3LEKA

Lectin domain of lectinolysin complexed with lewis b antigen
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
VETENIARGKQASQSSTAYGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet aggregation factor Sm-hPAF
publication title Structure of the lectin regulatory domain of the cholesterol-dependent cytolysin lectinolysin reveals the basis for its lewis antigen specificity.
pubmed doi rcsb
source organism Streptococcus mitis
molecule tags Blood clotting
total genus 39
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3lekA00
2B9VA 3SEEA 3WNLA 4JX0A 2J22A 3A7QA 2XONA 3WF1A 4RN5A 2VZUA 3U37A 1K3IA 1CX1A 1JU3A 3T0BA 3VD5A 4PQQA 2WBKA 4BK4A 3WNOA 2X10A 2J1TA 2ZEXA 3NRUA 5JXIA 1GUIA 2Y6JA 2Y6KA 4OZOA 2W94A 2YB7A 4HG6B 4P02B 1GU3A 2BZDA 3GGLA 3E1F1 3CZUA 1XNTA 1NKGA 3I3BA 2EICA 2J1RA 2WN2A 3HOBA 3T2OA 2J1SA 1H6YA 1UMHA 3K77A 5HPOA 4CU7A 2E32A 2E26A 2X05A 1K42A 4CVUA 2LS6A 5DMYA 1UY1A 2JDAA 5FUIA 1BHGA 3HN3A 5EIYB 4CU9A 1KEXA 1UYXA 2RJ2A 4QX3A 2YC2A 4A4AA 3CDZB 1O8PA 1UXXX 1SDDB 4CUBA 4M4RA 5C71A 4P00B 5HXMA 2YC4A 1WCQA 3IIIA 3WNPA 3I3DA 1UY3A 2WZ8A 4P5YA 1UY2A 3DYMA 3I2IA 2W1WA 4KMQA 3EYPA 1L7RA 5C70A 4QB6A 4XUPA 2YG0A 5EJZB 3P6BA 5CZKA 2VCBA 3PUHA 1KGYA 1W8OA 3I2FA 4QDRA 3F2ZA 2JKXA 4DEQA 4BXSV 3C7FA 4ZY9A 2V72A 4AAXA 2VM9A 4MGSA 2BBAA 1ULPA 1XPWA 4OMDA 1SHWB 2VZ1A 1W0NA 3MBWA 2HYXA 3IB3A 3C7EA 2VQUA 3GDBA 2E31A 4BK5A 2OKXA 4BJ0A 1RYYA 4JKKA 2WAAA 5IFTA 5F7UA 2EIBA 4GWJA 1JZ7A 2ZXQA 2ZEWA 1GOFA 4KI5M 1JZ3A 1CIYA 1OH4A 3MO4A 3FL7A 1UX7A 5I0DA 2XQXA 3MV01 4QB1A 4A45A 2YFUA 4M4PA 3T08A 4W50A 1HN1A 5DN2A 5DPNA 3LEGA 4TTGA 4E8DA 3MUY1 2J1VA 1P8JA 3FN9A 3T2QA 4E8CA 3MUZ1 2JE8A 4GWIA 4ARYA 2W1QA 3NJXA 3OGRA 2WO1A 1W99A 3ABZA 1JZ2A 1PX3A 5JXGA 1NAEA 2VR4A 1UYYA 1NUKA 3OG2A 4LQRA 5JUVA 5J1XA 3ECQA 3WEZA 1JZ5A 4DUVA 2WQ8A 3DECA 2Y6GA 3ACHA 3I97A 5G05L 4A41A 2HLEA 4OUEA 2C26A 3NQHA 3HNYM 3UNPA 1XNAA 1DLCA 4IUGA 2VCCA 1GMMA 2VC9A 3LQCA 3THDA 3OB8A 1PMJX 1OF4A 5LA0A 3WF4A 5EJ1B 1JYNA 3DYOA 3VD7A 5LCWL 1JI6A 4QPWA 2VMDA 4QDQA 2C9KA 3WNKA 3VD3A 4XURA 3SKJE 2ZEYA 2Y6LA 1JHJA 3T0AA 5IYYA 2W1UA 3BGAA 2QQOA 2LW8A 1DP0A 2WN3A 4MGQA 3VDBA 4MO3M 1OF3A 1T2XA 3CQOA 3K4AA 1J84A 2PQSA 3C7GA 1NX9A 2QQLA 3I2GA 4UI9L 4MADA 1O59A 2VZTA 4L0PA 1JZ6A 1F4AA 1TVGA 5LA1A 3WQBA 3I3EA 2ZEZA 4AG4A 4ARXA 4RYDA 5A1AA 3P1IA 4XUNA 4DXSA 2W46A 3C7HA 4A6OA 2VZSA 3OBAA 2RVAA 3LPFA 1YQ2A 5IHRA 3IAQA 2VTFA 1OT5A 3EB7A 3HNBM 3WF3A 2W87A 2DDUA 4LKSA 2W95A 5C7GA 1I5PA 2W9XA 4QX2A 2VZ3A 4CU6A 3SKVA 1GOGA 4D8MA 2V5DA 2VJXA 3J7HA 2BGPA 1L7QA 1W9SA 4JKMA 3OEAA 2VMCA 5JXHA 1UMIA 2J1EA 4XUTA 4A42A 2WDBA 2CDOA 4FI9A 5IJRA 2Y6HA 4ZZ8A 2VMEA 3K4DA 2VCAA 2QQKA 2J1UA 3I2HA 2VMFA 4TXWA 3T09A 1GOHA 3LE0A 5LA2A 2E33A 2EIDA 3IAPA 2ORZA 4DEVA 3HPNA 4DXRA 4DUXA 3HEIA 2EIEA 3CMGA 4ZXEA 3OGSA 3IDAA 2W1SA 4P08A 4PF1A 1US3A 2DCKA 4D0QA 3LEIA 5DQ0A 4DXTA 3GM8A 3T0DA 4A44A 1O8SA 2Y8KA 1K12A 2Z4FA 3OEBA 2J7MA 5JR2A 2V4VA 2VZPA 4A3ZA 3UETA 2R7EB 1OD3A 4Z2AA 4JKLA 4ZZ5A 1JYVA 3BN6A 1J83A 4MOAA 2C4XA 3GXUA 3NJVA 4UAPA 1EUTA 1K45A 4QDSA 2WZEA 1W9WA 1WKYA 3WSOA 3CKHA 2BGOA 1LNSA 2QBXA 4QX1A 1MPXA 2WABA 4JHZA 3LEKA 5G04L 3C8XA 1PX4A 3SEPA 1JU4A 2WO2A 3THCA 2JD9A 5JXJA 3K46A 4LPLA 4XUQA 1ULOA 4CUCA 4OYUA 3A23A 3FHAA 3VD9A 1IQDC 1UY4A 1DYOA 4PT6A 4W4ZA 2B4KA 4QX0A 3C7OA 1EUUA 3HNMA 4W8JA 2QQIA 2WO3A 4UOJA 2W47A 1UXZA 2XHNA 2WUHA 2X09A 4XVHA 3WNMA 4QB2A 3VDAA 4OMCA 1JYWA 2Y64A 2J1AA 4ET7A 3VDCA 3AC0A 3CIHA 3WF2A 3ACGA 2KD7A 1CZTA 5B4XA 1R64A 3ACFA 4QAWA 3W5MA 1US2A 2VQTA 1D7PM 3W5NA 3OGVA 2RV9A 3NNGA 3DYPA 3UESA 3WNNA 3CZJA 2W5FA 5CYYA 2VZQA 1W9TA 4CU8A 5B4NA 1SG3A 1JZ4A 2BERA 3A22A 2ORXA 2VOTA 1PMHX 4GZ9A 2VZRA 2QQNA 1F4HA 1UYZA 3A21A 3T2PA 4LHSA 3JXSA 4CUAA 4KWUA 5IFPA 4YPJA 2ID4A 2L9LA 3K75B 1UZ0A 3MV11 3HJRA 4XZUG 3LPGA 2WAOA 1XC6A 1UWWA 3D3AA 1GQPA 2VZOA 3WF0A 3FHQA 2W3JA 3PUIA 1UY0A 1W8NA 2VO5A 3ACIA 3I2JA 2W92A 3I2KA 3ZM8A 1GNYA 2VZVA 3K4ZA 5JMOA 2QQJA 3ETPA 1H6XA 4BDVB 1JYXA 2YFZA 2WYSA 3VD4A 2CDPA 2W91A 1JZ8A 2XOMA 2QQMA 4XUOA 1CZSA 1TG7A 4DUWA 2VL4A 1CZVA 2DCJA
chains in the Genus database with same CATH superfamily
4Y1ZA 1VBA3 2HWE2 4LBKA 4L92A 4C90A 2XL7A 2HWF3 4O65A 3O12A 2J22A 5LY2A 3VKFC 5F1RA 3UJOA 2XONA 4HETA 1TMF2 3N36A 2ZX2A 1MVQA 5FZ9A 3RQ0A 3WF1A 4HXCA 3CJIB 4AF9A 1W6PA 1UPIA 2QZ2A 5C4WC 1OLQA 1I9RA 1ZRCA 1O4TA 4NN0A 5JWPA 4OI4A 2VD7A 5F5IA 4I0AA 2DBIA 3SH5A 5FPUA 3RWNA 1NQDA 3SITA 3RZZA 1SLCA 3K3NA 2J1TA 3WNOA 5CG9A 3F95A 3NRUA 2HWD2 1RUC3 2Y6JA 4AE2A 5J7MA 1V70A 3MEPA 2W94A 1ULDA 1GU3A 1NA1B 3LAGA 3VZKA 4CEWB 3VZMA 1YEWA 3GGLA 5J36A 2B8MA 2VOKA 4KGGA 3WQ1A 5DZGA 2EICA 2HWF1 5DAWA 5LWBA 3ILRA 1AXZA 4FPCA 2B9UA 3E6DA 5HCFA 3NJZA 4CRQA 5J09A 4BLJA 2VBBA 3HR9A 2BUKA 3IM0A 5HPOA 2Y26A 2E32A 4CU7A 2E26A 4RHV2 4YVWC 4Q4V3 3AKQA 5IUQA 1K42A 2JIGA 1ACCA 1HB1A 5I0RA 4XF0A 4ISRA 2JDAA 1G9CA 1BHGA 4CEYB 5L7OA 5EIYB 1CQ9A 1QJU2 5K8SA 3PVEA 4V2WA 3WCSA 3KGZA 3PMSA 4LO6B 2R1BA 1UZVA 2E7TA 2H0BA 2BEOA 4XF1A 3N9QA 2VECA 1F35A 3ZXJA 4FFIA 5T5PA 3S7EA 5FQ0B 1SDDB 3J8F2 2VNGA 2PHFA 4LJHA 4B1LA 2YC4A 3D5OA 5HXMA 4A6SA 5IK7A 3WNPA 1UZWA 3MIHA 2B5HA 2WZ8A 2QCSB 2GC1A 1Q8QA 2GZWA 1BEV3 4LIUA 1HJFA 3L2HA 4RR3B 1OOPB 1AL21 1W2UA 2B46X 1A3KA 2D3SA 1XU2A 4YM2A 5BYNA 5JCTA 4M3CA 4KMQA 5C70A 3GHNA 1QQP2 2ZOEB 1PZ7A 5CKQA 2YG0A 1W6PB 2PLV2 1LHWA 5EJZB 1PIV1 1N1SA 2D3RA 2GP3A 4UW4A 3W21A 3ZYHA 4I0WB 5T52A 4BQ1A 3PUHA 1RUE2 1G8WA 1XNKA 4U36A 1W8OA 3B02A 1WLDA 3I2FA 4QDRA 4XBNA 4BXSV 3O1MA 3MLLA 4MGYE 3BTAA 4N90A 1C8M3 3U14A 4MGSA 4H2AA 2YU1A 1RVF1 3MIDA 1SLBA 1NY71 1ULPA 1IS5A 1ND2C 4IE7A 3VBSB 1QH7A 2WNEA 3AKRA 4E2GA 4GIQA 1QWRA 5GLUA 2VZ1A 3WD5A 4RFRB 1ALYA 4Q8LA 4F3JA 1KFUL 3OBTA 2A71A 2G4IA 3IKWA 3OUJA 2E31A 3NV4A 1WA4A 4ZPIA 2IZWA 2OUHA 5BY5A 4QKFA 2WAAA 4QPGC 4YWAA 3VN4A 5FZ4A 4AAPA 4COWA 3B9CA 3IN9A 5C9AA 1JZ7A 2AR6A 1O91A 2ZABA 2DVAA 4YM3A 3U4XA 2MHFA 2A70A 4Y5SA 3SLIA 4Y24A 3WCRA 1JZ3A 3U07A 1CIYA 1DQ5A 1OH4A 1ZM1A 3ZYRA 1RUG1 3WQ7A 4JQRA 3MV01 3GZUC 2Q8CA 4LR4A 1BBT2 2DUQA 3AMQA 3DN7A 3ZN4A 3H50A 5BNPC 1YYNA 1JHNA 4XJ9A 2FZ2A 4W50A 5DPNA 2P4EA 1UX6A 1X36A 5CFDC 5DZEA 5T50A 3ELNA 3ZYBA 3RG0A 2X29A 4I30A 4YW7A 1S0DA 3C2UA 4H3WA 4M3CB 4I09A 4WVZA 3WDXA 3O14A 4AQTA 1Y7BA 1O6UA 3POFA 4B3NA 4FXKB 2OIIA 2W1QA 2GC0A 2ZJCA 5FZAA 2VUJA 5FK8A 2BYVE 1V6OA 2P3JA 3ABZA 4ZU4A 1PX3A 1JZ2A 3IZOA 1JBCA 1NUKA 3AVRA 1KFXL 5DABA 4CCNA 1YCIA 2XB6C 1YIFA 1S1AA 2FQPA 2XJSA 2YBSA 4GKYA 1ZZ8A 3FLRA 3ECQA 3AJYA 1OLME 3LOBA 4AI2A 4EV0A 2UURA 1YFUA 1U0AA 2PHTA 2R072 3N3HA 1QJU3 2LUWA 2RS13 3VZLA 5KHIA 4GMP1 1ZNPA 3VBUC 1B35C 1OPOA 4AFMA 1UKGA 2A7AA 4JDOA 4Q0SA 4A41A 5C3SA 3POEA 4QXCA 5JMCA 1W8WA 3NQHA 2WNVC 5KHGA 1RMU2 1VBB1 4FFGA 3VHOA 4AFCA 4BIOA 1GMMA 2VC9A 4GWNA 4AVTA 4UW5A 1JN2P 3TEZA 4LBLA 5JDBA 3OD4A 5LA0A 1QKQA 4N9IA 2FDIA 2JDKA 1NCRA 3DYOA 4IGOA 1YO8A 1IQAA 1TE1B 2NMOA 4X6QB 5FYSA 4HL0A 5C9AB 3CJIC 3NSTA 3K48A 1TZOA 1GQGA 3T30A 2O8OA 2OPKA 2Z69A 5FKCA 3AMPA 1ZBA2 2JB4A 2RS11 2YGMA 4CUGA 1R1A2 1A34A 4LE4A 1QQP3 1HRI1 5BPXA 5JXGA 4K8RB 3SKJE 2PLV3 2ZEYA 5DDJ1 3O1TA 5FZ0A 3AZXA 4CDQA 3BIWE 1H2MA 4LLFA 2D98A 3NO8A 1VMHA 4K40A 3DXTA 5FV3A 1DP0A 1JUIA 5LASA 4OHZA 2HEWF 4AYUA 2ZKNA 3KB5A 3WVJA 4CEWC 2YY1A 1FPN1 4AEJA 5HCAA 1PO12 1SBFA 4Q4Y3 1AR82 3DKQA 5F6LB 5EV7A 2OZ6A 1ENQA 3M1HA 4B4PA 1J84A 4IQPA 2ZZQA 5FIXA 3JBG1 1I6XA 3QOPA 3C7GA 2ZKLA 5GZGA 1PNFA 4Q1PA 1YFWA 2VZTA 4AHXA 5LEJA 2KM2A 4GH4A 4DZGA 2FDJA 1ST8A 5JOXA 1H9PA 2VGDA 1F4AA 1TVGA 5B2GB 5LA1A 5FO9B 2ZGPA 1U5YA 3WQBA 5A7PA 3THPA 2HEVF 2ILMA 1W8FA 4ARXA 4FTSA 1F31A 1UO9A 2N7GA 5CAZA 1GP4A 3P1IA 3WW4A 4XUNA 5KC5A 3MIEA 2DWRA 1HJGA 2JDHA 4FXGB 3AX4A 1WBFA 1YQCA 5A32A 2RVAA 4PLMA 2A6ZA 4LA2A 1PGL1 4JC1A 1PZ9A 5E6HA 3IAQA 3WW3A 4GQ7A 2HWC3 2Y34A 1ASJ1 4Y1YA 1POV0 3ZSEA 3WF3A 5A3MA 3OTFA 4M00A 4I0BA 5CKNA 1C5IA 4N43A 1FMD3 1MZFA 5FLIA 3AMHA 1HKDA 3LOIA 4K3UA 3BPSA 3GALA 4KG8A 2Q8DA 1BBT3 1W9YA 4CU6A 4RR3C 1BCXA 1OOPC 2V5DA 3OYWA 2G9FA 2VXRA 1NCRB 1X33A 4JKMA 3ST7A 3ZDSA 1NE6A 2IXLA 2WWSA 1GP6A 3H1WA 4META 5LRRA 1UD1A 4AVBA 4E4ZA 2YDEA 1YQ6A 4LO5B 3RYKA 1VBE2 5KXDA 2BRTA 2XBO2 3BODA 4QX8A 3VZOA 1VIWB 4NR1A 2HWC1 5K0UA 4W6XA 5HCHA 1ZZCA 1SLLA 2EXJA 3D6EA 5A3PA 1N3OA 3V56A 1GNZA 1XU1A 4CDQB 4ZZ8A 1O7FA 4RGAA 4XBLA 1RUD3 2VMFA 4XC9A 3R4SA 1VAVA 2KA3A 2TBVA 2XVGA 3AM2A 3B7MA 1J3QA 3IAPA 1AR91 3VBSC 2JDUA 3WP3A 5FPZA 2RG4A 2XMLA 2P6HA 2OVUA 3CMGA 2HBUA 3OGSA 2WFF1 4YFWA 4ZXEA 3ZSJA 4XF4A 3PL0A 4D0QA 3SNMA 2YYOA 3NWKA 4HN1A 3RFRA 3ZXLA 1GKBA 2AACA 5FZLA 5FTTC 3GCXA 1LU2A 4WM7A 2CU5A 5F8PA 1IKPA 2E7AA 3IDCB 4DINB 1C1FA 5E88A 2FDHA 1H2KA 1SDWA 1SCRA 4FPLA 5JR2A 1YNAA 2V4VA 2VVEA 1V6IA 2I2SA 1RUD1 5AFBA 1OC1A 4JKLA 5IVJA 3LA7A 1R092 3W20A 3KZ4C 5D8AA 2Q1ZB 3BN6A 1APNA 1Z7S1 4MOAA 2CYFA 2XWBB 5KHKA 5J37A 2PA7A 2AREA 5A32B 4N7UA 2GC2A 3HBZA 1J58A 1S55A 5K4LA 1OI6A 4YW1A 4IEOA 4BQWA 2EXIA 3DXUA 1JUHA 1O5LA 3KCCA 4QXBA 1WKYA 4N43B 4IE0A 4EYUA 1FV2A 5FMBA 5L9RA 1IG0A 3R4DB 2D40A 3PUAA 4GB33 1RL3A 3LIHA 4XACA 2JD4A 2QBXA 4QX1A 1PO13 1MPXA 2PAEA 2PMWB 2VAUA 2ZPXA 4RFT0 4N53C 2R063 3OYWB 1SFNA 2WABA 5FY1A 1CPMA 3WZ1A 2H6BA 3X29B 3ZR5A 5FMOS 4Q4W3 1PX4A 1WMFA 1EAH1 2C9AA 2QQVA 1LHNA 1PVC1 1ZRRA 3MICA 4CP9A 5LZ6A 2RR13 2CV6A 4TN7A 5LRSA 4CUCA 4FQZA 4LXLA 5FXXA 2B39A 4XCBA 1ODMA 1KJLA 4OHXA 3FHAA 4PQ9A 4XQDA 3AVSA 1X82A 4YGBA 1FI2A 4DPNA 1UY4A 1DYOA 1ZZ7A 4IEQA 1R083 3MW4A 3DUIA 2B4KA 4D7SA 5AC93 4NIDA 2CY6A 4E27A 2PHLA 4IEPA 1OSGA 1XSRA 2ADDA 4PIXA 5DG1A 2WO3A 3VB9A 4CXWA 2W47A 3H42B 3QACA 2EAAA 4Q4W1 2ZGUA 2B45X 3FJSA 1WA6X 2IXCA 5JOYA 4RL7A 1ZBE1 1RUI2 3AKTA 3VHRA 4B7KA 1JYWA 4WM7B 4KU8A 5FPVA 3LWCA 2D6NA 3POWA 3FHIB 3HT1A 1RUJ2 5C9AC 5JLVA 3CIHA 3WF2A 3K3OA 5HBAA 3N4MA 3RI8A 1CZTA 4CZSA 3ACFA 2O8QA 3ZYPA 1OPMA 2VQTA 1MS1A 5H9SA 4NRMA 3VLBB 3WDVA 1VBC1 5D8AB 4WV8A 1LGNA 2RV9A 5IVVA 3IPVA 1CWPA 1MS5A 3E6BA 1UYPA 2ZGTA 1LB2A 1ENSA 1JXNA 1LJ7A 4DO0A 4XOGA 4QWNA 2XJRA 5DUUA 2IWGB 2E51A 3B69A 2ZMLA 1J1TA 2BWAA 2VZQA 1GZCA 1OKQA 4TSVA 2GALA 1V9U3 4IETA 4Y1VA 5FP7A 4AGRA 2G9GA 4ES8A 2E53A 1W2TA 1JZ4A 5K9YA 1PVXA 4P9XA 3ZXFA 3M4FA 5CEHA 3OPTA 2BERA 4CDWC 2OYZA 1UU5A 2VNRA 5JAXA 2XLFA 1COV2 1Z78A 4JRLA 4ONUA 5CNAA 3TBDA 4CUAA 4CP9B 1GZWA 2VMHA 3AL5A 3NKTA 2ID4A 2VTXA 1LOEA 2IXJA 2D6MA 2JKBA 1JYTA 3O0XA 1UZ0A 3FBYA 2ZX1A 5J96B 4MG2A 4QQLA 4UWDA 2WKKA 4RGKA 1D0HA 1LHOA 1XC6A 1UWWA 2VOWA 1WCSA 3CNAA 4HONA 1G9BA 4B8EA 1XNDA 1W05A 1WW5A 4Z92B 1GANA 2GH8A 5KC6A 5FBJA 1W8NA 3E97A 1ND2A 4F7ZA 2F4LA 2JDZA 1W6NA 1LODA 2OA2A 3ASIA 3O5SA 4V1PA 4YLZA 1W0PA 1S2KA 3I2KA 1NLSA 2WZR2 2RM23 3LB9A 3ZM8A 5JMOA 4O9EA 2QQJA 4BDVB 4IGQA 3BIEA 1EPZA 1LU1A 4COYA 2O14A 1NCRC 2XOMA 4OHWA 3U78A 4XPVA 1G7YA 4LO7A 4XF9A 3EMRA 4KG0A 1CAVA 2B9VA 3WNLA 2ZAHA 4IEYA 1UW8A 4MX3A 4EQVA 1NG0A 4GULA 5BUVA 1QJX2 4XYXA 4RN5A 2YC0A 5FRAA 3U37A 3UV9A 4CDQC 3IPVB 3MLJA 3TN91 4AI1A 1CX1A 4DB5A 3O1SA 1FNYA 4LIVA 3TEYA 4Q4X3 2ETEA 1X8MA 3GBFA 2RM21 1HX6A 2V4AA 4B7EA 2QFEA 5HI0A 5JXIA 1NZIA 2P3YA 3CEWA 4AEDA 2EF6A 4OHVA 1XRUA 4K8FA 1VBA2 5BNPA 5IVFA 2YBKA 4HG6B 4P02B 2Q8OA 5C8WA 2HWF2 1S2EA 1VLNA 3KV5A 4Y22B 1H2LA 4IEZA 4QXKA 4HSJA 1TME3 3G7DA 3RZKA 1XYPA 1NKGA 3FUOA 1OA3A 3N35A 2QVSB 3T2OA 5E16A 1HRV1 1IPJA 4FSJA 1RHI3 2XQRA 2WO7A 5I0TA 2VU9A 3ZO0B 1PMIA 1UL9A 1F8VA 3ZMOA 2RMU3 3QCWA 4UT5A 5FYYA 1Q43A 5FBZA 1RUI3 1GZWB 3ILNA 3O0WA 5F5AA 1RUC2 2Y60A 2A5ZA 2VXJA 4IE5A 3GYDA 4CVUA 4LHNA 1RUJ3 2LS6A 1KS5A 2OQ6A 5FUIA 3HN3A 4FO9A 4IE4A 1XSQA 5BXXA 1W2AX 4L11A 1KEXA 4KU7A 1UOBA 4FPEA 1LRHA 3SHRA 1AX1A 3VBUA 4EN7B 5C5UA 1B35A 5I93A 1BYHA 1UXXX 1ND2B 1OQDA 1W6NB 2WNVA 3HWJA 1RHI1 3PVBB 2NMNA 2UYBA 3IBMA 2RMU1 3ZXEA 1WCQA 4Q4V2 4LKDA 2IVIB 3I3DA 4IV1B 2EXKA 2HYKA 5BNQA 1AL22 3H8OA 4S2DA 5FOJB 1J3PA 3PVNA 5FYMA 1CAVB 1UY2A 3OSDA 1DZTA 1X9PA 4ZS2A 4NRPA 3V64A 3WUCA 4QKBA 3A0KA 3MLKA 3UGFA 1CGPA 2DYCA 3KM5A 4IEWA 5EJ3A 5FKBA 4HOOA 4I01A 4A7ZA 3PTYA 1C57A 4NIAA 3VV1A 2YZ4A 5FY5A 1AYM1 5DAPA 2FCUA 3QH7A 4E4SA 1W39A 3IT8A 4AHZA 4NIHA 1DQ1A 4AEDB 4CEWA 2JECA 1KJRA 2Q8EA 1BEV2 1DLLA 2DVGA 3GZTB 3WP5A 1Q5OA 5BNPB 3WDTA 1UOJA 4YW3A 1DQ4A 4EJRA 3T1MA 1XPWA 4CP0A 4OMDA 5EFUA 3WOGA 1SHWB 4NHYA 1OFNA 2AZ5A 3CF6E 4ISQA 4NUBA 5F5CA 5JIAA 3RRDA 3ZSLA 4CCDA 1WMDA 3D0SA 3M3CA 2HYXA 4WM7C 1UZZA 2VBPA 3PDQA 1VMJA 5FCCA 2QUOA 4KWLA 2CGPA 5F6KA 4MVTA 1KDMA 2E7QA 5FUNA 1AR61 1AXKA 3RPQA 4XF3A 3RVHA 5IFTA 5F7UA 1H30A 1MEC1 2EIBA 1C8M2 3LFMA 4GWJA 5K7PA 1UQXA 4AW7A 4C0HA 2ZEWA 5D8AC 3H1YA 1GOFA 1WLTA 2GN3A 4KI5M 2ZHNA 4LLOA 2R041 4Q26A 1GR3A 3VBUB 2AGSA 4CPBA 1WCKA 4DY5A 2XQXA 5I0DA 3P3NA 1O4ZA 4JHTA 1W3VA 4PIZA 4A45A 4GWMA 3HMYA 3VKOA 4LBMA 4M4PA 2B42B 2VG9A 1FOD1 1HN1A 1OOPA 4MZUA 4E8DA 2UWCA 4YGEA 2WS91 3S30A 1ND3A 4BYYA 1P8JA 3I59A 4XDOA 1CN1A 3EXUA 4PI2A 3KCYA 3T2QA 1MS8A 1QXRA 1AR71 5FZBA 5DUXA 1GP5A 5A6XA 4W65A 2BVVA 4IGPA 1YQ5A 3NJXA 4GKXA 3ETQA 3OGRA 1QDCA 4J1WA 2JXAA 5IATA 1W99A 2HWB3 3WHTA 1WBLA 2VQAA 1NAEA 2VR4A 4LQRA 2JWPA 1FT9A 4LKEA 2F6BA 3NNLA 3H8RA 2IXKA 2BNOA 2XGXA 5F39A 2EA7A 3D4KA 4AXOA 5J1XA 1OLRA 1VRBA 1Y4WA 3GZEA 2R0HA 3LKJA 3OGGA 3DECA 1S2BA 4P9GA 3SCGA 3VBSA 3DL3A 3WG4A 1MQTB 3ACHA 3I97A 3ZFEA 2JG9C 3BYWA 1STMA 4ASKA 3KCXA 5FUPA 1NYWA 1BZWA 2C26A 5ANNA 4FBFA 1Q8VA 1RGSA 1DLCA 2W52A 4K1YA 1YI9A 3LD8A 4IUGA 3BB6A 3KS7A 4HVQA 3OB8A 4DS0A 1FAYA 1OD5A 4JDMA 4QXHA 3PVOA 4XDQA 2HWB1 1JYNA 4XDPA 2BV4A 4HPKA 2ZGRA 4Z2WA 1AL23 4COUA 5A3TA 1LGCA 4D69A 1QJY1 2VW0A 1IHMA 3D8CA 2RS12 2VUDA 3WHUA 2JICA 1HRI2 1UKRA 5EWSA 1PZ8A 2Z2SB 3NL1A 4NHXA 3ZXAC 1UMZA 1PIV3 1WW7A 3INAA 2VNVA 1IPSA 5F2SA 3T1LA 1Q8PA 2JDMA 1JHJA 3RSJA 4IESA 3VKLA 5IYYA 1OUXA 3I2OA 1FPN2 5FLJA 1W6MA 4OQ8A 1OH3A 2O0OA 4P9JA 3VDBA 4QX7A 3CU7A 4YGDA 4MO3M 1RVF3 1OUSA 2Q1FA 1QOTA 2ARBA 1T2XA 2I74A 3RYRA 1Y3TA 4MGZE 4N53A 4AHYA 4LITA 1ND3B 2YROA 1CAUA 1S4CA 2PQSA 3R0RA 4FP2A 5JI7A 3I59B 4OI1A 4UI9L 2WT0A 4LUKA 1H8TA 3TRSB 4BB3A 4JQTA 4I3PA 1MACA 4LK7A 2XVLA 5FREA 3I3EA 2ZEZA 1WCUA 4MXWA 3WINE 1LULA 4NOTA 5FZGA 1RITA 3FC0A 5FMCA 4RYDA 4DMIA 5EYXA 4Q4Y2 4DNYA 2OX0A 3RS6A 3KT4A 3SCHA 1ENRA 2K46A 2ZHLA 4YYOA 4JV4A 4PBOA 3RJRA 4A6OA 1PGL2 1VBD1 2DUPA 3LPFA 3MIGA 2XDVA 1YQ2A 4JVAA 2Z5WA 1G9DA 5CG8A 1OT5A 4IEUA 3ZFEB 1RUG3 1AYN1 3HNBM 3R6SA 1W04A 2W87A 4QMAA 3SQOA 1W2NA 2R1DA 4Q29A 5AVPA 4IV1C 3AJZA 3MW3A 3JQXA 1RUOA 5C7GA 4QX2A 2VZ3A 1POV1 4V2VA 5F37A 4J25A 5JI9A 4HPKB 3OEAA 3ZYIB 5IT6A 1F15A 5JXHA 4BPZA 1UMIA 1WW4A 4BMEA 3NNFA 5FWJA 2HWC2 3NKGA 4LTAA 3M70A 2WDBA 1YQ8A 4FI9A 1OFSA 3VGIA 1FMD2 4FPGA 5IJRA 2PHRA 4GXLA 2Y6HA 1MS4A 4AEDC 4BLIA 4DFSA 4R4XA 3RI9A 3K4DA 1PM4A 1RUNA 1W6MB 2DBNA 4TXWA 3T09A 3LE0A 5FY4A 3PJYA 2EIDA 4D6SA 1A78A 1ULCA 2ORZA 5CADA 4DEVA 2WFF2 1SFPA 5LB6A 4GMP3 4UFHA 3ZN6A 1H8VA 4DUXA 3S57A 1V0AA 4CDWA 1U5ZA 5E89A 2CHHA 4DRVA 2PELA 4N53B 4NPLA 4NE9A 4YW4A 2GSYA 3LSDA 1OQ1A 1CAUB 1VBB3 3P3PA 2DCKA 1Q8SA 1KDKA 2GAUA 1XJAA 3SISA 1H8TB 4AK3A 5IK4A 3EQEA 3I3QA 3LEIA 5DQ0A 1CIWA 2R0FA 5ERLA 4DXTA 1QEXA 2NYYA 2LRPA 1YHFA 4TZDA 1DGWX 4TWTA 3UYJA 2OQ7A 4A44A 2VTXJ 1LOCA 2Y8KA 1RUD2 3M2MA 1K12A 3ZPOA 4AI9A 2J7MA 4MXWB 1MR5A 3DPRA 4P9IA 3BOPA 1OD3A 5FMDA 2WR9A 5CVRA 3W58A 3JUUA 3BVCA 4BQ5A 1HQLA 3LCPA 1RIRA 1J83A 4AQ6A 1HRI3 2D3PA 4FPFA 1GZ9A 4E4HA 3VDDA 3NJVA 5DDJ3 5LBFA 5FZDA 1TMF1 1DHKB 2Z79A 2GMEA 1R1ZA 5GZDA 4QDSA 3HAGA 3ENRA 2QDNA 1MS3A 3MF6A 1JYCA 1FPN3 4YG6A 2SBAA 5ANQA 4UFKA 3WSOA 2BPA2 3WG3A 2BGOA 1LNSA 4UBHA 5DUWA 2HWD1 1H1IA 4YW6A 2DVDA 2X8KA 1AJKA 3JBG3 3GBWA 3WUDA 3AK0A 4ZXKA 1YLLA 2XLAA 2D5FA 4O9GA 4A3XA 3K46A 4NVPA 5FXWA 4CP1A 1HB3A 1TEIA 4ZHNA 5CB7A 3POBA 4NHLA 2DTWA 2FZ1A 3AMMA 3AZYA 4G3YC 4QQPA 5KBFA 2K0GA 4HBNA 2X53S 4ASLA 2RDRA 5F3GA 3UK9A 3A23A 4Y4RA 5FP4A 4CDXC 1Q3EA 4YZ1A 4GB32 4LT5A 4KNCA 3VHPA 3VD9A 1Y9QA 2GDFA 1LOGA 3A0NA 3WQ0A 4RHV1 4FTBA 4PT6A 2R062 3AP9A 3DKWA 1MQTC 4C1WA 4UF0B 1G9FA 4QX0A 3CJXA 4MLOA 3JD73 3ZN6B 4Q4W2 3VBRC 5IVCA 4UOJA 1JOPA 1BMV2 1ASJ3 4CDWB 4D6RA 1NT0A 5JPNB 3OPZA 2RR12 1ZBE2 2MEV1 3H0OA 5HV0A 2XHNA 2WUHA 4XVHA 1VRH1 3RZHA 5EYYA 5FY0A 1CAWA 2DUOA 4OMCA 5J98B 2Y64A 4PDWA 5ACA1 4L9BA 2J1AA 2BNNA 2AH2A 2BQPA 2D6LX 3AC0A 1R082 3DPRB 1X8EA 4MV2A 1M4WA 5AC92 1DGLA 3LDKA 2KD7A 3N7JA 1HQNA 1VBC2 5B4XA 2P2KA 1NCQB 3RZMA 4QAWA 4R52A 2VNOA 4NPRA 3MYXA 3W5NA 2JE9A 3JD71 5JR7B 4G9SB 2RE9A 4QHBA 3ZMNA 5FZOA 3DYPA 4BIFA 3UESA 2WLQA 4FT8A 3VDDB 2W68A 3SMHA 1WCDJ 1AZDA 5KHHA 2W5FA 1NLQA 5CYYA 4PIYA 4ORFA 2DFBA 1YIPA 4XHXA 3JB8A 5C3RA 1RUE1 3ZFGB 1DZRA 1AR93 4M0NA 1LKNA 5DUVA 2ZZJA 1ND3C 3E6CC 1ULFA 2WFF3 4FOYA 2PXJA 1PMHX 2H0VA 5CIRA 2HEYF 4EN0A 4A7KA 2P5BA 3O7OA 4SLIA 2I07B 1QXPA 1X7NA 4YZ2A 1KS4A 4PF5A 4UBGA 3CLPA 3PUQA 4K21A 2G1MA 2L9LA 2Q1MA 5EHDA 1U5IA 1V9U2 1U5XA 3K75B 1SEFA 2B7YA 2D6PA 4YGCA 4B29A 5BV6A 5C33A 1DGRA 4UFMA 4XCAA 5A80A 5FK7A 4AVSA 3ES4A 2A3XA 1S0FA 1UN1A 2ZACA 3HJRA 4XZUG 3UL2A 1Z7S3 2WA4A 3WDYA 4ZKTB 3D3AA 1M06G 1POQA 2XUEA 4NIIA 4CA9A 2A3WA 3ZFEC 5C3OA 5IVEA 1QDOA 2W3JA 1XYOA 3PUIA 4C8DA 1PK6A 1YWKA 2OXBA 5GZEA 3ACIA 2W92A 3KSCA 2AENA 3D82A 3K4ZA 2VZVA 5H9PA 4AFAA 4S2FA 3ETPA 2IVJA 4INDA 4N9HA 2FHRA 1B09A 1O5UA 2P1BA 2WYSA 3VD4A 2CDPA 1REEA 1CAWB 3Q8CA 2QQMA 1VAKA 5LATA 1OLMA 4PDWB 1TG7A 2VL4A 4JGZA 1QMJA 1GWMA 3SEEA 5CBLA 2FDGA 2PHUA 3PNAA 4CCKA 1EAH3 3Q8AA 3MIFA 1W28A 3VBFA 3KGLA 1PVC3 1O3SA 2YV8A 3AYDA 3HQUA 3TN92 2V09A 1AUYA 3U0ZA 1KQRA 4Q27A 4LHLA 3PU8A 3ILFA 3RDIA 2RM22 5FZOB 2QZ3A 1V6KA 5T3NA 5KXBA 4XIOA 1VB4A 2RS33 1XBFA 4PQQA 1YFXA 2VQ0A 4OFGA 1GUIA 1OQEA 4MGIE 2BTVC 1D0GA 4Z1VA 5D21A 5A6QA 4XFCA 3Q8BA 2UWAA 4Q0PA 1UIJA 1UAIA 2XJTA 4LUMA 2PFWA 1FX5A 3EO6A 3E1F1 3CZUA 1XNTA 4D7YA 1H8TC 5BNNC 1BQPA 2J1RA 3HOBA 1S0EA 1H6YA 3OD0A 3QLQA 1UMHA 3I2DA 4OZXA 1J59A 1ZBE3 3ZXDA 4AGGA 4CCMA 5FOBB 4K20A 5JIUA 3BOWA 1ULGA 1Y9GA 2ET7A 4GJYA 4Q4X2 3WR0A 1OHFA 1SMVA 5F3CA 3ACLA 1A8DA 1RMU1 3N7MA 1JOBA 4R9AA 3THTA 4WVWA 2RS31 4FPYA 1NLRA 5C6CA 5DMYA 3I4IA 3BUCA 1S0IA 4MHRA 3H3ZA 4FOQA 4CCOA 3M3IA 1DU3D 1UNBA 1TME2 5APAA 5FYVA 1VBC3 4QQ2A 4CU9A 4URAA 4LBOA 4HT1T 2NP0A 1PGW2 2RJ2A 4QX3A 3AXDA 4HN0A 4ZU5A 4AEMA 5CA6A 3LFIA 1RHI2 1IOAA 3MI8A 4NAMA 1I3HA 2JG9A 1PK6B 2RMU2 1U12A 1WD4A 1ZBA1 3AFGA 4K1ZA 4M4RA 5C71A 1CJPA 1QU0A 1R1A1 3AFKA 3TEXA 3E5UA 3V0BA 4P00B 2GU9A 2G19A 5EXOA 3DV8A 3LEMA 2XJPA 1N3PA 1UY3A 2R32A 4P5YA 1W03A 1W8HA 3FFQA 5L36A 1SBEA 4J1XA 5JVVA 3DYMA 4JGZB 5CISA 4AHWA 3I2IA 1AR81 1IS4A 2PN5A 2W1WA 3PMEA 4LBQA 5FYIA 5FZEA 4BXFA 3VBFB 3KV6A 3I8TA 3LF7A 3S7IA 2DFCA 2YU2A 2BOJA 1VR3A 4LKFA 1REFA 4N8MA 4OI0A 2WZPP 1H2NA 4UFJA 1X9TA 3P6BA 2HJIA 1AYM2 3W59A 5C8CA 2VCBA 1N1VA 4WZCA 1EPWA 2A75A 3LA2A 2FD8A 1KGYA 2DU1A 2VW2A 5LK5A 5FWEA 2ZA9A 1UIKA 1W90A 2GMPA 2XVKA 3FX3A 4URTA 4Y22A 3TNQA 4AFBA 4AAXA 1WMEA 4YVSA 5FZMA 3S5AA 2WT2A 2QNKA 3JQWA 1EV11 1W9FA 1DQ6A 1VAMA 2ERFA 3H9AA 4H55A 2JDYA 3GHMA 1LHUA 2K9ZA 4HK9A 2JJ6A 1SLTA 1S0JA 1W0NA 3MBWA 5FY9A 5A7NA 1S0GA 1O3RA 3IB3A 1EYBA 3SC7X 1WZXA 2VQUA 5H9RA 5IWFA 4CE8A 3H7YA 1N3QA 1ZZ6A 3M8LA 2BVBA 2XJVA 4BK5A 2OKXA 3DPRC 4BJ0A 1RYYA 1W2OA 4JKKA 4P9LA 2VBDA 3URFA 1NCQC 3N9LA 5JSOA 1RUF3 2ZXQA 3AB0A 1VP6A 3AZWA 1UPSA 3N9MA 3VDDC 5LY1A 5FJHA 2XUMA 3TN93 2R6QA 2W08A 3HQXA 3BTYA 4XJZA 2O1QA 2SLIA 4PI0A 3ZN5A 3MO4A 4XFGA 2GC3A 3ZIXA 5AFEA 2JG9B 3Q9OA 3FL7A 3OUHA 1VBE1 3MFAA 3ZFGC 2XBO1 4BA6A 4QQOA 4DOUA 5A6ZA 3V0BB 1ZRFA 4IV1A 1FOD2 2BJSA 4MYEA 1S0CA 2BW8A 3MDPA 2P17A 4X8NA 4YG3A 1WW6A 1DQ2A 3EHKA 2E9QA 2YMZA 4NIGA 4TTGA 2CTVA 3MUY1 2J1VA 1D2QA 1RUF1 2DCYA 2HKXA 5TSWA 1HRV3 1AVBA 1J1LA 3AYCA 3P5BA 4LBQB 4BQ4A 2RS53 4D7TA 2PHXA 3BTXA 4GWIA 1XE7A 3TYJA 3NW4A 3WDUA 2RJKA 5JSPA 4QKDA 2Y6FA 2WO1A 5A7SA 5C8CB 2WNUC 5A7WA 1UYYA 3OG2A 2WWJA 1XNBA 4HZFA 1DIWA 2DV9A 1YC61 4LORA 4YZ4A 4Z82A 4DUVA 5DXDA 2ATFA 3O0VA 4Q1RA 2EXHA 2LROA 1IZ3A 2GN7A 3BPZA 3NAPA 4YVSB 5T54A 4FAHA 2Y6GA 3HD8B 1D4M1 5G05L 1R091 1Q8OA 3I7DA 4OUEA 5DAQA 3WLUA 1HXS1 5FP8A 3HNYM 3USUA 3ZYJB 2RS51 4NMIA 3VBOA 2VCCA 3A4UA 4GJZA 4MXVA 1PMJX 4PDWC 4IV3C 2HWB2 4EZHA 1IPKA 4XQ4A 3AYEA 3R4UA 4C1XA 2PQQA 1C5HA 4G4FA 3VKMA 3WF4A 1QJY2 3U11A 4OUMA 3FLPA 2A6YA 2PHWA 1EY2A 5F2WA 4J6GA 1CR7A 2BDRA 3B94A 4QPYA 1BVVA 1XB9A 3NNJA 2AYHA 5T5JA 1HIXA 5KXEA 2CL2A 2VMDA 1LOAA 4QDQA 4COZA 4K6BA 3WNKA 2X5IB 5FZ6A 4NWWA 2VVDA 1L7LA 1NZCA 3IDBB 1WMXA 2Y6LA 4LBJA 1O4YA 1AYM3 3T0AA 1CAXA 4WVVA 4BCUA 2RDQA 5GALA 3IDEA 1AX0A 2WN3A 2ZGQA 1G86A 1GZTA 4MGQA 4S2HA 4ZU7A 1C1LA 1OF3A 2V73A 1IKQA 1E5SA 1XE8A 2A1XA 3GBGA 3K4AA 3RZLA 3ME2A 1F9KA 5T55A 2QQWA 5EPAA 1NX9A 3I2GA 1T6GC 1ZYBA 1PIV2 5FZ1A 3TEWA 3VZNA 5F5QA 1RTVA 4BHPA 5F32A 2Y0OA 2Q30A 1ONAA 2E6VA 4QD2A 5A1LA 1AR63 2VUCA 3OGJA 3KHCA 5FYCA 4AG4A 2XHKA 1MEC3 5A3UA 4CDXA 3BU0A 4BQ3A 5A7WB 4XXPA 1RVF2 5GKAC 3ZXGA 1NY72 1CVNA 2ET1A 3UKTA 1VBD2 3UKNA 4TLGA 2W46A 2D44A 2R043 3I3MA 1MQTA 4IE6A 2VZSA 1PK6C 5LEKA 1V6NA 4CPBD 4KH9A 3VBRA 3WW1A 3NAPB 4BWOA 1CONA 2VTFA 3W9AA 1FYUA 2VCMA 1AHSA 2WSVA 4UW3A 4AWDA 4M3CE 3NV1A 5LW9A 1AX2A 4JZRA 2DDUA 4IERA 3USUB 1UOFA 3PHMA 4UXAA 1BK0A 1X50A 3VBOB 3VBHA 3J9SA 4ES9A 3K51A 5JPMB 1FOD3 5KHJA 1WGPA 1V00A 4EN6B 4JGZC 2C6SA 1GOGA 3SKVA 4D8MA 3J7HA 2WS93 1W6OB 2WSUA 1UU6A 1L7QA 4EZ4A 3RZJA 3PURA 2DURA 3VBFC 2VMCA 3H3UA 1AJOA 4QPIA 1AR73 2VH9A 5GJ6A 3ORJA 2J1EA 4XUTA 1COV1 5JZGA 3OPWA 1RUG2 1OA2A 1PNGA 2WWUA 4AQSA 3POJA 4XIKA 4Z8BA 5DZFA 4XE9A 4LK6A 1AF9A 1K5MA 4AI8A 4XEZA 4BU2A 4D3WA 1SACA 1CAXB 2VMEA 4XFIA 1HLCA 2QQKA 2J1UA 2VCAA 3I2HA 3EJKA 3LDBA 4XJ8A 5LA2A 5GLWA 5FR3A 2E33A 3S5QA 1MZ6A 1NXD1 3MFCA 3HPNA 4QQHA 2NN8A 1VALA 4KWJA 3MW2A 5FY7A 3IIAA 4FTEA 4EROA 1ZREA 2W1SA 4IXLA 1GICA 1RUH3 4HKLA 4P08A 4PF1A 1US3A 3MGUA 4CTEA 1YJKA 4RGGA 4JAAA 3N7LA 2XKOA 3NJYA 1VJ2A 2TNFA 2V5YA 3T0DA 2JE7A 1O8SA 2WZR1 1MZ5A 4L2NA 3FBMA 3OEBA 2ARXA 3JCIA 4AGVA 4U2AA 4CDXB 1QJY3 1PO21 4BQYA 3DEMA 5T5OA 4HSLA 4RSUA 5FAXA 2UY9A 2BP6A 4TLFA 4ZZ5A 4LO8A 4AI0A 3DCQA 2DVFA 1LEDA 1VBB2 1ENXA 1GSLA 2DTYA 3VBRB 3RMYA 1FXZA 1HV1A 1QJX1 1RUH1 4UAPA 1EUTA 1K45A 1EP0A 3VZJA 4D6QA 2WZEA 1FV3A 4A7YA 4ATEA 1GLHA 4O7XA 3VBHB 1WUVA 5HXVA 3CKHA 4JTNA 1LTEA 3WT3A 2GP5A 4DY3A 2AC1A 3FWEA 3GJBA 4QX5A 1LOBA 5FPAA 4XMAA 4AZZA 4Y20A 2ZGLA 4GA9A 3ZKYA 5KXCA 5IK5A 1HDKA 4JHZA 1VE0A 1CJDA 1VBA1 3LEKA 3ES1A 3IMNA 4FFHA 3B5LB 5FYBA 1XOYA 5G04L 2BGCA 3C8XA 5J3UA 2I45A 4UYBA 2WO2A 3SEPA 2WRAA 3ON7A 4QPIB 2JD9A 5DDJ2 3THCA 5JXJA 2PHDA 5JZGB 2ZX3A 4LPLA 1F5FA 5A33A 5C8CC 1ULOA 4Y5Z0 3UJQA 4OYUA 1TNFA 2ZMNA 3VKNA 1UCXA 2ZX4A 5JOZA 1K5MB 1DCSA 1E5RA 5FZ8A 1QNWA 4B1MA 3BI3A 1RUC1 4QGNA 4YVSC 1C4RA 4Y33A 1W6QA 3JBG2 1VBD3 4W4ZA 2ZGOA 3C7OA 2GNBA 3GZAA 1QY4A 1AL0G 2MEV2 2KR2A 3SXWA 1AYN3 1VRH2 4KBBA 1GV9A 4CCCA 5BNNA 1OVSA 2GNTA 4XW3A 4S2GA 4GALA 2XL9A 2YPJA 3B01A 2X09A 1DZQA 3H7JA 4NO4A 2ZGNA 3WNMA 1ZA4A 2FDKA 1LENA 1QJFA 3OUIA 4R9CA 3JU9A 5A7OA 1BXHA 3VDAA 1SZBA 5D2AA 4GD4A 3ZDVA 5ACA2 2ZMKA 2G9ZA 2JDNA 1POV3 2JEMA 4E2SA 2C0ZA 4XJWA 1H0BA 3KT7A 5FLHA 4ET7A 3KF5A 4Q4V1 3ACGA 3WDWA 1REDA 2WINB 1W8UA 3JD72 3H8XA 2BBVA 5E8AA 2X5IC 1US2A 1ASJ2 2PAMA 3W5MA 1HV0A 2XLGA 3WP6A 3AL6A 2ZBJA 3L9JT 4IEVA 3ATGA 3WNNA 2ADEA 1JODA 2K2SA 1CD3G 2NZ9A 4M3CF 5L19A 2RJLA 3ROUA 3ZSKA 1YXWA 2WQZC 2IFRA 3USSA 4YW2A 4MSVA 1LAJA 2C24A 3POGA 5B4NA 2PYTA 5FZHA 1SG3A 4KWKA 4M01A 4C0BA 2VUAA 2BFUS 4SBVA 3A22A 1KITA 2C5DA 1I1EA 2ORXA 4AEKA 4GZ9A 4Y20B 1N1TA 1BEV1 3ZLIA 5E1RA 2VZRA 5DAVA 2WL1A 3KV9A 3WW2A 5CFCA 1CX4A 2J42A 4K7JA 4OVEA 1F4HA 3WNXA 1DGWA 2EVXA 3A21A 4FPOB 4LHSA 3JXSA 3OOXA 4P5HA 3AXEA 1XXNA 2ENRA 4AVVA 5A33B 5A1FA 5IFPA 4YPJA 5BNOA 5FXVA 5IK8A 3FE5A 3OF1A 4FQ4A 1LESA 2BU9A 1AR92 4I3GA 2QQUA 4YW5A 4UF0A 2LALA 2VPVA 3S6PA 4FAGA 1OKOA 2HWE3 3LPGA 4O61A 3NAPC 4QT6A 1W6QB 4Y1XA 4Y1UA 1C8M1 4AI3A 5L7OB 2BFUL 3APBA 3FHQA 1LR5A 4I2OA 1TMF3 1VPHA 3OY8A 4FPHA 5FY8A 2QKDA 3Q8EA 2D97A 3HT2A 3VBOC 3I2JA 3ZR6A 5BNNB 2JB8A 4XTMA 3WG1A 3J26N 2VOXA 3FZ3A 5ISLA 1LOFC 5A3NA 1JS9A 2ES3A 2QJVA 2W91A 1JZ8A 4RS5C 1TQ5A 2HWD3 1CZSA 4XUOA 3ZPYA 4DUWA 2WA3A 1QF3A 5CU1A 2DCJA 1OXCA 1NCQA 1Z7S2 3LIGA 4JX0A 4OULA 4QU1A 3A7QA 3M3OA 2HWE1 4HKOA 4AFDA 4KGQA 5KR7A 1JYIA 3U1XA 2WNOA 1OMIA 2AUYA 4N7IA 4XQWA 2VZUA 1UF2C 3TB0A 1K3IA 1JU3A 4XFBA 3T0BA 2IFWA 2YXSA 4LBNA 3VD5A 4BM8A 1W0OA 2XWJB 4WM8A 2P37A 2WBKA 4BK4A 3VL9A 1YRZA 2X10A 1ZX5A 2ZEXA 3E5QA 4Q0QA 4XTPA 3ZFGA 3OJBA 5F9TA 4RHV3 4L97A 5LA9A 1OBNA 1SPPA 2Y6KA 4AVAA 2CNAA 3CBNA 4OZOA 2YB7A 4OCTA 2BZDA 1EAH2 4YFZA 5FZFA 1PVC2 1BLZA 1DYPA 1GBGA 4XFFA 2W0XA 5T5LA 3I3BA 4R4ZA 3HQRA 2MEV3 1HW5A 2WN2A 3MPPG 4MGKE 4Y4YA 2J1SA 4XJAA 4YZ5A 1VRH3 4PCRA 5CFCB 1MS0A 1IGOA 2ZGSA 3K77A 2IXHA 3B00A 4QHOA 2Q0AA 2RS32 3J8F3 3TWIA 3J4UH 1WWYA 4MGTA 4Y5TA 5ACA3 2X05A 4AOCA 5BNOB 5EQUA 1DDLA 1G9AA 2WNUA 3ZSMA 1JW6A 2ZGMA 1UY1A 1GWKA 2NQYA 3GCWA 4CSWA 2QE3A 4A2UA 1A8MA 3ZYGA 1WD3A 1UYXA 1GQHA 2D6KA 4CCJA 2YC2A 4DIQA 4A4AA 1QJU1 1QJEA 3CDZB 1O8PA 3M3EA 5FXZA 3OY8B 2ZX0A 4YRDA 1N47A 4CUBA 3VBHC 1OVPA 2R49A 3RJ2X 1SQ4A 1RUE3 5A3LA 3UGHA 3J8F1 4NWVA 4ITCA 3IIIA 3PIJA 1NA1C 4IV3A 4OHYA 1NOVA 1LGBA 3PLQA 1SFYA 3VUOA 4HVRA 3PIGA 2VOVA 1DFQA 1I5ZA 2WIIB 3AZZA 4AL9A 4W6WA 4CYDA 1ZRDA 4XXAA 1OURA 2RDNA 4QPIC 3AP7A 5A3WA 4NHKA 5JZGC 5HCBA 3MF9A 3EYPA 1L7RA 1JMUB 4QB6A 2BWCA 2DF7A 4P9YA 4XUPA 2ZAAA 2Z42A 4FP3A 1DBNA 1K5MC 2MNGA 5C3QA 2FMYA 1JOJA 1O3QA 1QQP1 2F4PA 4LHKA 4NJ4A 5CZKA 4L99A 5IVYA 2QQPA 2ZTNA 4YM1A 2PLV1 1V6MA 4JGYA 4WM8B 5FPBA 3F2ZA 2OS2A 4CEYC 1RXGA 2IXIA 2JKXA 2P34A 4DEQA 5IAVA 2WC2A 2A6WA 3C7FA 4ZY9A 5C3PA 3ZOIA 5GZFA 2V72A 1EV12 1SPPB 4XAAA 3BTZA 3KMHA 2W39A 3ZFFA 3CL1A 3BKZA 4WVMA 2VM9A 4Q4Y1 4PHZA 2BBAA 1F5JA 1GNHA 3H8UA 4NHMA 4QGMA 2CSGA 3L2YA 4B4RA 4YM0A 1ODNA 3B93A 5FYHA 1W8TA 3O1OA 4LE3A 4QGLA 1DGRN 3C7EA 2A3YA 2VMIA 1URXA 2Y38A 2F17A 3R05A 2FMDA 4ATFA 3GDBA 1ZZ9A 2Y0IA 5AVAA 2CAVA 2BNMA 5GM0A 2YPDA 4ASMB 1HN0A 4JDNA 4BMBA 2TUNA 2KXLA 2AEYA 3POSA 2WNUB 5KWRA 3PJQA 5EP9A 4NAOA 1BJQA 1QXJA 1XYNA 3SH3A 2R30A 4IDZA 2HBTA 4Y26A 1CESA 3KVAA 1QJZA 2P3IA 3I54A 5A7QA 2DCTA 3GNEA 4XBQA 5FFOC 4GAZA 5IAXA 1MVEA 1ULEA 1UU4A 2WYFA 3VHNA 4IL7A 5A6YA 4UFIA 2W2IA 4XABA 2XH6A 3KF3A 3TOJA 1UX7A 3UT0A 4OQ9A 4CCEA 4QB1A 3O1PA 2MPFA 4RQPA 5IW0A 1C3HA 4CXXA 4EWDA 1FMD1 4XHBA 2XJUA 3LDRA 2YFUA 4IV3B 3T08A 1RUF2 5DN2A 1LCLA 1BBT1 2YHJA 3LEGA 4H7LA 3AYAA 4HMZA 2JDPA 5F3EA 4BISA 3NMBA 3OBZA 2JX9A 4OUSA 4LNVA 2R073 3MIBA 3FN9A 2A73B 1LHVA 1NQJA 4I02A 4E8CA 2VY0A 3LSEA 2YBPA 3KV4A 3MUZ1 4JRAA 4AR2A 2JE8A 4CDUA 4XAEA 1RMU3 3KWVA 4EWAA 5FO8B 1TNRA 3OBRA 4ARYA 4GH4B 1D4VB 4YG0A 2ARCA 4WBBA 4GMP0 5A3OA 4QM8A 4JGYB 5FJKA 4BOWA 4Q0VA 4EN9B 3GF6A 5DG2A 2XPJA 3E5XA 5JUVA 2Y33A 4H7MA 5L7OC 3VL8A 2WFPA 5FYTA 1D4M2 3WEZA 1JZ5A 2UYAA 3LGRA 1HRV2 2WQ8A 3ZFFB 1HXS2 4WVMB 3O1RA 2ZCWA 1ZA7A 2RS52 1QGLA 2HLEA 1DG6A 2R071 1ZBA3 2ZHMA 3RWKX 4CP2A 1R1A3 1XQNA 3UNPA 1XNAA 3H3LA 2D6OX 5ABJA 3K2OA 3NNMA 4QHZA 3LQCA 3THDA 5HV4A 5EZWA 1KRIA 1OF4A 2ZGKA 3KT1A 1IS3A 5L9VA 3NVCA 5EJ1B 5GLTA 4PLOA 4DRRA 3VD7A 2GMMA 4LBQD 4XJUA 3AP5A 5C5TA 3J7NA 1AR83 1W3XA 2JG8A 5LCWL 3SCFA 1HB2A 3WX5A 1JI6A 1V6LA 4LA3A 1FNZA 4QPWA 5I8TA 3T4HB 4E2QA 2C9KA 2YGLA 1YUDA 3VD3A 4XURA 1RC6A 2JENA 1QOOA 3PTRB 5C4WA 3QBQA 2PAKA 4B4QA 2W1UA 1IS6A 3IMMA 3BGAA 3M3QA 4Q0UA 5K0UB 2QQOA 2LW8A 4RQPB 5CKMA 4H14A 3FLTA 4DQAA 4WZFA 2RDSA 3HVDA 3RNSA 2XXZA 4GB31 5FO7B 1EV13 4PLNA 4UW6A 3CQOA 1PO11 4M0HA 5CFCC 4HFSA 5I8SA 4NROA 2R061 4FVVA 4ZONA 2IUWA 4LMFA 3GJAA 3ZIWA 3ZYFA 5FPXA 2QQLA 3I49A 2WQ4A 3LZZA 1C28A 1O59A 3C3VA 4MADA 5FMOL 5FYUA 2FDFA 3HIFA 1BMV1 1VB2A 2OPWA 4L0PA 1JZ6A 5BNOC 4CDUB 2RR11 3CO2A 4CXYA 3T4VA 1GYKA 2NLRA 1DF0A 2OT7A 3KD4A 3LA3A 1H4HA 2EIGA 2XJQA 1QOSA 5A1AA 5FPLA 3AZVA 4YVWA 1SLIA 1QHDA 3QH6A 1H9WA 4DXSA 1Y9MA 4RD7A 4QM9A 1QNYA 3DGTA 3C7HA 1R081 3OBAA 5AC91 5IHRA 5FYZA 2A6XA 3EB7A 2RHPA 3N9NA 3WP4A 1VBE3 2P3KA 2XBO3 5GZCA 2VULA 4DXZA 4NPMA 4HVOA 1DYKA 1YJLA 1BKZA 4LKSA 3T2TA 3M7AA 3AKPA 3U10A 2OUJA 5ABJB 1AR62 2W95A 1MEC2 1RINA 4P9WA 1I5PA 2LM3A 2OW4A 2W9XA 3KHBA 3T3YA 4ZS3A 3RYPA 2VJXA 4D94A 3KQRA 3KQ4B 5FZKA 2BGPA 2FBEA 1PGSA 1SCSA 1W9SA 4X8PA 1H1AA 1PM7A 4AQ2A 2R042 1D2SA 2AEZA 3ZKUA 4CCLA 2JG8B 4XMIA 2X5IA 4A42A 2DCZA 3WV6A 5FZ3A 2CDOA 4BZ4A 2FCVA 4WM8C 1GWLA 1HQWA 4HK8A 3EBRA 1O3TA 2JG8C 1KXGA 1L3JA 3H1MA 4AVCA 2QTWB 2CGNA 5C4WB 3O1UA 2JIJA 3RMXA 1GOHA 1PHMA 4OLLA 1GFF2 2WS92 1V9U1 2P6CA 3PU3A 2CWMA 4DXRA 3HEIA 1D4M3 2EIEA 3N7KA 1R093 5FZ7A 1AR72 1HXS3 4QU2A 4W6YA 1W06A 3IDAA 3V0AA 2VE1A 1H1MA 3POYA 3AP4A 5I8YA 3IWZA 4FPKA 1FATA 1BK1A 1XE0A 4BE3A 1W8ZA 1T6BX 3CHXA 3GM8A 5I0UA 1F2NA 5I91A 4IEXA 4YSFA 1PO22 3OCPA 4LOSA 2Z4FA 2VZPA 4A3ZA 2NPIA 3KLSA 3UETA 4YARA 2R7EB 4QPGA 2C1FA 2EALA 4YVWB 4Z2AA 1UOGA 2XR4A 4MHUA 3DF0A 1ZVFA 1JYVA 5SV8A 1RUH2 2C4XA 3AMNA 2OZJA 3GXUA 2CWSA 2Q4SA 2QDRA 2GNDA 3U75A 2Q5TA 1W9WA 2DVBA 4FOVA 1S0BA 4LEJA 4E4DX 1J3RA 4OI2A 5I0SA 4EE2A 4QKNA 1LOFA 1UZYA 1W6OA 4XFHA 3AKSA 5DAXA 4RS5A 1E5HA 2FCTA 4L8QA 4YZ3A 2A6VA 3FUQA 4KQ7A 4XZPA 4KBZA 2GNMA 2NM1A 3NV3A 5FZCA 5FDBA 4LO4B 3B3QE 1NE4A 1WLCA 5CFDA 2WLPA 1JU4A 1OA4A 4GH4C 1RJ7A 5F3IA 4JCKA 4XUQA 3TAYA 4Q5OA 4BQXA 4EWEA 2LTNA 5FP9A 4JGYC 1HB4A 4XILA 2H6CA 3S0MA 4BH9A 4JTOA 4PBPA 1K5JA 4Q4X1 5LBBA 4Q2FA 2GH2A 3ALQA 1IQDC 3ZFFC 2VW1A 4X6RB 1MS9A 1N1YA 2UU8A 5LBEA 4YNIA 2ZHKA 1EUUA 2VMGA 1BVP1 2QQIA 3HNMA 4W8JA 2D43A 1XNCA 3ITQA 2CGOA 2D7FA 4TYSA 1TME1 4Z07A 3ZX7A 1UXZA 2UWBA 3J7LA 5J48A 5M0TA 2WJSA 1PGW1 3JB4C 3V0AB 2D93A 4N43C 5JOWA 4QB2A 4LOTA 1H4GA 4F8AA 5FZIA 5GLZA 2IC1A 4EN8B 1ZZBA 4HKWA 5D1IA 1RUI1 1A6CA 3VDCA 2EAKA 5H9QA 3MZHA 4BQ2A 3ZVXA 3WXPA 3QD6A 1VMFA 2DU0A 1CPNA 1MZEA 1Q56A 1RUJ1 1RXFA 1R64A 4QPGB 3U4SA 4R8HA 1RB8G 3NV2A 1E57A 1COV3 3CJIA 1AYN2 1D7PM 3RGBA 3OGVA 3FFZA 4XETA 4MH0E 3KVBA 3NNGA 4Y3OA 5FP3A 5K0UC 4FCAA 1YI7A 3POIA 2D5HA 3CZJA 1WLWA 4NRQA 3N9OA 4RQPC 1C8NA 2PTMA 3B9IA 3BALA 2XG3A 1W9TA 4CU8A 3PUSA 2HH9A 1SLAA 3RZGA 1NA1A 1LEMA 4F83A 4PJYA 2ZS6B 4RS5B 1JH5A 3HBKA 4C91A 2VOTA 3G6JB 2ARAA 1G6NA 2E63A 4CDUC 5L9BA 5CFDB 2CAUA 2QQNA 3MHZA 1AXYA 3WY6A 1UYZA 3T2PA 2UY8A 3V65A 3JZVA 4KL1A 2VVFA 4R9BA 4Q8KA 4KWUA 1Z0HA 2WZR3 2TEPA 4E9KA 3J7MA 4HANA 3Q8FA 1PO23 2BOIA 1IG3A 3UKVA 4K9SA 3MV11 4CEYA 3TNPB 2R16A 5L73A 2XKPA 4FOWA 5JSRA 5LK7B 4IW3A 1V6JA 2WAOA 2WT1A 3D0JA 5A70A 1GQPA 4HLTA 1QH6A 2VZOA 1JTZX 3UGGA 3WF0A 3ZXKA 3O1VA 4UFLA 4FFFA 4MUVA 1QJX3 1RJ8A 1UY0A 4XFAA 1Y43B 3HN1A 1ZRIA 5ABJC 5FQ0A 1NXMA 2VO5A 3WG2A 4RA0A 5IVBA 1DQ0A 3N9PA 1QIQA 4FPJA 1B35B 1SBDA 1GNYA 4COVA 4P14A 2WNVB 1H6XA 3BU7A 1JYXA 5SV5A 5LBCA 1YFYA 2YFZA 3FMGA 2YUEA 4LULA 3MPBA 1KD7A 3AP6A 1LECA 3BCWA 4R9DA 5GLVA 3SH4A 1CZVA 1E5IA 4RR3A
chains in the Genus database with same CATH topology
2B9VA 3SEEA 3WNLA 4JX0A 2J22A 3A7QA 2XONA 3WF1A 4RN5A 2VZUA 3U37A 1K3IA 1CX1A 1JU3A 3T0BA 3VD5A 4PQQA 2WBKA 4BK4A 3WNOA 2X10A 2J1TA 2ZEXA 3NRUA 5JXIA 1GUIA 2Y6JA 2Y6KA 4OZOA 2W94A 2YB7A 4HG6B 4P02B 1GU3A 2BZDA 3GGLA 3E1F1 3CZUA 1XNTA 1NKGA 3I3BA 2EICA 2J1RA 2WN2A 3HOBA 3T2OA 2J1SA 1H6YA 1UMHA 3K77A 5HPOA 4CU7A 2E32A 2E26A 2X05A 1K42A 4CVUA 2LS6A 5DMYA 1UY1A 2JDAA 5FUIA 1BHGA 3HN3A 5EIYB 4CU9A 1KEXA 1UYXA 2RJ2A 4QX3A 2YC2A 4A4AA 3CDZB 1O8PA 1UXXX 1SDDB 4CUBA 4M4RA 5C71A 4P00B 5HXMA 2YC4A 1WCQA 3IIIA 3WNPA 3I3DA 1UY3A 2WZ8A 4P5YA 1UY2A 3DYMA 3I2IA 2W1WA 4KMQA 3EYPA 1L7RA 5C70A 4QB6A 4XUPA 2YG0A 5EJZB 3P6BA 5CZKA 2VCBA 3PUHA 1KGYA 1W8OA 3I2FA 4QDRA 3F2ZA 2JKXA 4DEQA 4BXSV 3C7FA 4ZY9A 2V72A 4AAXA 2VM9A 4MGSA 2BBAA 1ULPA 1XPWA 4OMDA 1SHWB 2VZ1A 1W0NA 3MBWA 2HYXA 3IB3A 3C7EA 2VQUA 3GDBA 2E31A 4BK5A 2OKXA 4BJ0A 1RYYA 4JKKA 2WAAA 5IFTA 5F7UA 2EIBA 4GWJA 1JZ7A 2ZXQA 2ZEWA 1GOFA 4KI5M 1JZ3A 1CIYA 1OH4A 3MO4A 3FL7A 1UX7A 5I0DA 2XQXA 3MV01 4QB1A 4A45A 2YFUA 4M4PA 3T08A 4W50A 1HN1A 5DN2A 5DPNA 3LEGA 4TTGA 4E8DA 3MUY1 2J1VA 1P8JA 3FN9A 3T2QA 4E8CA 3MUZ1 2JE8A 4GWIA 4ARYA 2W1QA 3NJXA 3OGRA 2WO1A 1W99A 3ABZA 1JZ2A 1PX3A 5JXGA 1NAEA 2VR4A 1UYYA 1NUKA 3OG2A 4LQRA 5JUVA 5J1XA 3ECQA 3WEZA 1JZ5A 4DUVA 2WQ8A 3DECA 2Y6GA 3ACHA 3I97A 5G05L 4A41A 2HLEA 4OUEA 2C26A 3NQHA 3HNYM 3UNPA 1XNAA 1DLCA 4IUGA 2VCCA 1GMMA 2VC9A 3LQCA 3THDA 3OB8A 1PMJX 1OF4A 5LA0A 3WF4A 5EJ1B 1JYNA 3DYOA 3VD7A 5LCWL 1JI6A 4QPWA 2VMDA 4QDQA 2C9KA 3WNKA 3VD3A 4XURA 3SKJE 2ZEYA 2Y6LA 1JHJA 3T0AA 5IYYA 2W1UA 3BGAA 2QQOA 2LW8A 1DP0A 2WN3A 4MGQA 3VDBA 4MO3M 1OF3A 1T2XA 3CQOA 3K4AA 1J84A 2PQSA 3C7GA 1NX9A 2QQLA 3I2GA 4UI9L 4MADA 1O59A 2VZTA 4L0PA 1JZ6A 1F4AA 1TVGA 5LA1A 3WQBA 3I3EA 2ZEZA 4AG4A 4ARXA 4RYDA 5A1AA 3P1IA 4XUNA 4DXSA 2W46A 3C7HA 4A6OA 2VZSA 3OBAA 2RVAA 3LPFA 1YQ2A 5IHRA 3IAQA 2VTFA 1OT5A 3EB7A 3HNBM 3WF3A 2W87A 2DDUA 4LKSA 2W95A 5C7GA 1I5PA 2W9XA 4QX2A 2VZ3A 4CU6A 3SKVA 1GOGA 4D8MA 2V5DA 2VJXA 3J7HA 2BGPA 1L7QA 1W9SA 4JKMA 3OEAA 2VMCA 5JXHA 1UMIA 2J1EA 4XUTA 4A42A 2WDBA 2CDOA 4FI9A 5IJRA 2Y6HA 4ZZ8A 2VMEA 3K4DA 2VCAA 2QQKA 2J1UA 3I2HA 2VMFA 4TXWA 3T09A 1GOHA 3LE0A 5LA2A 2E33A 2EIDA 3IAPA 2ORZA 4DEVA 3HPNA 4DXRA 4DUXA 3HEIA 2EIEA 3CMGA 4ZXEA 3OGSA 3IDAA 2W1SA 4P08A 4PF1A 1US3A 2DCKA 4D0QA 3LEIA 5DQ0A 4DXTA 3GM8A 3T0DA 4A44A 1O8SA 2Y8KA 1K12A 2Z4FA 3OEBA 2J7MA 5JR2A 2V4VA 2VZPA 4A3ZA 3UETA 2R7EB 1OD3A 4Z2AA 4JKLA 4ZZ5A 1JYVA 3BN6A 1J83A 4MOAA 2C4XA 3GXUA 3NJVA 4UAPA 1EUTA 1K45A 4QDSA 2WZEA 1W9WA 1WKYA 3WSOA 3CKHA 2BGOA 1LNSA 2QBXA 4QX1A 1MPXA 2WABA 4JHZA 3LEKA 5G04L 3C8XA 1PX4A 3SEPA 1JU4A 2WO2A 3THCA 2JD9A 5JXJA 3K46A 4LPLA 4XUQA 1ULOA 4CUCA 4OYUA 3A23A 3FHAA 3VD9A 1IQDC 1UY4A 1DYOA 4PT6A 4W4ZA 2B4KA 4QX0A 3C7OA 1EUUA 3HNMA 4W8JA 2QQIA 2WO3A 4UOJA 2W47A 1UXZA 2XHNA 2WUHA 2X09A 4XVHA 3WNMA 4QB2A 3VDAA 4OMCA 1JYWA 2Y64A 2J1AA 4ET7A 3VDCA 3AC0A 3CIHA 3WF2A 3ACGA 2KD7A 1CZTA 5B4XA 1R64A 3ACFA 4QAWA 3W5MA 1US2A 2VQTA 1D7PM 3W5NA 3OGVA 2RV9A 3NNGA 3DYPA 3UESA 3WNNA 3CZJA 2W5FA 5CYYA 2VZQA 1W9TA 4CU8A 5B4NA 1SG3A 1JZ4A 2BERA 3A22A 2ORXA 2VOTA 1PMHX 4GZ9A 2VZRA 2QQNA 1F4HA 1UYZA 3A21A 3T2PA 4LHSA 3JXSA 4CUAA 4KWUA 5IFPA 4YPJA 2ID4A 2L9LA 3K75B 1UZ0A 3MV11 3HJRA 4XZUG 3LPGA 2WAOA 1XC6A 1UWWA 3D3AA 1GQPA 2VZOA 3WF0A 3FHQA 2W3JA 3PUIA 1UY0A 1W8NA 2VO5A 3ACIA 3I2JA 2W92A 3I2KA 3ZM8A 1GNYA 2VZVA 3K4ZA 5JMOA 2QQJA 3ETPA 1H6XA 4BDVB 1JYXA 2YFZA 2WYSA 3VD4A 2CDPA 2W91A 1JZ8A 2XOMA 2QQMA 4XUOA 1CZSA 1TG7A 4DUWA 2VL4A 1CZVA 2DCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9V A;  3SEE A;  3WNL A;  4JX0 A;  2J22 A;  3A7Q A;  2XON A;  3WF1 A;  4RN5 A;  2VZU A;  3U37 A;  1K3I A;  1CX1 A;  1JU3 A;  3T0B A;  3VD5 A;  4PQQ A;  2WBK A;  4BK4 A;  3WNO A;  2X10 A;  2J1T A;  2ZEX A;  3NRU A;  5JXI A;  1GUI A;  2Y6J A;  2Y6K A;  4OZO A;  2W94 A;  2YB7 A;  4HG6 B;  4P02 B;  1GU3 A;  2BZD A;  3GGL A;  3E1F 1;  3CZU A;  1XNT A;  1NKG A;  3I3B A;  2EIC A;  2J1R A;  2WN2 A;  3HOB A;  3T2O A;  2J1S A;  1H6Y A;  1UMH A;  3K77 A;  5HPO A;  4CU7 A;  2E32 A;  2E26 A;  2X05 A;  1K42 A;  4CVU A;  2LS6 A;  5DMY A;  1UY1 A;  2JDA A;  5FUI A;  1BHG A;  3HN3 A;  5EIY B;  4CU9 A;  1KEX A;  1UYX A;  2RJ2 A;  4QX3 A;  2YC2 A;  4A4A A;  3CDZ B;  1O8P A;  1UXX X;  1SDD B;  4CUB A;  4M4R A;  5C71 A;  4P00 B;  5HXM A;  2YC4 A;  1WCQ A;  3III A;  3WNP A;  3I3D A;  1UY3 A;  2WZ8 A;  4P5Y A;  1UY2 A;  3DYM A;  3I2I A;  2W1W A;  4KMQ A;  3EYP A;  1L7R A;  5C70 A;  4QB6 A;  4XUP A;  2YG0 A;  5EJZ B;  3P6B A;  5CZK A;  2VCB A;  3PUH A;  1KGY A;  1W8O A;  3I2F A;  4QDR A;  3F2Z A;  2JKX A;  4DEQ A;  4BXS V;  3C7F A;  4ZY9 A;  2V72 A;  4AAX A;  2VM9 A;  4MGS A;  2BBA A;  1ULP A;  1XPW A;  4OMD A;  1SHW B;  2VZ1 A;  1W0N A;  3MBW A;  2HYX A;  3IB3 A;  3C7E A;  2VQU A;  3GDB A;  2E31 A;  4BK5 A;  2OKX A;  4BJ0 A;  1RYY A;  4JKK A;  2WAA A;  5IFT A;  5F7U A;  2EIB A;  4GWJ A;  1JZ7 A;  2ZXQ A;  2ZEW A;  1GOF A;  4KI5 M;  1JZ3 A;  1CIY A;  1OH4 A;  3MO4 A;  3FL7 A;  1UX7 A;  5I0D A;  2XQX A;  3MV0 1;  4QB1 A;  4A45 A;  2YFU A;  4M4P A;  3T08 A;  4W50 A;  1HN1 A;  5DN2 A;  5DPN A;  3LEG A;  4TTG A;  4E8D A;  3MUY 1;  2J1V A;  1P8J A;  3FN9 A;  3T2Q A;  4E8C A;  3MUZ 1;  2JE8 A;  4GWI A;  4ARY A;  2W1Q A;  3NJX A;  3OGR A;  2WO1 A;  1W99 A;  3ABZ A;  1JZ2 A;  1PX3 A;  5JXG A;  1NAE A;  2VR4 A;  1UYY A;  1NUK A;  3OG2 A;  4LQR A;  5JUV A;  5J1X A;  3ECQ A;  3WEZ A;  1JZ5 A;  4DUV A;  2WQ8 A;  3DEC A;  2Y6G A;  3ACH A;  3I97 A;  5G05 L;  4A41 A;  2HLE A;  4OUE A;  2C26 A;  3NQH A;  3HNY M;  3UNP A;  1XNA A;  1DLC A;  4IUG A;  2VCC A;  1GMM A;  2VC9 A;  3LQC A;  3THD A;  3OB8 A;  1PMJ X;  1OF4 A;  5LA0 A;  3WF4 A;  5EJ1 B;  1JYN A;  3DYO A;  3VD7 A;  5LCW L;  1JI6 A;  4QPW A;  2VMD A;  4QDQ A;  2C9K A;  3WNK A;  3VD3 A;  4XUR A;  3SKJ E;  2ZEY A;  2Y6L A;  1JHJ A;  3T0A A;  5IYY A;  2W1U A;  3BGA A;  2QQO A;  2LW8 A;  1DP0 A;  2WN3 A;  4MGQ A;  3VDB A;  4MO3 M;  1OF3 A;  1T2X A;  3CQO A;  3K4A A;  1J84 A;  2PQS A;  3C7G A;  1NX9 A;  2QQL A;  3I2G A;  4UI9 L;  4MAD A;  1O59 A;  2VZT A;  4L0P A;  1JZ6 A;  1F4A A;  1TVG A;  5LA1 A;  3WQB A;  3I3E A;  2ZEZ A;  4AG4 A;  4ARX A;  4RYD A;  5A1A A;  3P1I A;  4XUN A;  4DXS A;  2W46 A;  3C7H A;  4A6O A;  2VZS A;  3OBA A;  2RVA A;  3LPF A;  1YQ2 A;  5IHR A;  3IAQ A;  2VTF A;  1OT5 A;  3EB7 A;  3HNB M;  3WF3 A;  2W87 A;  2DDU A;  4LKS A;  2W95 A;  5C7G A;  1I5P A;  2W9X A;  4QX2 A;  2VZ3 A;  4CU6 A;  3SKV A;  1GOG A;  4D8M A;  2V5D A;  2VJX A;  3J7H A;  2BGP A;  1L7Q A;  1W9S A;  4JKM A;  3OEA A;  2VMC A;  5JXH A;  1UMI A;  2J1E A;  4XUT A;  4A42 A;  2WDB A;  2CDO A;  4FI9 A;  5IJR A;  2Y6H A;  4ZZ8 A;  2VME A;  3K4D A;  2VCA A;  2QQK A;  2J1U A;  3I2H A;  2VMF A;  4TXW A;  3T09 A;  1GOH A;  3LE0 A;  5LA2 A;  2E33 A;  2EID A;  3IAP A;  2ORZ A;  4DEV A;  3HPN A;  4DXR A;  4DUX A;  3HEI A;  2EIE A;  3CMG A;  4ZXE A;  3OGS A;  3IDA A;  2W1S A;  4P08 A;  4PF1 A;  1US3 A;  2DCK A;  4D0Q A;  3LEI A;  5DQ0 A;  4DXT A;  3GM8 A;  3T0D A;  4A44 A;  1O8S A;  2Y8K A;  1K12 A;  2Z4F A;  3OEB A;  2J7M A;  5JR2 A;  2V4V A;  2VZP A;  4A3Z A;  3UET A;  2R7E B;  1OD3 A;  4Z2A A;  4JKL A;  4ZZ5 A;  1JYV A;  3BN6 A;  1J83 A;  4MOA A;  2C4X A;  3GXU A;  3NJV A;  4UAP A;  1EUT A;  1K45 A;  4QDS A;  2WZE A;  1W9W A;  1WKY A;  3WSO A;  3CKH A;  2BGO A;  1LNS A;  2QBX A;  4QX1 A;  1MPX A;  2WAB A;  4JHZ A;  3LEK A;  5G04 L;  3C8X A;  1PX4 A;  3SEP A;  1JU4 A;  2WO2 A;  3THC A;  2JD9 A;  5JXJ A;  3K46 A;  4LPL A;  4XUQ A;  1ULO A;  4CUC A;  4OYU A;  3A23 A;  3FHA A;  3VD9 A;  1IQD C;  1UY4 A;  1DYO A;  4PT6 A;  4W4Z A;  2B4K A;  4QX0 A;  3C7O A;  1EUU A;  3HNM A;  4W8J A;  2QQI A;  2WO3 A;  4UOJ A;  2W47 A;  1UXZ A;  2XHN A;  2WUH A;  2X09 A;  4XVH A;  3WNM A;  4QB2 A;  3VDA A;  4OMC A;  1JYW A;  2Y64 A;  2J1A A;  4ET7 A;  3VDC A;  3AC0 A;  3CIH A;  3WF2 A;  3ACG A;  2KD7 A;  1CZT A;  5B4X A;  1R64 A;  3ACF A;  4QAW A;  3W5M A;  1US2 A;  2VQT A;  1D7P M;  3W5N A;  3OGV A;  2RV9 A;  3NNG A;  3DYP A;  3UES A;  3WNN A;  3CZJ A;  2W5F A;  5CYY A;  2VZQ A;  1W9T A;  4CU8 A;  5B4N A;  1SG3 A;  1JZ4 A;  2BER A;  3A22 A;  2ORX A;  2VOT A;  1PMH X;  4GZ9 A;  2VZR A;  2QQN A;  1F4H A;  1UYZ A;  3A21 A;  3T2P A;  4LHS A;  3JXS A;  4CUA A;  4KWU A;  5IFP A;  4YPJ A;  2ID4 A;  2L9L A;  3K75 B;  1UZ0 A;  3MV1 1;  3HJR A;  4XZU G;  3LPG A;  2WAO A;  1XC6 A;  1UWW A;  3D3A A;  1GQP A;  2VZO A;  3WF0 A;  3FHQ A;  2W3J A;  3PUI A;  1UY0 A;  1W8N A;  2VO5 A;  3ACI A;  3I2J A;  2W92 A;  3I2K A;  3ZM8 A;  1GNY A;  2VZV A;  3K4Z A;  5JMO A;  2QQJ A;  3ETP A;  1H6X A;  4BDV B;  1JYX A;  2YFZ A;  2WYS A;  3VD4 A;  2CDP A;  2W91 A;  1JZ8 A;  2XOM A;  2QQM A;  4XUO A;  1CZS A;  1TG7 A;  4DUW A;  2VL4 A;  1CZV A;  2DCJ A; 
#chains in the Genus database with same CATH topology
 4Y1Z A;  1VBA 3;  2HWE 2;  4LBK A;  4L92 A;  4C90 A;  2XL7 A;  2HWF 3;  4O65 A;  3O12 A;  2J22 A;  5LY2 A;  3VKF C;  5F1R A;  3UJO A;  2XON A;  4HET A;  1TMF 2;  3N36 A;  2ZX2 A;  1MVQ A;  5FZ9 A;  3RQ0 A;  3WF1 A;  4HXC A;  3CJI B;  4AF9 A;  1W6P A;  1UPI A;  2QZ2 A;  5C4W C;  1OLQ A;  1I9R A;  1ZRC A;  1O4T A;  4NN0 A;  5JWP A;  4OI4 A;  2VD7 A;  5F5I A;  4I0A A;  2DBI A;  3SH5 A;  5FPU A;  3RWN A;  1NQD A;  3SIT A;  3RZZ A;  1SLC A;  3K3N A;  2J1T A;  3WNO A;  5CG9 A;  3F95 A;  3NRU A;  2HWD 2;  1RUC 3;  2Y6J A;  4AE2 A;  5J7M A;  1V70 A;  3MEP A;  2W94 A;  1ULD A;  1GU3 A;  1NA1 B;  3LAG A;  3VZK A;  4CEW B;  3VZM A;  1YEW A;  3GGL A;  5J36 A;  2B8M A;  2VOK A;  4KGG A;  3WQ1 A;  5DZG A;  2EIC A;  2HWF 1;  5DAW A;  5LWB A;  3ILR A;  1AXZ A;  4FPC A;  2B9U A;  3E6D A;  5HCF A;  3NJZ A;  4CRQ A;  5J09 A;  4BLJ A;  2VBB A;  3HR9 A;  2BUK A;  3IM0 A;  5HPO A;  2Y26 A;  2E32 A;  4CU7 A;  2E26 A;  4RHV 2;  4YVW C;  4Q4V 3;  3AKQ A;  5IUQ A;  1K42 A;  2JIG A;  1ACC A;  1HB1 A;  5I0R A;  4XF0 A;  4ISR A;  2JDA A;  1G9C A;  1BHG A;  4CEY B;  5L7O A;  5EIY B;  1CQ9 A;  1QJU 2;  5K8S A;  3PVE A;  4V2W A;  3WCS A;  3KGZ A;  3PMS A;  4LO6 B;  2R1B A;  1UZV A;  2E7T A;  2H0B A;  2BEO A;  4XF1 A;  3N9Q A;  2VEC A;  1F35 A;  3ZXJ A;  4FFI A;  5T5P A;  3S7E A;  5FQ0 B;  1SDD B;  3J8F 2;  2VNG A;  2PHF A;  4LJH A;  4B1L A;  2YC4 A;  3D5O A;  5HXM A;  4A6S A;  5IK7 A;  3WNP A;  1UZW A;  3MIH A;  2B5H A;  2WZ8 A;  2QCS B;  2GC1 A;  1Q8Q A;  2GZW A;  1BEV 3;  4LIU A;  1HJF A;  3L2H A;  4RR3 B;  1OOP B;  1AL2 1;  1W2U A;  2B46 X;  1A3K A;  2D3S A;  1XU2 A;  4YM2 A;  5BYN A;  5JCT A;  4M3C A;  4KMQ A;  5C70 A;  3GHN A;  1QQP 2;  2ZOE B;  1PZ7 A;  5CKQ A;  2YG0 A;  1W6P B;  2PLV 2;  1LHW A;  5EJZ B;  1PIV 1;  1N1S A;  2D3R A;  2GP3 A;  4UW4 A;  3W21 A;  3ZYH A;  4I0W B;  5T52 A;  4BQ1 A;  3PUH A;  1RUE 2;  1G8W A;  1XNK A;  4U36 A;  1W8O A;  3B02 A;  1WLD A;  3I2F A;  4QDR A;  4XBN A;  4BXS V;  3O1M A;  3MLL A;  4MGY E;  3BTA A;  4N90 A;  1C8M 3;  3U14 A;  4MGS A;  4H2A A;  2YU1 A;  1RVF 1;  3MID A;  1SLB A;  1NY7 1;  1ULP A;  1IS5 A;  1ND2 C;  4IE7 A;  3VBS B;  1QH7 A;  2WNE A;  3AKR A;  4E2G A;  4GIQ A;  1QWR A;  5GLU A;  2VZ1 A;  3WD5 A;  4RFR B;  1ALY A;  4Q8L A;  4F3J A;  1KFU L;  3OBT A;  2A71 A;  2G4I A;  3IKW A;  3OUJ A;  2E31 A;  3NV4 A;  1WA4 A;  4ZPI A;  2IZW A;  2OUH A;  5BY5 A;  4QKF A;  2WAA A;  4QPG C;  4YWA A;  3VN4 A;  5FZ4 A;  4AAP A;  4COW A;  3B9C A;  3IN9 A;  5C9A A;  1JZ7 A;  2AR6 A;  1O91 A;  2ZAB A;  2DVA A;  4YM3 A;  3U4X A;  2MHF A;  2A70 A;  4Y5S A;  3SLI A;  4Y24 A;  3WCR A;  1JZ3 A;  3U07 A;  1CIY A;  1DQ5 A;  1OH4 A;  1ZM1 A;  3ZYR A;  1RUG 1;  3WQ7 A;  4JQR A;  3MV0 1;  3GZU C;  2Q8C A;  4LR4 A;  1BBT 2;  2DUQ A;  3AMQ A;  3DN7 A;  3ZN4 A;  3H50 A;  5BNP C;  1YYN A;  1JHN A;  4XJ9 A;  2FZ2 A;  4W50 A;  5DPN A;  2P4E A;  1UX6 A;  1X36 A;  5CFD C;  5DZE A;  5T50 A;  3ELN A;  3ZYB A;  3RG0 A;  2X29 A;  4I30 A;  4YW7 A;  1S0D A;  3C2U A;  4H3W A;  4M3C B;  4I09 A;  4WVZ A;  3WDX A;  3O14 A;  4AQT A;  1Y7B A;  1O6U A;  3POF A;  4B3N A;  4FXK B;  2OII A;  2W1Q A;  2GC0 A;  2ZJC A;  5FZA A;  2VUJ A;  5FK8 A;  2BYV E;  1V6O A;  2P3J A;  3ABZ A;  4ZU4 A;  1PX3 A;  1JZ2 A;  3IZO A;  1JBC A;  1NUK A;  3AVR A;  1KFX L;  5DAB A;  4CCN A;  1YCI A;  2XB6 C;  1YIF A;  1S1A A;  2FQP A;  2XJS A;  2YBS A;  4GKY A;  1ZZ8 A;  3FLR A;  3ECQ A;  3AJY A;  1OLM E;  3LOB A;  4AI2 A;  4EV0 A;  2UUR A;  1YFU A;  1U0A A;  2PHT A;  2R07 2;  3N3H A;  1QJU 3;  2LUW A;  2RS1 3;  3VZL A;  5KHI A;  4GMP 1;  1ZNP A;  3VBU C;  1B35 C;  1OPO A;  4AFM A;  1UKG A;  2A7A A;  4JDO A;  4Q0S A;  4A41 A;  5C3S A;  3POE A;  4QXC A;  5JMC A;  1W8W A;  3NQH A;  2WNV C;  5KHG A;  1RMU 2;  1VBB 1;  4FFG A;  3VHO A;  4AFC A;  4BIO A;  1GMM A;  2VC9 A;  4GWN A;  4AVT A;  4UW5 A;  1JN2 P;  3TEZ A;  4LBL A;  5JDB A;  3OD4 A;  5LA0 A;  1QKQ A;  4N9I A;  2FDI A;  2JDK A;  1NCR A;  3DYO A;  4IGO A;  1YO8 A;  1IQA A;  1TE1 B;  2NMO A;  4X6Q B;  5FYS A;  4HL0 A;  5C9A B;  3CJI C;  3NST A;  3K48 A;  1TZO A;  1GQG A;  3T30 A;  2O8O A;  2OPK A;  2Z69 A;  5FKC A;  3AMP A;  1ZBA 2;  2JB4 A;  2RS1 1;  2YGM A;  4CUG A;  1R1A 2;  1A34 A;  4LE4 A;  1QQP 3;  1HRI 1;  5BPX A;  5JXG A;  4K8R B;  3SKJ E;  2PLV 3;  2ZEY A;  5DDJ 1;  3O1T A;  5FZ0 A;  3AZX A;  4CDQ A;  3BIW E;  1H2M A;  4LLF A;  2D98 A;  3NO8 A;  1VMH A;  4K40 A;  3DXT A;  5FV3 A;  1DP0 A;  1JUI A;  5LAS A;  4OHZ A;  2HEW F;  4AYU A;  2ZKN A;  3KB5 A;  3WVJ A;  4CEW C;  2YY1 A;  1FPN 1;  4AEJ A;  5HCA A;  1PO1 2;  1SBF A;  4Q4Y 3;  1AR8 2;  3DKQ A;  5F6L B;  5EV7 A;  2OZ6 A;  1ENQ A;  3M1H A;  4B4P A;  1J84 A;  4IQP A;  2ZZQ A;  5FIX A;  3JBG 1;  1I6X A;  3QOP A;  3C7G A;  2ZKL A;  5GZG A;  1PNF A;  4Q1P A;  1YFW A;  2VZT A;  4AHX A;  5LEJ A;  2KM2 A;  4GH4 A;  4DZG A;  2FDJ A;  1ST8 A;  5JOX A;  1H9P A;  2VGD A;  1F4A A;  1TVG A;  5B2G B;  5LA1 A;  5FO9 B;  2ZGP A;  1U5Y A;  3WQB A;  5A7P A;  3THP A;  2HEV F;  2ILM A;  1W8F A;  4ARX A;  4FTS A;  1F31 A;  1UO9 A;  2N7G A;  5CAZ A;  1GP4 A;  3P1I A;  3WW4 A;  4XUN A;  5KC5 A;  3MIE A;  2DWR A;  1HJG A;  2JDH A;  4FXG B;  3AX4 A;  1WBF A;  1YQC A;  5A32 A;  2RVA A;  4PLM A;  2A6Z A;  4LA2 A;  1PGL 1;  4JC1 A;  1PZ9 A;  5E6H A;  3IAQ A;  3WW3 A;  4GQ7 A;  2HWC 3;  2Y34 A;  1ASJ 1;  4Y1Y A;  1POV 0;  3ZSE A;  3WF3 A;  5A3M A;  3OTF A;  4M00 A;  4I0B A;  5CKN A;  1C5I A;  4N43 A;  1FMD 3;  1MZF A;  5FLI A;  3AMH A;  1HKD A;  3LOI A;  4K3U A;  3BPS A;  3GAL A;  4KG8 A;  2Q8D A;  1BBT 3;  1W9Y A;  4CU6 A;  4RR3 C;  1BCX A;  1OOP C;  2V5D A;  3OYW A;  2G9F A;  2VXR A;  1NCR B;  1X33 A;  4JKM A;  3ST7 A;  3ZDS A;  1NE6 A;  2IXL A;  2WWS A;  1GP6 A;  3H1W A;  4MET A;  5LRR A;  1UD1 A;  4AVB A;  4E4Z A;  2YDE A;  1YQ6 A;  4LO5 B;  3RYK A;  1VBE 2;  5KXD A;  2BRT A;  2XBO 2;  3BOD A;  4QX8 A;  3VZO A;  1VIW B;  4NR1 A;  2HWC 1;  5K0U A;  4W6X A;  5HCH A;  1ZZC A;  1SLL A;  2EXJ A;  3D6E A;  5A3P A;  1N3O A;  3V56 A;  1GNZ A;  1XU1 A;  4CDQ B;  4ZZ8 A;  1O7F A;  4RGA A;  4XBL A;  1RUD 3;  2VMF A;  4XC9 A;  3R4S A;  1VAV A;  2KA3 A;  2TBV A;  2XVG A;  3AM2 A;  3B7M A;  1J3Q A;  3IAP A;  1AR9 1;  3VBS C;  2JDU A;  3WP3 A;  5FPZ A;  2RG4 A;  2XML A;  2P6H A;  2OVU A;  3CMG A;  2HBU A;  3OGS A;  2WFF 1;  4YFW A;  4ZXE A;  3ZSJ A;  4XF4 A;  3PL0 A;  4D0Q A;  3SNM A;  2YYO A;  3NWK A;  4HN1 A;  3RFR A;  3ZXL A;  1GKB A;  2AAC A;  5FZL A;  5FTT C;  3GCX A;  1LU2 A;  4WM7 A;  2CU5 A;  5F8P A;  1IKP A;  2E7A A;  3IDC B;  4DIN B;  1C1F A;  5E88 A;  2FDH A;  1H2K A;  1SDW A;  1SCR A;  4FPL A;  5JR2 A;  1YNA A;  2V4V A;  2VVE A;  1V6I A;  2I2S A;  1RUD 1;  5AFB A;  1OC1 A;  4JKL A;  5IVJ A;  3LA7 A;  1R09 2;  3W20 A;  3KZ4 C;  5D8A A;  2Q1Z B;  3BN6 A;  1APN A;  1Z7S 1;  4MOA A;  2CYF A;  2XWB B;  5KHK A;  5J37 A;  2PA7 A;  2ARE A;  5A32 B;  4N7U A;  2GC2 A;  3HBZ A;  1J58 A;  1S55 A;  5K4L A;  1OI6 A;  4YW1 A;  4IEO A;  4BQW A;  2EXI A;  3DXU A;  1JUH A;  1O5L A;  3KCC A;  4QXB A;  1WKY A;  4N43 B;  4IE0 A;  4EYU A;  1FV2 A;  5FMB A;  5L9R A;  1IG0 A;  3R4D B;  2D40 A;  3PUA A;  4GB3 3;  1RL3 A;  3LIH A;  4XAC A;  2JD4 A;  2QBX A;  4QX1 A;  1PO1 3;  1MPX A;  2PAE A;  2PMW B;  2VAU A;  2ZPX A;  4RFT 0;  4N53 C;  2R06 3;  3OYW B;  1SFN A;  2WAB A;  5FY1 A;  1CPM A;  3WZ1 A;  2H6B A;  3X29 B;  3ZR5 A;  5FMO S;  4Q4W 3;  1PX4 A;  1WMF A;  1EAH 1;  2C9A A;  2QQV A;  1LHN A;  1PVC 1;  1ZRR A;  3MIC A;  4CP9 A;  5LZ6 A;  2RR1 3;  2CV6 A;  4TN7 A;  5LRS A;  4CUC A;  4FQZ A;  4LXL A;  5FXX A;  2B39 A;  4XCB A;  1ODM A;  1KJL A;  4OHX A;  3FHA A;  4PQ9 A;  4XQD A;  3AVS A;  1X82 A;  4YGB A;  1FI2 A;  4DPN A;  1UY4 A;  1DYO A;  1ZZ7 A;  4IEQ A;  1R08 3;  3MW4 A;  3DUI A;  2B4K A;  4D7S A;  5AC9 3;  4NID A;  2CY6 A;  4E27 A;  2PHL A;  4IEP A;  1OSG A;  1XSR A;  2ADD A;  4PIX A;  5DG1 A;  2WO3 A;  3VB9 A;  4CXW A;  2W47 A;  3H42 B;  3QAC A;  2EAA A;  4Q4W 1;  2ZGU A;  2B45 X;  3FJS A;  1WA6 X;  2IXC A;  5JOY A;  4RL7 A;  1ZBE 1;  1RUI 2;  3AKT A;  3VHR A;  4B7K A;  1JYW A;  4WM7 B;  4KU8 A;  5FPV A;  3LWC A;  2D6N A;  3POW A;  3FHI B;  3HT1 A;  1RUJ 2;  5C9A C;  5JLV A;  3CIH A;  3WF2 A;  3K3O A;  5HBA A;  3N4M A;  3RI8 A;  1CZT A;  4CZS A;  3ACF A;  2O8Q A;  3ZYP A;  1OPM A;  2VQT A;  1MS1 A;  5H9S A;  4NRM A;  3VLB B;  3WDV A;  1VBC 1;  5D8A B;  4WV8 A;  1LGN A;  2RV9 A;  5IVV A;  3IPV A;  1CWP A;  1MS5 A;  3E6B A;  1UYP A;  2ZGT A;  1LB2 A;  1ENS A;  1JXN A;  1LJ7 A;  4DO0 A;  4XOG A;  4QWN A;  2XJR A;  5DUU A;  2IWG B;  2E51 A;  3B69 A;  2ZML A;  1J1T A;  2BWA A;  2VZQ A;  1GZC A;  1OKQ A;  4TSV A;  2GAL A;  1V9U 3;  4IET A;  4Y1V A;  5FP7 A;  4AGR A;  2G9G A;  4ES8 A;  2E53 A;  1W2T A;  1JZ4 A;  5K9Y A;  1PVX A;  4P9X A;  3ZXF A;  3M4F A;  5CEH A;  3OPT A;  2BER A;  4CDW C;  2OYZ A;  1UU5 A;  2VNR A;  5JAX A;  2XLF A;  1COV 2;  1Z78 A;  4JRL A;  4ONU A;  5CNA A;  3TBD A;  4CUA A;  4CP9 B;  1GZW A;  2VMH A;  3AL5 A;  3NKT A;  2ID4 A;  2VTX A;  1LOE A;  2IXJ A;  2D6M A;  2JKB A;  1JYT A;  3O0X A;  1UZ0 A;  3FBY A;  2ZX1 A;  5J96 B;  4MG2 A;  4QQL A;  4UWD A;  2WKK A;  4RGK A;  1D0H A;  1LHO A;  1XC6 A;  1UWW A;  2VOW A;  1WCS A;  3CNA A;  4HON A;  1G9B A;  4B8E A;  1XND A;  1W05 A;  1WW5 A;  4Z92 B;  1GAN A;  2GH8 A;  5KC6 A;  5FBJ A;  1W8N A;  3E97 A;  1ND2 A;  4F7Z A;  2F4L A;  2JDZ A;  1W6N A;  1LOD A;  2OA2 A;  3ASI A;  3O5S A;  4V1P A;  4YLZ A;  1W0P A;  1S2K A;  3I2K A;  1NLS A;  2WZR 2;  2RM2 3;  3LB9 A;  3ZM8 A;  5JMO A;  4O9E A;  2QQJ A;  4BDV B;  4IGQ A;  3BIE A;  1EPZ A;  1LU1 A;  4COY A;  2O14 A;  1NCR C;  2XOM A;  4OHW A;  3U78 A;  4XPV A;  1G7Y A;  4LO7 A;  4XF9 A;  3EMR A;  4KG0 A;  1CAV A;  2B9V A;  3WNL A;  2ZAH A;  4IEY A;  1UW8 A;  4MX3 A;  4EQV A;  1NG0 A;  4GUL A;  5BUV A;  1QJX 2;  4XYX A;  4RN5 A;  2YC0 A;  5FRA A;  3U37 A;  3UV9 A;  4CDQ C;  3IPV B;  3MLJ A;  3TN9 1;  4AI1 A;  1CX1 A;  4DB5 A;  3O1S A;  1FNY A;  4LIV A;  3TEY A;  4Q4X 3;  2ETE A;  1X8M A;  3GBF A;  2RM2 1;  1HX6 A;  2V4A A;  4B7E A;  2QFE A;  5HI0 A;  5JXI A;  1NZI A;  2P3Y A;  3CEW A;  4AED A;  2EF6 A;  4OHV A;  1XRU A;  4K8F A;  1VBA 2;  5BNP A;  5IVF A;  2YBK A;  4HG6 B;  4P02 B;  2Q8O A;  5C8W A;  2HWF 2;  1S2E A;  1VLN A;  3KV5 A;  4Y22 B;  1H2L A;  4IEZ A;  4QXK A;  4HSJ A;  1TME 3;  3G7D A;  3RZK A;  1XYP A;  1NKG A;  3FUO A;  1OA3 A;  3N35 A;  2QVS B;  3T2O A;  5E16 A;  1HRV 1;  1IPJ A;  4FSJ A;  1RHI 3;  2XQR A;  2WO7 A;  5I0T A;  2VU9 A;  3ZO0 B;  1PMI A;  1UL9 A;  1F8V A;  3ZMO A;  2RMU 3;  3QCW A;  4UT5 A;  5FYY A;  1Q43 A;  5FBZ A;  1RUI 3;  1GZW B;  3ILN A;  3O0W A;  5F5A A;  1RUC 2;  2Y60 A;  2A5Z A;  2VXJ A;  4IE5 A;  3GYD A;  4CVU A;  4LHN A;  1RUJ 3;  2LS6 A;  1KS5 A;  2OQ6 A;  5FUI A;  3HN3 A;  4FO9 A;  4IE4 A;  1XSQ A;  5BXX A;  1W2A X;  4L11 A;  1KEX A;  4KU7 A;  1UOB A;  4FPE A;  1LRH A;  3SHR A;  1AX1 A;  3VBU A;  4EN7 B;  5C5U A;  1B35 A;  5I93 A;  1BYH A;  1UXX X;  1ND2 B;  1OQD A;  1W6N B;  2WNV A;  3HWJ A;  1RHI 1;  3PVB B;  2NMN A;  2UYB A;  3IBM A;  2RMU 1;  3ZXE A;  1WCQ A;  4Q4V 2;  4LKD A;  2IVI B;  3I3D A;  4IV1 B;  2EXK A;  2HYK A;  5BNQ A;  1AL2 2;  3H8O A;  4S2D A;  5FOJ B;  1J3P A;  3PVN A;  5FYM A;  1CAV B;  1UY2 A;  3OSD A;  1DZT A;  1X9P A;  4ZS2 A;  4NRP A;  3V64 A;  3WUC A;  4QKB A;  3A0K A;  3MLK A;  3UGF A;  1CGP A;  2DYC A;  3KM5 A;  4IEW A;  5EJ3 A;  5FKB A;  4HOO A;  4I01 A;  4A7Z A;  3PTY A;  1C57 A;  4NIA A;  3VV1 A;  2YZ4 A;  5FY5 A;  1AYM 1;  5DAP A;  2FCU A;  3QH7 A;  4E4S A;  1W39 A;  3IT8 A;  4AHZ A;  4NIH A;  1DQ1 A;  4AED B;  4CEW A;  2JEC A;  1KJR A;  2Q8E A;  1BEV 2;  1DLL A;  2DVG A;  3GZT B;  3WP5 A;  1Q5O A;  5BNP B;  3WDT A;  1UOJ A;  4YW3 A;  1DQ4 A;  4EJR A;  3T1M A;  1XPW A;  4CP0 A;  4OMD A;  5EFU A;  3WOG A;  1SHW B;  4NHY A;  1OFN A;  2AZ5 A;  3CF6 E;  4ISQ A;  4NUB A;  5F5C A;  5JIA A;  3RRD A;  3ZSL A;  4CCD A;  1WMD A;  3D0S A;  3M3C A;  2HYX A;  4WM7 C;  1UZZ A;  2VBP A;  3PDQ A;  1VMJ A;  5FCC A;  2QUO A;  4KWL A;  2CGP A;  5F6K A;  4MVT A;  1KDM A;  2E7Q A;  5FUN A;  1AR6 1;  1AXK A;  3RPQ A;  4XF3 A;  3RVH A;  5IFT A;  5F7U A;  1H30 A;  1MEC 1;  2EIB A;  1C8M 2;  3LFM A;  4GWJ A;  5K7P A;  1UQX A;  4AW7 A;  4C0H A;  2ZEW A;  5D8A C;  3H1Y A;  1GOF A;  1WLT A;  2GN3 A;  4KI5 M;  2ZHN A;  4LLO A;  2R04 1;  4Q26 A;  1GR3 A;  3VBU B;  2AGS A;  4CPB A;  1WCK A;  4DY5 A;  2XQX A;  5I0D A;  3P3N A;  1O4Z A;  4JHT A;  1W3V A;  4PIZ A;  4A45 A;  4GWM A;  3HMY A;  3VKO A;  4LBM A;  4M4P A;  2B42 B;  2VG9 A;  1FOD 1;  1HN1 A;  1OOP A;  4MZU A;  4E8D A;  2UWC A;  4YGE A;  2WS9 1;  3S30 A;  1ND3 A;  4BYY A;  1P8J A;  3I59 A;  4XDO A;  1CN1 A;  3EXU A;  4PI2 A;  3KCY A;  3T2Q A;  1MS8 A;  1QXR A;  1AR7 1;  5FZB A;  5DUX A;  1GP5 A;  5A6X A;  4W65 A;  2BVV A;  4IGP A;  1YQ5 A;  3NJX A;  4GKX A;  3ETQ A;  3OGR A;  1QDC A;  4J1W A;  2JXA A;  5IAT A;  1W99 A;  2HWB 3;  3WHT A;  1WBL A;  2VQA A;  1NAE A;  2VR4 A;  4LQR A;  2JWP A;  1FT9 A;  4LKE A;  2F6B A;  3NNL A;  3H8R A;  2IXK A;  2BNO A;  2XGX A;  5F39 A;  2EA7 A;  3D4K A;  4AXO A;  5J1X A;  1OLR A;  1VRB A;  1Y4W A;  3GZE A;  2R0H A;  3LKJ A;  3OGG A;  3DEC A;  1S2B A;  4P9G A;  3SCG A;  3VBS A;  3DL3 A;  3WG4 A;  1MQT B;  3ACH A;  3I97 A;  3ZFE A;  2JG9 C;  3BYW A;  1STM A;  4ASK A;  3KCX A;  5FUP A;  1NYW A;  1BZW A;  2C26 A;  5ANN A;  4FBF A;  1Q8V A;  1RGS A;  1DLC A;  2W52 A;  4K1Y A;  1YI9 A;  3LD8 A;  4IUG A;  3BB6 A;  3KS7 A;  4HVQ A;  3OB8 A;  4DS0 A;  1FAY A;  1OD5 A;  4JDM A;  4QXH A;  3PVO A;  4XDQ A;  2HWB 1;  1JYN A;  4XDP A;  2BV4 A;  4HPK A;  2ZGR A;  4Z2W A;  1AL2 3;  4COU A;  5A3T A;  1LGC A;  4D69 A;  1QJY 1;  2VW0 A;  1IHM A;  3D8C A;  2RS1 2;  2VUD A;  3WHU A;  2JIC A;  1HRI 2;  1UKR A;  5EWS A;  1PZ8 A;  2Z2S B;  3NL1 A;  4NHX A;  3ZXA C;  1UMZ A;  1PIV 3;  1WW7 A;  3INA A;  2VNV A;  1IPS A;  5F2S A;  3T1L A;  1Q8P A;  2JDM A;  1JHJ A;  3RSJ A;  4IES A;  3VKL A;  5IYY A;  1OUX A;  3I2O A;  1FPN 2;  5FLJ A;  1W6M A;  4OQ8 A;  1OH3 A;  2O0O A;  4P9J A;  3VDB A;  4QX7 A;  3CU7 A;  4YGD A;  4MO3 M;  1RVF 3;  1OUS A;  2Q1F A;  1QOT A;  2ARB A;  1T2X A;  2I74 A;  3RYR A;  1Y3T A;  4MGZ E;  4N53 A;  4AHY A;  4LIT A;  1ND3 B;  2YRO A;  1CAU A;  1S4C A;  2PQS A;  3R0R A;  4FP2 A;  5JI7 A;  3I59 B;  4OI1 A;  4UI9 L;  2WT0 A;  4LUK A;  1H8T A;  3TRS B;  4BB3 A;  4JQT A;  4I3P A;  1MAC A;  4LK7 A;  2XVL A;  5FRE A;  3I3E A;  2ZEZ A;  1WCU A;  4MXW A;  3WIN E;  1LUL A;  4NOT A;  5FZG A;  1RIT A;  3FC0 A;  5FMC A;  4RYD A;  4DMI A;  5EYX A;  4Q4Y 2;  4DNY A;  2OX0 A;  3RS6 A;  3KT4 A;  3SCH A;  1ENR A;  2K46 A;  2ZHL A;  4YYO A;  4JV4 A;  4PBO A;  3RJR A;  4A6O A;  1PGL 2;  1VBD 1;  2DUP A;  3LPF A;  3MIG A;  2XDV A;  1YQ2 A;  4JVA A;  2Z5W A;  1G9D A;  5CG8 A;  1OT5 A;  4IEU A;  3ZFE B;  1RUG 3;  1AYN 1;  3HNB M;  3R6S A;  1W04 A;  2W87 A;  4QMA A;  3SQO A;  1W2N A;  2R1D A;  4Q29 A;  5AVP A;  4IV1 C;  3AJZ A;  3MW3 A;  3JQX A;  1RUO A;  5C7G A;  4QX2 A;  2VZ3 A;  1POV 1;  4V2V A;  5F37 A;  4J25 A;  5JI9 A;  4HPK B;  3OEA A;  3ZYI B;  5IT6 A;  1F15 A;  5JXH A;  4BPZ A;  1UMI A;  1WW4 A;  4BME A;  3NNF A;  5FWJ A;  2HWC 2;  3NKG A;  4LTA A;  3M70 A;  2WDB A;  1YQ8 A;  4FI9 A;  1OFS A;  3VGI A;  1FMD 2;  4FPG A;  5IJR A;  2PHR A;  4GXL A;  2Y6H A;  1MS4 A;  4AED C;  4BLI A;  4DFS A;  4R4X A;  3RI9 A;  3K4D A;  1PM4 A;  1RUN A;  1W6M B;  2DBN A;  4TXW A;  3T09 A;  3LE0 A;  5FY4 A;  3PJY A;  2EID A;  4D6S A;  1A78 A;  1ULC A;  2ORZ A;  5CAD A;  4DEV A;  2WFF 2;  1SFP A;  5LB6 A;  4GMP 3;  4UFH A;  3ZN6 A;  1H8V A;  4DUX A;  3S57 A;  1V0A A;  4CDW A;  1U5Z A;  5E89 A;  2CHH A;  4DRV A;  2PEL A;  4N53 B;  4NPL A;  4NE9 A;  4YW4 A;  2GSY A;  3LSD A;  1OQ1 A;  1CAU B;  1VBB 3;  3P3P A;  2DCK A;  1Q8S A;  1KDK A;  2GAU A;  1XJA A;  3SIS A;  1H8T B;  4AK3 A;  5IK4 A;  3EQE A;  3I3Q A;  3LEI A;  5DQ0 A;  1CIW A;  2R0F A;  5ERL A;  4DXT A;  1QEX A;  2NYY A;  2LRP A;  1YHF A;  4TZD A;  1DGW X;  4TWT A;  3UYJ A;  2OQ7 A;  4A44 A;  2VTX J;  1LOC A;  2Y8K A;  1RUD 2;  3M2M A;  1K12 A;  3ZPO A;  4AI9 A;  2J7M A;  4MXW B;  1MR5 A;  3DPR A;  4P9I A;  3BOP A;  1OD3 A;  5FMD A;  2WR9 A;  5CVR A;  3W58 A;  3JUU A;  3BVC A;  4BQ5 A;  1HQL A;  3LCP A;  1RIR A;  1J83 A;  4AQ6 A;  1HRI 3;  2D3P A;  4FPF A;  1GZ9 A;  4E4H A;  3VDD A;  3NJV A;  5DDJ 3;  5LBF A;  5FZD A;  1TMF 1;  1DHK B;  2Z79 A;  2GME A;  1R1Z A;  5GZD A;  4QDS A;  3HAG A;  3ENR A;  2QDN A;  1MS3 A;  3MF6 A;  1JYC A;  1FPN 3;  4YG6 A;  2SBA A;  5ANQ A;  4UFK A;  3WSO A;  2BPA 2;  3WG3 A;  2BGO A;  1LNS A;  4UBH A;  5DUW A;  2HWD 1;  1H1I A;  4YW6 A;  2DVD A;  2X8K A;  1AJK A;  3JBG 3;  3GBW A;  3WUD A;  3AK0 A;  4ZXK A;  1YLL A;  2XLA A;  2D5F A;  4O9G A;  4A3X A;  3K46 A;  4NVP A;  5FXW A;  4CP1 A;  1HB3 A;  1TEI A;  4ZHN A;  5CB7 A;  3POB A;  4NHL A;  2DTW A;  2FZ1 A;  3AMM A;  3AZY A;  4G3Y C;  4QQP A;  5KBF A;  2K0G A;  4HBN A;  2X53 S;  4ASL A;  2RDR A;  5F3G A;  3UK9 A;  3A23 A;  4Y4R A;  5FP4 A;  4CDX C;  1Q3E A;  4YZ1 A;  4GB3 2;  4LT5 A;  4KNC A;  3VHP A;  3VD9 A;  1Y9Q A;  2GDF A;  1LOG A;  3A0N A;  3WQ0 A;  4RHV 1;  4FTB A;  4PT6 A;  2R06 2;  3AP9 A;  3DKW A;  1MQT C;  4C1W A;  4UF0 B;  1G9F A;  4QX0 A;  3CJX A;  4MLO A;  3JD7 3;  3ZN6 B;  4Q4W 2;  3VBR C;  5IVC A;  4UOJ A;  1JOP A;  1BMV 2;  1ASJ 3;  4CDW B;  4D6R A;  1NT0 A;  5JPN B;  3OPZ A;  2RR1 2;  1ZBE 2;  2MEV 1;  3H0O A;  5HV0 A;  2XHN A;  2WUH A;  4XVH A;  1VRH 1;  3RZH A;  5EYY A;  5FY0 A;  1CAW A;  2DUO A;  4OMC A;  5J98 B;  2Y64 A;  4PDW A;  5ACA 1;  4L9B A;  2J1A A;  2BNN A;  2AH2 A;  2BQP A;  2D6L X;  3AC0 A;  1R08 2;  3DPR B;  1X8E A;  4MV2 A;  1M4W A;  5AC9 2;  1DGL A;  3LDK A;  2KD7 A;  3N7J A;  1HQN A;  1VBC 2;  5B4X A;  2P2K A;  1NCQ B;  3RZM A;  4QAW A;  4R52 A;  2VNO A;  4NPR A;  3MYX A;  3W5N A;  2JE9 A;  3JD7 1;  5JR7 B;  4G9S B;  2RE9 A;  4QHB A;  3ZMN A;  5FZO A;  3DYP A;  4BIF A;  3UES A;  2WLQ A;  4FT8 A;  3VDD B;  2W68 A;  3SMH A;  1WCD J;  1AZD A;  5KHH A;  2W5F A;  1NLQ A;  5CYY A;  4PIY A;  4ORF A;  2DFB A;  1YIP A;  4XHX A;  3JB8 A;  5C3R A;  1RUE 1;  3ZFG B;  1DZR A;  1AR9 3;  4M0N A;  1LKN A;  5DUV A;  2ZZJ A;  1ND3 C;  3E6C C;  1ULF A;  2WFF 3;  4FOY A;  2PXJ A;  1PMH X;  2H0V A;  5CIR A;  2HEY F;  4EN0 A;  4A7K A;  2P5B A;  3O7O A;  4SLI A;  2I07 B;  1QXP A;  1X7N A;  4YZ2 A;  1KS4 A;  4PF5 A;  4UBG A;  3CLP A;  3PUQ A;  4K21 A;  2G1M A;  2L9L A;  2Q1M A;  5EHD A;  1U5I A;  1V9U 2;  1U5X A;  3K75 B;  1SEF A;  2B7Y A;  2D6P A;  4YGC A;  4B29 A;  5BV6 A;  5C33 A;  1DGR A;  4UFM A;  4XCA A;  5A80 A;  5FK7 A;  4AVS A;  3ES4 A;  2A3X A;  1S0F A;  1UN1 A;  2ZAC A;  3HJR A;  4XZU G;  3UL2 A;  1Z7S 3;  2WA4 A;  3WDY A;  4ZKT B;  3D3A A;  1M06 G;  1POQ A;  2XUE A;  4NII A;  4CA9 A;  2A3W A;  3ZFE C;  5C3O A;  5IVE A;  1QDO A;  2W3J A;  1XYO A;  3PUI A;  4C8D A;  1PK6 A;  1YWK A;  2OXB A;  5GZE A;  3ACI A;  2W92 A;  3KSC A;  2AEN A;  3D82 A;  3K4Z A;  2VZV A;  5H9P A;  4AFA A;  4S2F A;  3ETP A;  2IVJ A;  4IND A;  4N9H A;  2FHR A;  1B09 A;  1O5U A;  2P1B A;  2WYS A;  3VD4 A;  2CDP A;  1REE A;  1CAW B;  3Q8C A;  2QQM A;  1VAK A;  5LAT A;  1OLM A;  4PDW B;  1TG7 A;  2VL4 A;  4JGZ A;  1QMJ A;  1GWM A;  3SEE A;  5CBL A;  2FDG A;  2PHU A;  3PNA A;  4CCK A;  1EAH 3;  3Q8A A;  3MIF A;  1W28 A;  3VBF A;  3KGL A;  1PVC 3;  1O3S A;  2YV8 A;  3AYD A;  3HQU A;  3TN9 2;  2V09 A;  1AUY A;  3U0Z A;  1KQR A;  4Q27 A;  4LHL A;  3PU8 A;  3ILF A;  3RDI A;  2RM2 2;  5FZO B;  2QZ3 A;  1V6K A;  5T3N A;  5KXB A;  4XIO A;  1VB4 A;  2RS3 3;  1XBF A;  4PQQ A;  1YFX A;  2VQ0 A;  4OFG A;  1GUI A;  1OQE A;  4MGI E;  2BTV C;  1D0G A;  4Z1V A;  5D21 A;  5A6Q A;  4XFC A;  3Q8B A;  2UWA A;  4Q0P A;  1UIJ A;  1UAI A;  2XJT A;  4LUM A;  2PFW A;  1FX5 A;  3EO6 A;  3E1F 1;  3CZU A;  1XNT A;  4D7Y A;  1H8T C;  5BNN C;  1BQP A;  2J1R A;  3HOB A;  1S0E A;  1H6Y A;  3OD0 A;  3QLQ A;  1UMH A;  3I2D A;  4OZX A;  1J59 A;  1ZBE 3;  3ZXD A;  4AGG A;  4CCM A;  5FOB B;  4K20 A;  5JIU A;  3BOW A;  1ULG A;  1Y9G A;  2ET7 A;  4GJY A;  4Q4X 2;  3WR0 A;  1OHF A;  1SMV A;  5F3C A;  3ACL A;  1A8D A;  1RMU 1;  3N7M A;  1JOB A;  4R9A A;  3THT A;  4WVW A;  2RS3 1;  4FPY A;  1NLR A;  5C6C A;  5DMY A;  3I4I A;  3BUC A;  1S0I A;  4MHR A;  3H3Z A;  4FOQ A;  4CCO A;  3M3I A;  1DU3 D;  1UNB A;  1TME 2;  5APA A;  5FYV A;  1VBC 3;  4QQ2 A;  4CU9 A;  4URA A;  4LBO A;  4HT1 T;  2NP0 A;  1PGW 2;  2RJ2 A;  4QX3 A;  3AXD A;  4HN0 A;  4ZU5 A;  4AEM A;  5CA6 A;  3LFI A;  1RHI 2;  1IOA A;  3MI8 A;  4NAM A;  1I3H A;  2JG9 A;  1PK6 B;  2RMU 2;  1U12 A;  1WD4 A;  1ZBA 1;  3AFG A;  4K1Z A;  4M4R A;  5C71 A;  1CJP A;  1QU0 A;  1R1A 1;  3AFK A;  3TEX A;  3E5U A;  3V0B A;  4P00 B;  2GU9 A;  2G19 A;  5EXO A;  3DV8 A;  3LEM A;  2XJP A;  1N3P A;  1UY3 A;  2R32 A;  4P5Y A;  1W03 A;  1W8H A;  3FFQ A;  5L36 A;  1SBE A;  4J1X A;  5JVV A;  3DYM A;  4JGZ B;  5CIS A;  4AHW A;  3I2I A;  1AR8 1;  1IS4 A;  2PN5 A;  2W1W A;  3PME A;  4LBQ A;  5FYI A;  5FZE A;  4BXF A;  3VBF B;  3KV6 A;  3I8T A;  3LF7 A;  3S7I A;  2DFC A;  2YU2 A;  2BOJ A;  1VR3 A;  4LKF A;  1REF A;  4N8M A;  4OI0 A;  2WZP P;  1H2N A;  4UFJ A;  1X9T A;  3P6B A;  2HJI A;  1AYM 2;  3W59 A;  5C8C A;  2VCB A;  1N1V A;  4WZC A;  1EPW A;  2A75 A;  3LA2 A;  2FD8 A;  1KGY A;  2DU1 A;  2VW2 A;  5LK5 A;  5FWE A;  2ZA9 A;  1UIK A;  1W90 A;  2GMP A;  2XVK A;  3FX3 A;  4URT A;  4Y22 A;  3TNQ A;  4AFB A;  4AAX A;  1WME A;  4YVS A;  5FZM A;  3S5A A;  2WT2 A;  2QNK A;  3JQW A;  1EV1 1;  1W9F A;  1DQ6 A;  1VAM A;  2ERF A;  3H9A A;  4H55 A;  2JDY A;  3GHM A;  1LHU A;  2K9Z A;  4HK9 A;  2JJ6 A;  1SLT A;  1S0J A;  1W0N A;  3MBW A;  5FY9 A;  5A7N A;  1S0G A;  1O3R A;  3IB3 A;  1EYB A;  3SC7 X;  1WZX A;  2VQU A;  5H9R A;  5IWF A;  4CE8 A;  3H7Y A;  1N3Q A;  1ZZ6 A;  3M8L A;  2BVB A;  2XJV A;  4BK5 A;  2OKX A;  3DPR C;  4BJ0 A;  1RYY A;  1W2O A;  4JKK A;  4P9L A;  2VBD A;  3URF A;  1NCQ C;  3N9L A;  5JSO A;  1RUF 3;  2ZXQ A;  3AB0 A;  1VP6 A;  3AZW A;  1UPS A;  3N9M A;  3VDD C;  5LY1 A;  5FJH A;  2XUM A;  3TN9 3;  2R6Q A;  2W08 A;  3HQX A;  3BTY A;  4XJZ A;  2O1Q A;  2SLI A;  4PI0 A;  3ZN5 A;  3MO4 A;  4XFG A;  2GC3 A;  3ZIX A;  5AFE A;  2JG9 B;  3Q9O A;  3FL7 A;  3OUH A;  1VBE 1;  3MFA A;  3ZFG C;  2XBO 1;  4BA6 A;  4QQO A;  4DOU A;  5A6Z A;  3V0B B;  1ZRF A;  4IV1 A;  1FOD 2;  2BJS A;  4MYE A;  1S0C A;  2BW8 A;  3MDP A;  2P17 A;  4X8N A;  4YG3 A;  1WW6 A;  1DQ2 A;  3EHK A;  2E9Q A;  2YMZ A;  4NIG A;  4TTG A;  2CTV A;  3MUY 1;  2J1V A;  1D2Q A;  1RUF 1;  2DCY A;  2HKX A;  5TSW A;  1HRV 3;  1AVB A;  1J1L A;  3AYC A;  3P5B A;  4LBQ B;  4BQ4 A;  2RS5 3;  4D7T A;  2PHX A;  3BTX A;  4GWI A;  1XE7 A;  3TYJ A;  3NW4 A;  3WDU A;  2RJK A;  5JSP A;  4QKD A;  2Y6F A;  2WO1 A;  5A7S A;  5C8C B;  2WNU C;  5A7W A;  1UYY A;  3OG2 A;  2WWJ A;  1XNB A;  4HZF A;  1DIW A;  2DV9 A;  1YC6 1;  4LOR A;  4YZ4 A;  4Z82 A;  4DUV A;  5DXD A;  2ATF A;  3O0V A;  4Q1R A;  2EXH A;  2LRO A;  1IZ3 A;  2GN7 A;  3BPZ A;  3NAP A;  4YVS B;  5T54 A;  4FAH A;  2Y6G A;  3HD8 B;  1D4M 1;  5G05 L;  1R09 1;  1Q8O A;  3I7D A;  4OUE A;  5DAQ A;  3WLU A;  1HXS 1;  5FP8 A;  3HNY M;  3USU A;  3ZYJ B;  2RS5 1;  4NMI A;  3VBO A;  2VCC A;  3A4U A;  4GJZ A;  4MXV A;  1PMJ X;  4PDW C;  4IV3 C;  2HWB 2;  4EZH A;  1IPK A;  4XQ4 A;  3AYE A;  3R4U A;  4C1X A;  2PQQ A;  1C5H A;  4G4F A;  3VKM A;  3WF4 A;  1QJY 2;  3U11 A;  4OUM A;  3FLP A;  2A6Y A;  2PHW A;  1EY2 A;  5F2W A;  4J6G A;  1CR7 A;  2BDR A;  3B94 A;  4QPY A;  1BVV A;  1XB9 A;  3NNJ A;  2AYH A;  5T5J A;  1HIX A;  5KXE A;  2CL2 A;  2VMD A;  1LOA A;  4QDQ A;  4COZ A;  4K6B A;  3WNK A;  2X5I B;  5FZ6 A;  4NWW A;  2VVD A;  1L7L A;  1NZC A;  3IDB B;  1WMX A;  2Y6L A;  4LBJ A;  1O4Y A;  1AYM 3;  3T0A A;  1CAX A;  4WVV A;  4BCU A;  2RDQ A;  5GAL A;  3IDE A;  1AX0 A;  2WN3 A;  2ZGQ A;  1G86 A;  1GZT A;  4MGQ A;  4S2H A;  4ZU7 A;  1C1L A;  1OF3 A;  2V73 A;  1IKQ A;  1E5S A;  1XE8 A;  2A1X A;  3GBG A;  3K4A A;  3RZL A;  3ME2 A;  1F9K A;  5T55 A;  2QQW A;  5EPA A;  1NX9 A;  3I2G A;  1T6G C;  1ZYB A;  1PIV 2;  5FZ1 A;  3TEW A;  3VZN A;  5F5Q A;  1RTV A;  4BHP A;  5F32 A;  2Y0O A;  2Q30 A;  1ONA A;  2E6V A;  4QD2 A;  5A1L A;  1AR6 3;  2VUC A;  3OGJ A;  3KHC A;  5FYC A;  4AG4 A;  2XHK A;  1MEC 3;  5A3U A;  4CDX A;  3BU0 A;  4BQ3 A;  5A7W B;  4XXP A;  1RVF 2;  5GKA C;  3ZXG A;  1NY7 2;  1CVN A;  2ET1 A;  3UKT A;  1VBD 2;  3UKN A;  4TLG A;  2W46 A;  2D44 A;  2R04 3;  3I3M A;  1MQT A;  4IE6 A;  2VZS A;  1PK6 C;  5LEK A;  1V6N A;  4CPB D;  4KH9 A;  3VBR A;  3WW1 A;  3NAP B;  4BWO A;  1CON A;  2VTF A;  3W9A A;  1FYU A;  2VCM A;  1AHS A;  2WSV A;  4UW3 A;  4AWD A;  4M3C E;  3NV1 A;  5LW9 A;  1AX2 A;  4JZR A;  2DDU A;  4IER A;  3USU B;  1UOF A;  3PHM A;  4UXA A;  1BK0 A;  1X50 A;  3VBO B;  3VBH A;  3J9S A;  4ES9 A;  3K51 A;  5JPM B;  1FOD 3;  5KHJ A;  1WGP A;  1V00 A;  4EN6 B;  4JGZ C;  2C6S A;  1GOG A;  3SKV A;  4D8M A;  3J7H A;  2WS9 3;  1W6O B;  2WSU A;  1UU6 A;  1L7Q A;  4EZ4 A;  3RZJ A;  3PUR A;  2DUR A;  3VBF C;  2VMC A;  3H3U A;  1AJO A;  4QPI A;  1AR7 3;  2VH9 A;  5GJ6 A;  3ORJ A;  2J1E A;  4XUT A;  1COV 1;  5JZG A;  3OPW A;  1RUG 2;  1OA2 A;  1PNG A;  2WWU A;  4AQS A;  3POJ A;  4XIK A;  4Z8B A;  5DZF A;  4XE9 A;  4LK6 A;  1AF9 A;  1K5M A;  4AI8 A;  4XEZ A;  4BU2 A;  4D3W A;  1SAC A;  1CAX B;  2VME A;  4XFI A;  1HLC A;  2QQK A;  2J1U A;  2VCA A;  3I2H A;  3EJK A;  3LDB A;  4XJ8 A;  5LA2 A;  5GLW A;  5FR3 A;  2E33 A;  3S5Q A;  1MZ6 A;  1NXD 1;  3MFC A;  3HPN A;  4QQH A;  2NN8 A;  1VAL A;  4KWJ A;  3MW2 A;  5FY7 A;  3IIA A;  4FTE A;  4ERO A;  1ZRE A;  2W1S A;  4IXL A;  1GIC A;  1RUH 3;  4HKL A;  4P08 A;  4PF1 A;  1US3 A;  3MGU A;  4CTE A;  1YJK A;  4RGG A;  4JAA A;  3N7L A;  2XKO A;  3NJY A;  1VJ2 A;  2TNF A;  2V5Y A;  3T0D A;  2JE7 A;  1O8S A;  2WZR 1;  1MZ5 A;  4L2N A;  3FBM A;  3OEB A;  2ARX A;  3JCI A;  4AGV A;  4U2A A;  4CDX B;  1QJY 3;  1PO2 1;  4BQY A;  3DEM A;  5T5O A;  4HSL A;  4RSU A;  5FAX A;  2UY9 A;  2BP6 A;  4TLF A;  4ZZ5 A;  4LO8 A;  4AI0 A;  3DCQ A;  2DVF A;  1LED A;  1VBB 2;  1ENX A;  1GSL A;  2DTY A;  3VBR B;  3RMY A;  1FXZ A;  1HV1 A;  1QJX 1;  1RUH 1;  4UAP A;  1EUT A;  1K45 A;  1EP0 A;  3VZJ A;  4D6Q A;  2WZE A;  1FV3 A;  4A7Y A;  4ATE A;  1GLH A;  4O7X A;  3VBH B;  1WUV A;  5HXV A;  3CKH A;  4JTN A;  1LTE A;  3WT3 A;  2GP5 A;  4DY3 A;  2AC1 A;  3FWE A;  3GJB A;  4QX5 A;  1LOB A;  5FPA A;  4XMA A;  4AZZ A;  4Y20 A;  2ZGL A;  4GA9 A;  3ZKY A;  5KXC A;  5IK5 A;  1HDK A;  4JHZ A;  1VE0 A;  1CJD A;  1VBA 1;  3LEK A;  3ES1 A;  3IMN A;  4FFH A;  3B5L B;  5FYB A;  1XOY A;  5G04 L;  2BGC A;  3C8X A;  5J3U A;  2I45 A;  4UYB A;  2WO2 A;  3SEP A;  2WRA A;  3ON7 A;  4QPI B;  2JD9 A;  5DDJ 2;  3THC A;  5JXJ A;  2PHD A;  5JZG B;  2ZX3 A;  4LPL A;  1F5F A;  5A33 A;  5C8C C;  1ULO A;  4Y5Z 0;  3UJQ A;  4OYU A;  1TNF A;  2ZMN A;  3VKN A;  1UCX A;  2ZX4 A;  5JOZ A;  1K5M B;  1DCS A;  1E5R A;  5FZ8 A;  1QNW A;  4B1M A;  3BI3 A;  1RUC 1;  4QGN A;  4YVS C;  1C4R A;  4Y33 A;  1W6Q A;  3JBG 2;  1VBD 3;  4W4Z A;  2ZGO A;  3C7O A;  2GNB A;  3GZA A;  1QY4 A;  1AL0 G;  2MEV 2;  2KR2 A;  3SXW A;  1AYN 3;  1VRH 2;  4KBB A;  1GV9 A;  4CCC A;  5BNN A;  1OVS A;  2GNT A;  4XW3 A;  4S2G A;  4GAL A;  2XL9 A;  2YPJ A;  3B01 A;  2X09 A;  1DZQ A;  3H7J A;  4NO4 A;  2ZGN A;  3WNM A;  1ZA4 A;  2FDK A;  1LEN A;  1QJF A;  3OUI A;  4R9C A;  3JU9 A;  5A7O A;  1BXH A;  3VDA A;  1SZB A;  5D2A A;  4GD4 A;  3ZDV A;  5ACA 2;  2ZMK A;  2G9Z A;  2JDN A;  1POV 3;  2JEM A;  4E2S A;  2C0Z A;  4XJW A;  1H0B A;  3KT7 A;  5FLH A;  4ET7 A;  3KF5 A;  4Q4V 1;  3ACG A;  3WDW A;  1RED A;  2WIN B;  1W8U A;  3JD7 2;  3H8X A;  2BBV A;  5E8A A;  2X5I C;  1US2 A;  1ASJ 2;  2PAM A;  3W5M A;  1HV0 A;  2XLG A;  3WP6 A;  3AL6 A;  2ZBJ A;  3L9J T;  4IEV A;  3ATG A;  3WNN A;  2ADE A;  1JOD A;  2K2S A;  1CD3 G;  2NZ9 A;  4M3C F;  5L19 A;  2RJL A;  3ROU A;  3ZSK A;  1YXW A;  2WQZ C;  2IFR A;  3USS A;  4YW2 A;  4MSV A;  1LAJ A;  2C24 A;  3POG A;  5B4N A;  2PYT A;  5FZH A;  1SG3 A;  4KWK A;  4M01 A;  4C0B A;  2VUA A;  2BFU S;  4SBV A;  3A22 A;  1KIT A;  2C5D A;  1I1E A;  2ORX A;  4AEK A;  4GZ9 A;  4Y20 B;  1N1T A;  1BEV 1;  3ZLI A;  5E1R A;  2VZR A;  5DAV A;  2WL1 A;  3KV9 A;  3WW2 A;  5CFC A;  1CX4 A;  2J42 A;  4K7J A;  4OVE A;  1F4H A;  3WNX A;  1DGW A;  2EVX A;  3A21 A;  4FPO B;  4LHS A;  3JXS A;  3OOX A;  4P5H A;  3AXE A;  1XXN A;  2ENR A;  4AVV A;  5A33 B;  5A1F A;  5IFP A;  4YPJ A;  5BNO A;  5FXV A;  5IK8 A;  3FE5 A;  3OF1 A;  4FQ4 A;  1LES A;  2BU9 A;  1AR9 2;  4I3G A;  2QQU A;  4YW5 A;  4UF0 A;  2LAL A;  2VPV A;  3S6P A;  4FAG A;  1OKO A;  2HWE 3;  3LPG A;  4O61 A;  3NAP C;  4QT6 A;  1W6Q B;  4Y1X A;  4Y1U A;  1C8M 1;  4AI3 A;  5L7O B;  2BFU L;  3APB A;  3FHQ A;  1LR5 A;  4I2O A;  1TMF 3;  1VPH A;  3OY8 A;  4FPH A;  5FY8 A;  2QKD A;  3Q8E A;  2D97 A;  3HT2 A;  3VBO C;  3I2J A;  3ZR6 A;  5BNN B;  2JB8 A;  4XTM A;  3WG1 A;  3J26 N;  2VOX A;  3FZ3 A;  5ISL A;  1LOF C;  5A3N A;  1JS9 A;  2ES3 A;  2QJV A;  2W91 A;  1JZ8 A;  4RS5 C;  1TQ5 A;  2HWD 3;  1CZS A;  4XUO A;  3ZPY A;  4DUW A;  2WA3 A;  1QF3 A;  5CU1 A;  2DCJ A;  1OXC A;  1NCQ A;  1Z7S 2;  3LIG A;  4JX0 A;  4OUL A;  4QU1 A;  3A7Q A;  3M3O A;  2HWE 1;  4HKO A;  4AFD A;  4KGQ A;  5KR7 A;  1JYI A;  3U1X A;  2WNO A;  1OMI A;  2AUY A;  4N7I A;  4XQW A;  2VZU A;  1UF2 C;  3TB0 A;  1K3I A;  1JU3 A;  4XFB A;  3T0B A;  2IFW A;  2YXS A;  4LBN A;  3VD5 A;  4BM8 A;  1W0O A;  2XWJ B;  4WM8 A;  2P37 A;  2WBK A;  4BK4 A;  3VL9 A;  1YRZ A;  2X10 A;  1ZX5 A;  2ZEX A;  3E5Q A;  4Q0Q A;  4XTP A;  3ZFG A;  3OJB A;  5F9T A;  4RHV 3;  4L97 A;  5LA9 A;  1OBN A;  1SPP A;  2Y6K A;  4AVA A;  2CNA A;  3CBN A;  4OZO A;  2YB7 A;  4OCT A;  2BZD A;  1EAH 2;  4YFZ A;  5FZF A;  1PVC 2;  1BLZ A;  1DYP A;  1GBG A;  4XFF A;  2W0X A;  5T5L A;  3I3B A;  4R4Z A;  3HQR A;  2MEV 3;  1HW5 A;  2WN2 A;  3MPP G;  4MGK E;  4Y4Y A;  2J1S A;  4XJA A;  4YZ5 A;  1VRH 3;  4PCR A;  5CFC B;  1MS0 A;  1IGO A;  2ZGS A;  3K77 A;  2IXH A;  3B00 A;  4QHO A;  2Q0A A;  2RS3 2;  3J8F 3;  3TWI A;  3J4U H;  1WWY A;  4MGT A;  4Y5T A;  5ACA 3;  2X05 A;  4AOC A;  5BNO B;  5EQU A;  1DDL A;  1G9A A;  2WNU A;  3ZSM A;  1JW6 A;  2ZGM A;  1UY1 A;  1GWK A;  2NQY A;  3GCW A;  4CSW A;  2QE3 A;  4A2U A;  1A8M A;  3ZYG A;  1WD3 A;  1UYX A;  1GQH A;  2D6K A;  4CCJ A;  2YC2 A;  4DIQ A;  4A4A A;  1QJU 1;  1QJE A;  3CDZ B;  1O8P A;  3M3E A;  5FXZ A;  3OY8 B;  2ZX0 A;  4YRD A;  1N47 A;  4CUB A;  3VBH C;  1OVP A;  2R49 A;  3RJ2 X;  1SQ4 A;  1RUE 3;  5A3L A;  3UGH A;  3J8F 1;  4NWV A;  4ITC A;  3III A;  3PIJ A;  1NA1 C;  4IV3 A;  4OHY A;  1NOV A;  1LGB A;  3PLQ A;  1SFY A;  3VUO A;  4HVR A;  3PIG A;  2VOV A;  1DFQ A;  1I5Z A;  2WII B;  3AZZ A;  4AL9 A;  4W6W A;  4CYD A;  1ZRD A;  4XXA A;  1OUR A;  2RDN A;  4QPI C;  3AP7 A;  5A3W A;  4NHK A;  5JZG C;  5HCB A;  3MF9 A;  3EYP A;  1L7R A;  1JMU B;  4QB6 A;  2BWC A;  2DF7 A;  4P9Y A;  4XUP A;  2ZAA A;  2Z42 A;  4FP3 A;  1DBN A;  1K5M C;  2MNG A;  5C3Q A;  2FMY A;  1JOJ A;  1O3Q A;  1QQP 1;  2F4P A;  4LHK A;  4NJ4 A;  5CZK A;  4L99 A;  5IVY A;  2QQP A;  2ZTN A;  4YM1 A;  2PLV 1;  1V6M A;  4JGY A;  4WM8 B;  5FPB A;  3F2Z A;  2OS2 A;  4CEY C;  1RXG A;  2IXI A;  2JKX A;  2P34 A;  4DEQ A;  5IAV A;  2WC2 A;  2A6W A;  3C7F A;  4ZY9 A;  5C3P A;  3ZOI A;  5GZF A;  2V72 A;  1EV1 2;  1SPP B;  4XAA A;  3BTZ A;  3KMH A;  2W39 A;  3ZFF A;  3CL1 A;  3BKZ A;  4WVM A;  2VM9 A;  4Q4Y 1;  4PHZ A;  2BBA A;  1F5J A;  1GNH A;  3H8U A;  4NHM A;  4QGM A;  2CSG A;  3L2Y A;  4B4R A;  4YM0 A;  1ODN A;  3B93 A;  5FYH A;  1W8T A;  3O1O A;  4LE3 A;  4QGL A;  1DGR N;  3C7E A;  2A3Y A;  2VMI A;  1URX A;  2Y38 A;  2F17 A;  3R05 A;  2FMD A;  4ATF A;  3GDB A;  1ZZ9 A;  2Y0I A;  5AVA A;  2CAV A;  2BNM A;  5GM0 A;  2YPD A;  4ASM B;  1HN0 A;  4JDN A;  4BMB A;  2TUN A;  2KXL A;  2AEY A;  3POS A;  2WNU B;  5KWR A;  3PJQ A;  5EP9 A;  4NAO A;  1BJQ A;  1QXJ A;  1XYN A;  3SH3 A;  2R30 A;  4IDZ A;  2HBT A;  4Y26 A;  1CES A;  3KVA A;  1QJZ A;  2P3I A;  3I54 A;  5A7Q A;  2DCT A;  3GNE A;  4XBQ A;  5FFO C;  4GAZ A;  5IAX A;  1MVE A;  1ULE A;  1UU4 A;  2WYF A;  3VHN A;  4IL7 A;  5A6Y A;  4UFI A;  2W2I A;  4XAB A;  2XH6 A;  3KF3 A;  3TOJ A;  1UX7 A;  3UT0 A;  4OQ9 A;  4CCE A;  4QB1 A;  3O1P A;  2MPF A;  4RQP A;  5IW0 A;  1C3H A;  4CXX A;  4EWD A;  1FMD 1;  4XHB A;  2XJU A;  3LDR A;  2YFU A;  4IV3 B;  3T08 A;  1RUF 2;  5DN2 A;  1LCL A;  1BBT 1;  2YHJ A;  3LEG A;  4H7L A;  3AYA A;  4HMZ A;  2JDP A;  5F3E A;  4BIS A;  3NMB A;  3OBZ A;  2JX9 A;  4OUS A;  4LNV A;  2R07 3;  3MIB A;  3FN9 A;  2A73 B;  1LHV A;  1NQJ A;  4I02 A;  4E8C A;  2VY0 A;  3LSE A;  2YBP A;  3KV4 A;  3MUZ 1;  4JRA A;  4AR2 A;  2JE8 A;  4CDU A;  4XAE A;  1RMU 3;  3KWV A;  4EWA A;  5FO8 B;  1TNR A;  3OBR A;  4ARY A;  4GH4 B;  1D4V B;  4YG0 A;  2ARC A;  4WBB A;  4GMP 0;  5A3O A;  4QM8 A;  4JGY B;  5FJK A;  4BOW A;  4Q0V A;  4EN9 B;  3GF6 A;  5DG2 A;  2XPJ A;  3E5X A;  5JUV A;  2Y33 A;  4H7M A;  5L7O C;  3VL8 A;  2WFP A;  5FYT A;  1D4M 2;  3WEZ A;  1JZ5 A;  2UYA A;  3LGR A;  1HRV 2;  2WQ8 A;  3ZFF B;  1HXS 2;  4WVM B;  3O1R A;  2ZCW A;  1ZA7 A;  2RS5 2;  1QGL A;  2HLE A;  1DG6 A;  2R07 1;  1ZBA 3;  2ZHM A;  3RWK X;  4CP2 A;  1R1A 3;  1XQN A;  3UNP A;  1XNA A;  3H3L A;  2D6O X;  5ABJ A;  3K2O A;  3NNM A;  4QHZ A;  3LQC A;  3THD A;  5HV4 A;  5EZW A;  1KRI A;  1OF4 A;  2ZGK A;  3KT1 A;  1IS3 A;  5L9V A;  3NVC A;  5EJ1 B;  5GLT A;  4PLO A;  4DRR A;  3VD7 A;  2GMM A;  4LBQ D;  4XJU A;  3AP5 A;  5C5T A;  3J7N A;  1AR8 3;  1W3X A;  2JG8 A;  5LCW L;  3SCF A;  1HB2 A;  3WX5 A;  1JI6 A;  1V6L A;  4LA3 A;  1FNZ A;  4QPW A;  5I8T A;  3T4H B;  4E2Q A;  2C9K A;  2YGL A;  1YUD A;  3VD3 A;  4XUR A;  1RC6 A;  2JEN A;  1QOO A;  3PTR B;  5C4W A;  3QBQ A;  2PAK A;  4B4Q A;  2W1U A;  1IS6 A;  3IMM A;  3BGA A;  3M3Q A;  4Q0U A;  5K0U B;  2QQO A;  2LW8 A;  4RQP B;  5CKM A;  4H14 A;  3FLT A;  4DQA A;  4WZF A;  2RDS A;  3HVD A;  3RNS A;  2XXZ A;  4GB3 1;  5FO7 B;  1EV1 3;  4PLN A;  4UW6 A;  3CQO A;  1PO1 1;  4M0H A;  5CFC C;  4HFS A;  5I8S A;  4NRO A;  2R06 1;  4FVV A;  4ZON A;  2IUW A;  4LMF A;  3GJA A;  3ZIW A;  3ZYF A;  5FPX A;  2QQL A;  3I49 A;  2WQ4 A;  3LZZ A;  1C28 A;  1O59 A;  3C3V A;  4MAD A;  5FMO L;  5FYU A;  2FDF A;  3HIF A;  1BMV 1;  1VB2 A;  2OPW A;  4L0P A;  1JZ6 A;  5BNO C;  4CDU B;  2RR1 1;  3CO2 A;  4CXY A;  3T4V A;  1GYK A;  2NLR A;  1DF0 A;  2OT7 A;  3KD4 A;  3LA3 A;  1H4H A;  2EIG A;  2XJQ A;  1QOS A;  5A1A A;  5FPL A;  3AZV A;  4YVW A;  1SLI A;  1QHD A;  3QH6 A;  1H9W A;  4DXS A;  1Y9M A;  4RD7 A;  4QM9 A;  1QNY A;  3DGT A;  3C7H A;  1R08 1;  3OBA A;  5AC9 1;  5IHR A;  5FYZ A;  2A6X A;  3EB7 A;  2RHP A;  3N9N A;  3WP4 A;  1VBE 3;  2P3K A;  2XBO 3;  5GZC A;  2VUL A;  4DXZ A;  4NPM A;  4HVO A;  1DYK A;  1YJL A;  1BKZ A;  4LKS A;  3T2T A;  3M7A A;  3AKP A;  3U10 A;  2OUJ A;  5ABJ B;  1AR6 2;  2W95 A;  1MEC 2;  1RIN A;  4P9W A;  1I5P A;  2LM3 A;  2OW4 A;  2W9X A;  3KHB A;  3T3Y A;  4ZS3 A;  3RYP A;  2VJX A;  4D94 A;  3KQR A;  3KQ4 B;  5FZK A;  2BGP A;  2FBE A;  1PGS A;  1SCS A;  1W9S A;  4X8P A;  1H1A A;  1PM7 A;  4AQ2 A;  2R04 2;  1D2S A;  2AEZ A;  3ZKU A;  4CCL A;  2JG8 B;  4XMI A;  2X5I A;  4A42 A;  2DCZ A;  3WV6 A;  5FZ3 A;  2CDO A;  4BZ4 A;  2FCV A;  4WM8 C;  1GWL A;  1HQW A;  4HK8 A;  3EBR A;  1O3T A;  2JG8 C;  1KXG A;  1L3J A;  3H1M A;  4AVC A;  2QTW B;  2CGN A;  5C4W B;  3O1U A;  2JIJ A;  3RMX A;  1GOH A;  1PHM A;  4OLL A;  1GFF 2;  2WS9 2;  1V9U 1;  2P6C A;  3PU3 A;  2CWM A;  4DXR A;  3HEI A;  1D4M 3;  2EIE A;  3N7K A;  1R09 3;  5FZ7 A;  1AR7 2;  1HXS 3;  4QU2 A;  4W6Y A;  1W06 A;  3IDA A;  3V0A A;  2VE1 A;  1H1M A;  3POY A;  3AP4 A;  5I8Y A;  3IWZ A;  4FPK A;  1FAT A;  1BK1 A;  1XE0 A;  4BE3 A;  1W8Z A;  1T6B X;  3CHX A;  3GM8 A;  5I0U A;  1F2N A;  5I91 A;  4IEX A;  4YSF A;  1PO2 2;  3OCP A;  4LOS A;  2Z4F A;  2VZP A;  4A3Z A;  2NPI A;  3KLS A;  3UET A;  4YAR A;  2R7E B;  4QPG A;  2C1F A;  2EAL A;  4YVW B;  4Z2A A;  1UOG A;  2XR4 A;  4MHU A;  3DF0 A;  1ZVF A;  1JYV A;  5SV8 A;  1RUH 2;  2C4X A;  3AMN A;  2OZJ A;  3GXU A;  2CWS A;  2Q4S A;  2QDR A;  2GND A;  3U75 A;  2Q5T A;  1W9W A;  2DVB A;  4FOV A;  1S0B A;  4LEJ A;  4E4D X;  1J3R A;  4OI2 A;  5I0S A;  4EE2 A;  4QKN A;  1LOF A;  1UZY A;  1W6O A;  4XFH A;  3AKS A;  5DAX A;  4RS5 A;  1E5H A;  2FCT A;  4L8Q A;  4YZ3 A;  2A6V A;  3FUQ A;  4KQ7 A;  4XZP A;  4KBZ A;  2GNM A;  2NM1 A;  3NV3 A;  5FZC A;  5FDB A;  4LO4 B;  3B3Q E;  1NE4 A;  1WLC A;  5CFD A;  2WLP A;  1JU4 A;  1OA4 A;  4GH4 C;  1RJ7 A;  5F3I A;  4JCK A;  4XUQ A;  3TAY A;  4Q5O A;  4BQX A;  4EWE A;  2LTN A;  5FP9 A;  4JGY C;  1HB4 A;  4XIL A;  2H6C A;  3S0M A;  4BH9 A;  4JTO A;  4PBP A;  1K5J A;  4Q4X 1;  5LBB A;  4Q2F A;  2GH2 A;  3ALQ A;  1IQD C;  3ZFF C;  2VW1 A;  4X6R B;  1MS9 A;  1N1Y A;  2UU8 A;  5LBE A;  4YNI A;  2ZHK A;  1EUU A;  2VMG A;  1BVP 1;  2QQI A;  3HNM A;  4W8J A;  2D43 A;  1XNC A;  3ITQ A;  2CGO A;  2D7F A;  4TYS A;  1TME 1;  4Z07 A;  3ZX7 A;  1UXZ A;  2UWB A;  3J7L A;  5J48 A;  5M0T A;  2WJS A;  1PGW 1;  3JB4 C;  3V0A B;  2D93 A;  4N43 C;  5JOW A;  4QB2 A;  4LOT A;  1H4G A;  4F8A A;  5FZI A;  5GLZ A;  2IC1 A;  4EN8 B;  1ZZB A;  4HKW A;  5D1I A;  1RUI 1;  1A6C A;  3VDC A;  2EAK A;  5H9Q A;  3MZH A;  4BQ2 A;  3ZVX A;  3WXP A;  3QD6 A;  1VMF A;  2DU0 A;  1CPN A;  1MZE A;  1Q56 A;  1RUJ 1;  1RXF A;  1R64 A;  4QPG B;  3U4S A;  4R8H A;  1RB8 G;  3NV2 A;  1E57 A;  1COV 3;  3CJI A;  1AYN 2;  1D7P M;  3RGB A;  3OGV A;  3FFZ A;  4XET A;  4MH0 E;  3KVB A;  3NNG A;  4Y3O A;  5FP3 A;  5K0U C;  4FCA A;  1YI7 A;  3POI A;  2D5H A;  3CZJ A;  1WLW A;  4NRQ A;  3N9O A;  4RQP C;  1C8N A;  2PTM A;  3B9I A;  3BAL A;  2XG3 A;  1W9T A;  4CU8 A;  3PUS A;  2HH9 A;  1SLA A;  3RZG A;  1NA1 A;  1LEM A;  4F83 A;  4PJY A;  2ZS6 B;  4RS5 B;  1JH5 A;  3HBK A;  4C91 A;  2VOT A;  3G6J B;  2ARA A;  1G6N A;  2E63 A;  4CDU C;  5L9B A;  5CFD B;  2CAU A;  2QQN A;  3MHZ A;  1AXY A;  3WY6 A;  1UYZ A;  3T2P A;  2UY8 A;  3V65 A;  3JZV A;  4KL1 A;  2VVF A;  4R9B A;  4Q8K A;  4KWU A;  1Z0H A;  2WZR 3;  2TEP A;  4E9K A;  3J7M A;  4HAN A;  3Q8F A;  1PO2 3;  2BOI A;  1IG3 A;  3UKV A;  4K9S A;  3MV1 1;  4CEY A;  3TNP B;  2R16 A;  5L73 A;  2XKP A;  4FOW A;  5JSR A;  5LK7 B;  4IW3 A;  1V6J A;  2WAO A;  2WT1 A;  3D0J A;  5A70 A;  1GQP A;  4HLT A;  1QH6 A;  2VZO A;  1JTZ X;  3UGG A;  3WF0 A;  3ZXK A;  3O1V A;  4UFL A;  4FFF A;  4MUV A;  1QJX 3;  1RJ8 A;  1UY0 A;  4XFA A;  1Y43 B;  3HN1 A;  1ZRI A;  5ABJ C;  5FQ0 A;  1NXM A;  2VO5 A;  3WG2 A;  4RA0 A;  5IVB A;  1DQ0 A;  3N9P A;  1QIQ A;  4FPJ A;  1B35 B;  1SBD A;  1GNY A;  4COV A;  4P14 A;  2WNV B;  1H6X A;  3BU7 A;  1JYX A;  5SV5 A;  5LBC A;  1YFY A;  2YFZ A;  3FMG A;  2YUE A;  4LUL A;  3MPB A;  1KD7 A;  3AP6 A;  1LEC A;  3BCW A;  4R9D A;  5GLV A;  3SH4 A;  1CZV A;  1E5I A;  4RR3 A; 
#chains in the Genus database with same CATH homology
 2B9V A;  3SEE A;  3WNL A;  4JX0 A;  2J22 A;  3A7Q A;  2XON A;  3WF1 A;  4RN5 A;  2VZU A;  3U37 A;  1K3I A;  1CX1 A;  1JU3 A;  3T0B A;  3VD5 A;  4PQQ A;  2WBK A;  4BK4 A;  3WNO A;  2X10 A;  2J1T A;  2ZEX A;  3NRU A;  5JXI A;  1GUI A;  2Y6J A;  2Y6K A;  4OZO A;  2W94 A;  2YB7 A;  4HG6 B;  4P02 B;  1GU3 A;  2BZD A;  3GGL A;  3E1F 1;  3CZU A;  1XNT A;  1NKG A;  3I3B A;  2EIC A;  2J1R A;  2WN2 A;  3HOB A;  3T2O A;  2J1S A;  1H6Y A;  1UMH A;  3K77 A;  5HPO A;  4CU7 A;  2E32 A;  2E26 A;  2X05 A;  1K42 A;  4CVU A;  2LS6 A;  5DMY A;  1UY1 A;  2JDA A;  5FUI A;  1BHG A;  3HN3 A;  5EIY B;  4CU9 A;  1KEX A;  1UYX A;  2RJ2 A;  4QX3 A;  2YC2 A;  4A4A A;  3CDZ B;  1O8P A;  1UXX X;  1SDD B;  4CUB A;  4M4R A;  5C71 A;  4P00 B;  5HXM A;  2YC4 A;  1WCQ A;  3III A;  3WNP A;  3I3D A;  1UY3 A;  2WZ8 A;  4P5Y A;  1UY2 A;  3DYM A;  3I2I A;  2W1W A;  4KMQ A;  3EYP A;  1L7R A;  5C70 A;  4QB6 A;  4XUP A;  2YG0 A;  5EJZ B;  3P6B A;  5CZK A;  2VCB A;  3PUH A;  1KGY A;  1W8O A;  3I2F A;  4QDR A;  3F2Z A;  2JKX A;  4DEQ A;  4BXS V;  3C7F A;  4ZY9 A;  2V72 A;  4AAX A;  2VM9 A;  4MGS A;  2BBA A;  1ULP A;  1XPW A;  4OMD A;  1SHW B;  2VZ1 A;  1W0N A;  3MBW A;  2HYX A;  3IB3 A;  3C7E A;  2VQU A;  3GDB A;  2E31 A;  4BK5 A;  2OKX A;  4BJ0 A;  1RYY A;  4JKK A;  2WAA A;  5IFT A;  5F7U A;  2EIB A;  4GWJ A;  1JZ7 A;  2ZXQ A;  2ZEW A;  1GOF A;  4KI5 M;  1JZ3 A;  1CIY A;  1OH4 A;  3MO4 A;  3FL7 A;  1UX7 A;  5I0D A;  2XQX A;  3MV0 1;  4QB1 A;  4A45 A;  2YFU A;  4M4P A;  3T08 A;  4W50 A;  1HN1 A;  5DN2 A;  5DPN A;  3LEG A;  4TTG A;  4E8D A;  3MUY 1;  2J1V A;  1P8J A;  3FN9 A;  3T2Q A;  4E8C A;  3MUZ 1;  2JE8 A;  4GWI A;  4ARY A;  2W1Q A;  3NJX A;  3OGR A;  2WO1 A;  1W99 A;  3ABZ A;  1JZ2 A;  1PX3 A;  5JXG A;  1NAE A;  2VR4 A;  1UYY A;  1NUK A;  3OG2 A;  4LQR A;  5JUV A;  5J1X A;  3ECQ A;  3WEZ A;  1JZ5 A;  4DUV A;  2WQ8 A;  3DEC A;  2Y6G A;  3ACH A;  3I97 A;  5G05 L;  4A41 A;  2HLE A;  4OUE A;  2C26 A;  3NQH A;  3HNY M;  3UNP A;  1XNA A;  1DLC A;  4IUG A;  2VCC A;  1GMM A;  2VC9 A;  3LQC A;  3THD A;  3OB8 A;  1PMJ X;  1OF4 A;  5LA0 A;  3WF4 A;  5EJ1 B;  1JYN A;  3DYO A;  3VD7 A;  5LCW L;  1JI6 A;  4QPW A;  2VMD A;  4QDQ A;  2C9K A;  3WNK A;  3VD3 A;  4XUR A;  3SKJ E;  2ZEY A;  2Y6L A;  1JHJ A;  3T0A A;  5IYY A;  2W1U A;  3BGA A;  2QQO A;  2LW8 A;  1DP0 A;  2WN3 A;  4MGQ A;  3VDB A;  4MO3 M;  1OF3 A;  1T2X A;  3CQO A;  3K4A A;  1J84 A;  2PQS A;  3C7G A;  1NX9 A;  2QQL A;  3I2G A;  4UI9 L;  4MAD A;  1O59 A;  2VZT A;  4L0P A;  1JZ6 A;  1F4A A;  1TVG A;  5LA1 A;  3WQB A;  3I3E A;  2ZEZ A;  4AG4 A;  4ARX A;  4RYD A;  5A1A A;  3P1I A;  4XUN A;  4DXS A;  2W46 A;  3C7H A;  4A6O A;  2VZS A;  3OBA A;  2RVA A;  3LPF A;  1YQ2 A;  5IHR A;  3IAQ A;  2VTF A;  1OT5 A;  3EB7 A;  3HNB M;  3WF3 A;  2W87 A;  2DDU A;  4LKS A;  2W95 A;  5C7G A;  1I5P A;  2W9X A;  4QX2 A;  2VZ3 A;  4CU6 A;  3SKV A;  1GOG A;  4D8M A;  2V5D A;  2VJX A;  3J7H A;  2BGP A;  1L7Q A;  1W9S A;  4JKM A;  3OEA A;  2VMC A;  5JXH A;  1UMI A;  2J1E A;  4XUT A;  4A42 A;  2WDB A;  2CDO A;  4FI9 A;  5IJR A;  2Y6H A;  4ZZ8 A;  2VME A;  3K4D A;  2VCA A;  2QQK A;  2J1U A;  3I2H A;  2VMF A;  4TXW A;  3T09 A;  1GOH A;  3LE0 A;  5LA2 A;  2E33 A;  2EID A;  3IAP A;  2ORZ A;  4DEV A;  3HPN A;  4DXR A;  4DUX A;  3HEI A;  2EIE A;  3CMG A;  4ZXE A;  3OGS A;  3IDA A;  2W1S A;  4P08 A;  4PF1 A;  1US3 A;  2DCK A;  4D0Q A;  3LEI A;  5DQ0 A;  4DXT A;  3GM8 A;  3T0D A;  4A44 A;  1O8S A;  2Y8K A;  1K12 A;  2Z4F A;  3OEB A;  2J7M A;  5JR2 A;  2V4V A;  2VZP A;  4A3Z A;  3UET A;  2R7E B;  1OD3 A;  4Z2A A;  4JKL A;  4ZZ5 A;  1JYV A;  3BN6 A;  1J83 A;  4MOA A;  2C4X A;  3GXU A;  3NJV A;  4UAP A;  1EUT A;  1K45 A;  4QDS A;  2WZE A;  1W9W A;  1WKY A;  3WSO A;  3CKH A;  2BGO A;  1LNS A;  2QBX A;  4QX1 A;  1MPX A;  2WAB A;  4JHZ A;  3LEK A;  5G04 L;  3C8X A;  1PX4 A;  3SEP A;  1JU4 A;  2WO2 A;  3THC A;  2JD9 A;  5JXJ A;  3K46 A;  4LPL A;  4XUQ A;  1ULO A;  4CUC A;  4OYU A;  3A23 A;  3FHA A;  3VD9 A;  1IQD C;  1UY4 A;  1DYO A;  4PT6 A;  4W4Z A;  2B4K A;  4QX0 A;  3C7O A;  1EUU A;  3HNM A;  4W8J A;  2QQI A;  2WO3 A;  4UOJ A;  2W47 A;  1UXZ A;  2XHN A;  2WUH A;  2X09 A;  4XVH A;  3WNM A;  4QB2 A;  3VDA A;  4OMC A;  1JYW A;  2Y64 A;  2J1A A;  4ET7 A;  3VDC A;  3AC0 A;  3CIH A;  3WF2 A;  3ACG A;  2KD7 A;  1CZT A;  5B4X A;  1R64 A;  3ACF A;  4QAW A;  3W5M A;  1US2 A;  2VQT A;  1D7P M;  3W5N A;  3OGV A;  2RV9 A;  3NNG A;  3DYP A;  3UES A;  3WNN A;  3CZJ A;  2W5F A;  5CYY A;  2VZQ A;  1W9T A;  4CU8 A;  5B4N A;  1SG3 A;  1JZ4 A;  2BER A;  3A22 A;  2ORX A;  2VOT A;  1PMH X;  4GZ9 A;  2VZR A;  2QQN A;  1F4H A;  1UYZ A;  3A21 A;  3T2P A;  4LHS A;  3JXS A;  4CUA A;  4KWU A;  5IFP A;  4YPJ A;  2ID4 A;  2L9L A;  3K75 B;  1UZ0 A;  3MV1 1;  3HJR A;  4XZU G;  3LPG A;  2WAO A;  1XC6 A;  1UWW A;  3D3A A;  1GQP A;  2VZO A;  3WF0 A;  3FHQ A;  2W3J A;  3PUI A;  1UY0 A;  1W8N A;  2VO5 A;  3ACI A;  3I2J A;  2W92 A;  3I2K A;  3ZM8 A;  1GNY A;  2VZV A;  3K4Z A;  5JMO A;  2QQJ A;  3ETP A;  1H6X A;  4BDV B;  1JYX A;  2YFZ A;  2WYS A;  3VD4 A;  2CDP A;  2W91 A;  1JZ8 A;  2XOM A;  2QQM A;  4XUO A;  1CZS A;  1TG7 A;  4DUW A;  2VL4 A;  1CZV A;  2DCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...