3LEKA

Lectin domain of lectinolysin complexed with lewis b antigen
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
b'VETENIARGKQASQSSTAYGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet aggregation factor Sm-hPAF
publication title Structure of the lectin regulatory domain of the cholesterol-dependent cytolysin lectinolysin reveals the basis for its lewis antigen specificity.
pubmed doi rcsb
source organism Streptococcus mitis
molecule tags Blood clotting
total genus 39
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3lekA00
3VD3A 3VD9A 1O8SA 2VZPA 3ABZA 4OZOA 2J1VA 5DMYA 5HPOA 5JXGA 2OKXA 3NQHA 4QDSA 3MBWA 3JXSA 5JXHA 2YC2A 4QX1A 4BK4A 4DUXA 2B9VA 2WN3A 4AAXA 2VC9A 5EJ1B 2VQUA 5IFPA 2VMDA 2XQXA 3WNPA 3T0BA 3VD5A 2ID4A 4FI9A 3C7OA 4ZZ5A 1JZ7A 1WKYA 4GWJA 3LQCA 3ECQA 3NJXA 4A45A 4DUWA 3SEEA 4PF1A 1NX9A 4LKSA 2WYSA 2E32A 2YFUA 3U37A 1JYWA 2L9LA 2W87A 3I3DA 3CIHA 2KD7A 1W9SA 1O59A 4BK5A 4ZZ8A 3GXUA 5JMOA 2J1TA 1XC6A 1US3A 3PUHA 2C9KA 3OEBA 1HN1A 2VQTA 2W46A 3HNMA 4QX0A 4M4RA 2Y6GA 5C71A 3CZJA 3ETPA 5HXMA 1K42A 3C8XA 2EICA 2RVAA 2Y6LA 3SKVA 1W8NA 2V72A 4JKMA 2J1SA 5EIYB 3DYPA 1TG7A 2JD9A 3I2IA 4ZY9A 1GMMA 5LA1A 3F2ZA 1H6XA 2BZDA 3MV01 4CU8A 3E1F1 3WSOA 1DP0A 4DEVA 1YQ2A 1JZ3A 1UWWA 2VZQA 1UY0A 4BXSV 1CX1A 2WN2A 2W94A 4UOJA 1GU3A 4W4ZA 4HG6B 4CU7A 3HPNA 3THDA 1JZ5A 2XHNA 1JU4A 4GZ9A 2WABA 3OGSA 1OH4A 3I3EA 3T0DA 2V5DA 2ORXA 1GUIA 4ZXEA 4CUBA 5G05L 4XUPA 1WCQA 3SKJE 4QAWA 1GOGA 1JI6A 1DYOA 1T2XA 2J1RA 3A7QA 2QQIA 1CZVA 1L7QA 2XONA 5A1AA 4A4AA 2BBAA 1J83A 1UY3A 4A41A 1O8PA 1W8OA 4XURA 4JHZA 2VZVA 2DCJA 4DUVA 1SG3A 2CDOA 4E8DA 4DXSA 3WF3A 2J1UA 2YFZA 1GOHA 1XNTA 1UXZA 2VZ1A 4BDVB 5B4NA 4QPWA 1JU3A 3K4DA 3MUZ1 1CZTA 1I5PA 4QB2A 1UX7A 2YC4A 5C7GA 1ULPA 1SHWB 5IJRA 3I97A 4QX2A 2X09A 3FN9A 5LA2A 2VJXA 4AG4A 4E8CA 1XNAA 5F7UA 3GGLA 3VDAA 3LPFA 4QDRA 2VCAA 4DEQA 4IUGA 1D7PM 1UY1A 4MO3M 1GNYA 4OMCA 4KMQA 4XUOA 5JXJA 1UXXX 3T0AA 4P02B 4XUQA 3UNPA 2R7EB 2VM9A 4M4PA 3LEIA 2Y6HA 1P8JA 1OT5A 3DYOA 1K45A 2W1WA 3D3AA 3WEZA 1L7RA 5IHRA 1W9TA 4GWIA 4ET7A 1US2A 2WO1A 5JUVA 1KEXA 4MGQA 5LA0A 2W3JA 2VZ3A 4LHSA 1W99A 2E33A 2W95A 3C7FA 1GOFA 3CQOA 2WQ8A 1JHJA 1XPWA 2Z4FA 5DN2A 2QQJA 1MPXA 2VZTA 3HJRA 2BGPA 3A23A 3WQBA 4QB6A 1EUTA 1UY4A 2J1AA 3DECA 3W5MA 5LCWL 3BN6A 3VDBA 2WZ8A 1PX4A 2HLEA 2VTFA 4YPJA 5J1XA 3IB3A 2W47A 2YB7A 4RN5A 2ZXQA 4XUNA 2E26A 3OG2A 4TXWA 2J7MA 4L0PA 4P08A 5G04L 3UESA 3VD4A 1DLCA 5B4XA 1UYXA 3AC0A 3T08A 2W5FA 2VOTA 5DPNA 2VZOA 3T2PA 3ACHA 3FHQA 3MUY1 4OMDA 3K46A 2RV9A 3CDZB 4OUEA 2WUHA 3T2QA 3WF2A 4A3ZA 2Y6JA 1UYYA 3HNBM 2JE8A 3CZUA 1F4AA 3WF4A 3I2HA 2E31A 2QQKA 1CIYA 4PQQA 1JZ8A 4PT6A 4CU9A 2QQMA 1J84A 1NAEA 3LPGA 4TTGA 3C7GA 4XVHA 4P5YA 5CYYA 3UETA 4QB1A 4QX3A 2W9XA 1H6YA 4CUCA 3ACGA 4DXTA 4MGSA 3OEAA 4D0QA 1PX3A 1KGYA 1JYVA 4KI5M 4XUTA 2ORZA 1R64A 2BERA 1UMIA 1NUKA 5DQ0A 3MO4A 2W91A 3HN3A 3OB8A 4QDQA 3T2OA 2J1EA 3NNGA 3WF0A 3I2FA 2J22A 4JKLA 5FUIA 1UYZA 2VCBA 2Y64A 3GDBA 2EIEA 2PQSA 1UY2A 3P1IA 3THCA 1UZ0A 2VL4A 2C26A 3FHAA 4A42A 1LNSA 3ACIA 2EIDA 2JKXA 1EUUA 3IIIA 3LEKA 4D8MA 4RYDA 5JR2A 2B4KA 3NRUA 3OBAA 2Y6KA 4KWUA 4UI9L 3A22A 1JZ4A 2ZEWA 5EJZB 1OD3A 2VO5A 3CMGA 3ZM8A 4LPLA 2W1UA 1OF4A 2C4XA 4XZUG 2CDPA 3IAPA 1GQPA 2ZEXA 4CUAA 2DCKA 4DXRA 5C70A 5JXIA 2DDUA 2LW8A 2VZUA 3CKHA 2QQLA 1K3IA 1JZ6A 3K4AA 2VMCA 1IQDC 2WZEA 3DYMA 1JZ2A 2QQNA 4W8JA 2VR4A 3OGVA 3HOBA 3OGRA 1CZSA 3I3BA 2VZSA 4OYUA 3PUIA 2WO2A 4BJ0A 1BHGA 2W92A 2X10A 3K77A 2VMFA 3I2JA 5IFTA 4JX0A 1UMHA 3EB7A 4P00B 3I2KA 2RJ2A 1JYNA 3MV11 3J7HA 3BGAA 3IDAA 3HNYM 3K75B 4Z2AA 3WNMA 2ZEZA 2Y8KA 5CZKA 3VDCA 4A6OA 1JYXA 4ARXA 3WNOA 3IAQA 4JKKA 2QQOA 2BGOA 1RYYA 2XOMA 1W0NA 3EYPA 3FL7A 2VMEA 4W50A 2HYXA 2LS6A 4MOAA 1F4HA 2W1SA 3WNKA 5I0DA 3LE0A 2W1QA 1PMJX 4CU6A 1OF3A 2JDAA 2WDBA 2WO3A 3GM8A 3ACFA 2WBKA 3VD7A 2VZRA 3LEGA 3NJVA 1NKGA 3HEIA 3T09A 3C7EA 3K4ZA 4MADA 3P6BA 1K12A 2YG0A 3C7HA 3WNNA 5IYYA 2V4VA 2QBXA 2VCCA 3I2GA 1PMHX 2WAOA 1ULOA 2ZEYA 4A44A 1SDDB 3A21A 1W9WA 3WF1A 2EIBA 4ARYA 4UAPA 1TVGA 4CVUA 3W5NA 4LQRA 2X05A 3WNLA 2WAAA 3SEPA
chains in the Genus database with same CATH superfamily
3LEMA 3VD3A 3VD9A 5A3OA 2RR13 2Y0IA 4XAAA 2RMU2 1JUIA 2WFF3 1EV12 3WR0A 5JXGA 4FPCA 4CCJA 3BTZA 1OA4A 5FCCA 3VBRC 1FX5A 3NQHA 1RUI2 2IFRA 4XYXA 3JXSA 2JICA 4EN7B 5GZEA 1ZREA 3U0ZA 2HJIA 4AI3A 2WN3A 4AAXA 1W2NA 4B8EA 4RS5C 1HXS2 2KXLA 3PVBB 2SLIA 3WP3A 4AHWA 1W2OA 5FWEA 1D4VB 4LXLA 5BXXA 4UFLA 4LR4A 2BBVA 3LWCA 4ZZ5A 2ZGLA 1U5XA 5L9BA 4K21A 1B35A 1JZ7A 4MXWB 3A0KA 4K7JA 4YZ1A 3LQCA 2ADDA 3V0BA 1NLQA 3IPVA 5DUXA 1HJFA 3LDBA 1NX9A 2RDSA 4IV3C 2R30A 2WYSA 2YFUA 1JYIA 3HR9A 1LODA 2LALA 5I93A 2VUAA 1KFUL 3M3CA 3OBTA 2BNNA 4H3WA 1NXMA 3HBZA 4LLFA 4ONUA 3E6DA 4Q4W2 1VRBA 1LOFA 5F5AA 3PUSA 4Q29A 3S7IA 5K0UC 5J96B 3RZLA 2ZGQA 5JMOA 3GXUA 2XWBB 1OURA 1XC6A 1VBC3 2RM22 1M4WA 3AMPA 2D7FA 2HWC3 1IG3A 5IAVA 5DAWA 2F17A 3MIFA 3ZR5A 4CCKA 4XQDA 5FYYA 3ES4A 2WNUB 3MPBA 2I2SA 5ABJA 4QX0A 2DV9A 1KQRA 2P1BA 3MW2A 3ZIWA 4V2VA 1RUF2 1DQ2A 1N1VA 4D7SA 3C8XA 4FPYA 4COYA 3ELNA 4M3CF 4YM0A 4BCUA 1CONA 3BIWE 3VBHB 1LOEA 3H7YA 2R062 5A7SA 5BNQA 5I0SA 3ZYBA 2V72A 1UU6A 3GZEA 1E5HA 2YPDA 3BOPA 1GSLA 5EIYB 4LBLA 3PIGA 2KR2A 3MPPG 4H55A 2HYKA 4QX8A 2ZGKA 1I9RA 2E63A 1CJDA 3NV4A 3MV01 1OFNA 3E1F1 3NAPB 4UFIA 1C57A 3ZYGA 2R32A 3S5AA 1R083 1QOOA 5JIAA 1AR91 4LK7A 2O14A 3G7DA 2QDNA 4TYSA 1DQ6A 5C4WB 2ENRA 3CO2A 4D6RA 1UY0A 2EF6A 1K5JA 3WXPA 2CU5A 4CDUB 2FDKA 2R1DA 1H2KA 2WZR3 4B4RA 2W94A 1IS5A 1GU3A 5JWPA 1FPN3 3ST7A 1W2TA 3IMMA 4MHUA 3IM0A 1STMA 1JU4A 4R8HA 4I0AA 1Y4WA 4UFKA 3VBUB 1X8MA 3I3EA 2V5DA 3ZDVA 3T0DA 1LKNA 4Q4X2 5FYBA 2Y38A 4ZXEA 5G05L 4NO4A 1AR83 1QNYA 4Y1XA 4NHKA 4BHPA 1H8TC 1S0CA 3RNSA 4AFCA 3DPRC 4AF9A 5IK8A 1ZRCA 5FWJA 1GOGA 2ERFA 2AEZA 1IPSA 1DYOA 2DBIA 3B93A 5HCAA 2YDEA 2DUQA 1ND3C 2LROA 1DYKA 5FV3A 5L7OC 1L7QA 2QQWA 4IGOA 2XONA 2HEWF 3MF9A 3V65A 3RSJA 2CY6A 2YV8A 5A3MA 4P14A 3UK9A 2PHTA 4XTPA 2BBAA 2GNTA 3ZIXA 2OVUA 3FFQA 4EN9B 1W8OA 2NLRA 4E4SA 2A3YA 4QPIC 4DUVA 5C3QA 1V9U3 4M0NA 4UXAA 4NVPA 4FPEA 1ZBE3 2J1UA 4UF0A 3RYKA 2R043 4PI0A 1CAUB 5B4NA 1JU3A 1BQPA 1HJGA 2FDFA 4QB2A 4PDWA 5FZ7A 5GJ6A 5FZ0A 4HKOA 2ZHMA 4URTA 3UJOA 2V09A 1S0EA 3MLLA 4AR2A 1Q8QA 3ME2A 1RGSA 3WUCA 3MHZA 2EAKA 1TMF2 3QH7A 5A3NA 3O1PA 3I97A 5DAXA 3FBMA 4QHZA 4GH4B 4MXWA 3AJZA 4I0WB 4XMAA 4Y1VA 5FPZA 5LATA 3BU7A 4QKDA 2UYAA 4V2WA 3D0JA 2ETEA 3ETQA 1XNAA 3INAA 4E8CA 3IN9A 3B7MA 4B7EA 5F7UA 3GGLA 2JDMA 2PLV2 2CTVA 1NCRC 4QDRA 2VCAA 4DEQA 1VMHA 3PUAA 1F31A 3LDRA 5KHHA 3RZHA 3AKQA 3HBKA 4DRRA 1UY1A 2HWC2 2XJRA 4KMQA 4YZ2A 1OOPA 1VE0A 1S2KA 2LTNA 5FY1A 5JXJA 2CWMA 3WP6A 3NV2A 4ZU7A 3D82A 3UNPA 2OXBA 5FZLA 1FV2A 1F8VA 3O1RA 2PA7A 1PIV1 1FYUA 3LEIA 4AVCA 2XBO1 3PURA 4BQ2A 1BVVA 1OT5A 3MYXA 3W20A 1PGW2 5FZGA 3LD8A 2GP3A 3ZFFB 3D3AA 4M3CB 1UU5A 3WY6A 1J1LA 5F9TA 1EP0A 2P5BA 1QJU1 3FHIB 4AEMA 4NIIA 5DUVA 1DG6A 1US2A 2GSYA 1JOJA 2MPFA 3QH6A 4N7IA 4NR1A 4LHSA 5LA0A 1W04A 3VBHA 3RYPA 5KXEA 3B00A 5CISA 3C7FA 5FZOA 2C0ZA 3AZZA 1YLLA 3AVSA 4O65A 1V6MA 1CX4A 5CNAA 2BFUL 4BM8A 1VJ2A 1XPWA 1DBNA 2Z4FA 3KGLA 3KQ4B 4IEZA 4AVSA 3VUOA 3NV1A 2ZAAA 3I49A 4AFBA 4AVTA 5HBAA 3DXUA 3CJIC 3HJRA 2BGPA 2F6BA 2ZS6B 3POYA 4FPLA 2ZAHA 3B5LB 1U0AA 4QB6A 3LSEA 1EUTA 3VBFB 2J1AA 1RUD2 1AYN3 1VRH1 1S0FA 2XVLA 4CCEA 5KHGA 3H8XA 3BTXA 3IKWA 4EN8B 5C4WA 5LCWL 2ATFA 3BN6A 1POV3 2OPWA 2WZ8A 1FAYA 2VVFA 2ZHKA 1H30A 4YPJA 4BLIA 4D3WA 1VP6A 5J1XA 5C33A 2K46A 5CBLA 4YGCA 2VW1A 4QXKA 4Y1UA 2ZXQA 2XXZA 2DYCA 1NOVA 3OG2A 3BPSA 2UYBA 2DCTA 2DTYA 4P08A 3WG3A 4NPRA 1XOYA 1ZBA1 2AACA 2PMWB 4Q1PA 4YW7A 5FMOL 4KWJA 5FP9A 4FTSA 3VBUA 3N9NA 2WR9A 1LGBA 4KGGA 3RDIA 3ZSEA 1AYM2 1QJY2 2PXJA 2VOTA 3H9AA 3QACA 1FOD3 1EAH1 1CESA 2HKXA 4HONA 2WZPP 2FCTA 1LHOA 3FHQA 1ZVFA 3MUY1 4OMDA 1AX0A 3AP7A 1H4GA 3K46A 2RV9A 2R0HA 2RG4A 4AOCA 3FLTA 3KVBA 1V00A 1G9CA 4OUEA 3RG0A 3VZJA 2Y6FA 2Z2SB 3T2QA 1N1TA 5GZFA 2QZ2A 3M4FA 4BIFA 1A78A 1O91A 4NIHA 1Q8PA 1OQEA 1HB2A 3HNBM 1V9U2 2P6CA 1ZA7A 4P9WA 5KBFA 1F4AA 2RMU1 1EV11 3I2HA 1DGWX 1UOBA 2WT1A 4DRVA 5C9AC 1QQP3 2EVXA 1RUI1 2CAVA 4R9BA 2DVFA 2VW2A 1GQGA 1C3HA 1Q3EA 1Q8OA 4HFSA 3GHMA 2ZOEB 3T3YA 2FDIA 3C7GA 1ULDA 3UETA 3NO8A 2WINB 4UWDA 3NKTA 4AZZA 3SCHA 2XL9A 5LASA 1HXS1 1CAUA 1AJKA 2W9XA 4N43C 5EP9A 2SBAA 4X8NA 2A3WA 3AZXA 2Q8OA 3ACGA 4DXTA 3ITQA 3OEAA 2Q8EA 2DUOA 2B9UA 5GLWA 1KGYA 1NCQA 2N7GA 4Y1YA 3HMYA 2B46X 4FAGA 2I45A 3WDUA 3ZXEA 1NE6A 1UU4A 2FDJA 2JG9C 1UMIA 5FPBA 4INDA 5DQ0A 3PVEA 5FZAA 3MO4A 3HN3A 4QDQA 2OT7A 1UIJA 1YQ5A 4Q4W1 1UPSA 3ATGA 1IPKA 3WD5A 1V6NA 4FAHA 3MI8A 4E2GA 5BNOB 3BKZA 1SBDA 1KDKA 1SBFA 2RM21 4N53C 2Y64A 4YW1A 2GMMA 1OXCA 5H9SA 5DZFA 4A3XA 1AUYA 4KGQA 1AR93 2JDHA 1VB2A 5EPAA 3VBRB 3MZHA 3IT8A 4BMBA 3DCQA 1UZ0A 1PK6A 4YVWB 1ACCA 4Q0QA 3ZFEA 5FXXA 5IVCA 3S0MA 1RUF1 3MGUA 2ZX4A 1DDLA 3FHAA 3PTRB 4K20A 4WVWA 1LULA 3TEYA 2QDRA 4RS5B 1SFPA 4AQTA 2R061 3IIIA 4LBNA 2NYYA 4RYDA 4GWNA 5JR2A 4XQ4A 2QE3A 1SCRA 2B5HA 2Y6KA 1KJRA 3D6EA 3OBAA 4KWUA 3AVRA 1SLCA 1ASJ3 3A22A 3AMHA 3K3OA 5L36A 1OHFA 1H0BA 3PTYA 1NXD1 1PZ7A 4IV3B 4LPLA 2CSGA 2TUNA 4OQ9A 2D93A 4MLOA 5FBJA 1XE0A 4S2HA 4XBQA 5JOWA 5F37A 4GJZA 4XZUG 2GP5A 2NQYA 3IAPA 4P5HA 4DNYA 2ZEXA 5J3UA 5K0UB 2ZA9A 4DXRA 2ZCWA 2E6VA 4L2NA 1HQNA 2O0OA 1BMV2 1REDA 1ENQA 1FOD2 3FUOA 2JD4A 1JZ6A 1JOBA 5HCFA 1OOPC 3TB0A 2QQNA 1URXA 2IZWA 4A7KA 4Q4X1 1CPMA 2QFEA 3I3BA 1MEC3 2YPJA 5K9YA 2C1FA 1F5FA 4LBQD 3USUA 2UURA 2NM1A 5DZGA 1BHGA 1WCSA 4XETA 5F5CA 4QKFA 4BH9A 3O1VA 1R1ZA 3N3HA 2XLAA 1CQ9A 3LCPA 1UMHA 1MQTC 1QDOA 1OSGA 1HRV3 2WKKA 3BVCA 3EB7A 3I2KA 4ASLA 1UD1A 3WVJA 1VB4A 3W59A 4AHZA 1CAVA 1QQP2 5FOBB 3N4MA 1SQ4A 4LUMA 5FJKA 3I54A 3ZO0B 1QIQA 4H2AA 3LIHA 4GALA 5GLZA 3T30A 1MZ5A 3H1MA 3BGAA 1W6MB 3DKQA 5F2WA 3CBNA 3RYRA 3I4IA 4HK8A 3VDDC 4Z2AA 5APAA 3JBG3 2ZEZA 5CZKA 4Y33A 3VDCA 2P3KA 4YM1A 3NNMA 2H0VA 3SNMA 3ZYJB 2VMGA 2UWBA 3WW2A 4E4ZA 1YQ8A 4JHTA 4X8PA 3WNOA 5FZ6A 2P6HA 5GLVA 3THPA 2NPIA 1LOBA 2GH8A 2BGOA 1RYYA 1PIV3 3N9QA 1BJQA 2JIGA 1E57A 1J1TA 3FL7A 5IVYA 4JZRA 1YRZA 1PM7A 3J8F2 1TMF1 5A3PA 5CFDC 4PJYA 3PL0A 4JDNA 2FZ2A 4SLIA 2IVJA 2G4IA 4J25A 2W1SA 1O4TA 1RMU3 2G19A 3J7MA 3BYWA 5ISLA 1DU3D 1VIWB 3VHNA 3ZYIB 4FT8A 2PLV1 2ZABA 1AR73 1VBD3 1OLQA 2A6YA 3B02A 3K3NA 3M1HA 3DPRB 3LFMA 4I3PA 1RUJ3 2DF7A 1OI6A 2VPVA 1GBGA 2AC1A 4TLFA 1MS8A 5CIRA 2HWC1 2QTWB 2YBPA 3IWZA 4WM8C 5FLHA 5L7OB 3V64A 1AR92 3VD7A 5IWFA 2BNOA 5A7QA 2WNVC 3NJVA 2VBBA 2AYHA 4GJYA 1RUNA 4YVSB 4HKWA 3T09A 4MADA 4CDXB 2BGCA 2XWJB 1G9AA 4IV1C 2YG0A 1PGW1 1APNA 1VRH3 4CRQA 3WNNA 2V4VA 1Y9QA 2EA7A 2VCCA 4AAPA 4EN0A 4BQ1A 3KHCA 3SCGA 2WAOA 1K5MC 2ZEYA 5A6QA 1QJEA 1Q5OA 1W9WA 4O7XA 3OUIA 4ARYA 3CNAA 2NN8A 4CVUA 5LY2A 2WSUA 2MHFA 2X05A 1YFXA 2YC0A 3VKNA 1ASJ2 4QU2A 5E88A 3U4SA 2D44A 5C8CA 3NJYA 4AEDB 1O8SA 2BVBA 1OPOA 1S2BA 3ABZA 4RGKA 2J1VA 4IEYA 1WW6A 1C5IA 4AW7A 3OPZA 2OKXA 1OBNA 2BFUS 4CEWC 4JRAA 1UIKA 4QPGB 4XABA 3KM5A 3MBWA 3OSDA 4HPKB 4YWAA 2ZACA 2YC2A 4JGYB 5J48A 4QX1A 1S0DA 2A6XA 3AL5A 2B9VA 1NCQC 2PQQA 4CP0A 3ZMNA 3ZYFA 2QJVA 3GALA 1F15A 1PVXA 3B9IA 1RUD1 4YZ3A 4BYYA 2XVKA 2JG8B 1ZZ6A 4TZDA 4NWVA 2JB4A 2XQXA 2A73B 4HVQA 3T0BA 1OKQA 4QGMA 3C7OA 2IXIA 2YU2A 2RMU3 3DGTA 3GBWA 1XYPA 3KCXA 5JVVA 5FO8B 1XSRA 5F2SA 1MEC2 4LOSA 1JS9A 2EIGA 3NJXA 5CVRA 4Y20B 4A45A 3VGIA 2DU0A 2VY0A 3KT4A 4LKSA 5FYZA 4XJWA 3SH5A 3VHOA 1AYM1 1QJY1 1DZRA 5KXDA 4AI2A 1IS3A 1A6CA 4LITA 1HRV2 2ILMA 1HXS3 5C5UA 4YW2A 1U12A 1PK6C 2Z79A 3NVCA 2BVVA 2E51A 4K40A 5FZ8A 1KS5A 4ZZ8A 2B7YA 5CEHA 1VPHA 4JGYA 4ES8A 5JCTA 2RS32 1HRI3 1W39A 2WLPA 1UKGA 3OEBA 4HOOA 1V9U1 3EQEA 3JBG2 1F2NA 1HN1A 3S5QA 2ES3A 2W46A 3HNMA 1CAXB 3AXEA 4JQRA 4M4RA 4V1PA 2WO7A 4EV0A 1RXGA 1VAKA 5C71A 1HV0A 4Y5TA 3CJIB 3VKMA 1K42A 5J98B 4C0BA 1CGPA 2RVAA 3GNEA 4NHLA 4Q4W3 4CYDA 3L2YA 2Y6LA 3SKVA 4RL7A 3JCIA 1W8NA 4QKNA 1YYNA 5L9RA 5LW9A 1O5UA 2CGNA 3OUJA 4EE2A 4EYUA 2J1SA 5LY1A 3DYPA 3B9CA 3ZYPA 4E27A 3KZ4C 4UW5A 2OX0A 5FZEA 1GMMA 4OVEA 4ATFA 3K51A 1RMU2 3AYCA 3J7LA 1O3TA 3I7DA 4QD2A 3VKFC 5KXBA 3CEWA 3WSOA 1AR72 1VBD2 3RI8A 4U36A 4G4FA 1RUJ2 1RUF3 2FHRA 3EBRA 4UBHA 3LA3A 2ZPXA 5JI9A 2VZQA 4XF3A 2WFPA 4AGRA 4BXSV 2R063 1GNHA 5ACA2 5FK8A 2BOIA 2X5IC 2JDUA 5DDJ2 4YM3A 3OYWB 1GWLA 2VBPA 4HG6B 4W4ZA 2XDVA 1XNBA 1KS4A 4Q8LA 5FDBA 4FFIA 1NE4A 3ZSMA 2XHNA 1A3KA 5BNPC 3H8OA 3LOBA 3IDBB 4P9GA 2GH2A 3U07A 3TN92 2PHUA 2WABA 3OGSA 2HBTA 5J7MA 1OH4A 3Q8FA 5FZFA 4HZFA 4HKLA 1MR5A 5L19A 5FZBA 2JEMA 4B7KA 3U11A 4CUBA 2ZHNA 3PU8A 5C9AB 1ZRDA 4YVSA 3SKJE 5FYVA 3HAGA 4QAWA 4CDXA 4CEYC 5BNNC 2P3IA 4DS0A 1ND2A 4CXXA 4AVBA 1OKOA 2YMZA 2IVIB 2J1RA 1JYCA 4IE4A 3VBSC 2PAMA 1J3PA 2YHJA 4BZ4A 2JE9A 2Q8CA 4AWDA 5J09A 1HQLA 1LENA 4A4AA 1O3QA 1FXZA 3VKOA 1J83A 4OHYA 1N1SA 2KM2A 1O8PA 4AEDA 2JDZA 4JHZA 1NT0A 4Q4X3 1Y7BA 4WM7B 3AYDA 3SC7X 2MNGA 1BYHA 3LB9A 4CDWC 4META 1SG3A 1JTZX 4E8DA 4YZ5A 2DCYA 4Z82A 4OI2A 3R4DB 4Q0UA 4QKBA 4QPGA 3WF3A 5IATA 1TE1B 2JG9B 2D6OX 2P2KA 1POV1 1UXZA 4JGZB 4TWTA 4Y4YA 2D5FA 2VQAA 1GZWB 1CZTA 1YFUA 3DKWA 2OQ6A 3FE5A 3MUZ1 4MGZE 2PAKA 2W2IA 4Q1RA 1UX7A 1LHVA 5EHDA 2JG8A 4E9KA 4HL0A 2YC4A 4AFAA 5C7GA 2IWGB 1FNZA 3IIAA 4KBBA 4BQYA 5D8AC 1SHWB 5IJRA 3ZFGB 5LEJA 2G1MA 2C5DA 5A32B 2ZGTA 1G9BA 1WZXA 4LLOA 2XQRA 4RHV2 1FOD1 3LOIA 1D0GA 1UQXA 3GHNA 3I59B 3BCWA 1F35A 1W6OB 4AE2A 3OGGA 3O1TA 3AP6A 4OUMA 5I91A 3TWIA 4IEOA 3MLKA 4FPGA 4CDQB 4MUVA 2BNMA 1D7PM 3KV5A 5A1FA 1YQ6A 1KRIA 1B09A 2CNAA 3ZXAC 4XUOA 1GNYA 1BBT3 4EZ4A 1HRI2 1T6GC 1ENRA 1XRUA 4XF9A 3WDXA 1J58A 5I0TA 1DGRN 2PHDA 2ZMLA 3E97A 4IGQA 4ZONA 1TMF3 5EWSA 3RMYA 1BK1A 5A70A 1HV1A 3BI3A 1QOTA 1QQP1 5HCHA 1EY2A 4HK9A 4C1XA 3PVOA 1W2AX 4PCRA 4GMP0 1WA4A 1K45A 1HDKA 1UYPA 2PLV3 4EWDA 3WEZA 1R093 5CFCC 5IAXA 1OA3A 2E9QA 3AMNA 4DZGA 2ZGNA 4GWIA 3U1XA 1OQ1A 1R1A2 5IVJA 1W6PB 3EXUA 3NJZA 2WO1A 4MGQA 2A75A 2W3JA 1IS6A 2VZ3A 2WSVA 1O7FA 1ULFA 2E33A 4FFGA 1J3QA 1JH5A 3RMXA 4M01A 5LB6A 2XMLA 5DN2A 3ZSKA 2IXHA 4NIGA 3P3NA 1XNCA 3J8F1 4YGBA 1AVBA 2QQJA 2QUOA 3KD4A 2VZTA 3ON7A 3P5BA 4OI0A 1GFF2 3A23A 2FD8A 4YARA 3WQBA 1W9YA 3FJSA 4N8MA 1NYWA 4XDPA 4JDOA 4LIVA 1I5ZA 2Y26A 3MF6A 1LRHA 4D6QA 2BWAA 2ZGMA 3W5MA 3BTYA 1WLWA 5GM0A 3WW3A 1O5LA 1AX2A 1GWKA 4YG0A 4MGYE 5JOYA 2GN3A 1GP4A 1VMJA 3IB3A 3OYWA 3VBOA 3RZMA 1PGL2 4RN5A 1MQTB 4G9SB 4O61A 5C5TA 4XUNA 2E26A 4LORA 4GB33 2J7MA 4L0PA 5G04L 5GLTA 3VD4A 3N7JA 1LR5A 2ARBA 1UYXA 3AC0A 3FLPA 3OPWA 4Z8BA 5DXDA 3MFAA 2W5FA 4RR3C 3VZKA 2VZOA 1BVP1 2VULA 4ES9A 1RUD3 1YXWA 4IDZA 5F3CA 3RZZA 4LBKA 2BUKA 2PAEA 5FLJA 5F5IA 4HXCA 4C1WA 1W9FA 3UV9A 4A3ZA 2QNKA 1W0OA 5FY9A 1F9KA 4I0BA 4Y3OA 1UYYA 1QEXA 1UL9A 1ASJ1 2YY1A 4BQ4A 1YCIA 5FKBA 3J26N 4HT1T 2WA3A 3ZMOA 3WT3A 1BZWA 1NA1B 4XACA 2HWF2 1YO8A 2D6NA 3TNPB 4ISRA 1AYM3 1FV3A 1LESA 1QJY3 2C9AA 3ILRA 4U2AA 4CXWA 1LAJA 4WM7A 3QOPA 5B2GB 4CCLA 1BEV3 2QQMA 4A2UA 1PO23 3LPGA 1LGNA 4HMZA 4YLZA 1LHUA 2HH9A 4P5YA 3JU9A 4RFT0 5CYYA 3FMGA 1JOPA 1ZA4A 4QB1A 5FMCA 5CKNA 1MS9A 4JGZA 1QXRA 1GZWA 1OA2A 3KF3A 3CHXA 4KWKA 1H6YA 5FYIA 1SBEA 1HB3A 1IS4A 1PX3A 4D0QA 2FCVA 4FFHA 1MEC1 4ZS3A 3KWVA 4QWNA 1R64A 3OY8B 2BERA 1TZOA 1NUKA 1IHMA 1QJFA 2W91A 4LKEA 1BBT2 1GYKA 4AXOA 4FBFA 3PMEA 1FMD2 2JDPA 3GJBA 1UW8A 4CDQA 2YXSA 1HRV1 4Z92B 1AJOA 2YGMA 5A33B 2PHRA 1K5MB 3HT1A 3AKRA 4JKLA 1MS4A 4IE0A 4QQPA 5IVEA 5FUIA 4D69A 5FP8A 3ZSJA 1UYZA 1ND2C 3VV1A 3NL1A 2GMEA 4RQPC 2RS31 5JR7B 2OUJA 2PQSA 3K2OA 1R092 4PLOA 1BXHA 4Q4Y3 5EJ3A 4EWAA 5EFUA 4CEWB 3AK0A 3JBG1 1TME2 1GLHA 2WA4A 3P1IA 1NG0A 4XFIA 1QF3A 2C26A 3D8CA 3ES1A 3WG1A 2JIJA 2P34A 2QZ3A 2GZWA 2EIDA 1CN1A 4BWOA 2IC1A 3ZXKA 3LEKA 3APBA 2UU8A 3POWA 5HI0A 2ZX2A 1W6QB 4QT6A 3ZR6A 4B1LA 3NRUA 2WNUA 4KBZA 5EXOA 4AI1A 4UI9L 3WUDA 1RMU1 1WCKA 2X29A 5EQUA 5KHKA 2D3SA 4LKFA 3U4XA 1T6BX 3LA2A 1OD3A 2K2SA 4BB3A 1AR71 1VBD1 4UW3A 2VO5A 3ZM8A 3WG4A 4FPHA 2W1UA 1W8HA 2RS53 1RUJ1 3O14A 1YI7A 1Q56A 3KV6A 3IDCB 4HANA 4CP2A 5E1RA 1JHNA 1OC1A 2LUWA 3GBFA 5ACA1 2ZX0A 1O4ZA 4GB32 1VLNA 5DDJ1 4NRPA 1V0AA 2DDUA 4HVOA 5A3LA 4A7YA 5A3WA 1B35C 2WL1A 3NAPA 4IESA 4LO4B 3CKHA 3TN91 2Y33A 3H7JA 1K3IA 3K4AA 2HEYF 1NZIA 2WZEA 1GV9A 3E5UA 1W90A 4OQ8A 5FK7A 5C3PA 4IEUA 4XJ8A 1XQNA 3OGRA 1CZSA 4AGGA 4W6YA 4I30A 1LHWA 4CDUA 4OULA 4Y26A 1X33A 5AC93 3PUIA 4FVVA 3ZN6B 1A8MA 1HB1A 1FT9A 5FPLA 2EXHA 1LOFC 2TNFA 3GF6A 5CA6A 1MS3A 5K4LA 3KV4A 4JX0A 1G9FA 5FZCA 2OYZA 4XQWA 2O8QA 1RUG2 4JQTA 2CGOA 1RIRA 4MGIE 4FOYA 3OBZA 4CP9B 5LBBA 3TEXA 3RZKA 5ANNA 3U78A 1BEV2 1QWRA 1PO22 1RL3A 1NA1A 5ABJC 3AX4A 3K75B 1CWPA 1E5RA 3WNMA 5F1RA 4H14A 2WNEA 3VHRA 2EALA 2Y8KA 2OZJA 1A34A 2Q30A 1V6IA 4I09A 3VHPA 4ARXA 2IUWA 3RJRA 4WZCA 4XBLA 1CD3G 2D3RA 1YIPA 2X5IB 5KXCA 2OZ6A 5T54A 5GZCA 1SEFA 3Q9OA 3H8UA 2XOMA 4BQ3A 2YYOA 4QX5A 2HEVF 2XJUA 1BMV1 1GR3A 2R1BA 5BPXA 4LE4A 3VZOA 2VMEA 2X8KA 4A7ZA 5FXZA 4OI4A 4W50A 2VECA 3EHKA 4RHV1 1UZWA 4XJZA 3H3LA 1POQA 5I0DA 3LE0A 4HBNA 4QXCA 3OY8A 2WC2A 1OF3A 5FOJB 1SFNA 2GNBA 5D2AA 1H2LA 4CEYB 3FX3A 1SCSA 4C90A 4PBOA 5JZGB 3CL1A 2MEV2 4BISA 3VBSB 4P9YA 1HRI1 3E6BA 3CU7A 3GM8A 4DOUA 1UOFA 4Q4Y2 1H2NA 2WBKA 4A6SA 4GH4A 1E5SA 2VZRA 5DAPA 4OFGA 2DCZA 2DVGA 2XKPA 2ZX3A 3J8F3 4IE5A 3SH4A 3LEGA 5LBFA 3HEIA 3POSA 3D4KA 2A6WA 3SLIA 3WHUA 3C7EA 2WIIB 3P6BA 4QQ2A 3TEWA 4XFBA 2EXKA 2R073 3I2GA 2VOXA 2B39A 3O1OA 2ARAA 3IDEA 3A21A 1R1A1 4WZFA 1QJX2 4QGLA 1VBE3 1TVGA 3W5NA 4IETA 2D3PA 3NW4A 1JZ2A 2A6VA 4K9SA 1S0JA 1MS5A 4WVMB 5FZDA 1RITA 4FXKB 2HWB3 1CPNA 4AYUA 2BOJA 1WCDJ 4OZOA 1OQDA 1RHI2 1EYBA 5HPOA 2RS52 1AXYA 2ZHLA 3OBRA 4OLLA 1S4CA 4M3CA 3ZFFA 1G9DA 3T1MA 3AFKA 5DG1A 5JXHA 2BTVC 4I3GA 5GZGA 4BK4A 4DUXA 3ZXGA 5HV0A 1ODMA 1C1LA 2WYFA 1HW5A 5H9RA 3S30A 5E6HA 2YROA 2VQUA 3ZXJA 1MZFA 1OD5A 1PMIA 4PDWC 1H1MA 3WNPA 4Y22B 4GAZA 4YW5A 2WWUA 1PGL1 1WKYA 1TQ5A 4GWJA 3BALA 2BRTA 2QCSB 1XSQA 5JOXA 1HKDA 3T1LA 4DUWA 5AC92 2H6BA 3SEEA 4PF1A 4LHKA 2DWRA 3VBFA 3U37A 1JYWA 2ARXA 3KT7A 3ZXLA 4S2FA 4ASMB 4W65A 3HQUA 3JUUA 3CIHA 4FTEA 2IXKA 5IVBA 1OLMA 1QXPA 2BEOA 1W9SA 3AMMA 3DXTA 4BK5A 1I1EA 3DN7A 4XJUA 3POBA 1I3HA 5IK5A 2J1TA 2EXIA 1X9PA 2XVGA 3H3ZA 3M8LA 4EN6B 1RXFA 1WLTA 2PHXA 3O12A 4AGVA 2C9KA 3POIA 5LK7B 4WBBA 2Z42A 1YI9A 5E89A 4XJAA 1N1YA 4CP9A 2HWF1 4DFSA 2Y6GA 3UGGA 3WZ1A 3V0AB 5T5LA 5F6LB 1DZTA 3ETPA 4PBPA 5FYMA 5HXMA 2NMOA 4K8RB 4LBOA 2EICA 1LOGA 3AZYA 4HSLA 4F7ZA 2IFWA 2VTXA 4EZHA 5C3OA 1NLSA 3DF0A 4LK6A 5FY5A 4CPBD 1W8UA 1X82A 1RINA 3PIJA 3VBHC 1FATA 3SITA 1N3QA 1TG7A 2JKBA 2RS33 2C24A 2JD9A 3O0VA 4IEWA 4ZY9A 4RGAA 1PHMA 1EPWA 1QMJA 3F2ZA 4NIAA 2ZJCA 2DVDA 2UY8A 1XNKA 3N9OA 5FP4A 3X29B 4XAEA 1BK0A 3ILNA 3TYJA 4DEVA 5A6ZA 5JDBA 1LU1A 5AFBA 1UWWA 2WRAA 1BBT1 1FMD1 3ZYRA 2W0XA 5A7WB 4B3NA 5C4WC 3R05A 4UOJA 1X8EA 4CU7A 1JZ5A 5JZGA 2DBNA 4CDUC 4Y5SA 1BCXA 4P9LA 2BW8A 2LM3A 3C2UA 3MIBA 3RRDA 3N7LA 4GZ9A 3M3EA 4ASKA 1HIXA 2D6PA 1H8TB 2XJQA 1R091 2R072 1OVPA 1JODA 5T5JA 3VBUC 3L9JT 4YW6A 4XUPA 1RUC3 1TME1 2D6MA 3FBYA 3ZYHA 2RDQA 1W8TA 3HWJA 3OOXA 5FMDA 2BJSA 1VBE2 3VLBB 1QGLA 1AXZA 1LEMA 5BV6A 1JI6A 1ND3B 1WLDA 1T2XA 4JV4A 5ACA3 5EYXA 4Q4V2 4AVAA 3AKSA 4GIQA 5DDJ3 5BNOA 2HWB2 3KMHA 2PHWA 1CZVA 2QQIA 4L92A 4AVVA 5A1AA 4XBNA 4CUGA 1PVC3 4LA2A 2ZZJA 4UFHA 5FYSA 3TN93 3B69A 5F6KA 2FDHA 2A5ZA 1YIFA 1QJZA 1W6NB 1UY3A 3MICA 4RGGA 3E5XA 4QPIB 2JWPA 3KQRA 4UT5A 4WVMA 3AL6A 3VBRA 4XURA 4A41A 5LEKA 4YVWA 3BUCA 2DCJA 2XUMA 1X50A 2G9ZA 2CDOA 4KNCA 2R16A 1O6UA 1LTEA 3WLUA 2YFZA 1JW6A 1GOHA 3AXDA 4RS5A 4BDVB 2W52A 4LEJA 2ZGUA 3EO6A 4PIZA 4Q27A 4DMIA 3K4DA 5T5PA 1I5PA 5IVVA 2VGDA 2D6KA 4UW6A 5E16A 1V6OA 4GB31 2F4LA 4Q0SA 4LBJA 3ZN5A 4MYEA 3Q8CA 4XMIA 1S55A 3MW4A 3NMBA 4Z2WA 2DFBA 4QX2A 2X09A 5KWRA 4NIDA 4RQPB 2YZ4A 1NY72 5FZ3A 5J37A 1BLZA 2B42B 4IV3A 5LA2A 2VJXA 1NCRB 1V6LA 3M7AA 4BXFA 4JDMA 3N9LA 1E5IA 1HN0A 5LBEA 3VDAA 3LPFA 4OHXA 1SZBA 4IXLA 1AXKA 4IUGA 5K0UA 4CPBA 2OS2A 4QQLA 2VH9A 3Q8EA 3H3UA 1QOSA 2B8MA 4AI0A 4BQWA 4MO3M 1C4RA 4BU2A 2PFWA 5HXVA 2P3YA 4TSVA 4XUQA 4PQ9A 4CZSA 1DF0A 2VMHA 4LIUA 1RUG1 1D2QA 4NMIA 2OQ7A 2VXRA 5FMOS 4AI9A 3J4UH 3U14A 4RHV3 2GMPA 5F3EA 2Y6HA 2DTWA 2P37A 3UGHA 1BEV1 2GC0A 3DYOA 4XHXA 1PO21 3WHTA 3GJAA 4W6XA 1RVF2 1L7RA 3ZFEC 5IHRA 1OFSA 2JXAA 1JBCA 3V0AA 5FLIA 4XFHA 2HWE3 4UYBA 4L8QA 2FBEA 4FPOB 3GZAA 4FO9A 5FP3A 3SXWA 5JUVA 4N9HA 1J59A 4XEZA 3NV3A 1U5ZA 4NHXA 5FYUA 1GOFA 2UWAA 1GP5A 4DY5A 2WQ8A 5I0RA 3AP4A 2EXJA 4IE7A 1W6MA 2GALA 5KC6A 1Y43B 2WWJA 1MPXA 4XDOA 2VNOA 5FPAA 1YJKA 1PZ9A 3V0BB 1C8M3 1DQ4A 2XH6A 3IPVB 4FFFA 5GKAC 1R1A3 3IZOA 3MIGA 2PELA 3DECA 1CVNA 4YGDA 2WS93 5T3NA 5JSOA 4IGPA 1OUSA 1PX4A 2HLEA 2VTFA 5AVAA 3R6SA 1DHKB 2G9GA 2MEV1 2YB7A 4FOVA 4YYOA 2DURA 2VQ0A 3JD73 4Q4Y1 4HVRA 5GLUA 4BOWA 4FTBA 1RUC2 4TXWA 3UESA 3POJA 4AQ6A 4IERA 1OVSA 2XR4A 5IUQA 3SQOA 1DLCA 1Z7S3 4GMP1 4OUSA 4XILA 5FQ0B 1WD3A 3GCWA 4XC9A 3T08A 3M3IA 5A3TA 4NRQA 2VVDA 3T2PA 4I2OA 2CWSA 3DPRA 2XKOA 3J7NA 1Y9GA 3ZDSA 5ABJB 1H4HA 4YNIA 1D2SA 1PVC2 1YQCA 1RUH2 2WUHA 4L11A 4JCKA 5L7OA 1MZ6A 3BTAA 3WF2A 1QJX1 3N36A 4FQ4A 3T4HB 3WNXA 2VNRA 1MVQA 4KWLA 2E7TA 4TN7A 1WWYA 2HBUA 3LF7A 4J6GA 2FCUA 4B4QA 2VCMA 4AFDA 3CZUA 3WF4A 2CV6A 1V6JA 1RHI1 5M0TA 5IK4A 1W6NA 2RS51 2QQKA 1CIYA 1ST8A 2VW0A 3I8TA 4QPIA 4PQQA 5BUVA 1JZ8A 4XIOA 1WGPA 4BA6A 4CU9A 1DZQA 3EMRA 3HQRA 1KJLA 1J84A 2AGSA 4XVHA 4AEKA 5K7PA 1XBFA 1IG0A 1GP6A 3MEPA 3AZWA 2ZZQA 4K1ZA 3MFCA 4N43B 3PJQA 4QX3A 2BPA2 1GNZA 2PHFA 1PNFA 1AZDA 3RWKX 1RUOA 2A7AA 4QU1A 2OW4A 5FPUA 5CG9A 5F3IA 1MS1A 1UO9A 5FY0A 4PLMA 3NSTA 5FYTA 1W8ZA 4R4ZA 3PMSA 3KB5A 4KH9A 4MGSA 5JLVA 3LIGA 1VBB3 2WQ4A 1JYVA 1AR63 2HWF3 2YUEA 4HPKA 5BY5A 4LMFA 4XUTA 4D94A 4MV2A 4AQSA 2ORZA 2FQPA 3H42B 1LOCA 5AC91 1RUE3 5I0UA 5FMBA 1NCRA 4ISQA 3NNLA 4ZU5A 1XYNA 3OB8A 1TNFA 2ZMNA 5AVPA 3OUHA 3T2OA 1Y3TA 4QQOA 3NNGA 3WF0A 3K48A 5FUPA 1LHNA 3U10A 3I2FA 1XU1A 3SH3A 2XG3A 3POGA 3QCWA 1PM4A 1D4M3 5FAXA 4E2QA 3E6CC 3N9PA 4N53B 3ZKYA 4RSUA 1AL22 4OCTA 2J42A 4XTMA 1MACA 5FUNA 5BNOC 1G6NA 4Y20A 4I02A 4XDQA 1UNBA 3TBDA 3MW3A 3I2DA 4MZUA 4PI2A 1UN1A 4C91A 3THCA 2HWE2 4QMAA 4COVA 3Q8BA 2JDNA 2AEYA 2Q1FA 2VD7A 1QXJA 1FMD3 1H1IA 1NLRA 2OUHA 3RGBA 2YBSA 4YVWC 4A42A 1COV2 1LNSA 1H2MA 1VBA2 3ACIA 1WMFA 3ENRA 4UF0B 2A70A 2FMDA 1EUUA 2ET1A 3RQ0A 5JI7A 4D8MA 1VR3A 4PDWB 3MIEA 1WD4A 4XFAA 1QKQA 5C8CC 2CYFA 4NWWA 3P3PA 1WBLA 4JC1A 1C8M2 1CAXA 2TBVA 2ZGOA 4FP2A 5D21A 5FBZA 2W08A 3O0XA 2VE1A 3LDKA 3UKVA 1TME3 3ORJA 3RI9A 1YFYA 3CJIA 1W8WA 4GULA 4RA0A 5A7NA 1H9PA 4FPKA 2WS92 3CMGA 3I3QA 3KSCA 3R4SA 2BDRA 2D6LX 4OHVA 3W21A 3WQ1A 4CTEA 3NKGA 4XXPA 4YSFA 4C8DA 1DGRA 1S1AA 3TAYA 3GBGA 4XF0A 3JD72 4LHNA 1QDCA 2CDPA 1N3OA 2DCKA 2XJVA 3PDQA 4QGNA 5C70A 4MVTA 4FOWA 5FZ1A 4QQHA 5LA9A 1VAMA 5JXIA 2LW8A 5FO7B 1Z7S2 1OOPB 2RJKA 2QQLA 4RFRB 5KHIA 5LRSA 2VMCA 1IQDC 3S57A 4R4XA 4YRDA 4E2SA 2GAUA 2BYVE 4LA3A 2R071 3M3OA 3BIEA 3TNQA 2VZSA 4OYUA 4UW4A 4QHOA 2CHHA 4F3JA 5FQ0A 1H1AA 3O1MA 3EJKA 1AF9A 2JENA 3NNJA 2B45X 3W58A 1VBE1 5CKMA 4BIOA 5KR7A 2WO2A 3AMQA 2W92A 2X10A 4KG8A 4BJ0A 2Z5WA 3O1SA 4Q4V1 3ALQA 3WW4A 1GKBA 5JAXA 2HWB1 5A80A 4P00B 2V4AA 4H7MA 1PNGA 2DFCA 2RJ2A 2XJPA 3FUQA 4JGYC 4LO8A 5FZOB 1JYNA 4DB5A 2Q8DA 3VDDB 5C9AA 5I8TA 3FWEA 3USSA 1ENSA 5JMCA 1FI2A 4Q0VA 1IKQA 3HNYM 4AQ2A 5GALA 1JMUB 3F95A 1YJLA 3D0SA 4GWMA 4XPVA 3ZN4A 4AEJA 1ZYBA 4NRMA 2E7QA 3LSDA 4GD4A 3GYDA 2XGXA 1OLRA 2D5HA 3MLJA 4N43A 1VBB2 2JJ6A 2ZGRA 5BYNA 1RUG3 1AR62 2QQOA 1POV0 2OPKA 1WMDA 1W0NA 5CFDB 2GC3A 4YFZA 2HWD2 5FPVA 1LECA 4ZU4A 1RUE2 2XJTA 4F83A 1LB2A 3AP5A 3O1UA 4NHYA 4ZPIA 2VOKA 2RJLA 1DCSA 2VAUA 1LU2A 1NY71 2LS6A 4CA9A 2JG9A 4YFWA 3WNKA 3V56A 3L2HA 2W1QA 3E5QA 1PMJX 4MH0E 4QM8A 4Y24A 2QQPA 4CU6A 1D4M2 2Q5TA 4D7YA 2WDBA 4D6SA 4KL1A 4WM8B 3ASIA 5F5QA 2QVSB 4N9IA 4XHBA 3ZXDA 1IOAA 4LE3A 1V70A 1DQ5A 1S0IA 5A1LA 1CJPA 4WVZA 2WNVB 5FFOC 3ZFGA 1XNDA 2XL7A 4GA9A 2A3XA 4S2GA 1WMEA 1PO13 4N53A 4NN0A 3WDYA 5A32A 2WLQA 3TOJA 1KD7A 3T4VA 3I59A 2RR12 3ILFA 4G3YC 1LCLA 2WFF2 1W6OA 4HETA 3QLQA 2D98A 4IV1B 4IL7A 3HT2A 1HQWA 1OUXA 1XYOA 3K4ZA 5T52A 1GZ9A 4COWA 4DY3A 4NUBA 3WV6A 5LRRA 2ZTNA 4YVSC 2D43A 2UY9A 1NQDA 3KCYA 4CDXC 1RVF1 1Z78A 2A1XA 1CAWB 2Y0OA 2FMYA 1KDMA 1PMHX 2ZX1A 3O5SA 5JPNB 1SDDB 1ZZ7A 4YGEA 3CJXA 2EIBA 3CLPA 2MEV3 5HV4A 4UAPA 1UAIA 4S2DA 4LQRA 1GZTA 2VNGA 5FY4A 3WNLA 2WAAA 3WCRA 1ALYA 4BQXA 3M70A 1UCXA 1UF2C 2E53A 3MDPA 3WDWA 2VZPA 5DMYA 4GMP3 1RB8G 3URFA 4AEDC 3R4UA 4QDSA 2ZBJA 1NCQB 4R52A 5A7OA 5E8AA 1GWMA 4J1WA 2VVEA 2DU1A 1XB9A 1HLCA 1W6PA 2GDFA 4QPGC 3POFA 2GN7A 2VC9A 1X9TA 3LAGA 5EJ1B 2AREA 2BU9A 2RDRA 1ZZCA 1RC6A 5IFPA 2VMDA 1QJX3 4PLNA 4LBMA 4ATEA 3VD5A 1O3RA 2ID4A 4FI9A 4XW3A 5I8YA 4IEVA 2JG8C 1DGWA 4ZS2A 4OI1A 5KHJA 1VBC2 4K1YA 1JYTA 3ZKUA 2RS13 1RHI3 4UFJA 1EPZA 2VNVA 3ECQA 2NZ9A 1RUC1 2VBDA 4NPMA 4URAA 4FQZA 1NQJA 4M0HA 4LJHA 2PYTA 2E32A 3N7KA 5DAVA 2L9LA 2W87A 4HSJA 1UZZA 2E7AA 3I3DA 1PK6B 5EZWA 3ZFEB 3OTFA 2KD7A 1DYPA 3LZZA 1MVEA 1O59A 4GXLA 1PVC1 5GZDA 1WW7A 3SISA 1RUH1 3WOGA 1MQTA 2Q4SA 5FZ9A 1J3RA 2QKDA 3PNAA 1ZZBA 4LULA 5FREA 1FNYA 1GQHA 4MSVA 5CAZA 1C1FA 1QHDA 1US3A 3KCCA 1IZ3A 3PUHA 4CCDA 2XB6C 1I6XA 1UOJA 1X36A 1JXNA 5KC5A 1S0BA 2VQTA 3OGJA 1RTVA 5IT6A 2WQZC 3VDDA 1R082 5L9VA 3CZJA 3N9MA 1PGSA 3ACLA 5FYHA 4OHZA 3N7MA 1W8FA 3VL9A 1IKPA 1YC61 3WCSA 2WZR2 3N35A 2CL2A 4RD7A 4JKMA 3ZX7A 1FPN2 4HN1A 5DG2A 3JB8A 1W06A 1YHFA 3VZLA 2F4PA 2JB8A 2XLFA 3I2IA 2GU9A 2R6QA 4BPZA 1SLLA 5LA1A 1XE7A 4IQPA 1Z0HA 5CFDA 3VN4A 1H6XA 2BZDA 4CU8A 4MGTA 2ZKLA 3ZPOA 3FLRA 5DABA 1DP0A 1YQ2A 4AHYA 3HD8B 4LUKA 1AR82 3VB9A 3UKTA 1ULCA 1JZ3A 2Q0AA 1WLCA 1DGLA 1VMFA 4O9GA 1CX1A 2WN2A 3USUB 5BNPB 1PO12 4WM8A 1HB4A 1UMZA 3HPNA 4HN0A 3THDA 2CGPA 1F5JA 2UWCA 2O8OA 3J9SA 2NMNA 3VBOC 1AL21 5FJHA 2WNVA 1XJAA 5F39A 3ROUA 1CAVB 5T5OA 4AHXA 4IEXA 1TEIA 3AKPA 1LOAA 4BQ5A 3SHRA 1Q8VA 2ORXA 1GUIA 1WBFA 4R9AA 4AI8A 5BNNB 5C8WA 4IV1A 1AX1A 1WCQA 2HWE1 3WW1A 4MXVA 5T50A 5CADA 1ZBE2 1OH3A 5A33A 3S7EA 1DQ0A 1K5MA 2R042 2ZMKA 3SMHA 2FDGA 1COV1 3A7QA 1CAWA 1VBA1 2OIIA 4Q8KA 1YNAA 3TRSB 3RPQA 2YBKA 4M00A 1IQAA 3OF1A 2Z69A 4BE3A 3GZUC 1WMXA 3HN1A 2QQVA 3AM2A 4CEWA 4CDWB 4L99A 4ORFA 1C8M1 3WP5A 2VZVA 5K8SA 4WVVA 5J36A 2R49A 4DXSA 4WM7C 2WWSA 2WS91 2AH2A 3WX5A 1XNTA 4YW3A 2VZ1A 4J1XA 4JVAA 4EROA 2FZ1A 2DVAA 4Q4V3 3NNFA 4QPWA 4FSJA 1W6QA 2IXJA 3H1WA 4N7UA 4JGZC 2RS12 4XXAA 3LFIA 2VOVA 3JD71 3KGZA 2H6CA 2Q1ZB 5D8AB 4CSWA 1U5YA 4XFCA 2EAAA 1SLBA 2BP6A 3CF6E 4L97A 1ULPA 4E4DX 4JRLA 4IEQA 1Z7S1 1U5IA 3VZNA 3FN9A 1AL0G 3ZFGC 3FFZA 3AB0A 4AG4A 2H0BA 1M06G 4F8AA 1MZEA 3T2TA 1YWKA 4LOTA 2BV4A 4FPFA 4PF5A 2AZ5A 2V5YA 4XF4A 1WW4A 4CDQC 4OMCA 4R9CA 4NAMA 3A4UA 1ODNA 5FZMA 4IEPA 3G6JB 3VKLA 4EWEA 3BPZA 1UXXX 3NWKA 3RVHA 3H50A 1W3XA 2CAUA 2DVBA 3B3QE 4P02B 3T0AA 1SACA 2R7EB 1ZM1A 2VM9A 1GICA 4CP1A 3RZGA 3H8RA 5FPXA 5C8CB 1SDWA 1UX6A 1DIWA 4M4PA 3WDVA 5A7PA 3D5OA 1P8JA 1VALA 1WUVA 5CFCB 2LRPA 3PU3A 3WP4A 2W1WA 4GKXA 1IGOA 1RJ7A 5F8PA 3ZN6A 4D7TA 4LBQB 4X6QB 4KQ7A 1W9TA 3GCXA 4COUA 1W3VA 1AYN2 4ET7A 1DQ1A 2PTMA 1KITA 3HVDA 4JTNA 1Q8SA 1KEXA 3KS7A 3KLSA 4Z1VA 2D97A 5L73A 1W99A 1ZRIA 2W95A 4LNVA 1C5HA 3CQOA 3KHBA 4CE8A 4YM2A 2R0FA 1VBB1 1AR61 1JHJA 1OMIA 2OA2A 2WT0A 4LTAA 2WNUC 3HQXA 2HWD1 4P9XA 4O9EA 1RUE1 4LO7A 2G9FA 4MG2A 4CCNA 5JSRA 2GC1A 2ADEA 1W0PA 1RVF3 4K8FA 1UY4A 2DUPA 4AFMA 3PUQA 4NOTA 5JOZA 1D4M1 2JECA 2X5IA 3R0RA 3RZJA 2WNOA 3TEZA 4XFGA 3VDBA 4YZ4A 5DUWA 1TNRA 2VUDA 5FYCA 3AP9A 5BNPA 4ZXKA 2W47A 4YW4A 1G86A 1SLAA 4FOQA 2ZGPA 3NAPC 3PHMA 4RR3B 2I07B 2RR11 4FCAA 2WFF1 4TLGA 4NPLA 5B4XA 1ZNPA 3FC0A 5DPNA 3W9AA 4CEYA 3ACHA 3ZVXA 5BNNA 3OPTA 4GQ7A 1CR7A 2XPJA 5FTTC 4EJRA 3CDZB 4W6WA 3VBSA 1MS0A 2W39A 3JQWA 5FY7A 4NHMA 4LT5A 4P9JA 1Y9MA 3OD4A 5A3UA 3RFRA 5C6CA 2VXJA 4EQVA 2VMIA 2Y6JA 1N3PA 2VTXJ 2AR6A 2RDNA 1H8VA 1XU2A 1Q43A 2PN5A 5CKQA 2GNMA 2K9ZA 2JE8A 4GKYA 3Q8AA 1UOGA 4BLJA 3JZVA 5FZHA 4K3UA 3OD0A 2E31A 2VG9A 4IE6A 5ERLA 4SBVA 5FKCA 3PLQA 4MGKE 5EYYA 4CDWA 4X6RB 5A6XA 4YG6A 1NA1C 4DPNA 4ZKTB 2XBO3 3OCPA 4L9BA 4PT6A 1S2EA 1ZZ8A 4B4PA 3SCFA 2AUYA 1NAEA 1DFQA 4TTGA 1RUH3 2ZGSA 1YUDA 4ITCA 4XFFA 3H1YA 1QJU3 2P4EA 4MX3A 1REEA 2P3JA 4XF1A 4UFMA 2BWCA 2VOWA 1S0GA 4PIXA 4CUCA 1WCUA 2WJSA 1A8DA 4LO6B 5D8AA 3MIDA 3VZMA 1VBC1 3QD6A 4NE9A 3AYEA 4WV8A 4KU7A 4KI5M 4CXYA 5T55A 1W03A 2GC2A 5FZ4A 4C0HA 5CU1A 1X7NA 4QM9A 3IMNA 3PJYA 2ET7A 2JE7A 3BU0A 4JAAA 1GANA 2J1EA 4AK3A 1XXNA 5C3RA 2WT2A 4Y22A 3DUIA 4YG3A 4DO0A 2J22A 4R9DA 1ND2B 2IXCA 3BB6A 3RJ2X 5FIXA 2W68A 5FY8A 4XCAA 1KXGA 1SPPB 3AJYA 2VCBA 4M3CE 4GH4C 1YFWA 3GDBA 5FP7A 3UL2A 2EIEA 4Y1ZA 4AL9A 1O3SA 1ZZ9A 2I74A 1W05A 1UY2A 2Q1MA 4Q2FA 5F32A 2C6SA 5C3SA 5FRAA 3WG2A 1PZ8A 1ZBA3 2O1QA 3U75A 2VL4A 5CFCA 4NJ4A 1R081 1WA6X 4FXGB 1RJ8A 1QU0A 5DZEA 2A71A 5ANQA 5TSWA 1EAH3 4LBQA 3THTA 2GNDA 4KG0A 2JKXA 4XZPA 1L3JA 3A0NA 3AFGA 1VAVA 5H9QA 5AFEA 4DINB 1AHSA 2WZR1 2JX9A 1QH6A 1AL23 4E4HA 3IBMA 4IW3A 1FPN1 2B4KA 4FPJA 3UKNA 3KT1A 1SLIA 1UZVA 4QHBA 3UT0A 1W28A 1SMVA 4PIYA 1XE8A 3DV8A 1ULGA 3HIFA 4B29A 3ZFFC 1JZ4A 2ZEWA 3BOWA 5EJZB 1ZRFA 3MIHA 3GZTB 3POEA 1EV13 4LHLA 1OLME 1G8WA 5SV5A 1AR81 1CIWA 4FP3A 1RUI3 5F3GA 1OF4A 2YGLA 5JIUA 1COV3 3DEMA 1VBA3 4CCMA 1ZX5A 3O7OA 5DUUA 3LA7A 2C4XA 4JTOA 5I8SA 2AENA 1PO11 1GQPA 3O0WA 1B35B 4CUAA 2IXLA 1IPJA 1LEDA 4NROA 5SV8A 2A6ZA 2VZUA 4I01A 4B1MA 3DL3A 3WQ0A 3FZ3A 4DIQA 1L7LA 1WW5A 2XJSA 3DYMA 2BQPA 2ZKNA 1N47A 2XUEA 3AZVA 4HLTA 5H9PA 4CCOA 4RR3A 4W8JA 5A6YA 2RHPA 3I2OA 2VR4A 3OGVA 3HOBA 3KF5A 3VBFC 3ZOIA 1SLTA 1G7YA 3AKTA 2D40A 5A7WA 2ARCA 4XJ9A 5D1IA 5JSPA 1ZBE1 5JPMB 3QBQA 3WINE 2VUJA 4XCBA 2R041 5FZKA 3K77A 1QH7A 2VMFA 3I2JA 5IFTA 3JQXA 1D0HA 4P9IA 3VL8A 1PIV2 3I3MA 1H8TA 1BKZA 3M3QA 2XBO2 3ZSLA 1O4YA 2RM23 3MV11 3J7HA 2JDYA 3IDAA 4Z07A 3B01A 1ND3A 1SFYA 2QQUA 3LKJA 3UJQA 1QJU2 4QXHA 4LO5B 5CB7A 5FO9B 3AYAA 4A6OA 1LJ7A 1C8NA 4CCCA 1ZRRA 1JYXA 1REFA 2TEPA 1C28A 1UZYA 5IVFA 5FR3A 4QPYA 1NZCA 3UYJA 4KU8A 4LKDA 3ZXFA 4Q5OA 3OJBA 2RS11 3IAQA 4JKKA 4QXBA 3S6PA 2XLGA 2X53S 1DLLA 2V73A 3EYPA 3H0OA 2PHLA 3VBOB 5LBCA 3UGFA 4NAOA 3C3VA 5IK7A 2K0GA 2VU9A 3PVNA 5FZIA 5HCBA 3ZPYA 1KFXL 2HYXA 2JDKA 1F4HA 4MOAA 4COZA 3KVAA 2XHKA 3RS6A 4UBGA 4Q0PA 1VRH2 3ZLIA 5CG8A 2JDAA 4Y5Z0 2VUCA 5LZ6A 5IW0A 2P17A 1H9WA 5LK5A 1ENXA 1JN2P 3B94A 3BODA 4XE9A 4DXZA 5DAQA 2YU1A 2WO3A 3WDTA 3M2MA 5JZGC 4Q26A 4K6BA 4PHZA 2Y60A 4XOGA 3ACFA 1YEWA 4XIKA 5FXWA 2HWD3 1ONAA 1QY4A 4OZXA 4RQPA 2KA3A 4H7LA 2NP0A 3JB4C 2Y34A 1QNWA 1SPPA 1ZBA2 3WQ7A 1V6KA 1NKGA 1JUHA 1EAH2 1HX6A 1K12A 4OHWA 5EV7A 1ULEA 1OPMA 3C7HA 4ZHNA 1UPIA 4QX7A 3KV9A 5IYYA 5LWBA 2QBXA 1UKRA 5FXVA 4A44A 1ULOA 1LGCA 4Y4RA 1AYN1 1W2UA 4N90A 3WF1A 4MHRA 4BMEA 4DQAA 2RE9A 3LGRA 1GZCA 3RWNA 3SEPA
chains in the Genus database with same CATH topology
3VD3A 3VD9A 1O8SA 2VZPA 3ABZA 4OZOA 2J1VA 5DMYA 5HPOA 5JXGA 2OKXA 3NQHA 4QDSA 3MBWA 3JXSA 5JXHA 2YC2A 4QX1A 4BK4A 4DUXA 2B9VA 2WN3A 4AAXA 2VC9A 5EJ1B 2VQUA 5IFPA 2VMDA 2XQXA 3WNPA 3T0BA 3VD5A 2ID4A 4FI9A 3C7OA 4ZZ5A 1JZ7A 1WKYA 4GWJA 3LQCA 3ECQA 3NJXA 4A45A 4DUWA 3SEEA 4PF1A 1NX9A 4LKSA 2WYSA 2E32A 2YFUA 3U37A 1JYWA 2L9LA 2W87A 3I3DA 3CIHA 2KD7A 1W9SA 1O59A 4BK5A 4ZZ8A 3GXUA 5JMOA 2J1TA 1XC6A 1US3A 3PUHA 2C9KA 3OEBA 1HN1A 2VQTA 2W46A 3HNMA 4QX0A 4M4RA 2Y6GA 5C71A 3CZJA 3ETPA 5HXMA 1K42A 3C8XA 2EICA 2RVAA 2Y6LA 3SKVA 1W8NA 2V72A 4JKMA 2J1SA 5EIYB 3DYPA 1TG7A 2JD9A 3I2IA 4ZY9A 1GMMA 5LA1A 3F2ZA 1H6XA 2BZDA 3MV01 4CU8A 3E1F1 3WSOA 1DP0A 4DEVA 1YQ2A 1JZ3A 1UWWA 2VZQA 1UY0A 4BXSV 1CX1A 2WN2A 2W94A 4UOJA 1GU3A 4W4ZA 4HG6B 4CU7A 3HPNA 3THDA 1JZ5A 2XHNA 1JU4A 4GZ9A 2WABA 3OGSA 1OH4A 3I3EA 3T0DA 2V5DA 2ORXA 1GUIA 4ZXEA 4CUBA 5G05L 4XUPA 1WCQA 3SKJE 4QAWA 1GOGA 1JI6A 1DYOA 1T2XA 2J1RA 3A7QA 2QQIA 1CZVA 1L7QA 2XONA 5A1AA 4A4AA 2BBAA 1J83A 1UY3A 4A41A 1O8PA 1W8OA 4XURA 4JHZA 2VZVA 2DCJA 4DUVA 1SG3A 2CDOA 4E8DA 4DXSA 3WF3A 2J1UA 2YFZA 1GOHA 1XNTA 1UXZA 2VZ1A 4BDVB 5B4NA 4QPWA 1JU3A 3K4DA 3MUZ1 1CZTA 1I5PA 4QB2A 1UX7A 2YC4A 5C7GA 1ULPA 1SHWB 5IJRA 3I97A 4QX2A 2X09A 3FN9A 5LA2A 2VJXA 4AG4A 4E8CA 1XNAA 5F7UA 3GGLA 3VDAA 3LPFA 4QDRA 2VCAA 4DEQA 4IUGA 1D7PM 1UY1A 4MO3M 1GNYA 4OMCA 4KMQA 4XUOA 5JXJA 1UXXX 3T0AA 4P02B 4XUQA 3UNPA 2R7EB 2VM9A 4M4PA 3LEIA 2Y6HA 1P8JA 1OT5A 3DYOA 1K45A 2W1WA 3D3AA 3WEZA 1L7RA 5IHRA 1W9TA 4GWIA 4ET7A 1US2A 2WO1A 5JUVA 1KEXA 4MGQA 5LA0A 2W3JA 2VZ3A 4LHSA 1W99A 2E33A 2W95A 3C7FA 1GOFA 3CQOA 2WQ8A 1JHJA 1XPWA 2Z4FA 5DN2A 2QQJA 1MPXA 2VZTA 3HJRA 2BGPA 3A23A 3WQBA 4QB6A 1EUTA 1UY4A 2J1AA 3DECA 3W5MA 5LCWL 3BN6A 3VDBA 2WZ8A 1PX4A 2HLEA 2VTFA 4YPJA 5J1XA 3IB3A 2W47A 2YB7A 4RN5A 2ZXQA 4XUNA 2E26A 3OG2A 4TXWA 2J7MA 4L0PA 4P08A 5G04L 3UESA 3VD4A 1DLCA 5B4XA 1UYXA 3AC0A 3T08A 2W5FA 2VOTA 5DPNA 2VZOA 3T2PA 3ACHA 3FHQA 3MUY1 4OMDA 3K46A 2RV9A 3CDZB 4OUEA 2WUHA 3T2QA 3WF2A 4A3ZA 2Y6JA 1UYYA 3HNBM 2JE8A 3CZUA 1F4AA 3WF4A 3I2HA 2E31A 2QQKA 1CIYA 4PQQA 1JZ8A 4PT6A 4CU9A 2QQMA 1J84A 1NAEA 3LPGA 4TTGA 3C7GA 4XVHA 4P5YA 5CYYA 3UETA 4QB1A 4QX3A 2W9XA 1H6YA 4CUCA 3ACGA 4DXTA 4MGSA 3OEAA 4D0QA 1PX3A 1KGYA 1JYVA 4KI5M 4XUTA 2ORZA 1R64A 2BERA 1UMIA 1NUKA 5DQ0A 3MO4A 2W91A 3HN3A 3OB8A 4QDQA 3T2OA 2J1EA 3NNGA 3WF0A 3I2FA 2J22A 4JKLA 5FUIA 1UYZA 2VCBA 2Y64A 3GDBA 2EIEA 2PQSA 1UY2A 3P1IA 3THCA 1UZ0A 2VL4A 2C26A 3FHAA 4A42A 1LNSA 3ACIA 2EIDA 2JKXA 1EUUA 3IIIA 3LEKA 4D8MA 4RYDA 5JR2A 2B4KA 3NRUA 3OBAA 2Y6KA 4KWUA 4UI9L 3A22A 1JZ4A 2ZEWA 5EJZB 1OD3A 2VO5A 3CMGA 3ZM8A 4LPLA 2W1UA 1OF4A 2C4XA 4XZUG 2CDPA 3IAPA 1GQPA 2ZEXA 4CUAA 2DCKA 4DXRA 5C70A 5JXIA 2DDUA 2LW8A 2VZUA 3CKHA 2QQLA 1K3IA 1JZ6A 3K4AA 2VMCA 1IQDC 2WZEA 3DYMA 1JZ2A 2QQNA 4W8JA 2VR4A 3OGVA 3HOBA 3OGRA 1CZSA 3I3BA 2VZSA 4OYUA 3PUIA 2WO2A 4BJ0A 1BHGA 2W92A 2X10A 3K77A 2VMFA 3I2JA 5IFTA 4JX0A 1UMHA 3EB7A 4P00B 3I2KA 2RJ2A 1JYNA 3MV11 3J7HA 3BGAA 3IDAA 3HNYM 3K75B 4Z2AA 3WNMA 2ZEZA 2Y8KA 5CZKA 3VDCA 4A6OA 1JYXA 4ARXA 3WNOA 3IAQA 4JKKA 2QQOA 2BGOA 1RYYA 2XOMA 1W0NA 3EYPA 3FL7A 2VMEA 4W50A 2HYXA 2LS6A 4MOAA 1F4HA 2W1SA 3WNKA 5I0DA 3LE0A 2W1QA 1PMJX 4CU6A 1OF3A 2JDAA 2WDBA 2WO3A 3GM8A 3ACFA 2WBKA 3VD7A 2VZRA 3LEGA 3NJVA 1NKGA 3HEIA 3T09A 3C7EA 3K4ZA 4MADA 3P6BA 1K12A 2YG0A 3C7HA 3WNNA 5IYYA 2V4VA 2QBXA 2VCCA 3I2GA 1PMHX 2WAOA 1ULOA 2ZEYA 4A44A 1SDDB 3A21A 1W9WA 3WF1A 2EIBA 4ARYA 4UAPA 1TVGA 4CVUA 3W5NA 4LQRA 2X05A 3WNLA 2WAAA 3SEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VD3 A;  3VD9 A;  1O8S A;  2VZP A;  3ABZ A;  4OZO A;  2J1V A;  5DMY A;  5HPO A;  5JXG A;  2OKX A;  3NQH A;  4QDS A;  3MBW A;  3JXS A;  5JXH A;  2YC2 A;  4QX1 A;  4BK4 A;  4DUX A;  2B9V A;  2WN3 A;  4AAX A;  2VC9 A;  5EJ1 B;  2VQU A;  5IFP A;  2VMD A;  2XQX A;  3WNP A;  3T0B A;  3VD5 A;  2ID4 A;  4FI9 A;  3C7O A;  4ZZ5 A;  1JZ7 A;  1WKY A;  4GWJ A;  3LQC A;  3ECQ A;  3NJX A;  4A45 A;  4DUW A;  3SEE A;  4PF1 A;  1NX9 A;  4LKS A;  2WYS A;  2E32 A;  2YFU A;  3U37 A;  1JYW A;  2L9L A;  2W87 A;  3I3D A;  3CIH A;  2KD7 A;  1W9S A;  1O59 A;  4BK5 A;  4ZZ8 A;  3GXU A;  5JMO A;  2J1T A;  1XC6 A;  1US3 A;  3PUH A;  2C9K A;  3OEB A;  1HN1 A;  2VQT A;  2W46 A;  3HNM A;  4QX0 A;  4M4R A;  2Y6G A;  5C71 A;  3CZJ A;  3ETP A;  5HXM A;  1K42 A;  3C8X A;  2EIC A;  2RVA A;  2Y6L A;  3SKV A;  1W8N A;  2V72 A;  4JKM A;  2J1S A;  5EIY B;  3DYP A;  1TG7 A;  2JD9 A;  3I2I A;  4ZY9 A;  1GMM A;  5LA1 A;  3F2Z A;  1H6X A;  2BZD A;  3MV0 1;  4CU8 A;  3E1F 1;  3WSO A;  1DP0 A;  4DEV A;  1YQ2 A;  1JZ3 A;  1UWW A;  2VZQ A;  1UY0 A;  4BXS V;  1CX1 A;  2WN2 A;  2W94 A;  4UOJ A;  1GU3 A;  4W4Z A;  4HG6 B;  4CU7 A;  3HPN A;  3THD A;  1JZ5 A;  2XHN A;  1JU4 A;  4GZ9 A;  2WAB A;  3OGS A;  1OH4 A;  3I3E A;  3T0D A;  2V5D A;  2ORX A;  1GUI A;  4ZXE A;  4CUB A;  5G05 L;  4XUP A;  1WCQ A;  3SKJ E;  4QAW A;  1GOG A;  1JI6 A;  1DYO A;  1T2X A;  2J1R A;  3A7Q A;  2QQI A;  1CZV A;  1L7Q A;  2XON A;  5A1A A;  4A4A A;  2BBA A;  1J83 A;  1UY3 A;  4A41 A;  1O8P A;  1W8O A;  4XUR A;  4JHZ A;  2VZV A;  2DCJ A;  4DUV A;  1SG3 A;  2CDO A;  4E8D A;  4DXS A;  3WF3 A;  2J1U A;  2YFZ A;  1GOH A;  1XNT A;  1UXZ A;  2VZ1 A;  4BDV B;  5B4N A;  4QPW A;  1JU3 A;  3K4D A;  3MUZ 1;  1CZT A;  1I5P A;  4QB2 A;  1UX7 A;  2YC4 A;  5C7G A;  1ULP A;  1SHW B;  5IJR A;  3I97 A;  4QX2 A;  2X09 A;  3FN9 A;  5LA2 A;  2VJX A;  4AG4 A;  4E8C A;  1XNA A;  5F7U A;  3GGL A;  3VDA A;  3LPF A;  4QDR A;  2VCA A;  4DEQ A;  4IUG A;  1D7P M;  1UY1 A;  4MO3 M;  1GNY A;  4OMC A;  4KMQ A;  4XUO A;  5JXJ A;  1UXX X;  3T0A A;  4P02 B;  4XUQ A;  3UNP A;  2R7E B;  2VM9 A;  4M4P A;  3LEI A;  2Y6H A;  1P8J A;  1OT5 A;  3DYO A;  1K45 A;  2W1W A;  3D3A A;  3WEZ A;  1L7R A;  5IHR A;  1W9T A;  4GWI A;  4ET7 A;  1US2 A;  2WO1 A;  5JUV A;  1KEX A;  4MGQ A;  5LA0 A;  2W3J A;  2VZ3 A;  4LHS A;  1W99 A;  2E33 A;  2W95 A;  3C7F A;  1GOF A;  3CQO A;  2WQ8 A;  1JHJ A;  1XPW A;  2Z4F A;  5DN2 A;  2QQJ A;  1MPX A;  2VZT A;  3HJR A;  2BGP A;  3A23 A;  3WQB A;  4QB6 A;  1EUT A;  1UY4 A;  2J1A A;  3DEC A;  3W5M A;  5LCW L;  3BN6 A;  3VDB A;  2WZ8 A;  1PX4 A;  2HLE A;  2VTF A;  4YPJ A;  5J1X A;  3IB3 A;  2W47 A;  2YB7 A;  4RN5 A;  2ZXQ A;  4XUN A;  2E26 A;  3OG2 A;  4TXW A;  2J7M A;  4L0P A;  4P08 A;  5G04 L;  3UES A;  3VD4 A;  1DLC A;  5B4X A;  1UYX A;  3AC0 A;  3T08 A;  2W5F A;  2VOT A;  5DPN A;  2VZO A;  3T2P A;  3ACH A;  3FHQ A;  3MUY 1;  4OMD A;  3K46 A;  2RV9 A;  3CDZ B;  4OUE A;  2WUH A;  3T2Q A;  3WF2 A;  4A3Z A;  2Y6J A;  1UYY A;  3HNB M;  2JE8 A;  3CZU A;  1F4A A;  3WF4 A;  3I2H A;  2E31 A;  2QQK A;  1CIY A;  4PQQ A;  1JZ8 A;  4PT6 A;  4CU9 A;  2QQM A;  1J84 A;  1NAE A;  3LPG A;  4TTG A;  3C7G A;  4XVH A;  4P5Y A;  5CYY A;  3UET A;  4QB1 A;  4QX3 A;  2W9X A;  1H6Y A;  4CUC A;  3ACG A;  4DXT A;  4MGS A;  3OEA A;  4D0Q A;  1PX3 A;  1KGY A;  1JYV A;  4KI5 M;  4XUT A;  2ORZ A;  1R64 A;  2BER A;  1UMI A;  1NUK A;  5DQ0 A;  3MO4 A;  2W91 A;  3HN3 A;  3OB8 A;  4QDQ A;  3T2O A;  2J1E A;  3NNG A;  3WF0 A;  3I2F A;  2J22 A;  4JKL A;  5FUI A;  1UYZ A;  2VCB A;  2Y64 A;  3GDB A;  2EIE A;  2PQS A;  1UY2 A;  3P1I A;  3THC A;  1UZ0 A;  2VL4 A;  2C26 A;  3FHA A;  4A42 A;  1LNS A;  3ACI A;  2EID A;  2JKX A;  1EUU A;  3III A;  3LEK A;  4D8M A;  4RYD A;  5JR2 A;  2B4K A;  3NRU A;  3OBA A;  2Y6K A;  4KWU A;  4UI9 L;  3A22 A;  1JZ4 A;  2ZEW A;  5EJZ B;  1OD3 A;  2VO5 A;  3CMG A;  3ZM8 A;  4LPL A;  2W1U A;  1OF4 A;  2C4X A;  4XZU G;  2CDP A;  3IAP A;  1GQP A;  2ZEX A;  4CUA A;  2DCK A;  4DXR A;  5C70 A;  5JXI A;  2DDU A;  2LW8 A;  2VZU A;  3CKH A;  2QQL A;  1K3I A;  1JZ6 A;  3K4A A;  2VMC A;  1IQD C;  2WZE A;  3DYM A;  1JZ2 A;  2QQN A;  4W8J A;  2VR4 A;  3OGV A;  3HOB A;  3OGR A;  1CZS A;  3I3B A;  2VZS A;  4OYU A;  3PUI A;  2WO2 A;  4BJ0 A;  1BHG A;  2W92 A;  2X10 A;  3K77 A;  2VMF A;  3I2J A;  5IFT A;  4JX0 A;  1UMH A;  3EB7 A;  4P00 B;  3I2K A;  2RJ2 A;  1JYN A;  3MV1 1;  3J7H A;  3BGA A;  3IDA A;  3HNY M;  3K75 B;  4Z2A A;  3WNM A;  2ZEZ A;  2Y8K A;  5CZK A;  3VDC A;  4A6O A;  1JYX A;  4ARX A;  3WNO A;  3IAQ A;  4JKK A;  2QQO A;  2BGO A;  1RYY A;  2XOM A;  1W0N A;  3EYP A;  3FL7 A;  2VME A;  4W50 A;  2HYX A;  2LS6 A;  4MOA A;  1F4H A;  2W1S A;  3WNK A;  5I0D A;  3LE0 A;  2W1Q A;  1PMJ X;  4CU6 A;  1OF3 A;  2JDA A;  2WDB A;  2WO3 A;  3GM8 A;  3ACF A;  2WBK A;  3VD7 A;  2VZR A;  3LEG A;  3NJV A;  1NKG A;  3HEI A;  3T09 A;  3C7E A;  3K4Z A;  4MAD A;  3P6B A;  1K12 A;  2YG0 A;  3C7H A;  3WNN A;  5IYY A;  2V4V A;  2QBX A;  2VCC A;  3I2G A;  1PMH X;  2WAO A;  1ULO A;  2ZEY A;  4A44 A;  1SDD B;  3A21 A;  1W9W A;  3WF1 A;  2EIB A;  4ARY A;  4UAP A;  1TVG A;  4CVU A;  3W5N A;  4LQR A;  2X05 A;  3WNL A;  2WAA A;  3SEP A; 
#chains in the Genus database with same CATH topology
 3LEM A;  3VD3 A;  3VD9 A;  5A3O A;  2RR1 3;  2Y0I A;  4XAA A;  2RMU 2;  1JUI A;  2WFF 3;  1EV1 2;  3WR0 A;  5JXG A;  4FPC A;  4CCJ A;  3BTZ A;  1OA4 A;  5FCC A;  3VBR C;  1FX5 A;  3NQH A;  1RUI 2;  2IFR A;  4XYX A;  3JXS A;  2JIC A;  4EN7 B;  5GZE A;  1ZRE A;  3U0Z A;  2HJI A;  4AI3 A;  2WN3 A;  4AAX A;  1W2N A;  4B8E A;  4RS5 C;  1HXS 2;  2KXL A;  3PVB B;  2SLI A;  3WP3 A;  4AHW A;  1W2O A;  5FWE A;  1D4V B;  4LXL A;  5BXX A;  4UFL A;  4LR4 A;  2BBV A;  3LWC A;  4ZZ5 A;  2ZGL A;  1U5X A;  5L9B A;  4K21 A;  1B35 A;  1JZ7 A;  4MXW B;  3A0K A;  4K7J A;  4YZ1 A;  3LQC A;  2ADD A;  3V0B A;  1NLQ A;  3IPV A;  5DUX A;  1HJF A;  3LDB A;  1NX9 A;  2RDS A;  4IV3 C;  2R30 A;  2WYS A;  2YFU A;  1JYI A;  3HR9 A;  1LOD A;  2LAL A;  5I93 A;  2VUA A;  1KFU L;  3M3C A;  3OBT A;  2BNN A;  4H3W A;  1NXM A;  3HBZ A;  4LLF A;  4ONU A;  3E6D A;  4Q4W 2;  1VRB A;  1LOF A;  5F5A A;  3PUS A;  4Q29 A;  3S7I A;  5K0U C;  5J96 B;  3RZL A;  2ZGQ A;  5JMO A;  3GXU A;  2XWB B;  1OUR A;  1XC6 A;  1VBC 3;  2RM2 2;  1M4W A;  3AMP A;  2D7F A;  2HWC 3;  1IG3 A;  5IAV A;  5DAW A;  2F17 A;  3MIF A;  3ZR5 A;  4CCK A;  4XQD A;  5FYY A;  3ES4 A;  2WNU B;  3MPB A;  2I2S A;  5ABJ A;  4QX0 A;  2DV9 A;  1KQR A;  2P1B A;  3MW2 A;  3ZIW A;  4V2V A;  1RUF 2;  1DQ2 A;  1N1V A;  4D7S A;  3C8X A;  4FPY A;  4COY A;  3ELN A;  4M3C F;  4YM0 A;  4BCU A;  1CON A;  3BIW E;  3VBH B;  1LOE A;  3H7Y A;  2R06 2;  5A7S A;  5BNQ A;  5I0S A;  3ZYB A;  2V72 A;  1UU6 A;  3GZE A;  1E5H A;  2YPD A;  3BOP A;  1GSL A;  5EIY B;  4LBL A;  3PIG A;  2KR2 A;  3MPP G;  4H55 A;  2HYK A;  4QX8 A;  2ZGK A;  1I9R A;  2E63 A;  1CJD A;  3NV4 A;  3MV0 1;  1OFN A;  3E1F 1;  3NAP B;  4UFI A;  1C57 A;  3ZYG A;  2R32 A;  3S5A A;  1R08 3;  1QOO A;  5JIA A;  1AR9 1;  4LK7 A;  2O14 A;  3G7D A;  2QDN A;  4TYS A;  1DQ6 A;  5C4W B;  2ENR A;  3CO2 A;  4D6R A;  1UY0 A;  2EF6 A;  1K5J A;  3WXP A;  2CU5 A;  4CDU B;  2FDK A;  2R1D A;  1H2K A;  2WZR 3;  4B4R A;  2W94 A;  1IS5 A;  1GU3 A;  5JWP A;  1FPN 3;  3ST7 A;  1W2T A;  3IMM A;  4MHU A;  3IM0 A;  1STM A;  1JU4 A;  4R8H A;  4I0A A;  1Y4W A;  4UFK A;  3VBU B;  1X8M A;  3I3E A;  2V5D A;  3ZDV A;  3T0D A;  1LKN A;  4Q4X 2;  5FYB A;  2Y38 A;  4ZXE A;  5G05 L;  4NO4 A;  1AR8 3;  1QNY A;  4Y1X A;  4NHK A;  4BHP A;  1H8T C;  1S0C A;  3RNS A;  4AFC A;  3DPR C;  4AF9 A;  5IK8 A;  1ZRC A;  5FWJ A;  1GOG A;  2ERF A;  2AEZ A;  1IPS A;  1DYO A;  2DBI A;  3B93 A;  5HCA A;  2YDE A;  2DUQ A;  1ND3 C;  2LRO A;  1DYK A;  5FV3 A;  5L7O C;  1L7Q A;  2QQW A;  4IGO A;  2XON A;  2HEW F;  3MF9 A;  3V65 A;  3RSJ A;  2CY6 A;  2YV8 A;  5A3M A;  4P14 A;  3UK9 A;  2PHT A;  4XTP A;  2BBA A;  2GNT A;  3ZIX A;  2OVU A;  3FFQ A;  4EN9 B;  1W8O A;  2NLR A;  4E4S A;  2A3Y A;  4QPI C;  4DUV A;  5C3Q A;  1V9U 3;  4M0N A;  4UXA A;  4NVP A;  4FPE A;  1ZBE 3;  2J1U A;  4UF0 A;  3RYK A;  2R04 3;  4PI0 A;  1CAU B;  5B4N A;  1JU3 A;  1BQP A;  1HJG A;  2FDF A;  4QB2 A;  4PDW A;  5FZ7 A;  5GJ6 A;  5FZ0 A;  4HKO A;  2ZHM A;  4URT A;  3UJO A;  2V09 A;  1S0E A;  3MLL A;  4AR2 A;  1Q8Q A;  3ME2 A;  1RGS A;  3WUC A;  3MHZ A;  2EAK A;  1TMF 2;  3QH7 A;  5A3N A;  3O1P A;  3I97 A;  5DAX A;  3FBM A;  4QHZ A;  4GH4 B;  4MXW A;  3AJZ A;  4I0W B;  4XMA A;  4Y1V A;  5FPZ A;  5LAT A;  3BU7 A;  4QKD A;  2UYA A;  4V2W A;  3D0J A;  2ETE A;  3ETQ A;  1XNA A;  3INA A;  4E8C A;  3IN9 A;  3B7M A;  4B7E A;  5F7U A;  3GGL A;  2JDM A;  2PLV 2;  2CTV A;  1NCR C;  4QDR A;  2VCA A;  4DEQ A;  1VMH A;  3PUA A;  1F31 A;  3LDR A;  5KHH A;  3RZH A;  3AKQ A;  3HBK A;  4DRR A;  1UY1 A;  2HWC 2;  2XJR A;  4KMQ A;  4YZ2 A;  1OOP A;  1VE0 A;  1S2K A;  2LTN A;  5FY1 A;  5JXJ A;  2CWM A;  3WP6 A;  3NV2 A;  4ZU7 A;  3D82 A;  3UNP A;  2OXB A;  5FZL A;  1FV2 A;  1F8V A;  3O1R A;  2PA7 A;  1PIV 1;  1FYU A;  3LEI A;  4AVC A;  2XBO 1;  3PUR A;  4BQ2 A;  1BVV A;  1OT5 A;  3MYX A;  3W20 A;  1PGW 2;  5FZG A;  3LD8 A;  2GP3 A;  3ZFF B;  3D3A A;  4M3C B;  1UU5 A;  3WY6 A;  1J1L A;  5F9T A;  1EP0 A;  2P5B A;  1QJU 1;  3FHI B;  4AEM A;  4NII A;  5DUV A;  1DG6 A;  1US2 A;  2GSY A;  1JOJ A;  2MPF A;  3QH6 A;  4N7I A;  4NR1 A;  4LHS A;  5LA0 A;  1W04 A;  3VBH A;  3RYP A;  5KXE A;  3B00 A;  5CIS A;  3C7F A;  5FZO A;  2C0Z A;  3AZZ A;  1YLL A;  3AVS A;  4O65 A;  1V6M A;  1CX4 A;  5CNA A;  2BFU L;  4BM8 A;  1VJ2 A;  1XPW A;  1DBN A;  2Z4F A;  3KGL A;  3KQ4 B;  4IEZ A;  4AVS A;  3VUO A;  3NV1 A;  2ZAA A;  3I49 A;  4AFB A;  4AVT A;  5HBA A;  3DXU A;  3CJI C;  3HJR A;  2BGP A;  2F6B A;  2ZS6 B;  3POY A;  4FPL A;  2ZAH A;  3B5L B;  1U0A A;  4QB6 A;  3LSE A;  1EUT A;  3VBF B;  2J1A A;  1RUD 2;  1AYN 3;  1VRH 1;  1S0F A;  2XVL A;  4CCE A;  5KHG A;  3H8X A;  3BTX A;  3IKW A;  4EN8 B;  5C4W A;  5LCW L;  2ATF A;  3BN6 A;  1POV 3;  2OPW A;  2WZ8 A;  1FAY A;  2VVF A;  2ZHK A;  1H30 A;  4YPJ A;  4BLI A;  4D3W A;  1VP6 A;  5J1X A;  5C33 A;  2K46 A;  5CBL A;  4YGC A;  2VW1 A;  4QXK A;  4Y1U A;  2ZXQ A;  2XXZ A;  2DYC A;  1NOV A;  3OG2 A;  3BPS A;  2UYB A;  2DCT A;  2DTY A;  4P08 A;  3WG3 A;  4NPR A;  1XOY A;  1ZBA 1;  2AAC A;  2PMW B;  4Q1P A;  4YW7 A;  5FMO L;  4KWJ A;  5FP9 A;  4FTS A;  3VBU A;  3N9N A;  2WR9 A;  1LGB A;  4KGG A;  3RDI A;  3ZSE A;  1AYM 2;  1QJY 2;  2PXJ A;  2VOT A;  3H9A A;  3QAC A;  1FOD 3;  1EAH 1;  1CES A;  2HKX A;  4HON A;  2WZP P;  2FCT A;  1LHO A;  3FHQ A;  1ZVF A;  3MUY 1;  4OMD A;  1AX0 A;  3AP7 A;  1H4G A;  3K46 A;  2RV9 A;  2R0H A;  2RG4 A;  4AOC A;  3FLT A;  3KVB A;  1V00 A;  1G9C A;  4OUE A;  3RG0 A;  3VZJ A;  2Y6F A;  2Z2S B;  3T2Q A;  1N1T A;  5GZF A;  2QZ2 A;  3M4F A;  4BIF A;  1A78 A;  1O91 A;  4NIH A;  1Q8P A;  1OQE A;  1HB2 A;  3HNB M;  1V9U 2;  2P6C A;  1ZA7 A;  4P9W A;  5KBF A;  1F4A A;  2RMU 1;  1EV1 1;  3I2H A;  1DGW X;  1UOB A;  2WT1 A;  4DRV A;  5C9A C;  1QQP 3;  2EVX A;  1RUI 1;  2CAV A;  4R9B A;  2DVF A;  2VW2 A;  1GQG A;  1C3H A;  1Q3E A;  1Q8O A;  4HFS A;  3GHM A;  2ZOE B;  3T3Y A;  2FDI A;  3C7G A;  1ULD A;  3UET A;  3NO8 A;  2WIN B;  4UWD A;  3NKT A;  4AZZ A;  3SCH A;  2XL9 A;  5LAS A;  1HXS 1;  1CAU A;  1AJK A;  2W9X A;  4N43 C;  5EP9 A;  2SBA A;  4X8N A;  2A3W A;  3AZX A;  2Q8O A;  3ACG A;  4DXT A;  3ITQ A;  3OEA A;  2Q8E A;  2DUO A;  2B9U A;  5GLW A;  1KGY A;  1NCQ A;  2N7G A;  4Y1Y A;  3HMY A;  2B46 X;  4FAG A;  2I45 A;  3WDU A;  3ZXE A;  1NE6 A;  1UU4 A;  2FDJ A;  2JG9 C;  1UMI A;  5FPB A;  4IND A;  5DQ0 A;  3PVE A;  5FZA A;  3MO4 A;  3HN3 A;  4QDQ A;  2OT7 A;  1UIJ A;  1YQ5 A;  4Q4W 1;  1UPS A;  3ATG A;  1IPK A;  3WD5 A;  1V6N A;  4FAH A;  3MI8 A;  4E2G A;  5BNO B;  3BKZ A;  1SBD A;  1KDK A;  1SBF A;  2RM2 1;  4N53 C;  2Y64 A;  4YW1 A;  2GMM A;  1OXC A;  5H9S A;  5DZF A;  4A3X A;  1AUY A;  4KGQ A;  1AR9 3;  2JDH A;  1VB2 A;  5EPA A;  3VBR B;  3MZH A;  3IT8 A;  4BMB A;  3DCQ A;  1UZ0 A;  1PK6 A;  4YVW B;  1ACC A;  4Q0Q A;  3ZFE A;  5FXX A;  5IVC A;  3S0M A;  1RUF 1;  3MGU A;  2ZX4 A;  1DDL A;  3FHA A;  3PTR B;  4K20 A;  4WVW A;  1LUL A;  3TEY A;  2QDR A;  4RS5 B;  1SFP A;  4AQT A;  2R06 1;  3III A;  4LBN A;  2NYY A;  4RYD A;  4GWN A;  5JR2 A;  4XQ4 A;  2QE3 A;  1SCR A;  2B5H A;  2Y6K A;  1KJR A;  3D6E A;  3OBA A;  4KWU A;  3AVR A;  1SLC A;  1ASJ 3;  3A22 A;  3AMH A;  3K3O A;  5L36 A;  1OHF A;  1H0B A;  3PTY A;  1NXD 1;  1PZ7 A;  4IV3 B;  4LPL A;  2CSG A;  2TUN A;  4OQ9 A;  2D93 A;  4MLO A;  5FBJ A;  1XE0 A;  4S2H A;  4XBQ A;  5JOW A;  5F37 A;  4GJZ A;  4XZU G;  2GP5 A;  2NQY A;  3IAP A;  4P5H A;  4DNY A;  2ZEX A;  5J3U A;  5K0U B;  2ZA9 A;  4DXR A;  2ZCW A;  2E6V A;  4L2N A;  1HQN A;  2O0O A;  1BMV 2;  1RED A;  1ENQ A;  1FOD 2;  3FUO A;  2JD4 A;  1JZ6 A;  1JOB A;  5HCF A;  1OOP C;  3TB0 A;  2QQN A;  1URX A;  2IZW A;  4A7K A;  4Q4X 1;  1CPM A;  2QFE A;  3I3B A;  1MEC 3;  2YPJ A;  5K9Y A;  2C1F A;  1F5F A;  4LBQ D;  3USU A;  2UUR A;  2NM1 A;  5DZG A;  1BHG A;  1WCS A;  4XET A;  5F5C A;  4QKF A;  4BH9 A;  3O1V A;  1R1Z A;  3N3H A;  2XLA A;  1CQ9 A;  3LCP A;  1UMH A;  1MQT C;  1QDO A;  1OSG A;  1HRV 3;  2WKK A;  3BVC A;  3EB7 A;  3I2K A;  4ASL A;  1UD1 A;  3WVJ A;  1VB4 A;  3W59 A;  4AHZ A;  1CAV A;  1QQP 2;  5FOB B;  3N4M A;  1SQ4 A;  4LUM A;  5FJK A;  3I54 A;  3ZO0 B;  1QIQ A;  4H2A A;  3LIH A;  4GAL A;  5GLZ A;  3T30 A;  1MZ5 A;  3H1M A;  3BGA A;  1W6M B;  3DKQ A;  5F2W A;  3CBN A;  3RYR A;  3I4I A;  4HK8 A;  3VDD C;  4Z2A A;  5APA A;  3JBG 3;  2ZEZ A;  5CZK A;  4Y33 A;  3VDC A;  2P3K A;  4YM1 A;  3NNM A;  2H0V A;  3SNM A;  3ZYJ B;  2VMG A;  2UWB A;  3WW2 A;  4E4Z A;  1YQ8 A;  4JHT A;  4X8P A;  3WNO A;  5FZ6 A;  2P6H A;  5GLV A;  3THP A;  2NPI A;  1LOB A;  2GH8 A;  2BGO A;  1RYY A;  1PIV 3;  3N9Q A;  1BJQ A;  2JIG A;  1E57 A;  1J1T A;  3FL7 A;  5IVY A;  4JZR A;  1YRZ A;  1PM7 A;  3J8F 2;  1TMF 1;  5A3P A;  5CFD C;  4PJY A;  3PL0 A;  4JDN A;  2FZ2 A;  4SLI A;  2IVJ A;  2G4I A;  4J25 A;  2W1S A;  1O4T A;  1RMU 3;  2G19 A;  3J7M A;  3BYW A;  5ISL A;  1DU3 D;  1VIW B;  3VHN A;  3ZYI B;  4FT8 A;  2PLV 1;  2ZAB A;  1AR7 3;  1VBD 3;  1OLQ A;  2A6Y A;  3B02 A;  3K3N A;  3M1H A;  3DPR B;  3LFM A;  4I3P A;  1RUJ 3;  2DF7 A;  1OI6 A;  2VPV A;  1GBG A;  2AC1 A;  4TLF A;  1MS8 A;  5CIR A;  2HWC 1;  2QTW B;  2YBP A;  3IWZ A;  4WM8 C;  5FLH A;  5L7O B;  3V64 A;  1AR9 2;  3VD7 A;  5IWF A;  2BNO A;  5A7Q A;  2WNV C;  3NJV A;  2VBB A;  2AYH A;  4GJY A;  1RUN A;  4YVS B;  4HKW A;  3T09 A;  4MAD A;  4CDX B;  2BGC A;  2XWJ B;  1G9A A;  4IV1 C;  2YG0 A;  1PGW 1;  1APN A;  1VRH 3;  4CRQ A;  3WNN A;  2V4V A;  1Y9Q A;  2EA7 A;  2VCC A;  4AAP A;  4EN0 A;  4BQ1 A;  3KHC A;  3SCG A;  2WAO A;  1K5M C;  2ZEY A;  5A6Q A;  1QJE A;  1Q5O A;  1W9W A;  4O7X A;  3OUI A;  4ARY A;  3CNA A;  2NN8 A;  4CVU A;  5LY2 A;  2WSU A;  2MHF A;  2X05 A;  1YFX A;  2YC0 A;  3VKN A;  1ASJ 2;  4QU2 A;  5E88 A;  3U4S A;  2D44 A;  5C8C A;  3NJY A;  4AED B;  1O8S A;  2BVB A;  1OPO A;  1S2B A;  3ABZ A;  4RGK A;  2J1V A;  4IEY A;  1WW6 A;  1C5I A;  4AW7 A;  3OPZ A;  2OKX A;  1OBN A;  2BFU S;  4CEW C;  4JRA A;  1UIK A;  4QPG B;  4XAB A;  3KM5 A;  3MBW A;  3OSD A;  4HPK B;  4YWA A;  2ZAC A;  2YC2 A;  4JGY B;  5J48 A;  4QX1 A;  1S0D A;  2A6X A;  3AL5 A;  2B9V A;  1NCQ C;  2PQQ A;  4CP0 A;  3ZMN A;  3ZYF A;  2QJV A;  3GAL A;  1F15 A;  1PVX A;  3B9I A;  1RUD 1;  4YZ3 A;  4BYY A;  2XVK A;  2JG8 B;  1ZZ6 A;  4TZD A;  4NWV A;  2JB4 A;  2XQX A;  2A73 B;  4HVQ A;  3T0B A;  1OKQ A;  4QGM A;  3C7O A;  2IXI A;  2YU2 A;  2RMU 3;  3DGT A;  3GBW A;  1XYP A;  3KCX A;  5JVV A;  5FO8 B;  1XSR A;  5F2S A;  1MEC 2;  4LOS A;  1JS9 A;  2EIG A;  3NJX A;  5CVR A;  4Y20 B;  4A45 A;  3VGI A;  2DU0 A;  2VY0 A;  3KT4 A;  4LKS A;  5FYZ A;  4XJW A;  3SH5 A;  3VHO A;  1AYM 1;  1QJY 1;  1DZR A;  5KXD A;  4AI2 A;  1IS3 A;  1A6C A;  4LIT A;  1HRV 2;  2ILM A;  1HXS 3;  5C5U A;  4YW2 A;  1U12 A;  1PK6 C;  2Z79 A;  3NVC A;  2BVV A;  2E51 A;  4K40 A;  5FZ8 A;  1KS5 A;  4ZZ8 A;  2B7Y A;  5CEH A;  1VPH A;  4JGY A;  4ES8 A;  5JCT A;  2RS3 2;  1HRI 3;  1W39 A;  2WLP A;  1UKG A;  3OEB A;  4HOO A;  1V9U 1;  3EQE A;  3JBG 2;  1F2N A;  1HN1 A;  3S5Q A;  2ES3 A;  2W46 A;  3HNM A;  1CAX B;  3AXE A;  4JQR A;  4M4R A;  4V1P A;  2WO7 A;  4EV0 A;  1RXG A;  1VAK A;  5C71 A;  1HV0 A;  4Y5T A;  3CJI B;  3VKM A;  1K42 A;  5J98 B;  4C0B A;  1CGP A;  2RVA A;  3GNE A;  4NHL A;  4Q4W 3;  4CYD A;  3L2Y A;  2Y6L A;  3SKV A;  4RL7 A;  3JCI A;  1W8N A;  4QKN A;  1YYN A;  5L9R A;  5LW9 A;  1O5U A;  2CGN A;  3OUJ A;  4EE2 A;  4EYU A;  2J1S A;  5LY1 A;  3DYP A;  3B9C A;  3ZYP A;  4E27 A;  3KZ4 C;  4UW5 A;  2OX0 A;  5FZE A;  1GMM A;  4OVE A;  4ATF A;  3K51 A;  1RMU 2;  3AYC A;  3J7L A;  1O3T A;  3I7D A;  4QD2 A;  3VKF C;  5KXB A;  3CEW A;  3WSO A;  1AR7 2;  1VBD 2;  3RI8 A;  4U36 A;  4G4F A;  1RUJ 2;  1RUF 3;  2FHR A;  3EBR A;  4UBH A;  3LA3 A;  2ZPX A;  5JI9 A;  2VZQ A;  4XF3 A;  2WFP A;  4AGR A;  4BXS V;  2R06 3;  1GNH A;  5ACA 2;  5FK8 A;  2BOI A;  2X5I C;  2JDU A;  5DDJ 2;  4YM3 A;  3OYW B;  1GWL A;  2VBP A;  4HG6 B;  4W4Z A;  2XDV A;  1XNB A;  1KS4 A;  4Q8L A;  5FDB A;  4FFI A;  1NE4 A;  3ZSM A;  2XHN A;  1A3K A;  5BNP C;  3H8O A;  3LOB A;  3IDB B;  4P9G A;  2GH2 A;  3U07 A;  3TN9 2;  2PHU A;  2WAB A;  3OGS A;  2HBT A;  5J7M A;  1OH4 A;  3Q8F A;  5FZF A;  4HZF A;  4HKL A;  1MR5 A;  5L19 A;  5FZB A;  2JEM A;  4B7K A;  3U11 A;  4CUB A;  2ZHN A;  3PU8 A;  5C9A B;  1ZRD A;  4YVS A;  3SKJ E;  5FYV A;  3HAG A;  4QAW A;  4CDX A;  4CEY C;  5BNN C;  2P3I A;  4DS0 A;  1ND2 A;  4CXX A;  4AVB A;  1OKO A;  2YMZ A;  2IVI B;  2J1R A;  1JYC A;  4IE4 A;  3VBS C;  2PAM A;  1J3P A;  2YHJ A;  4BZ4 A;  2JE9 A;  2Q8C A;  4AWD A;  5J09 A;  1HQL A;  1LEN A;  4A4A A;  1O3Q A;  1FXZ A;  3VKO A;  1J83 A;  4OHY A;  1N1S A;  2KM2 A;  1O8P A;  4AED A;  2JDZ A;  4JHZ A;  1NT0 A;  4Q4X 3;  1Y7B A;  4WM7 B;  3AYD A;  3SC7 X;  2MNG A;  1BYH A;  3LB9 A;  4CDW C;  4MET A;  1SG3 A;  1JTZ X;  4E8D A;  4YZ5 A;  2DCY A;  4Z82 A;  4OI2 A;  3R4D B;  4Q0U A;  4QKB A;  4QPG A;  3WF3 A;  5IAT A;  1TE1 B;  2JG9 B;  2D6O X;  2P2K A;  1POV 1;  1UXZ A;  4JGZ B;  4TWT A;  4Y4Y A;  2D5F A;  2VQA A;  1GZW B;  1CZT A;  1YFU A;  3DKW A;  2OQ6 A;  3FE5 A;  3MUZ 1;  4MGZ E;  2PAK A;  2W2I A;  4Q1R A;  1UX7 A;  1LHV A;  5EHD A;  2JG8 A;  4E9K A;  4HL0 A;  2YC4 A;  4AFA A;  5C7G A;  2IWG B;  1FNZ A;  3IIA A;  4KBB A;  4BQY A;  5D8A C;  1SHW B;  5IJR A;  3ZFG B;  5LEJ A;  2G1M A;  2C5D A;  5A32 B;  2ZGT A;  1G9B A;  1WZX A;  4LLO A;  2XQR A;  4RHV 2;  1FOD 1;  3LOI A;  1D0G A;  1UQX A;  3GHN A;  3I59 B;  3BCW A;  1F35 A;  1W6O B;  4AE2 A;  3OGG A;  3O1T A;  3AP6 A;  4OUM A;  5I91 A;  3TWI A;  4IEO A;  3MLK A;  4FPG A;  4CDQ B;  4MUV A;  2BNM A;  1D7P M;  3KV5 A;  5A1F A;  1YQ6 A;  1KRI A;  1B09 A;  2CNA A;  3ZXA C;  4XUO A;  1GNY A;  1BBT 3;  4EZ4 A;  1HRI 2;  1T6G C;  1ENR A;  1XRU A;  4XF9 A;  3WDX A;  1J58 A;  5I0T A;  1DGR N;  2PHD A;  2ZML A;  3E97 A;  4IGQ A;  4ZON A;  1TMF 3;  5EWS A;  3RMY A;  1BK1 A;  5A70 A;  1HV1 A;  3BI3 A;  1QOT A;  1QQP 1;  5HCH A;  1EY2 A;  4HK9 A;  4C1X A;  3PVO A;  1W2A X;  4PCR A;  4GMP 0;  1WA4 A;  1K45 A;  1HDK A;  1UYP A;  2PLV 3;  4EWD A;  3WEZ A;  1R09 3;  5CFC C;  5IAX A;  1OA3 A;  2E9Q A;  3AMN A;  4DZG A;  2ZGN A;  4GWI A;  3U1X A;  1OQ1 A;  1R1A 2;  5IVJ A;  1W6P B;  3EXU A;  3NJZ A;  2WO1 A;  4MGQ A;  2A75 A;  2W3J A;  1IS6 A;  2VZ3 A;  2WSV A;  1O7F A;  1ULF A;  2E33 A;  4FFG A;  1J3Q A;  1JH5 A;  3RMX A;  4M01 A;  5LB6 A;  2XML A;  5DN2 A;  3ZSK A;  2IXH A;  4NIG A;  3P3N A;  1XNC A;  3J8F 1;  4YGB A;  1AVB A;  2QQJ A;  2QUO A;  3KD4 A;  2VZT A;  3ON7 A;  3P5B A;  4OI0 A;  1GFF 2;  3A23 A;  2FD8 A;  4YAR A;  3WQB A;  1W9Y A;  3FJS A;  4N8M A;  1NYW A;  4XDP A;  4JDO A;  4LIV A;  1I5Z A;  2Y26 A;  3MF6 A;  1LRH A;  4D6Q A;  2BWA A;  2ZGM A;  3W5M A;  3BTY A;  1WLW A;  5GM0 A;  3WW3 A;  1O5L A;  1AX2 A;  1GWK A;  4YG0 A;  4MGY E;  5JOY A;  2GN3 A;  1GP4 A;  1VMJ A;  3IB3 A;  3OYW A;  3VBO A;  3RZM A;  1PGL 2;  4RN5 A;  1MQT B;  4G9S B;  4O61 A;  5C5T A;  4XUN A;  2E26 A;  4LOR A;  4GB3 3;  2J7M A;  4L0P A;  5G04 L;  5GLT A;  3VD4 A;  3N7J A;  1LR5 A;  2ARB A;  1UYX A;  3AC0 A;  3FLP A;  3OPW A;  4Z8B A;  5DXD A;  3MFA A;  2W5F A;  4RR3 C;  3VZK A;  2VZO A;  1BVP 1;  2VUL A;  4ES9 A;  1RUD 3;  1YXW A;  4IDZ A;  5F3C A;  3RZZ A;  4LBK A;  2BUK A;  2PAE A;  5FLJ A;  5F5I A;  4HXC A;  4C1W A;  1W9F A;  3UV9 A;  4A3Z A;  2QNK A;  1W0O A;  5FY9 A;  1F9K A;  4I0B A;  4Y3O A;  1UYY A;  1QEX A;  1UL9 A;  1ASJ 1;  2YY1 A;  4BQ4 A;  1YCI A;  5FKB A;  3J26 N;  4HT1 T;  2WA3 A;  3ZMO A;  3WT3 A;  1BZW A;  1NA1 B;  4XAC A;  2HWF 2;  1YO8 A;  2D6N A;  3TNP B;  4ISR A;  1AYM 3;  1FV3 A;  1LES A;  1QJY 3;  2C9A A;  3ILR A;  4U2A A;  4CXW A;  1LAJ A;  4WM7 A;  3QOP A;  5B2G B;  4CCL A;  1BEV 3;  2QQM A;  4A2U A;  1PO2 3;  3LPG A;  1LGN A;  4HMZ A;  4YLZ A;  1LHU A;  2HH9 A;  4P5Y A;  3JU9 A;  4RFT 0;  5CYY A;  3FMG A;  1JOP A;  1ZA4 A;  4QB1 A;  5FMC A;  5CKN A;  1MS9 A;  4JGZ A;  1QXR A;  1GZW A;  1OA2 A;  3KF3 A;  3CHX A;  4KWK A;  1H6Y A;  5FYI A;  1SBE A;  1HB3 A;  1IS4 A;  1PX3 A;  4D0Q A;  2FCV A;  4FFH A;  1MEC 1;  4ZS3 A;  3KWV A;  4QWN A;  1R64 A;  3OY8 B;  2BER A;  1TZO A;  1NUK A;  1IHM A;  1QJF A;  2W91 A;  4LKE A;  1BBT 2;  1GYK A;  4AXO A;  4FBF A;  3PME A;  1FMD 2;  2JDP A;  3GJB A;  1UW8 A;  4CDQ A;  2YXS A;  1HRV 1;  4Z92 B;  1AJO A;  2YGM A;  5A33 B;  2PHR A;  1K5M B;  3HT1 A;  3AKR A;  4JKL A;  1MS4 A;  4IE0 A;  4QQP A;  5IVE A;  5FUI A;  4D69 A;  5FP8 A;  3ZSJ A;  1UYZ A;  1ND2 C;  3VV1 A;  3NL1 A;  2GME A;  4RQP C;  2RS3 1;  5JR7 B;  2OUJ A;  2PQS A;  3K2O A;  1R09 2;  4PLO A;  1BXH A;  4Q4Y 3;  5EJ3 A;  4EWA A;  5EFU A;  4CEW B;  3AK0 A;  3JBG 1;  1TME 2;  1GLH A;  2WA4 A;  3P1I A;  1NG0 A;  4XFI A;  1QF3 A;  2C26 A;  3D8C A;  3ES1 A;  3WG1 A;  2JIJ A;  2P34 A;  2QZ3 A;  2GZW A;  2EID A;  1CN1 A;  4BWO A;  2IC1 A;  3ZXK A;  3LEK A;  3APB A;  2UU8 A;  3POW A;  5HI0 A;  2ZX2 A;  1W6Q B;  4QT6 A;  3ZR6 A;  4B1L A;  3NRU A;  2WNU A;  4KBZ A;  5EXO A;  4AI1 A;  4UI9 L;  3WUD A;  1RMU 1;  1WCK A;  2X29 A;  5EQU A;  5KHK A;  2D3S A;  4LKF A;  3U4X A;  1T6B X;  3LA2 A;  1OD3 A;  2K2S A;  4BB3 A;  1AR7 1;  1VBD 1;  4UW3 A;  2VO5 A;  3ZM8 A;  3WG4 A;  4FPH A;  2W1U A;  1W8H A;  2RS5 3;  1RUJ 1;  3O14 A;  1YI7 A;  1Q56 A;  3KV6 A;  3IDC B;  4HAN A;  4CP2 A;  5E1R A;  1JHN A;  1OC1 A;  2LUW A;  3GBF A;  5ACA 1;  2ZX0 A;  1O4Z A;  4GB3 2;  1VLN A;  5DDJ 1;  4NRP A;  1V0A A;  2DDU A;  4HVO A;  5A3L A;  4A7Y A;  5A3W A;  1B35 C;  2WL1 A;  3NAP A;  4IES A;  4LO4 B;  3CKH A;  3TN9 1;  2Y33 A;  3H7J A;  1K3I A;  3K4A A;  2HEY F;  1NZI A;  2WZE A;  1GV9 A;  3E5U A;  1W90 A;  4OQ8 A;  5FK7 A;  5C3P A;  4IEU A;  4XJ8 A;  1XQN A;  3OGR A;  1CZS A;  4AGG A;  4W6Y A;  4I30 A;  1LHW A;  4CDU A;  4OUL A;  4Y26 A;  1X33 A;  5AC9 3;  3PUI A;  4FVV A;  3ZN6 B;  1A8M A;  1HB1 A;  1FT9 A;  5FPL A;  2EXH A;  1LOF C;  2TNF A;  3GF6 A;  5CA6 A;  1MS3 A;  5K4L A;  3KV4 A;  4JX0 A;  1G9F A;  5FZC A;  2OYZ A;  4XQW A;  2O8Q A;  1RUG 2;  4JQT A;  2CGO A;  1RIR A;  4MGI E;  4FOY A;  3OBZ A;  4CP9 B;  5LBB A;  3TEX A;  3RZK A;  5ANN A;  3U78 A;  1BEV 2;  1QWR A;  1PO2 2;  1RL3 A;  1NA1 A;  5ABJ C;  3AX4 A;  3K75 B;  1CWP A;  1E5R A;  3WNM A;  5F1R A;  4H14 A;  2WNE A;  3VHR A;  2EAL A;  2Y8K A;  2OZJ A;  1A34 A;  2Q30 A;  1V6I A;  4I09 A;  3VHP A;  4ARX A;  2IUW A;  3RJR A;  4WZC A;  4XBL A;  1CD3 G;  2D3R A;  1YIP A;  2X5I B;  5KXC A;  2OZ6 A;  5T54 A;  5GZC A;  1SEF A;  3Q9O A;  3H8U A;  2XOM A;  4BQ3 A;  2YYO A;  4QX5 A;  2HEV F;  2XJU A;  1BMV 1;  1GR3 A;  2R1B A;  5BPX A;  4LE4 A;  3VZO A;  2VME A;  2X8K A;  4A7Z A;  5FXZ A;  4OI4 A;  4W50 A;  2VEC A;  3EHK A;  4RHV 1;  1UZW A;  4XJZ A;  3H3L A;  1POQ A;  5I0D A;  3LE0 A;  4HBN A;  4QXC A;  3OY8 A;  2WC2 A;  1OF3 A;  5FOJ B;  1SFN A;  2GNB A;  5D2A A;  1H2L A;  4CEY B;  3FX3 A;  1SCS A;  4C90 A;  4PBO A;  5JZG B;  3CL1 A;  2MEV 2;  4BIS A;  3VBS B;  4P9Y A;  1HRI 1;  3E6B A;  3CU7 A;  3GM8 A;  4DOU A;  1UOF A;  4Q4Y 2;  1H2N A;  2WBK A;  4A6S A;  4GH4 A;  1E5S A;  2VZR A;  5DAP A;  4OFG A;  2DCZ A;  2DVG A;  2XKP A;  2ZX3 A;  3J8F 3;  4IE5 A;  3SH4 A;  3LEG A;  5LBF A;  3HEI A;  3POS A;  3D4K A;  2A6W A;  3SLI A;  3WHU A;  3C7E A;  2WII B;  3P6B A;  4QQ2 A;  3TEW A;  4XFB A;  2EXK A;  2R07 3;  3I2G A;  2VOX A;  2B39 A;  3O1O A;  2ARA A;  3IDE A;  3A21 A;  1R1A 1;  4WZF A;  1QJX 2;  4QGL A;  1VBE 3;  1TVG A;  3W5N A;  4IET A;  2D3P A;  3NW4 A;  1JZ2 A;  2A6V A;  4K9S A;  1S0J A;  1MS5 A;  4WVM B;  5FZD A;  1RIT A;  4FXK B;  2HWB 3;  1CPN A;  4AYU A;  2BOJ A;  1WCD J;  4OZO A;  1OQD A;  1RHI 2;  1EYB A;  5HPO A;  2RS5 2;  1AXY A;  2ZHL A;  3OBR A;  4OLL A;  1S4C A;  4M3C A;  3ZFF A;  1G9D A;  3T1M A;  3AFK A;  5DG1 A;  5JXH A;  2BTV C;  4I3G A;  5GZG A;  4BK4 A;  4DUX A;  3ZXG A;  5HV0 A;  1ODM A;  1C1L A;  2WYF A;  1HW5 A;  5H9R A;  3S30 A;  5E6H A;  2YRO A;  2VQU A;  3ZXJ A;  1MZF A;  1OD5 A;  1PMI A;  4PDW C;  1H1M A;  3WNP A;  4Y22 B;  4GAZ A;  4YW5 A;  2WWU A;  1PGL 1;  1WKY A;  1TQ5 A;  4GWJ A;  3BAL A;  2BRT A;  2QCS B;  1XSQ A;  5JOX A;  1HKD A;  3T1L A;  4DUW A;  5AC9 2;  2H6B A;  3SEE A;  4PF1 A;  4LHK A;  2DWR A;  3VBF A;  3U37 A;  1JYW A;  2ARX A;  3KT7 A;  3ZXL A;  4S2F A;  4ASM B;  4W65 A;  3HQU A;  3JUU A;  3CIH A;  4FTE A;  2IXK A;  5IVB A;  1OLM A;  1QXP A;  2BEO A;  1W9S A;  3AMM A;  3DXT A;  4BK5 A;  1I1E A;  3DN7 A;  4XJU A;  3POB A;  1I3H A;  5IK5 A;  2J1T A;  2EXI A;  1X9P A;  2XVG A;  3H3Z A;  3M8L A;  4EN6 B;  1RXF A;  1WLT A;  2PHX A;  3O12 A;  4AGV A;  2C9K A;  3POI A;  5LK7 B;  4WBB A;  2Z42 A;  1YI9 A;  5E89 A;  4XJA A;  1N1Y A;  4CP9 A;  2HWF 1;  4DFS A;  2Y6G A;  3UGG A;  3WZ1 A;  3V0A B;  5T5L A;  5F6L B;  1DZT A;  3ETP A;  4PBP A;  5FYM A;  5HXM A;  2NMO A;  4K8R B;  4LBO A;  2EIC A;  1LOG A;  3AZY A;  4HSL A;  4F7Z A;  2IFW A;  2VTX A;  4EZH A;  5C3O A;  1NLS A;  3DF0 A;  4LK6 A;  5FY5 A;  4CPB D;  1W8U A;  1X82 A;  1RIN A;  3PIJ A;  3VBH C;  1FAT A;  3SIT A;  1N3Q A;  1TG7 A;  2JKB A;  2RS3 3;  2C24 A;  2JD9 A;  3O0V A;  4IEW A;  4ZY9 A;  4RGA A;  1PHM A;  1EPW A;  1QMJ A;  3F2Z A;  4NIA A;  2ZJC A;  2DVD A;  2UY8 A;  1XNK A;  3N9O A;  5FP4 A;  3X29 B;  4XAE A;  1BK0 A;  3ILN A;  3TYJ A;  4DEV A;  5A6Z A;  5JDB A;  1LU1 A;  5AFB A;  1UWW A;  2WRA A;  1BBT 1;  1FMD 1;  3ZYR A;  2W0X A;  5A7W B;  4B3N A;  5C4W C;  3R05 A;  4UOJ A;  1X8E A;  4CU7 A;  1JZ5 A;  5JZG A;  2DBN A;  4CDU C;  4Y5S A;  1BCX A;  4P9L A;  2BW8 A;  2LM3 A;  3C2U A;  3MIB A;  3RRD A;  3N7L A;  4GZ9 A;  3M3E A;  4ASK A;  1HIX A;  2D6P A;  1H8T B;  2XJQ A;  1R09 1;  2R07 2;  1OVP A;  1JOD A;  5T5J A;  3VBU C;  3L9J T;  4YW6 A;  4XUP A;  1RUC 3;  1TME 1;  2D6M A;  3FBY A;  3ZYH A;  2RDQ A;  1W8T A;  3HWJ A;  3OOX A;  5FMD A;  2BJS A;  1VBE 2;  3VLB B;  1QGL A;  1AXZ A;  1LEM A;  5BV6 A;  1JI6 A;  1ND3 B;  1WLD A;  1T2X A;  4JV4 A;  5ACA 3;  5EYX A;  4Q4V 2;  4AVA A;  3AKS A;  4GIQ A;  5DDJ 3;  5BNO A;  2HWB 2;  3KMH A;  2PHW A;  1CZV A;  2QQI A;  4L92 A;  4AVV A;  5A1A A;  4XBN A;  4CUG A;  1PVC 3;  4LA2 A;  2ZZJ A;  4UFH A;  5FYS A;  3TN9 3;  3B69 A;  5F6K A;  2FDH A;  2A5Z A;  1YIF A;  1QJZ A;  1W6N B;  1UY3 A;  3MIC A;  4RGG A;  3E5X A;  4QPI B;  2JWP A;  3KQR A;  4UT5 A;  4WVM A;  3AL6 A;  3VBR A;  4XUR A;  4A41 A;  5LEK A;  4YVW A;  3BUC A;  2DCJ A;  2XUM A;  1X50 A;  2G9Z A;  2CDO A;  4KNC A;  2R16 A;  1O6U A;  1LTE A;  3WLU A;  2YFZ A;  1JW6 A;  1GOH A;  3AXD A;  4RS5 A;  4BDV B;  2W52 A;  4LEJ A;  2ZGU A;  3EO6 A;  4PIZ A;  4Q27 A;  4DMI A;  3K4D A;  5T5P A;  1I5P A;  5IVV A;  2VGD A;  2D6K A;  4UW6 A;  5E16 A;  1V6O A;  4GB3 1;  2F4L A;  4Q0S A;  4LBJ A;  3ZN5 A;  4MYE A;  3Q8C A;  4XMI A;  1S55 A;  3MW4 A;  3NMB A;  4Z2W A;  2DFB A;  4QX2 A;  2X09 A;  5KWR A;  4NID A;  4RQP B;  2YZ4 A;  1NY7 2;  5FZ3 A;  5J37 A;  1BLZ A;  2B42 B;  4IV3 A;  5LA2 A;  2VJX A;  1NCR B;  1V6L A;  3M7A A;  4BXF A;  4JDM A;  3N9L A;  1E5I A;  1HN0 A;  5LBE A;  3VDA A;  3LPF A;  4OHX A;  1SZB A;  4IXL A;  1AXK A;  4IUG A;  5K0U A;  4CPB A;  2OS2 A;  4QQL A;  2VH9 A;  3Q8E A;  3H3U A;  1QOS A;  2B8M A;  4AI0 A;  4BQW A;  4MO3 M;  1C4R A;  4BU2 A;  2PFW A;  5HXV A;  2P3Y A;  4TSV A;  4XUQ A;  4PQ9 A;  4CZS A;  1DF0 A;  2VMH A;  4LIU A;  1RUG 1;  1D2Q A;  4NMI A;  2OQ7 A;  2VXR A;  5FMO S;  4AI9 A;  3J4U H;  3U14 A;  4RHV 3;  2GMP A;  5F3E A;  2Y6H A;  2DTW A;  2P37 A;  3UGH A;  1BEV 1;  2GC0 A;  3DYO A;  4XHX A;  1PO2 1;  3WHT A;  3GJA A;  4W6X A;  1RVF 2;  1L7R A;  3ZFE C;  5IHR A;  1OFS A;  2JXA A;  1JBC A;  3V0A A;  5FLI A;  4XFH A;  2HWE 3;  4UYB A;  4L8Q A;  2FBE A;  4FPO B;  3GZA A;  4FO9 A;  5FP3 A;  3SXW A;  5JUV A;  4N9H A;  1J59 A;  4XEZ A;  3NV3 A;  1U5Z A;  4NHX A;  5FYU A;  1GOF A;  2UWA A;  1GP5 A;  4DY5 A;  2WQ8 A;  5I0R A;  3AP4 A;  2EXJ A;  4IE7 A;  1W6M A;  2GAL A;  5KC6 A;  1Y43 B;  2WWJ A;  1MPX A;  4XDO A;  2VNO A;  5FPA A;  1YJK A;  1PZ9 A;  3V0B B;  1C8M 3;  1DQ4 A;  2XH6 A;  3IPV B;  4FFF A;  5GKA C;  1R1A 3;  3IZO A;  3MIG A;  2PEL A;  3DEC A;  1CVN A;  4YGD A;  2WS9 3;  5T3N A;  5JSO A;  4IGP A;  1OUS A;  1PX4 A;  2HLE A;  2VTF A;  5AVA A;  3R6S A;  1DHK B;  2G9G A;  2MEV 1;  2YB7 A;  4FOV A;  4YYO A;  2DUR A;  2VQ0 A;  3JD7 3;  4Q4Y 1;  4HVR A;  5GLU A;  4BOW A;  4FTB A;  1RUC 2;  4TXW A;  3UES A;  3POJ A;  4AQ6 A;  4IER A;  1OVS A;  2XR4 A;  5IUQ A;  3SQO A;  1DLC A;  1Z7S 3;  4GMP 1;  4OUS A;  4XIL A;  5FQ0 B;  1WD3 A;  3GCW A;  4XC9 A;  3T08 A;  3M3I A;  5A3T A;  4NRQ A;  2VVD A;  3T2P A;  4I2O A;  2CWS A;  3DPR A;  2XKO A;  3J7N A;  1Y9G A;  3ZDS A;  5ABJ B;  1H4H A;  4YNI A;  1D2S A;  1PVC 2;  1YQC A;  1RUH 2;  2WUH A;  4L11 A;  4JCK A;  5L7O A;  1MZ6 A;  3BTA A;  3WF2 A;  1QJX 1;  3N36 A;  4FQ4 A;  3T4H B;  3WNX A;  2VNR A;  1MVQ A;  4KWL A;  2E7T A;  4TN7 A;  1WWY A;  2HBU A;  3LF7 A;  4J6G A;  2FCU A;  4B4Q A;  2VCM A;  4AFD A;  3CZU A;  3WF4 A;  2CV6 A;  1V6J A;  1RHI 1;  5M0T A;  5IK4 A;  1W6N A;  2RS5 1;  2QQK A;  1CIY A;  1ST8 A;  2VW0 A;  3I8T A;  4QPI A;  4PQQ A;  5BUV A;  1JZ8 A;  4XIO A;  1WGP A;  4BA6 A;  4CU9 A;  1DZQ A;  3EMR A;  3HQR A;  1KJL A;  1J84 A;  2AGS A;  4XVH A;  4AEK A;  5K7P A;  1XBF A;  1IG0 A;  1GP6 A;  3MEP A;  3AZW A;  2ZZQ A;  4K1Z A;  3MFC A;  4N43 B;  3PJQ A;  4QX3 A;  2BPA 2;  1GNZ A;  2PHF A;  1PNF A;  1AZD A;  3RWK X;  1RUO A;  2A7A A;  4QU1 A;  2OW4 A;  5FPU A;  5CG9 A;  5F3I A;  1MS1 A;  1UO9 A;  5FY0 A;  4PLM A;  3NST A;  5FYT A;  1W8Z A;  4R4Z A;  3PMS A;  3KB5 A;  4KH9 A;  4MGS A;  5JLV A;  3LIG A;  1VBB 3;  2WQ4 A;  1JYV A;  1AR6 3;  2HWF 3;  2YUE A;  4HPK A;  5BY5 A;  4LMF A;  4XUT A;  4D94 A;  4MV2 A;  4AQS A;  2ORZ A;  2FQP A;  3H42 B;  1LOC A;  5AC9 1;  1RUE 3;  5I0U A;  5FMB A;  1NCR A;  4ISQ A;  3NNL A;  4ZU5 A;  1XYN A;  3OB8 A;  1TNF A;  2ZMN A;  5AVP A;  3OUH A;  3T2O A;  1Y3T A;  4QQO A;  3NNG A;  3WF0 A;  3K48 A;  5FUP A;  1LHN A;  3U10 A;  3I2F A;  1XU1 A;  3SH3 A;  2XG3 A;  3POG A;  3QCW A;  1PM4 A;  1D4M 3;  5FAX A;  4E2Q A;  3E6C C;  3N9P A;  4N53 B;  3ZKY A;  4RSU A;  1AL2 2;  4OCT A;  2J42 A;  4XTM A;  1MAC A;  5FUN A;  5BNO C;  1G6N A;  4Y20 A;  4I02 A;  4XDQ A;  1UNB A;  3TBD A;  3MW3 A;  3I2D A;  4MZU A;  4PI2 A;  1UN1 A;  4C91 A;  3THC A;  2HWE 2;  4QMA A;  4COV A;  3Q8B A;  2JDN A;  2AEY A;  2Q1F A;  2VD7 A;  1QXJ A;  1FMD 3;  1H1I A;  1NLR A;  2OUH A;  3RGB A;  2YBS A;  4YVW C;  4A42 A;  1COV 2;  1LNS A;  1H2M A;  1VBA 2;  3ACI A;  1WMF A;  3ENR A;  4UF0 B;  2A70 A;  2FMD A;  1EUU A;  2ET1 A;  3RQ0 A;  5JI7 A;  4D8M A;  1VR3 A;  4PDW B;  3MIE A;  1WD4 A;  4XFA A;  1QKQ A;  5C8C C;  2CYF A;  4NWW A;  3P3P A;  1WBL A;  4JC1 A;  1C8M 2;  1CAX A;  2TBV A;  2ZGO A;  4FP2 A;  5D21 A;  5FBZ A;  2W08 A;  3O0X A;  2VE1 A;  3LDK A;  3UKV A;  1TME 3;  3ORJ A;  3RI9 A;  1YFY A;  3CJI A;  1W8W A;  4GUL A;  4RA0 A;  5A7N A;  1H9P A;  4FPK A;  2WS9 2;  3CMG A;  3I3Q A;  3KSC A;  3R4S A;  2BDR A;  2D6L X;  4OHV A;  3W21 A;  3WQ1 A;  4CTE A;  3NKG A;  4XXP A;  4YSF A;  4C8D A;  1DGR A;  1S1A A;  3TAY A;  3GBG A;  4XF0 A;  3JD7 2;  4LHN A;  1QDC A;  2CDP A;  1N3O A;  2DCK A;  2XJV A;  3PDQ A;  4QGN A;  5C70 A;  4MVT A;  4FOW A;  5FZ1 A;  4QQH A;  5LA9 A;  1VAM A;  5JXI A;  2LW8 A;  5FO7 B;  1Z7S 2;  1OOP B;  2RJK A;  2QQL A;  4RFR B;  5KHI A;  5LRS A;  2VMC A;  1IQD C;  3S57 A;  4R4X A;  4YRD A;  4E2S A;  2GAU A;  2BYV E;  4LA3 A;  2R07 1;  3M3O A;  3BIE A;  3TNQ A;  2VZS A;  4OYU A;  4UW4 A;  4QHO A;  2CHH A;  4F3J A;  5FQ0 A;  1H1A A;  3O1M A;  3EJK A;  1AF9 A;  2JEN A;  3NNJ A;  2B45 X;  3W58 A;  1VBE 1;  5CKM A;  4BIO A;  5KR7 A;  2WO2 A;  3AMQ A;  2W92 A;  2X10 A;  4KG8 A;  4BJ0 A;  2Z5W A;  3O1S A;  4Q4V 1;  3ALQ A;  3WW4 A;  1GKB A;  5JAX A;  2HWB 1;  5A80 A;  4P00 B;  2V4A A;  4H7M A;  1PNG A;  2DFC A;  2RJ2 A;  2XJP A;  3FUQ A;  4JGY C;  4LO8 A;  5FZO B;  1JYN A;  4DB5 A;  2Q8D A;  3VDD B;  5C9A A;  5I8T A;  3FWE A;  3USS A;  1ENS A;  5JMC A;  1FI2 A;  4Q0V A;  1IKQ A;  3HNY M;  4AQ2 A;  5GAL A;  1JMU B;  3F95 A;  1YJL A;  3D0S A;  4GWM A;  4XPV A;  3ZN4 A;  4AEJ A;  1ZYB A;  4NRM A;  2E7Q A;  3LSD A;  4GD4 A;  3GYD A;  2XGX A;  1OLR A;  2D5H A;  3MLJ A;  4N43 A;  1VBB 2;  2JJ6 A;  2ZGR A;  5BYN A;  1RUG 3;  1AR6 2;  2QQO A;  1POV 0;  2OPK A;  1WMD A;  1W0N A;  5CFD B;  2GC3 A;  4YFZ A;  2HWD 2;  5FPV A;  1LEC A;  4ZU4 A;  1RUE 2;  2XJT A;  4F83 A;  1LB2 A;  3AP5 A;  3O1U A;  4NHY A;  4ZPI A;  2VOK A;  2RJL A;  1DCS A;  2VAU A;  1LU2 A;  1NY7 1;  2LS6 A;  4CA9 A;  2JG9 A;  4YFW A;  3WNK A;  3V56 A;  3L2H A;  2W1Q A;  3E5Q A;  1PMJ X;  4MH0 E;  4QM8 A;  4Y24 A;  2QQP A;  4CU6 A;  1D4M 2;  2Q5T A;  4D7Y A;  2WDB A;  4D6S A;  4KL1 A;  4WM8 B;  3ASI A;  5F5Q A;  2QVS B;  4N9I A;  4XHB A;  3ZXD A;  1IOA A;  4LE3 A;  1V70 A;  1DQ5 A;  1S0I A;  5A1L A;  1CJP A;  4WVZ A;  2WNV B;  5FFO C;  3ZFG A;  1XND A;  2XL7 A;  4GA9 A;  2A3X A;  4S2G A;  1WME A;  1PO1 3;  4N53 A;  4NN0 A;  3WDY A;  5A32 A;  2WLQ A;  3TOJ A;  1KD7 A;  3T4V A;  3I59 A;  2RR1 2;  3ILF A;  4G3Y C;  1LCL A;  2WFF 2;  1W6O A;  4HET A;  3QLQ A;  2D98 A;  4IV1 B;  4IL7 A;  3HT2 A;  1HQW A;  1OUX A;  1XYO A;  3K4Z A;  5T52 A;  1GZ9 A;  4COW A;  4DY3 A;  4NUB A;  3WV6 A;  5LRR A;  2ZTN A;  4YVS C;  2D43 A;  2UY9 A;  1NQD A;  3KCY A;  4CDX C;  1RVF 1;  1Z78 A;  2A1X A;  1CAW B;  2Y0O A;  2FMY A;  1KDM A;  1PMH X;  2ZX1 A;  3O5S A;  5JPN B;  1SDD B;  1ZZ7 A;  4YGE A;  3CJX A;  2EIB A;  3CLP A;  2MEV 3;  5HV4 A;  4UAP A;  1UAI A;  4S2D A;  4LQR A;  1GZT A;  2VNG A;  5FY4 A;  3WNL A;  2WAA A;  3WCR A;  1ALY A;  4BQX A;  3M70 A;  1UCX A;  1UF2 C;  2E53 A;  3MDP A;  3WDW A;  2VZP A;  5DMY A;  4GMP 3;  1RB8 G;  3URF A;  4AED C;  3R4U A;  4QDS A;  2ZBJ A;  1NCQ B;  4R52 A;  5A7O A;  5E8A A;  1GWM A;  4J1W A;  2VVE A;  2DU1 A;  1XB9 A;  1HLC A;  1W6P A;  2GDF A;  4QPG C;  3POF A;  2GN7 A;  2VC9 A;  1X9T A;  3LAG A;  5EJ1 B;  2ARE A;  2BU9 A;  2RDR A;  1ZZC A;  1RC6 A;  5IFP A;  2VMD A;  1QJX 3;  4PLN A;  4LBM A;  4ATE A;  3VD5 A;  1O3R A;  2ID4 A;  4FI9 A;  4XW3 A;  5I8Y A;  4IEV A;  2JG8 C;  1DGW A;  4ZS2 A;  4OI1 A;  5KHJ A;  1VBC 2;  4K1Y A;  1JYT A;  3ZKU A;  2RS1 3;  1RHI 3;  4UFJ A;  1EPZ A;  2VNV A;  3ECQ A;  2NZ9 A;  1RUC 1;  2VBD A;  4NPM A;  4URA A;  4FQZ A;  1NQJ A;  4M0H A;  4LJH A;  2PYT A;  2E32 A;  3N7K A;  5DAV A;  2L9L A;  2W87 A;  4HSJ A;  1UZZ A;  2E7A A;  3I3D A;  1PK6 B;  5EZW A;  3ZFE B;  3OTF A;  2KD7 A;  1DYP A;  3LZZ A;  1MVE A;  1O59 A;  4GXL A;  1PVC 1;  5GZD A;  1WW7 A;  3SIS A;  1RUH 1;  3WOG A;  1MQT A;  2Q4S A;  5FZ9 A;  1J3R A;  2QKD A;  3PNA A;  1ZZB A;  4LUL A;  5FRE A;  1FNY A;  1GQH A;  4MSV A;  5CAZ A;  1C1F A;  1QHD A;  1US3 A;  3KCC A;  1IZ3 A;  3PUH A;  4CCD A;  2XB6 C;  1I6X A;  1UOJ A;  1X36 A;  1JXN A;  5KC5 A;  1S0B A;  2VQT A;  3OGJ A;  1RTV A;  5IT6 A;  2WQZ C;  3VDD A;  1R08 2;  5L9V A;  3CZJ A;  3N9M A;  1PGS A;  3ACL A;  5FYH A;  4OHZ A;  3N7M A;  1W8F A;  3VL9 A;  1IKP A;  1YC6 1;  3WCS A;  2WZR 2;  3N35 A;  2CL2 A;  4RD7 A;  4JKM A;  3ZX7 A;  1FPN 2;  4HN1 A;  5DG2 A;  3JB8 A;  1W06 A;  1YHF A;  3VZL A;  2F4P A;  2JB8 A;  2XLF A;  3I2I A;  2GU9 A;  2R6Q A;  4BPZ A;  1SLL A;  5LA1 A;  1XE7 A;  4IQP A;  1Z0H A;  5CFD A;  3VN4 A;  1H6X A;  2BZD A;  4CU8 A;  4MGT A;  2ZKL A;  3ZPO A;  3FLR A;  5DAB A;  1DP0 A;  1YQ2 A;  4AHY A;  3HD8 B;  4LUK A;  1AR8 2;  3VB9 A;  3UKT A;  1ULC A;  1JZ3 A;  2Q0A A;  1WLC A;  1DGL A;  1VMF A;  4O9G A;  1CX1 A;  2WN2 A;  3USU B;  5BNP B;  1PO1 2;  4WM8 A;  1HB4 A;  1UMZ A;  3HPN A;  4HN0 A;  3THD A;  2CGP A;  1F5J A;  2UWC A;  2O8O A;  3J9S A;  2NMN A;  3VBO C;  1AL2 1;  5FJH A;  2WNV A;  1XJA A;  5F39 A;  3ROU A;  1CAV B;  5T5O A;  4AHX A;  4IEX A;  1TEI A;  3AKP A;  1LOA A;  4BQ5 A;  3SHR A;  1Q8V A;  2ORX A;  1GUI A;  1WBF A;  4R9A A;  4AI8 A;  5BNN B;  5C8W A;  4IV1 A;  1AX1 A;  1WCQ A;  2HWE 1;  3WW1 A;  4MXV A;  5T50 A;  5CAD A;  1ZBE 2;  1OH3 A;  5A33 A;  3S7E A;  1DQ0 A;  1K5M A;  2R04 2;  2ZMK A;  3SMH A;  2FDG A;  1COV 1;  3A7Q A;  1CAW A;  1VBA 1;  2OII A;  4Q8K A;  1YNA A;  3TRS B;  3RPQ A;  2YBK A;  4M00 A;  1IQA A;  3OF1 A;  2Z69 A;  4BE3 A;  3GZU C;  1WMX A;  3HN1 A;  2QQV A;  3AM2 A;  4CEW A;  4CDW B;  4L99 A;  4ORF A;  1C8M 1;  3WP5 A;  2VZV A;  5K8S A;  4WVV A;  5J36 A;  2R49 A;  4DXS A;  4WM7 C;  2WWS A;  2WS9 1;  2AH2 A;  3WX5 A;  1XNT A;  4YW3 A;  2VZ1 A;  4J1X A;  4JVA A;  4ERO A;  2FZ1 A;  2DVA A;  4Q4V 3;  3NNF A;  4QPW A;  4FSJ A;  1W6Q A;  2IXJ A;  3H1W A;  4N7U A;  4JGZ C;  2RS1 2;  4XXA A;  3LFI A;  2VOV A;  3JD7 1;  3KGZ A;  2H6C A;  2Q1Z B;  5D8A B;  4CSW A;  1U5Y A;  4XFC A;  2EAA A;  1SLB A;  2BP6 A;  3CF6 E;  4L97 A;  1ULP A;  4E4D X;  4JRL A;  4IEQ A;  1Z7S 1;  1U5I A;  3VZN A;  3FN9 A;  1AL0 G;  3ZFG C;  3FFZ A;  3AB0 A;  4AG4 A;  2H0B A;  1M06 G;  4F8A A;  1MZE A;  3T2T A;  1YWK A;  4LOT A;  2BV4 A;  4FPF A;  4PF5 A;  2AZ5 A;  2V5Y A;  4XF4 A;  1WW4 A;  4CDQ C;  4OMC A;  4R9C A;  4NAM A;  3A4U A;  1ODN A;  5FZM A;  4IEP A;  3G6J B;  3VKL A;  4EWE A;  3BPZ A;  1UXX X;  3NWK A;  3RVH A;  3H50 A;  1W3X A;  2CAU A;  2DVB A;  3B3Q E;  4P02 B;  3T0A A;  1SAC A;  2R7E B;  1ZM1 A;  2VM9 A;  1GIC A;  4CP1 A;  3RZG A;  3H8R A;  5FPX A;  5C8C B;  1SDW A;  1UX6 A;  1DIW A;  4M4P A;  3WDV A;  5A7P A;  3D5O A;  1P8J A;  1VAL A;  1WUV A;  5CFC B;  2LRP A;  3PU3 A;  3WP4 A;  2W1W A;  4GKX A;  1IGO A;  1RJ7 A;  5F8P A;  3ZN6 A;  4D7T A;  4LBQ B;  4X6Q B;  4KQ7 A;  1W9T A;  3GCX A;  4COU A;  1W3V A;  1AYN 2;  4ET7 A;  1DQ1 A;  2PTM A;  1KIT A;  3HVD A;  4JTN A;  1Q8S A;  1KEX A;  3KS7 A;  3KLS A;  4Z1V A;  2D97 A;  5L73 A;  1W99 A;  1ZRI A;  2W95 A;  4LNV A;  1C5H A;  3CQO A;  3KHB A;  4CE8 A;  4YM2 A;  2R0F A;  1VBB 1;  1AR6 1;  1JHJ A;  1OMI A;  2OA2 A;  2WT0 A;  4LTA A;  2WNU C;  3HQX A;  2HWD 1;  4P9X A;  4O9E A;  1RUE 1;  4LO7 A;  2G9F A;  4MG2 A;  4CCN A;  5JSR A;  2GC1 A;  2ADE A;  1W0P A;  1RVF 3;  4K8F A;  1UY4 A;  2DUP A;  4AFM A;  3PUQ A;  4NOT A;  5JOZ A;  1D4M 1;  2JEC A;  2X5I A;  3R0R A;  3RZJ A;  2WNO A;  3TEZ A;  4XFG A;  3VDB A;  4YZ4 A;  5DUW A;  1TNR A;  2VUD A;  5FYC A;  3AP9 A;  5BNP A;  4ZXK A;  2W47 A;  4YW4 A;  1G86 A;  1SLA A;  4FOQ A;  2ZGP A;  3NAP C;  3PHM A;  4RR3 B;  2I07 B;  2RR1 1;  4FCA A;  2WFF 1;  4TLG A;  4NPL A;  5B4X A;  1ZNP A;  3FC0 A;  5DPN A;  3W9A A;  4CEY A;  3ACH A;  3ZVX A;  5BNN A;  3OPT A;  4GQ7 A;  1CR7 A;  2XPJ A;  5FTT C;  4EJR A;  3CDZ B;  4W6W A;  3VBS A;  1MS0 A;  2W39 A;  3JQW A;  5FY7 A;  4NHM A;  4LT5 A;  4P9J A;  1Y9M A;  3OD4 A;  5A3U A;  3RFR A;  5C6C A;  2VXJ A;  4EQV A;  2VMI A;  2Y6J A;  1N3P A;  2VTX J;  2AR6 A;  2RDN A;  1H8V A;  1XU2 A;  1Q43 A;  2PN5 A;  5CKQ A;  2GNM A;  2K9Z A;  2JE8 A;  4GKY A;  3Q8A A;  1UOG A;  4BLJ A;  3JZV A;  5FZH A;  4K3U A;  3OD0 A;  2E31 A;  2VG9 A;  4IE6 A;  5ERL A;  4SBV A;  5FKC A;  3PLQ A;  4MGK E;  5EYY A;  4CDW A;  4X6R B;  5A6X A;  4YG6 A;  1NA1 C;  4DPN A;  4ZKT B;  2XBO 3;  3OCP A;  4L9B A;  4PT6 A;  1S2E A;  1ZZ8 A;  4B4P A;  3SCF A;  2AUY A;  1NAE A;  1DFQ A;  4TTG A;  1RUH 3;  2ZGS A;  1YUD A;  4ITC A;  4XFF A;  3H1Y A;  1QJU 3;  2P4E A;  4MX3 A;  1REE A;  2P3J A;  4XF1 A;  4UFM A;  2BWC A;  2VOW A;  1S0G A;  4PIX A;  4CUC A;  1WCU A;  2WJS A;  1A8D A;  4LO6 B;  5D8A A;  3MID A;  3VZM A;  1VBC 1;  3QD6 A;  4NE9 A;  3AYE A;  4WV8 A;  4KU7 A;  4KI5 M;  4CXY A;  5T55 A;  1W03 A;  2GC2 A;  5FZ4 A;  4C0H A;  5CU1 A;  1X7N A;  4QM9 A;  3IMN A;  3PJY A;  2ET7 A;  2JE7 A;  3BU0 A;  4JAA A;  1GAN A;  2J1E A;  4AK3 A;  1XXN A;  5C3R A;  2WT2 A;  4Y22 A;  3DUI A;  4YG3 A;  4DO0 A;  2J22 A;  4R9D A;  1ND2 B;  2IXC A;  3BB6 A;  3RJ2 X;  5FIX A;  2W68 A;  5FY8 A;  4XCA A;  1KXG A;  1SPP B;  3AJY A;  2VCB A;  4M3C E;  4GH4 C;  1YFW A;  3GDB A;  5FP7 A;  3UL2 A;  2EIE A;  4Y1Z A;  4AL9 A;  1O3S A;  1ZZ9 A;  2I74 A;  1W05 A;  1UY2 A;  2Q1M A;  4Q2F A;  5F32 A;  2C6S A;  5C3S A;  5FRA A;  3WG2 A;  1PZ8 A;  1ZBA 3;  2O1Q A;  3U75 A;  2VL4 A;  5CFC A;  4NJ4 A;  1R08 1;  1WA6 X;  4FXG B;  1RJ8 A;  1QU0 A;  5DZE A;  2A71 A;  5ANQ A;  5TSW A;  1EAH 3;  4LBQ A;  3THT A;  2GND A;  4KG0 A;  2JKX A;  4XZP A;  1L3J A;  3A0N A;  3AFG A;  1VAV A;  5H9Q A;  5AFE A;  4DIN B;  1AHS A;  2WZR 1;  2JX9 A;  1QH6 A;  1AL2 3;  4E4H A;  3IBM A;  4IW3 A;  1FPN 1;  2B4K A;  4FPJ A;  3UKN A;  3KT1 A;  1SLI A;  1UZV A;  4QHB A;  3UT0 A;  1W28 A;  1SMV A;  4PIY A;  1XE8 A;  3DV8 A;  1ULG A;  3HIF A;  4B29 A;  3ZFF C;  1JZ4 A;  2ZEW A;  3BOW A;  5EJZ B;  1ZRF A;  3MIH A;  3GZT B;  3POE A;  1EV1 3;  4LHL A;  1OLM E;  1G8W A;  5SV5 A;  1AR8 1;  1CIW A;  4FP3 A;  1RUI 3;  5F3G A;  1OF4 A;  2YGL A;  5JIU A;  1COV 3;  3DEM A;  1VBA 3;  4CCM A;  1ZX5 A;  3O7O A;  5DUU A;  3LA7 A;  2C4X A;  4JTO A;  5I8S A;  2AEN A;  1PO1 1;  1GQP A;  3O0W A;  1B35 B;  4CUA A;  2IXL A;  1IPJ A;  1LED A;  4NRO A;  5SV8 A;  2A6Z A;  2VZU A;  4I01 A;  4B1M A;  3DL3 A;  3WQ0 A;  3FZ3 A;  4DIQ A;  1L7L A;  1WW5 A;  2XJS A;  3DYM A;  2BQP A;  2ZKN A;  1N47 A;  2XUE A;  3AZV A;  4HLT A;  5H9P A;  4CCO A;  4RR3 A;  4W8J A;  5A6Y A;  2RHP A;  3I2O A;  2VR4 A;  3OGV A;  3HOB A;  3KF5 A;  3VBF C;  3ZOI A;  1SLT A;  1G7Y A;  3AKT A;  2D40 A;  5A7W A;  2ARC A;  4XJ9 A;  5D1I A;  5JSP A;  1ZBE 1;  5JPM B;  3QBQ A;  3WIN E;  2VUJ A;  4XCB A;  2R04 1;  5FZK A;  3K77 A;  1QH7 A;  2VMF A;  3I2J A;  5IFT A;  3JQX A;  1D0H A;  4P9I A;  3VL8 A;  1PIV 2;  3I3M A;  1H8T A;  1BKZ A;  3M3Q A;  2XBO 2;  3ZSL A;  1O4Y A;  2RM2 3;  3MV1 1;  3J7H A;  2JDY A;  3IDA A;  4Z07 A;  3B01 A;  1ND3 A;  1SFY A;  2QQU A;  3LKJ A;  3UJQ A;  1QJU 2;  4QXH A;  4LO5 B;  5CB7 A;  5FO9 B;  3AYA A;  4A6O A;  1LJ7 A;  1C8N A;  4CCC A;  1ZRR A;  1JYX A;  1REF A;  2TEP A;  1C28 A;  1UZY A;  5IVF A;  5FR3 A;  4QPY A;  1NZC A;  3UYJ A;  4KU8 A;  4LKD A;  3ZXF A;  4Q5O A;  3OJB A;  2RS1 1;  3IAQ A;  4JKK A;  4QXB A;  3S6P A;  2XLG A;  2X53 S;  1DLL A;  2V73 A;  3EYP A;  3H0O A;  2PHL A;  3VBO B;  5LBC A;  3UGF A;  4NAO A;  3C3V A;  5IK7 A;  2K0G A;  2VU9 A;  3PVN A;  5FZI A;  5HCB A;  3ZPY A;  1KFX L;  2HYX A;  2JDK A;  1F4H A;  4MOA A;  4COZ A;  3KVA A;  2XHK A;  3RS6 A;  4UBG A;  4Q0P A;  1VRH 2;  3ZLI A;  5CG8 A;  2JDA A;  4Y5Z 0;  2VUC A;  5LZ6 A;  5IW0 A;  2P17 A;  1H9W A;  5LK5 A;  1ENX A;  1JN2 P;  3B94 A;  3BOD A;  4XE9 A;  4DXZ A;  5DAQ A;  2YU1 A;  2WO3 A;  3WDT A;  3M2M A;  5JZG C;  4Q26 A;  4K6B A;  4PHZ A;  2Y60 A;  4XOG A;  3ACF A;  1YEW A;  4XIK A;  5FXW A;  2HWD 3;  1ONA A;  1QY4 A;  4OZX A;  4RQP A;  2KA3 A;  4H7L A;  2NP0 A;  3JB4 C;  2Y34 A;  1QNW A;  1SPP A;  1ZBA 2;  3WQ7 A;  1V6K A;  1NKG A;  1JUH A;  1EAH 2;  1HX6 A;  1K12 A;  4OHW A;  5EV7 A;  1ULE A;  1OPM A;  3C7H A;  4ZHN A;  1UPI A;  4QX7 A;  3KV9 A;  5IYY A;  5LWB A;  2QBX A;  1UKR A;  5FXV A;  4A44 A;  1ULO A;  1LGC A;  4Y4R A;  1AYN 1;  1W2U A;  4N90 A;  3WF1 A;  4MHR A;  4BME A;  4DQA A;  2RE9 A;  3LGR A;  1GZC A;  3RWN A;  3SEP A; 
#chains in the Genus database with same CATH homology
 3VD3 A;  3VD9 A;  1O8S A;  2VZP A;  3ABZ A;  4OZO A;  2J1V A;  5DMY A;  5HPO A;  5JXG A;  2OKX A;  3NQH A;  4QDS A;  3MBW A;  3JXS A;  5JXH A;  2YC2 A;  4QX1 A;  4BK4 A;  4DUX A;  2B9V A;  2WN3 A;  4AAX A;  2VC9 A;  5EJ1 B;  2VQU A;  5IFP A;  2VMD A;  2XQX A;  3WNP A;  3T0B A;  3VD5 A;  2ID4 A;  4FI9 A;  3C7O A;  4ZZ5 A;  1JZ7 A;  1WKY A;  4GWJ A;  3LQC A;  3ECQ A;  3NJX A;  4A45 A;  4DUW A;  3SEE A;  4PF1 A;  1NX9 A;  4LKS A;  2WYS A;  2E32 A;  2YFU A;  3U37 A;  1JYW A;  2L9L A;  2W87 A;  3I3D A;  3CIH A;  2KD7 A;  1W9S A;  1O59 A;  4BK5 A;  4ZZ8 A;  3GXU A;  5JMO A;  2J1T A;  1XC6 A;  1US3 A;  3PUH A;  2C9K A;  3OEB A;  1HN1 A;  2VQT A;  2W46 A;  3HNM A;  4QX0 A;  4M4R A;  2Y6G A;  5C71 A;  3CZJ A;  3ETP A;  5HXM A;  1K42 A;  3C8X A;  2EIC A;  2RVA A;  2Y6L A;  3SKV A;  1W8N A;  2V72 A;  4JKM A;  2J1S A;  5EIY B;  3DYP A;  1TG7 A;  2JD9 A;  3I2I A;  4ZY9 A;  1GMM A;  5LA1 A;  3F2Z A;  1H6X A;  2BZD A;  3MV0 1;  4CU8 A;  3E1F 1;  3WSO A;  1DP0 A;  4DEV A;  1YQ2 A;  1JZ3 A;  1UWW A;  2VZQ A;  1UY0 A;  4BXS V;  1CX1 A;  2WN2 A;  2W94 A;  4UOJ A;  1GU3 A;  4W4Z A;  4HG6 B;  4CU7 A;  3HPN A;  3THD A;  1JZ5 A;  2XHN A;  1JU4 A;  4GZ9 A;  2WAB A;  3OGS A;  1OH4 A;  3I3E A;  3T0D A;  2V5D A;  2ORX A;  1GUI A;  4ZXE A;  4CUB A;  5G05 L;  4XUP A;  1WCQ A;  3SKJ E;  4QAW A;  1GOG A;  1JI6 A;  1DYO A;  1T2X A;  2J1R A;  3A7Q A;  2QQI A;  1CZV A;  1L7Q A;  2XON A;  5A1A A;  4A4A A;  2BBA A;  1J83 A;  1UY3 A;  4A41 A;  1O8P A;  1W8O A;  4XUR A;  4JHZ A;  2VZV A;  2DCJ A;  4DUV A;  1SG3 A;  2CDO A;  4E8D A;  4DXS A;  3WF3 A;  2J1U A;  2YFZ A;  1GOH A;  1XNT A;  1UXZ A;  2VZ1 A;  4BDV B;  5B4N A;  4QPW A;  1JU3 A;  3K4D A;  3MUZ 1;  1CZT A;  1I5P A;  4QB2 A;  1UX7 A;  2YC4 A;  5C7G A;  1ULP A;  1SHW B;  5IJR A;  3I97 A;  4QX2 A;  2X09 A;  3FN9 A;  5LA2 A;  2VJX A;  4AG4 A;  4E8C A;  1XNA A;  5F7U A;  3GGL A;  3VDA A;  3LPF A;  4QDR A;  2VCA A;  4DEQ A;  4IUG A;  1D7P M;  1UY1 A;  4MO3 M;  1GNY A;  4OMC A;  4KMQ A;  4XUO A;  5JXJ A;  1UXX X;  3T0A A;  4P02 B;  4XUQ A;  3UNP A;  2R7E B;  2VM9 A;  4M4P A;  3LEI A;  2Y6H A;  1P8J A;  1OT5 A;  3DYO A;  1K45 A;  2W1W A;  3D3A A;  3WEZ A;  1L7R A;  5IHR A;  1W9T A;  4GWI A;  4ET7 A;  1US2 A;  2WO1 A;  5JUV A;  1KEX A;  4MGQ A;  5LA0 A;  2W3J A;  2VZ3 A;  4LHS A;  1W99 A;  2E33 A;  2W95 A;  3C7F A;  1GOF A;  3CQO A;  2WQ8 A;  1JHJ A;  1XPW A;  2Z4F A;  5DN2 A;  2QQJ A;  1MPX A;  2VZT A;  3HJR A;  2BGP A;  3A23 A;  3WQB A;  4QB6 A;  1EUT A;  1UY4 A;  2J1A A;  3DEC A;  3W5M A;  5LCW L;  3BN6 A;  3VDB A;  2WZ8 A;  1PX4 A;  2HLE A;  2VTF A;  4YPJ A;  5J1X A;  3IB3 A;  2W47 A;  2YB7 A;  4RN5 A;  2ZXQ A;  4XUN A;  2E26 A;  3OG2 A;  4TXW A;  2J7M A;  4L0P A;  4P08 A;  5G04 L;  3UES A;  3VD4 A;  1DLC A;  5B4X A;  1UYX A;  3AC0 A;  3T08 A;  2W5F A;  2VOT A;  5DPN A;  2VZO A;  3T2P A;  3ACH A;  3FHQ A;  3MUY 1;  4OMD A;  3K46 A;  2RV9 A;  3CDZ B;  4OUE A;  2WUH A;  3T2Q A;  3WF2 A;  4A3Z A;  2Y6J A;  1UYY A;  3HNB M;  2JE8 A;  3CZU A;  1F4A A;  3WF4 A;  3I2H A;  2E31 A;  2QQK A;  1CIY A;  4PQQ A;  1JZ8 A;  4PT6 A;  4CU9 A;  2QQM A;  1J84 A;  1NAE A;  3LPG A;  4TTG A;  3C7G A;  4XVH A;  4P5Y A;  5CYY A;  3UET A;  4QB1 A;  4QX3 A;  2W9X A;  1H6Y A;  4CUC A;  3ACG A;  4DXT A;  4MGS A;  3OEA A;  4D0Q A;  1PX3 A;  1KGY A;  1JYV A;  4KI5 M;  4XUT A;  2ORZ A;  1R64 A;  2BER A;  1UMI A;  1NUK A;  5DQ0 A;  3MO4 A;  2W91 A;  3HN3 A;  3OB8 A;  4QDQ A;  3T2O A;  2J1E A;  3NNG A;  3WF0 A;  3I2F A;  2J22 A;  4JKL A;  5FUI A;  1UYZ A;  2VCB A;  2Y64 A;  3GDB A;  2EIE A;  2PQS A;  1UY2 A;  3P1I A;  3THC A;  1UZ0 A;  2VL4 A;  2C26 A;  3FHA A;  4A42 A;  1LNS A;  3ACI A;  2EID A;  2JKX A;  1EUU A;  3III A;  3LEK A;  4D8M A;  4RYD A;  5JR2 A;  2B4K A;  3NRU A;  3OBA A;  2Y6K A;  4KWU A;  4UI9 L;  3A22 A;  1JZ4 A;  2ZEW A;  5EJZ B;  1OD3 A;  2VO5 A;  3CMG A;  3ZM8 A;  4LPL A;  2W1U A;  1OF4 A;  2C4X A;  4XZU G;  2CDP A;  3IAP A;  1GQP A;  2ZEX A;  4CUA A;  2DCK A;  4DXR A;  5C70 A;  5JXI A;  2DDU A;  2LW8 A;  2VZU A;  3CKH A;  2QQL A;  1K3I A;  1JZ6 A;  3K4A A;  2VMC A;  1IQD C;  2WZE A;  3DYM A;  1JZ2 A;  2QQN A;  4W8J A;  2VR4 A;  3OGV A;  3HOB A;  3OGR A;  1CZS A;  3I3B A;  2VZS A;  4OYU A;  3PUI A;  2WO2 A;  4BJ0 A;  1BHG A;  2W92 A;  2X10 A;  3K77 A;  2VMF A;  3I2J A;  5IFT A;  4JX0 A;  1UMH A;  3EB7 A;  4P00 B;  3I2K A;  2RJ2 A;  1JYN A;  3MV1 1;  3J7H A;  3BGA A;  3IDA A;  3HNY M;  3K75 B;  4Z2A A;  3WNM A;  2ZEZ A;  2Y8K A;  5CZK A;  3VDC A;  4A6O A;  1JYX A;  4ARX A;  3WNO A;  3IAQ A;  4JKK A;  2QQO A;  2BGO A;  1RYY A;  2XOM A;  1W0N A;  3EYP A;  3FL7 A;  2VME A;  4W50 A;  2HYX A;  2LS6 A;  4MOA A;  1F4H A;  2W1S A;  3WNK A;  5I0D A;  3LE0 A;  2W1Q A;  1PMJ X;  4CU6 A;  1OF3 A;  2JDA A;  2WDB A;  2WO3 A;  3GM8 A;  3ACF A;  2WBK A;  3VD7 A;  2VZR A;  3LEG A;  3NJV A;  1NKG A;  3HEI A;  3T09 A;  3C7E A;  3K4Z A;  4MAD A;  3P6B A;  1K12 A;  2YG0 A;  3C7H A;  3WNN A;  5IYY A;  2V4V A;  2QBX A;  2VCC A;  3I2G A;  1PMH X;  2WAO A;  1ULO A;  2ZEY A;  4A44 A;  1SDD B;  3A21 A;  1W9W A;  3WF1 A;  2EIB A;  4ARY A;  4UAP A;  1TVG A;  4CVU A;  3W5N A;  4LQR A;  2X05 A;  3WNL A;  2WAA A;  3SEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...