JZB A;  3WC9 A;  3B7L A;  1HXG A;  5ILK A;  3WCE A;  1PS1 A;  3OAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...