3LEKA

Lectin domain of lectinolysin complexed with lewis b antigen
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
VETENIARGKQASQSSTAYGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the lectin regulatory domain of the cholesterol-dependent cytolysin lectinolysin reveals the basis for its lewis antigen specificity.
pubmed doi rcsb
source organism Streptococcus mitis
molecule tags Blood clotting
molecule keywords Platelet aggregation factor Sm-hPAF
total genus 39
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3lekA00
3GGLA 4BJ0A 5B4NA 4JKLA 1IQDC 2KD7A 3I2GA 1UY4A 2WO2A 5LA1A 2W92A 1WKYA 1CZTA 2RJ2A 4LQRA 4JX0A 2WUHA 2ZEXA 4D0QA 5EIYB 1W9WA 1GOFA 3IB3A 4OMDA 2W1UA 4P08A 4OUEA 2YG0A 1H6XA 3LEIA 3T2PA 2WZ8A 4M4RA 5B4XA 1L7RA 3HJRA 3F2ZA 2QQKA 3IAPA 2QQNA 3C7EA 4QDQA 3CMGA 3T0BA 5IFTA 3DYMA 4D8MA 1W8OA 3DYOA 1JZ5A 2VQUA 3FL7A 4BK5A 4IUGA 2ORZA 3WF1A 2ZXQA 1JZ8A 1K12A 4W8JA 5HXMA 4CVUA 2J1UA 4QB1A 4P02B 2VC9A 1W0NA 4A4AA 1UY3A 4P00B 3I2KA 2VZVA 3T0AA 4ZZ8A 4MO3M 4MGQA 1NAEA 3ACHA 3A7QA 4PT6A 3OG2A 3WQBA 3U37A 5J1XA 3BGAA 3VDBA 3ETPA 1GNYA 2VZPA 3E1F1 2Y6LA 5CYYA 2QQJA 2Y6KA 5JXHA 3WNNA 2CDOA 2W47A 3SEEA 1UY0A 4DEVA 1R64A 3J7HA 2JE8A 2Y8KA 2VMFA 4QPWA 4Z2AA 2W91A 4PQQA 1XC6A 5IYYA 4CUCA 2BGPA 1MPXA 3I3EA 2J1TA 4CUAA 3EYPA 4DUWA 4QDRA 2YFUA 1JI6A 4ZXEA 1CZVA 1UYYA 2EIEA 3P1IA 2VCBA 3VD3A 2E26A 4ARXA 5IJRA 3WNKA 3WNPA 3OGVA 3HPNA 5EJ1B 3CKHA 2Y6JA 4CU6A 1JU3A 3MO4A 4P5YA 4LPLA 2VZ3A 4JKMA 1TVGA 2B4KA 3HOBA 3WEZA 4KI5M 1US2A 2WN2A 2HLEA 3CZJA 4DUXA 2X10A 1UX7A 2VZ1A 2J1AA 2YC2A 3BN6A 3WF4A 1PX3A 2VZRA 3UESA 2ZEWA 2BZDA 1UMIA 3HNMA 3OB8A 1UXXX 4CU8A 3C7GA 4RN5A 2WO3A 2Y64A 1I5PA 3VD9A 2VZUA 2QBXA 4BDVB 2C26A 4A45A 1JU4A 3THCA 3T08A 2VM9A 4DXTA 1W99A 3VD7A 3ACGA 5JXIA 1NUKA 5JXGA 2W3JA 2CDPA 3HNBM 3K4AA 1W8NA 3C8XA 1JYXA 1KEXA 1SG3A 2C9KA 2J22A 1JZ7A 1XNAA 3WNMA 3UETA 3IIIA 4PF1A 4UOJA 2VZQA 2EIBA 2VZSA 5F7UA 2EIDA 4KWUA 1DLCA 2C4XA 4JHZA 1ULPA 4ZZ5A 2WQ8A 3ECQA 1HN1A 2J7MA 3C7OA 2XOMA 4KMQA 2W87A 2WABA 3ABZA 4DUVA 3GDBA 3OBAA 1W9SA 3I2JA 3OGSA 2DCKA 2J1RA 4A42A 4ET7A 3NJVA 2J1VA 1JYNA 1TG7A 4CU7A 4OYUA 3W5MA 3SKVA 3OEBA 1O8PA 1OF3A 4XUQA 2ZEZA 3T09A 2VZTA 5LA2A 3MV01 5FUIA 4RYDA 3I3BA 4HG6B 1UY1A 3LPGA 3I2FA 2WZEA 3NRUA 1YQ2A 4QDSA 1UXZA 2RVAA 4MGSA 2E31A 3T0DA 4OMCA 1UYXA 1OD3A 5DMYA 2VL4A 4QX0A 1GU3A 1WCQA 2JD9A 5DQ0A 1PMJX 4JKKA 4YPJA 2WYSA 3LQCA 1KGYA 3OEAA 4XUTA 3GXUA 2BBAA 5C71A 3ACFA 3MUY1 2QQLA 2OKXA 5A1AA 3HNYM 1LNSA 3LEKA 3K46A 2WO1A 3MV11 5IHRA 1J83A 2V72A 2E33A 2LW8A 1GMMA 2W1WA 4W4ZA 4QX1A 3CQOA 4MADA 2VCCA 2X05A 1GOGA 2LS6A 3W5NA 3DYPA 2WBKA 4LHSA 4XURA 3EB7A 3OGRA 1CIYA 3WSOA 2XQXA 2ID4A 4E8DA 2QQOA 4A6OA 1CX1A 2W1SA 2VMCA 1ULOA 5HPOA 3PUIA 3SKJE 3LE0A 3NNGA 4GWIA 1EUUA 1US3A 3LEGA 5DN2A 3VDCA 3A23A 4A41A 5JR2A 1BHGA 1UYZA 2BGOA 4GZ9A 4DXRA 2YFZA 3I97A 1D7PM 2VJXA 1UWWA 2PQSA 5EJZB 3JXSA 4BXSV 2L9LA 2W1QA 1PMHX 2VTFA 1OT5A 3LPFA 3MUZ1 2W46A 1K42A 3VDAA 1SHWB 1JZ6A 2XHNA 4E8CA 3P6BA 4DXSA 4A44A 2W94A 3CIHA 2JKXA 3T2OA 1NX9A 5C70A 2YB7A 4QX3A 1JYVA 3WF0A 4CU9A 1SDDB 3C7HA 1DYOA 2W95A 4CUBA 5IFPA 3HN3A 5JXJA 2VCAA 4QAWA 2VZOA 2R7EB 4OZOA 2J1EA 4LKSA 4QB6A 4XZUG 4BK4A 2WAOA 4QB2A 2WN3A 2VO5A 1PX4A 1O59A 3FN9A 3WNOA 1UMHA 2VMEA 3SEPA 1L7QA 2VQTA 4UI9L 2EICA 3C7FA 1UY2A 3VD5A 3ACIA 4L0PA 2B9VA 2ORXA 1GQPA 2QQMA 5G05L 3MBWA 4TTGA 4ARYA 3A21A 4W50A 4GWJA 3I2IA 1OF4A 3IAQA 2VOTA 4A3ZA 3A22A 1JZ3A 3WF2A 3T2QA 1K3IA 3K4DA 1F4AA 4FI9A 1T2XA 3FHQA 2Z4FA 1W9TA 1O8SA 1XPWA 1JZ2A 2QQIA 3DECA 3NQHA 3UNPA 1JYWA 1UZ0A 5LCWL 4M4PA 3ZM8A 2DCJA 2VMDA 2W5FA 4UAPA 5DPNA 1OH4A 3K4ZA 1P8JA 4ZY9A 2HYXA 2WDBA 3I2HA 4DEQA 2V5DA 1EUTA 3D3AA 3K77A 1JZ4A 3VD4A 5JMOA 1NKGA 2YC4A 3NJXA 4MOAA 4QX2A 2RV9A 3HEIA 4AAXA 2ZEYA 1K45A 3THDA 2X09A 1RYYA 4TXWA 5I0DA 3IDAA 1GOHA 4XUNA 1XNTA 1GUIA 2WAAA 2J1SA 3WNLA 3I3DA 5G04L 1J84A 3CDZB 3GM8A 5CZKA 1JHJA 1CZSA 3WF3A 2BERA 5JUVA 5LA0A 2W9XA 2VR4A 4XUPA 4XUOA 2Y6GA 2JDAA 2Y6HA 5C7GA 3PUHA 1F4HA 1DP0A 2V4VA 3CZUA 4XVHA 3K75B 2DDUA 2E32A 3AC0A 3FHAA 1H6YA 4AG4A 2XONA
chains in the Genus database with same CATH superfamily
3GGLA 4BJ0A 1HQNA 1PO12 5B4NA 5HCHA 5EJ3A 4GA9A 3WT3A 3M70A 1GQGA 1GYKA 5LA1A 5ISLA 4UF0A 1UNBA 2W92A 4LBMA 4X8PA 3U0ZA 1CZTA 3NNJA 4YARA 1FT9A 2VVFA 4O7XA 4D0QA 1VAKA 2CWMA 1UF2C 2RS31 2ZAAA 5F5QA 3DN7A 3WR0A 2VU9A 3QBQA 4HK8A 3IB3A 3DPRB 3JUUA 1AL23 5CVRA 3KF5A 4GMP1 2ZHKA 1C8M3 3I3MA 2WNVB 4LHNA 1C4RA 2ARAA 4R9AA 3W59A 1SLLA 2IXKA 1QDCA 3TRSB 4GD4A 2FZ1A 4LMFA 3OY8B 1BVP1 2B8MA 4E9KA 1YYNA 3R05A 4HANA 4N7UA 4QXKA 1S0DA 3V64A 2F4PA 3C7EA 1Z7S2 3RDIA 4Q4Y1 1AVBA 5ERLA 4JGYB 1HRV3 3GZEA 1H1IA 3CMGA 4RR3C 3N9QA 3S7IA 3T0BA 2GN3A 4YGCA 3DYOA 3AP7A 1YCIA 2G1MA 2VQUA 5FYUA 4QGMA 4AI3A 1PMIA 3GALA 1TZOA 3FL7A 2PHLA 4FAHA 4DOUA 2YBSA 3D6EA 5FZMA 1DGRA 5KHIA 2W68A 4E2SA 5JDBA 3AK0A 1JZ8A 1BK0A 1C5IA 3W21A 3N36A 4KG8A 3FFZA 5LEJA 3BPSA 4BQ2A 1K12A 4DMIA 4AFDA 4XBQA 1YUDA 1GP4A 1R1A2 4RQPC 5GJ6A 1QOTA 3AKTA 2VC9A 5FZ8A 1WD3A 4A4AA 1XJAA 5F1RA 1UY3A 2K0GA 2R16A 2VZVA 4X8NA 3JQXA 4IQPA 1Y9GA 4MO3M 2D6NA 1C8M1 4NAMA 5JOWA 5L19A 2Z42A 3H1MA 5A33B 1NAEA 1WMFA 3AYEA 3BODA 3KHBA 1VRH2 4DY3A 1MZEA 3S0MA 2VBPA 2W0XA 4MGIE 1JN2P 4OCTA 1XNBA 3NVCA 3VDBA 1JUHA 2BDRA 1LHVA 3ETPA 1YLLA 5EHDA 4GJZA 4YVWC 5J7MA 2GC2A 1IKPA 2XVKA 3E1F1 2MNGA 5ABJC 5EWSA 3H1WA 4H3WA 4DINB 1W6QA 5CISA 2QQJA 4N9HA 1WWYA 4C90A 1M06G 1AL22 2DF7A 4W65A 1G8WA 5JXHA 2I74A 1A8MA 2W47A 3T4VA 4TWTA 4AEJA 1GZTA 1QQP3 3LA2A 4WZCA 1MS3A 3FLTA 1QJY1 3WW3A 4QX8A 3AP5A 2W91A 4PQQA 3ZDSA 1XC6A 2WS92 2WIIB 4Q4V2 3LAGA 5FZ6A 2WNUC 3MLJA 3FWEA 3U07A 1NZIA 2QDNA 2TEPA 2J1TA 4IGPA 4SLIA 2VW2A 1QMJA 4DUWA 2VPVA 2YFUA 3KV5A 4ZXEA 4GMP3 1SBFA 2ZGUA 3AX4A 2GU9A 5CG9A 5GKAC 4EE2A 1UD1A 1X8EA 4MH0E 4CPBD 1WW6A 2EXIA 5FWEA 5IJRA 5IVJA 2UYAA 3DGTA 2JJ6A 3HPNA 4Q1RA 3KV6A 5GZDA 1VBA2 3FLPA 3CKHA 3U4XA 2CL2A 2XJUA 4LOTA 2OQ6A 2JENA 2BTVC 2PHTA 1KJLA 4QQOA 1S0CA 4P5YA 1JW6A 4SBVA 4UXAA 2VZ3A 5K4LA 3AZXA 4LNVA 2B4KA 2VTXJ 3BUCA 2ZMLA 3O0WA 2ZGMA 2HWE2 3WQ7A 5A3MA 4CXXA 3H3ZA 5A70A 5A7WB 4EZHA 3GYDA 1CAUB 5JOZA 2X10A 3EJKA 1RUG3 3BN6A 2VD7A 2H0BA 1QDOA 4KWJA 4XIOA 3RNSA 3WF4A 5KR7A 3MEPA 5FBZA 4CDXB 5C33A 1DZTA 3PJYA 3UESA 1SDWA 2YV8A 2ZEWA 5JZGB 5JLVA 4GALA 3USSA 4BCUA 1LGNA 1UMIA 2IVJA 4WM7A 3OB8A 1UXXX 1ZA7A 4GXLA 3MLLA 1WMEA 1U5YA 3KGLA 1W3VA 2JIGA 4AE2A 2A6VA 4HMZA 5E1RA 4OULA 5BNOB 5F37A 1RUNA 1I5PA 2VZUA 1RUI3 2C26A 2JG9B 5C9AB 5FK8A 1BZWA 4CEWB 3THCA 3T08A 3POFA 1XE8A 1KITA 1CWPA 1HLCA 2B9UA 3PUAA 3VD7A 1Y9QA 2A70A 1F35A 4NJ4A 1MZ6A 3NV4A 3HNBM 1ZBA1 4QXHA 5J37A 1RVF2 4Y1YA 1W8NA 4YGDA 1JYXA 3RPQA 3IIAA 1GP5A 1KEXA 1SG3A 3N7JA 4JDNA 2TBVA 5FOJB 3J7MA 3WNMA 1VBD2 2PYTA 2VNRA 1H2KA 1QEXA 2C24A 2F4LA 3IIIA 4PLOA 3RG0A 3MGUA 3H8RA 2FDJA 1H9WA 4UOJA 5CFDC 2VZQA 2V5YA 5C3SA 4Y3OA 5DAVA 1IQAA 5FJHA 3T1MA 3P5BA 1EAH1 3WLUA 1COV3 2VOWA 5JAXA 2O0OA 2J7MA 1HB2A 2JDKA 3C7OA 4JZRA 1W04A 2W87A 1GWMA 2ZPXA 3NV2A 5DZGA 5A3TA 4DUVA 4FQZA 4ASKA 1PIV3 5LZ6A 1J1LA 4JRLA 1ASJ3 4P9JA 4HSJA 4BM8A 4Z82A 1E5HA 1FNZA 1HV1A 4UF0B 2FCTA 2DCKA 4RGGA 1RUF3 5FZEA 3V0AA 4Z8BA 4XEZA 2VUCA 1BBT3 1D2SA 1OLMA 4K8FA 4RS5C 2CTVA 4AVTA 4Q4X2 4IV1C 4OYUA 3ZN5A 2OVUA 3H7JA 1AYM3 2HWB2 3ROUA 5L9VA 1QIQA 2WNVC 3OBZA 2PHRA 3V65A 4XUQA 2ZEZA 2XG3A 2EA7A 3N9PA 4FOVA 4AI0A 3PIGA 1HXS3 2VQAA 2XMLA 4XXAA 1TNFA 5FIXA 5FYCA 4YZ3A 4ATFA 2GDFA 1UY1A 2K9ZA 1XU1A 3I2FA 2VG9A 4LLOA 5CIRA 1ENQA 4LE3A 1QGLA 3UT0A 4LO6B 3O1PA 2A5ZA 1VBE2 4FP2A 4XIKA 2YPDA 3X29B 5AC92 4FPEA 2JWPA 4Z1VA 4WM7B 2CNAA 5IK8A 4MGSA 3T0DA 4OMCA 5LBFA 4DPNA 4JGYA 4AOCA 2E7AA 5D8AC 1SQ4A 2O1QA 3LGRA 3LSEA 4IEWA 3KCCA 3HMYA 2P3JA 2JG8A 4QX0A 1RUH2 2JG9A 1N1TA 1RUG2 1WCQA 2JD9A 3A4UA 1LJ7A 4L9BA 5DQ0A 1PMJX 4IV3A 4LHKA 5JZGC 1RHI1 2OW4A 3I2OA 3LQCA 1J3RA 1DHKB 4XUTA 3GXUA 2FCUA 2AREA 4XILA 3ENRA 1W39A 4GH4B 4BB3A 1OQ1A 1YFXA 3MW3A 1W6OB 1C57A 1VLNA 4IEQA 5FY8A 5H9PA 1G9AA 3HNYM 4XOGA 5D8AA 4AFMA 2WO1A 2ENRA 1RUJ3 2UY8A 2ZX0A 2GH8A 4OVEA 4UWDA 1SLIA 1BMV1 1S0GA 1G9DA 5CKNA 1VBE3 5CKQA 4PQ9A 2OUHA 1SACA 4AI1A 3FFQA 4W4ZA 2WR9A 4QX1A 5CEHA 5JSPA 1GR3A 1Q8VA 2ZX3A 3AXDA 3VBSB 2E63A 2LALA 4YW5A 1RL3A 4GAZA 3RRDA 5KHJA 4Y4YA 3EHKA 1XBFA 4GB32 2VCCA 3JZVA 2ZKNA 2IVIB 3B3QE 5T54A 5BNOC 1C3HA 3VBHC 1Q43A 4KQ7A 3DYPA 3VKOA 1YWKA 4Q4X3 2B46X 3PVBB 5M0TA 1HN0A 3RWNA 1VMJA 2ETEA 2IFWA 1R082 5FZDA 5LBBA 1Y3TA 2VGDA 2XXZA 1BEV2 1PK6B 3JQWA 1S1AA 1GP6A 2XJTA 1RINA 4I0AA 4RHV3 3ZFEC 1PNGA 1QNWA 4W6WA 5DZEA 3ZYGA 1BYHA 5CAZA 1V00A 1AR63 1E5RA 1UZZA 2XWJB 3L2YA 4PIYA 5FV3A 1DYKA 2O14A 5AVPA 2A7AA 1RMU2 4S2DA 3SXWA 5HPOA 3PUIA 3O1RA 3NNGA 2P4EA 4NWWA 1CN1A 1YXWA 3PLQA 5F3EA 5GZEA 4AGGA 5DN2A 3A23A 5BNPB 4DXRA 2GP3A 4N53C 3O1VA 3I97A 2WSUA 4HVOA 5J3UA 4MG2A 1ND2A 2A73B 4QKDA 2PQQA 1VRBA 4QHZA 4Y20B 4M3CE 5DAXA 1LTEA 4NO4A 2YMZA 5ACA2 1GKBA 2VNOA 2XR4A 4AGVA 2W46A 3WXPA 4BISA 1JXNA 2OT7A 5K7PA 1ODNA 4PLMA 3WINE 3CL1A 1JZ6A 5FYVA 1ONAA 1DLLA 4L2NA 4DO0A 3FBMA 4B1LA 4DXSA 2TUNA 5DAPA 2JG8C 2RDNA 2W94A 3CIHA 4BIOA 3WUCA 1V6KA 1DFQA 4A2UA 1RUI2 4FPGA 2AZ5A 2JKXA 3PMEA 3AVSA 3E6DA 3QH7A 3WF0A 4WZFA 1FAYA 4CU9A 1R093 3C7HA 4QPIA 1C5HA 1UCXA 3TWIA 4BQ4A 2N7GA 4NRMA 4FBFA 1CAUA 4EROA 5I8SA 1G86A 5JXJA 4NHMA 2ZGRA 4QAWA 2VZOA 4DY5A 3GF6A 4P14A 3ZVXA 1S0BA 2J1EA 4Q4W3 5DDJ1 2QZ2A 4N53A 2NMOA 4AVSA 4XABA 1BLZA 4UFLA 5GLWA 1POV0 3BVCA 4XQ4A 5ABJB 1FX5A 1PX4A 2QKDA 2VO5A 3FN9A 3K3NA 5E88A 2P5BA 4WV8A 4JTNA 1B35B 4UI9L 2VQTA 3TOJA 4XCAA 4K6BA 2DBIA 3QCWA 5BNOA 2AUYA 1AHSA 4A7KA 2ARXA 2D93A 3ACIA 2B9VA 4ATEA 1UIJA 2VY0A 5C9AA 3MBWA 4CP9A 4QPYA 4ITCA 1PK6A 4L11A 3A21A 5LEKA 2P3KA 2PAKA 2UYBA 4MVTA 5I91A 1RUH3 2XDVA 3ST7A 4GH4C 4FP3A 2X5IC 3WF2A 4D7SA 1ZBA3 3S5QA 1I1EA 2J42A 4LXLA 3WDUA 4FI9A 4RL7A 5FRAA 3I4IA 4K40A 5CFDA 4KGQA 1Q8QA 3V56A 3NQHA 3TN91 2QTWB 5AC93 2PFWA 1VAMA 1ND2B 2HEVF 2B39A 2WNUB 1PVC2 3POYA 2JDYA 1KDMA 1LU2A 3PIJA 4M4PA 5C8CB 5F9TA 2R072 1MS8A 3ZXGA 4UAPA 4D7YA 1BKZA 1IHMA 2D6MA 3VBSC 2TNFA 4RD7A 4PF5A 4IEOA 2OPKA 3GHNA 1P8JA 1DYPA 1N47A 2FHRA 3ZMNA 3K2OA 4HXCA 1KJRA 4JGYC 5T5JA 5L7OA 3EBRA 4ZXKA 3CO2A 5HI0A 1F8VA 2R073 2V5DA 5FO9B 3NNFA 3PURA 2Q5TA 5DABA 1H30A 5KC6A 1U12A 1BK1A 4ZHNA 2NN8A 5JMOA 4BWOA 2YC4A 2GALA 3WDWA 3HEIA 4N9IA 4Y1UA 4AAXA 2HWF1 1R081 4BZ4A 4QGNA 2Y0OA 1VRH3 3HQUA 4C91A 3KQRA 1CONA 3DV8A 3ATGA 2CGOA 3BB6A 3ZIWA 4V1PA 2AEZA 4YWAA 1YJKA 1XNTA 3VDDC 2J1SA 2I2SA 5FZOB 3ZFFA 2O8QA 2DFCA 5FMBA 5G04L 2R1DA 4COUA 4CP1A 3O1TA 3GM8A 3T2TA 4R9CA 1OKQA 2GC0A 3PDQA 3JD72 2YU2A 4R52A 2BERA 1WMXA 5JUVA 5LA0A 4XUPA 3VBHA 4MX3A 4S2FA 2JDAA 1R1A3 3HR9A 2V4VA 4XVHA 4AK3A 2G4IA 5GLTA 2DDUA 1OVSA 3AC0A 3FHAA 1XRUA 3ZN4A 1NT0A 4YYOA 4O9GA 3RS6A 4HKWA 1WLTA 4JKLA 4F8AA 3LKJA 3LA3A 1RTVA 2D5FA 5FZKA 1YJLA 1RUH1 2ZZJA 1UY4A 3E5UA 3ELNA 3IMNA 4GKYA 4RGAA 2FZ2A 4AQ2A 2YPJA 3HQXA 2P37A 1BCXA 3I59B 4OFGA 4OZXA 4QPIC 3KV9A 5FZ4A 2ZGPA 5A6ZA 1CAVA 4Q4Y3 1MZ5A 5FYSA 5IVCA 2WUHA 2ZEXA 3CU7A 3OD0A 4URAA 2QVSB 4NHKA 4FPLA 3P3PA 4P5HA 1GOFA 4YNIA 4BOWA 4CYDA 4YRDA 3AL5A 1ZYBA 4GWNA 3ZXEA 4LBOA 4P08A 4GULA 3TEWA 1ZZ6A 1PHMA 4PDWC 1OURA 2XJQA 5LASA 2VTXA 2WZ8A 4YG3A 4M4RA 3AJYA 5L7OB 4XF3A 2ZAHA 4IV1B 1K5JA 4L99A 1NQJA 1WLDA 3RMXA 1J58A 4B7KA 5F39A 2D6OX 3WUDA 1N3PA 2QQKA 1LOEA 2QQNA 4N43C 2DWRA 3LOIA 4NIIA 2PELA 1RIRA 2FCVA 2EVXA 3J8F2 3RI9A 3RZGA 2IXCA 5IFTA 3DYMA 1RUE3 1NY71 1W8OA 2D3RA 3ZSEA 1LRHA 1OQEA 1OA3A 5KXBA 1JH5A 2CU5A 2QFEA 1IPSA 3WF1A 3ZMOA 4URTA 1H1AA 1CD3G 2ZKLA 1RXFA 2JD4A 2P1BA 3LB9A 1KQRA 4XFFA 4DIQA 1W6MA 3AKRA 5JOYA 3RZLA 1ULFA 2Y0IA 1BEV3 5FYIA 5FREA 5C3RA 2C0ZA 2EXJA 3IDBB 4PHZA 4AEKA 1PVC3 4Q5OA 3RYRA 2CY6A 3MF9A 4P00B 3FLRA 3PVNA 4OI0A 2ZMNA 2C6SA 3GZTB 1VBD1 4QM8A 4AI8A 2ZGTA 4ZZ8A 1PO22 2BVBA 4MGQA 1GWKA 5BNNC 1ZRDA 1ZBE3 1AR72 1WCKA 3UKVA 2XJRA 1WZXA 3ZXFA 1GICA 2JDPA 3JBG2 2GMEA 5IAVA 3U37A 3RWKX 5J1XA 4N90A 3FHIB 1FOD1 1GQHA 3OPZA 2ZX4A 3G7DA 4M0NA 3JU9A 4XTPA 2ET1A 2P3YA 4N43A 1QJU3 4QHOA 2Y6LA 5H9QA 2DU0A 1N1VA 1HQLA 3T30A 5F3GA 1C28A 2EAKA 2RS11 2BGCA 2Y33A 1W05A 2Q8CA 4OHWA 3WCRA 1CAVB 1O4ZA 4LORA 4AI2A 4CCOA 3D0JA 1QXPA 3U10A 4WM8B 4DEVA 1NY72 1R64A 1HXS2 3J7HA 4HBNA 4Y5SA 2Y8KA 2VMFA 4PDWB 4Y5Z0 5FZHA 3TB0A 3U1XA 1C1LA 5K0UC 3WD5A 5JWPA 1V9U3 5ABJA 1JBCA 3KVBA 5J98B 4E4HA 4D94A 5IYYA 2BGPA 1MPXA 2BQPA 5K0UA 3U75A 4CUAA 1HV0A 2R30A 4QDRA 1BBT2 1N1YA 1NLSA 3H8UA 2GAUA 1AR93 3CJXA 1XOYA 1TNRA 3AP4A 3GBWA 4LBQB 4XW3A 4DFSA 5K8SA 2VQ0A 2IC1A 4GIQA 1UOBA 1ZVFA 4ARXA 4NPLA 1QJY3 2PHWA 2YUEA 3WNPA 1FOD3 5JIUA 3OGGA 1KFXL 1QJX3 1WA4A 2WFF2 5EJ1B 5FTTC 4BU2A 1VBA1 3BOPA 3N9MA 3R4DB 2FDIA 4CXYA 2HWD3 5DAQA 2ZGKA 3VKMA 4UT5A 1PK6C 1TME3 2DYCA 3ON7A 3WDYA 5FKBA 4LPLA 3AYDA 1UKGA 1EPWA 1QNYA 2VAUA 2EALA 3ZKYA 1AJKA 1CR7A 3WEZA 3ZFEA 5FZAA 4KI5M 4YZ5A 2UY9A 1LOFC 1W2UA 2HLEA 2WWUA 3FMGA 5B2GB 2HWC1 2XPJA 4V2VA 2JKBA 1QJFA 4B29A 2RJLA 3H8XA 4IERA 2VZ1A 2YC2A 2Y26A 3H9AA 2HWD1 4E4DX 2OUJA 5DAWA 3VBRC 4FPOB 2ZCWA 4Q4V1 4KBZA 5HV4A 1JOJA 4AFAA 4AW7A 2JB8A 3SCFA 2HEYF 1YFYA 4B4RA 1I6XA 1NQDA 4YW1A 3C7GA 1AXKA 4N43B 3VHOA 1AUYA 3BKZA 1SMVA 3Q8AA 4RR3A 5F6LB 1RHI3 2Y64A 1X9PA 5IVBA 3VD9A 1IKQA 4FT8A 5FXWA 5A7NA 3KT7A 3ZN6B 4Q4V3 3TEZA 3RZKA 1VBB3 5LATA 2D3PA 4AFBA 1NCQC 1H4GA 1IS6A 1YEWA 2JICA 3LFMA 4I30A 1NUKA 2A3WA 4NHYA 2XL7A 3SISA 4EN8B 1UYPA 3K4AA 4PDWA 1OPMA 4XDQA 4LJHA 4J25A 4O65A 2WSVA 4JVAA 1ASJ1 3PTYA 3ZFFB 1H2MA 1UX6A 2ET7A 1XNAA 4ZU5A 1DQ0A 3UETA 4D7TA 3DF0A 2P2KA 1SLAA 1AXYA 2H0VA 5I93A 4AF9A 2VH9A 4Q0QA 3WW2A 4XJAA 4IESA 4ZONA 5FP3A 5F7UA 2EIDA 3VBHB 1DLCA 2C4XA 4JHZA 2WNVA 3VGIA 5JI9A 2DBNA 2Q8OA 2I07B 3SH5A 5JSOA 5TSWA 1YIPA 3B94A 5FXZA 3TBDA 3NJZA 1W9YA 4YGEA 1GZ9A 2YDEA 4COZA 3S7EA 1LECA 4RS5A 3OBAA 1QJZA 5A7QA 3I2JA 4Y24A 3TN92 1XSRA 1W8TA 1AR61 2QDRA 1W6PA 3OGSA 2J1RA 1V6OA 2A6YA 2H6BA 3J7NA 3POWA 4E27A 3N4MA 1HJGA 4QQLA 5FYMA 2B45X 2VOVA 5IVEA 4ET7A 4CDUB 1N1SA 2BYVE 4M3CA 3WX5A 5ANQA 3W5MA 4QQ2A 3KF3A 2BNMA 3HQRA 3KVAA 3OEBA 1QOSA 3ZFGB 2BV4A 2OX0A 2YC0A 1FMD3 1NYWA 4WVWA 2WFPA 3T09A 5LA2A 3ZSLA 2PHDA 3L2HA 4HG6B 4V2WA 4EN0A 4TLFA 4AEDA 2SLIA 3NRUA 4CDWB 5A3LA 5BNQA 5J48A 4HN1A 1XXNA 3SH4A 1YQ2A 3WV6A 1UXZA 3WG4A 1RUF1 4YGBA 2E31A 2G9ZA 2YYOA 3URFA 2FBEA 2GSYA 4AQSA 2Q30A 2MEV3 5EYYA 4CRQA 1IS3A 3NV1A 4LEJA 3TNQA 3AMMA 1RUF2 4BQWA 1GU3A 2A3XA 2O8OA 2WS93 2FDGA 1MEC3 1DGWA 3PMSA 3WNXA 1D4M1 1REFA 3HIFA 2VUJA 1W28A 2WT0A 1CQ9A 1W6MB 4XJ8A 5DUVA 5GM0A 5C71A 3ZPYA 3WHTA 3ACFA 5APAA 1W6QB 2OKXA 2Q4SA 5BUVA 1F5JA 2RJKA 3BTYA 2FDFA 4CPBA 4M0HA 4HK9A 4I0BA 5A6YA 1S55A 3RZZA 1SBDA 2ZGNA 3KWVA 1GMMA 2BOJA 2HEWF 3BCWA 5I8TA 3KV4A 1S4CA 3VHNA 2VUDA 2WQZC 1B35C 1LHWA 1NCQB 4GB33 1AR62 1X82A 1KFUL 2BBVA 5FXXA 5ACA1 2VXRA 2NQYA 4Y33A 2BW8A 4GWMA 2Q1FA 1A8DA 1MZFA 1REDA 3MFCA 3W5NA 3OOXA 2V4AA 2MEV1 3EO6A 4YG6A 1SPPB 1IPJA 1RUJ1 4XURA 2RS13 5J96B 3OGRA 1CIYA 3WSOA 2XQXA 1SLTA 3ZXDA 1MEC1 2ID4A 1UU6A 2PLV2 2FMDA 3VBUA 1MVEA 5FY4A 1BXHA 3ZDVA 4E8DA 4DXZA 3BIWE 1CX1A 1KRIA 2VMCA 5HCAA 2X53S 2YBPA 4K8RB 3LE0A 4GWIA 1CAXB 5FMCA 5JR2A 4RA0A 4Y22A 3R0RA 4H14A 5C8CC 3RJRA 2LROA 2ZHMA 4IGOA 4QKFA 2BFUS 2OPWA 3RJ2X 5EJZB 2HJIA 1MVQA 1DQ6A 1W90A 4Q1PA 5EFUA 3AMHA 2W1QA 1PMHX 1F31A 1OT5A 4GB31 2ZHNA 4UFJA 5C4WA 4AZZA 1ENSA 4EYUA 1ULCA 4LKFA 1FNYA 1IG0A 1F5FA 5EQUA 3VDAA 1O4YA 3IDCB 3AZVA 3F95A 4JQTA 1V6JA 1U5XA 2A3YA 4CXWA 3OBRA 4G3YC 5KXCA 1X9TA 2XHNA 1Y7BA 4G9SB 4U2AA 5I0UA 1OFNA 3MIDA 1NE4A 3FE5A 3VKNA 2VW0A 1BMV2 4F3JA 2OYZA 1IOAA 2WLPA 2Z2SB 3H42B 1NX9A 3IM0A 1GBGA 2YB7A 4LHLA 4QX3A 3T2OA 1O91A 4O9EA 5KBFA 1U5IA 1DYOA 3SQOA 3MW2A 3NV3A 2R0HA 3I54A 2A1XA 2G9GA 1WD4A 2HWC2 3UGHA 1XYNA 1O6UA 1IS4A 2ES3A 2IFRA 3CJIA 3OUIA 4P9LA 1RHI2 4WBBA 4YW4A 3ZKUA 1F15A 3SNMA 1DIWA 2K46A 1YI7A 4NR1A 1SZBA 2YXSA 4OZOA 4ONUA 1QHDA 1YQ8A 5A3OA 1DZRA 1VBC3 2QJVA 4QB6A 4JAAA 4FTBA 4IEPA 3UJOA 4EWDA 4BK4A 5D1IA 2WAOA 1OLME 4H7MA 2WN3A 4QB2A 1AYM2 3USUB 3WNOA 3AMQA 1JOBA 2EICA 1R091 2UU8A 4B3NA 2BEOA 1XNCA 1A6CA 5AC91 4KNCA 4RR3B 4L8QA 3NKGA 4L0PA 2RS51 1GQPA 4KU8A 2QQMA 1Q8OA 3HBKA 5G05L 4LK7A 4TTGA 1ULDA 3BTZA 4AHYA 1UQXA 4W50A 1JTZX 2UURA 4XHBA 3SMHA 5C8WA 4G4FA 1IS5A 1JZ3A 3MICA 4AHZA 1K3IA 3K4DA 4XE9A 4FTEA 3WQ0A 3MZHA 1CAWA 3NAPB 3CF6E 2D44A 5FLJA 4DQAA 1T2XA 4NIGA 1HXS1 4MXWA 1LOBA 2JDZA 1O8SA 1Q5OA 2VCMA 3MF6A 4FFHA 1AZDA 1IG3A 2QQIA 3DECA 5L73A 4COVA 3UNPA 4XDOA 4JC1A 4RHV2 1RVF3 2P6HA 2EXHA 2ZTNA 5A80A 2VXJA 2DU1A 5FUNA 1QF3A 5FDBA 5LCWL 4P9XA 3ZM8A 5L7OC 1R083 4WVZA 2DCJA 1WW5A 2W5FA 4WVMA 1QOOA 1W06A 4N8MA 1OH4A 1EAH2 3K4ZA 1CJPA 2YY1A 1W2TA 1FOD2 3B93A 4KL1A 4XJUA 5CA6A 1AJOA 1PGW1 1YQ6A 1LGBA 2WYFA 3AZYA 1Y9MA 4DEQA 1CPNA 1K5MB 4AVVA 1AR71 1HRI1 3UV9A 1AR91 1J1TA 2DVAA 1QWRA 1PO21 5IK4A 1AR92 3BTAA 3OPWA 2JG9C 3TN93 4IEXA 3S57A 2D43A 3LIGA 3K77A 4B4PA 1J59A 1A78A 1EV13 3VZMA 3NJXA 4YVWA 5IAXA 5IW0A 4Q8KA 4FXKB 5A3PA 2ZEYA 4IV3B 2VBBA 3ZFGA 1ZREA 4QHBA 3TEYA 4M3CF 1JODA 1DBNA 1HRI3 4GH4A 2RS33 1W6OA 1UKRA 2A75A 5I0DA 1MQTA 3ITQA 1VPHA 2FQPA 2RM22 2HBTA 2NYYA 3IDAA 4XUNA 5BNNA 4KH9A 3Q9OA 1GUIA 3QH6A 1J84A 3CDZB 4OLLA 5FLHA 3KLSA 5FZCA 3BTXA 2ARBA 2OS2A 3J8F1 1EY2A 4LO5B 1WBFA 1JHJA 1EP0A 2JDNA 2V09A 1DQ2A 4L92A 2JX9A 1CPMA 2HYKA 3HBZA 4PI0A 5J09A 2VR4A 3JB4C 1LODA 1VBB2 2GC3A 5CNAA 1VE0A 2Y6HA 3ZFFC 4CP2A 5C7GA 1NA1C 4FPJA 3LOBA 1F4HA 1DQ1A 1HB3A 2LM3A 1MS9A 1NCRA 1H6YA 3LWCA 4AG4A 2HWE1 2XONA 1JYCA 3FUQA 2EIGA 3GJBA 3NAPA 1IQDC 3G6JB 5FPBA 4JGZC 1E5SA 2WO2A 5CADA 5IVFA 3VBOB 1RITA 3I3QA 4FSJA 5A1LA 2RJ2A 3JCIA 4CZSA 4LQRA 4JX0A 4XMAA 4P9YA 5FR3A 2D7FA 1NCQA 3LF7A 3PL0A 1W9WA 2HKXA 3ZXAC 1ND3C 3FX3A 1H4HA 1I3HA 3M2MA 3WW1A 2WZPP 5IK7A 1ND3A 1JS9A 4OUEA 5LA9A 4E2QA 5GLVA 5FOBB 2YG0A 5DDJ3 1VIWB 1UOFA 4MXVA 4FFFA 3DKWA 1JHNA 5FZ3A 2WRAA 4I09A 1SPPA 1UO9A 4UFHA 1L7RA 4MHRA 4HOOA 2FD8A 5EPAA 5GLUA 1W8FA 2F6BA 3IAPA 3O12A 4QDQA 1OI6A 3O5SA 5DZFA 2DTYA 3JD71 5BYNA 3HT2A 3N9NA 4HFSA 4KU7A 3POIA 4QD2A 2SBAA 1LOGA 4XJZA 3NO8A 1Z0HA 3VKLA 4AL9A 4IUGA 1W0PA 4BK5A 2XQRA 4AVAA 2WNEA 3M3OA 4R8HA 2ZXQA 4IGQA 5I0SA 1H8TC 2Z69A 4ZU4A 1LULA 5FPUA 3JD73 1HRV2 2RMU1 1UMZA 4W8JA 4CVUA 2ZZQA 5HXMA 2DVGA 4I02A 4QB1A 2HWF2 4GMP0 4QU1A 4IEUA 4XXPA 5F3IA 5A7PA 5C4WB 1VJ2A 1I9RA 1W0NA 2R043 4C8DA 3DL3A 3T3YA 3E6BA 4E2GA 1XNDA 3BALA 3KB5A 3VL8A 3I2KA 1Z78A 3VDDA 4XQDA 4MV2A 4Y4RA 1OD5A 4X6QB 3OYWA 4BQ3A 1EYBA 1MEC2 1B35A 1UOJA 3AKPA 3E5QA 4B8EA 4ISQA 2OIIA 4MGTA 5T52A 4LUKA 1SFNA 4HPKB 3IMMA 1GNYA 2WINB 5FPXA 4UBHA 2MEV2 1R1A1 1YI9A 5JPNB 3Q8EA 3Q8CA 2R062 2YBKA 2XH6A 5CYYA 1PVC1 2Y6KA 3ZOIA 4CDQC 2CDOA 4OUSA 4R4XA 3B02A 5FJKA 3SEEA 1D4M3 4MZUA 1VB4A 3OSDA 3VBFA 1UY0A 4YZ4A 3W58A 2ZHLA 4JDOA 3B01A 4QPWA 4WM8C 2XWBB 1DQ5A 3U11A 4Z2AA 2B7YA 2DTWA 2RMU3 3FJSA 3LDRA 4P9IA 3USUA 4IE0A 1Z7S1 4CUCA 3I3EA 3RSJA 1GZWB 2DUOA 2LRPA 5E16A 4EWAA 5A3UA 3KM5A 4O61A 5IUQA 1LEMA 1V6NA 4ES9A 3BIEA 3T4HB 2Q1MA 5C8CA 1YNAA 5IATA 3VZOA 2YGLA 1CZVA 3J26N 4FOYA 1UYYA 2HWC3 4BMBA 1ZRIA 1X50A 2JDMA 2WKKA 1C1FA 3D8CA 4TSVA 3VD3A 1SCSA 5H9RA 1OXCA 3ZIXA 2E26A 2JB4A 1G9FA 1LHNA 1OOPA 5LBCA 3S6PA 1LGCA 5FYHA 3WNKA 4YW6A 3TNPB 3VBRA 5BV6A 2JEMA 5FZ1A 5FZGA 1PM7A 1NE6A 2Y6JA 1H9PA 1X33A 2CSGA 3CBNA 4IETA 3FUOA 4NHXA 4COYA 2BWCA 1FI2A 1AXZA 3KS7A 5DUUA 2QNKA 5A7WA 5CKMA 1PO11 3VBUC 1J3PA 2WC2A 4JTOA 3Q8FA 1ZRCA 4UYBA 4IEVA 2PHUA 4CEYC 1MS0A 3CZJA 4DUXA 2QQWA 2AYHA 4WVMB 3ZYPA 3AYCA 3N7LA 2J1AA 3ES4A 4LKDA 4META 5H9SA 4RGKA 1RC6A 1PX3A 2E51A 1CX4A 2VZRA 2ZGQA 1COV1 1OFSA 3SCGA 4NVPA 3UGFA 5CG8A 1UU4A 5E8AA 2FDKA 4P9GA 4S2GA 2UWAA 3QOPA 5FYBA 1GANA 2FDHA 4CEWA 1VALA 5D2AA 3ME2A 2ATFA 1UZWA 4BDVB 1TME2 2QBXA 5FQ0B 1ACCA 4A45A 3ZR5A 3O14A 1UZVA 4UFKA 3UKTA 5F2WA 5A6XA 3BI3A 3GBFA 2DUQA 3ACGA 2ZA9A 5HV0A 5FPZA 5JXGA 1XYPA 2CDPA 1RXGA 3VUOA 3C8XA 1WBLA 2BOIA 2CGPA 2C9KA 4BQYA 3KZ4C 4AYUA 4BA6A 1JZ7A 1Q8SA 3VZNA 4CEWC 1GZWA 3E6CC 4YG0A 5C4WC 4KWKA 3LEMA 3ZSKA 5E89A 1ASJ2 1ZRRA 3D82A 4R4ZA 1LOAA 4BPZA 5EYXA 1OPOA 4LLFA 3QLQA 2EIBA 2VZSA 1SBEA 5EZWA 2KXLA 1C8NA 2B5HA 4KWUA 5KXEA 3SITA 2E6VA 3R6SA 4TLGA 1ULPA 2CAUA 3ECQA 4LA3A 1HN1A 4QQPA 1FPN1 4AVBA 4YZ1A 1VMFA 4MUVA 4U36A 4IV1A 2ADEA 2DUPA 1DGLA 1GLHA 3ABZA 1V6IA 3B69A 3UGGA 3NJYA 5AFEA 5EP9A 1AX1A 1W9SA 1KDKA 3LCPA 5JIAA 3VBOC 3AYAA 5C9AC 5LK7B 1DZQA 4LKEA 3VBOA 1HKDA 2A6ZA 2VUAA 4HN0A 4Y1VA 5JMCA 4W6XA 1HJFA 3NJVA 3LDBA 2J1VA 1JYNA 4D69A 4CU7A 3V0AB 4RQPA 2W2IA 4XFAA 1S0IA 1W9FA 1PVXA 2HWD2 2XBO1 1S0EA 2XLGA 4XAAA 4A6SA 4FO9A 1AR83 1VR3A 2WFF3 4XF4A 1E57A 3DPRC 3OUJA 2BP6A 4FCAA 1OLRA 1RMU3 3MV01 3HN1A 4XFIA 3LPGA 3C2UA 3BYWA 1WA6X 4GKXA 3H0OA 2AEYA 1RUG1 5FP4A 3ILFA 4Q26A 5T5PA 2RR11 4MLOA 1W6NB 1ZZ9A 3KCXA 1OD3A 2UWBA 2WZR2 3AKQA 4I2OA 3ALQA 2WFF1 1K5MC 5HCBA 5JPMB 1XE7A 2VL4A 1KXGA 4QPGA 2KA3A 4C1XA 2KM2A 2AH2A 2RM23 1LU1A 4JKKA 1ULEA 5KHKA 1KGYA 3OUHA 1TMF2 4IEYA 5D8AB 5F32A 3VB9A 5T5LA 1QJX1 1BBT1 1EV11 4XF9A 3DXTA 2QQLA 1ZNPA 1QH7A 4YW7A 2GNMA 5AVAA 2HWB1 4Y1XA 3K46A 3LEKA 5A32B 4S2HA 3S30A 1XNKA 4N7IA 3MV11 3ZYRA 1IPKA 2R041 2V72A 2XBO3 4Q4X1 2NMNA 4JGZA 4XF0A 5C3PA 2LW8A 5FY9A 3NKTA 3ZO0B 3NAPC 2W1WA 3INAA 1W8HA 4CSWA 3LIHA 4KBBA 1S2KA 1AX2A 4IDZA 4LR4A 5K0UB 1W2AX 2QQVA 3MDPA 4ZS2A 1Y43B 1QXJA 1OKOA 3UYJA 2RS12 2BNOA 2X05A 1UAIA 1GOGA 3B00A 4HPKA 3EQEA 1NLRA 3MYXA 2VECA 3H3UA 4IXLA 2OQ7A 3KCYA 5FMDA 1FATA 2PLV3 4XFHA 1JUIA 1ZZ7A 3RYPA 3O1OA 1YHFA 4NE9A 4LHSA 4UW4A 3VHRA 1GNZA 5FYYA 3JBG1 4AQTA 4EV0A 4CP0A 3K51A 2BVVA 1H2NA 1NZCA 5GALA 1YQ5A 3VBFB 3U4SA 2D98A 4OQ8A 3A0KA 4A6OA 4XAEA 2W1SA 5FAXA 5BNPA 2IXLA 4F7ZA 3PVOA 4RSUA 5FKCA 1EUUA 4EN6B 1RVF1 1US3A 3POEA 3VDCA 2ZACA 4ASLA 1BHGA 1UYZA 1G9CA 2Y34A 1OA4A 3Q8BA 3AM2A 4GZ9A 1D7PM 3ZFEB 2WLQA 4AVCA 3ZXJA 3WG2A 2PQSA 3B5LB 5F2SA 3OF1A 4NRPA 3JXSA 4BXSV 2L9LA 3WDTA 1ULGA 1W2NA 1YC61 2VTFA 3LPFA 4BLJA 4XJWA 1KS4A 3ZSJA 5F6KA 1WW4A 2PN5A 4LE4A 4Y20A 2WJSA 1H8TB 3ZYJB 2CHHA 2FMYA 4F83A 1SHWB 2F17A 5DG2A 3VBRB 2ZJCA 5HBAA 3AMPA 4QPGB 4CDQA 4E8CA 2Y6FA 3P6BA 4NMIA 4YM1A 5LW9A 1YIFA 4FQ4A 3OGJA 2HWF3 4XC9A 3O1UA 2XJPA 3B9CA 2GMMA 3PJQA 3KSCA 2C9AA 1SDDB 2PMWB 4OUMA 3IZOA 5DUXA 5EXOA 4HLTA 5IT6A 1MR5A 5FXVA 4TZDA 1JMUB 1GFF2 5FY0A 5L9BA 3N7MA 5KHGA 5A32A 1YQCA 4PI2A 4DB5A 1LKNA 1RUD2 1QKQA 1GV9A 3HN3A 4FVVA 3K48A 3O0VA 5BNPC 2AGSA 1PGSA 5F8PA 1AYN3 4N53B 5FO8B 2R7EB 1RUC3 5JR7B 1U5ZA 5FZIA 5AFBA 4LKSA 5FZFA 2JE7A 3EXUA 2Q8DA 1JYIA 5KC5A 5A33A 3ILNA 1OHFA 1O59A 4XYXA 2VMEA 4JV4A 4Q29A 1DG6A 5LBEA 1UY2A 5KXDA 5FO7B 3VD5A 5FPAA 3UL2A 1RUD1 5GLZA 2DCYA 2ORXA 2W52A 2ZOEB 3T1LA 4CDUC 3AP6A 4ASMB 4ARYA 2GMPA 4YZ2A 4QMAA 3OTFA 3RYKA 3TEXA 3PU8A 4GWJA 4MGKE 4CCCA 4K20A 4A3ZA 3IAQA 2VOTA 5A7OA 4Q4W2 3WCSA 4CP9B 3RGBA 4UBGA 2PHFA 3T2QA 4BYYA 2YU1A 2WS91 1F4AA 1OOPC 2P3IA 3LDKA 3I7DA 4NHLA 1G9BA 1LEDA 3FHQA 2Z4FA 5LB6A 1W9TA 4RFT0 1XPWA 5F5IA 3VZJA 5CBLA 1PO23 2PA7A 2BRTA 1SFYA 2DVBA 5CFDB 1UZ0A 1Q8PA 4LULA 1ZZ8A 5FY5A 4CCDA 4YM3A 3D5OA 4HKOA 2VMDA 2WNUA 2JECA 4WVVA 4BMEA 4OHXA 2UWCA 3J9SA 5JSRA 5DPNA 4AEDB 3ACLA 3N35A 4CDWA 3B7MA 3ZXKA 4ZY9A 3M3CA 2HYXA 1D0GA 5T55A 2JXAA 4CDQB 4UW3A 2WDBA 4XPVA 1D0HA 2RDRA 4DRVA 4H2AA 3HT1A 4IV3C 1VRH1 2ZABA 5FZ0A 4LITA 2DURA 2XLAA 1QU0A 4MSVA 1RUD3 1VP6A 3MPPG 1ALYA 1U0AA 1FYUA 1R1ZA 3JB8A 1VMHA 4PIZA 3GCXA 1OUSA 1LCLA 3J8F3 1PIV2 5LWBA 4MOAA 3LA7A 4QX2A 3WDXA 3O1SA 2ZGOA 2RV9A 2DVDA 2K2SA 1YO8A 3SHRA 2R063 1K45A 3WDVA 1RJ7A 1W8UA 2GP5A 1UW8A 2R49A 1T6GC 3DXUA 4LK6A 4XCBA 3THDA 3POGA 2WWJA 2R071 1O3SA 1LENA 3H8OA 4AHWA 5T50A 5T3NA 1E5IA 2X09A 1RYYA 4YSFA 4D6SA 1LESA 2CWSA 1NCRC 2YGMA 2GNBA 3HWJA 2P6CA 4ZKTB 3M3QA 1LOFA 1AX0A 1VBD3 1ZZBA 2ZGLA 4CDXA 4R9DA 5C5TA 3WNLA 5JCTA 2YHJA 3I3DA 3M1HA 5ACA3 1W6NA 3HVDA 3RMYA 5CZKA 4XACA 4YVSA 2WO7A 1D2QA 1GWLA 1CZSA 2VOXA 4Q4Y2 2R042 4XFBA 5BPXA 3WF3A 2W9XA 2ZMKA 2Y38A 4B7EA 4XUOA 4JDMA 2R0FA 3AFKA 3L9JT 4OI2A 3ZLIA 4ZU7A 1H0BA 4HONA 1QJX2 3PUHA 4KGGA 1DP0A 1UZYA 3CZUA 2IUWA 4PBOA 1TMF1 5FWJA 1W03A 4FXGB 2E32A 3IKWA 1POQA 1QH6A 2IXJA 3AKSA 4NIHA 1ZRFA 2KR2A 1FV2A 3CJIC 2RDSA 1O4TA 2KD7A 2XVLA 3I2GA 1O5LA 4NUBA 3HAGA 3WW4A 4PCRA 3I49A 2BFUL 2P34A 2CV6A 4JGZB 4BE3A 5FK7A 1WKYA 3SLIA 1G7YA 1V9U1 2E7QA 3MFAA 4JHTA 3K3OA 3O0XA 4YM2A 4UFMA 5DDJ2 2I45A 2RR12 5EIYB 2D97A 3KQ4B 3EMRA 3IN9A 3S5AA 2VMHA 2PAEA 3GHMA 5D21A 4YW2A 1TEIA 4OMDA 2EAAA 2W1UA 4BQ5A 4YLZA 3RZJA 3BU0A 1JYTA 1POV3 2JIJA 4HKLA 1OUXA 5A1FA 2X8KA 1H6XA 4Q0PA 2HWE3 4FFIA 3LEIA 3T2PA 3IPVA 1OLQA 4NOTA 1SLBA 1OH3A 5B4XA 4OQ9A 3DUIA 1HB4A 1X7NA 2BNNA 2XBO2 4K3UA 1YFUA 3HJRA 3F2ZA 1PGL1 5LRRA 3DKQA 1RUI1 4B1MA 1OVPA 1SCRA 2MPFA 4YW3A 4PIXA 2WWSA 4D8MA 4FPYA 3VHPA 4AEDC 1PNFA 5C6CA 1HX6A 1JZ5A 2W08A 1MS5A 3SCHA 4Z2WA 4CEYA 1AR82 2ORZA 4OI4A 4XF1A 2VMIA 2WA3A 1NA1A 3P3NA 4KWLA 2NM1A 1WCDJ 1PZ8A 1VBC1 3UK9A 2J1UA 3IBMA 4P02B 2BPA2 2BU9A 5FPVA 5IVYA 5E6HA 4YVSB 2R1BA 2LTNA 3AL6A 4Q0UA 3AVRA 1W2OA 5DXDA 5KWRA 3T0AA 5FY7A 1H8TA 1RMU1 4CDXC 2GZWA 4B4QA 3MIFA 1XB9A 3N9LA 3ACHA 3A7QA 4FFGA 1DDLA 4PT6A 3OG2A 2D6LX 4XQWA 1H1MA 2C1FA 2JG8B 3WQBA 1BEV1 4Q0SA 1OBNA 1TQ5A 2RR13 3BGAA 4OHVA 1HW5A 5LY2A 4EWEA 4J6GA 5I0TA 2E7TA 3BPZA 2VZPA 4R9BA 3OD4A 3VLBB 2AACA 3KT1A 4QXCA 1TME1 2WQ4A 2X29A 4WM8A 2JDUA 3MLKA 1AR81 3WVJA 2PXJA 3NNLA 1AYN1 3WNNA 3RQ0A 2HBUA 2RHPA 2Q8EA 1HIXA 4D6QA 1CAWB 2JE8A 5GZCA 4TYSA 3SC7X 3OCPA 4YFZA 3LFIA 4HVRA 1COV2 2GNTA 2ZX1A 3VBSA 4BH9A 3R4UA 5CFCC 1CVNA 4AAPA 1MACA 3WOGA 4LUMA 3EYPA 1LB2A 4QXBA 5L36A 1J3QA 1RB8G 3AJZA 1JI6A 1NLQA 4NIAA 3VBFC 4EZ4A 2Z5WA 2OXBA 2IWGB 3PHMA 4HSLA 4ZPIA 3ZYFA 2EIEA 4AHXA 3P1IA 2VCBA 1WLCA 1I5ZA 4KG0A 5FP8A 2ILMA 1WCSA 2GNDA 4IE7A 2EXKA 2D6PA 5KHHA 1AF9A 3TYJA 2D6KA 2E53A 1RJ8A 3OGVA 2D3SA 1F2NA 3N3HA 4GQ7A 3ZYBA 1V9U2 3W9AA 4CEYB 5BY5A 4CU6A 1JU3A 5FUPA 3WP5A 4K1ZA 1APNA 4LIVA 3MO4A 3OBTA 4LO7A 2PAMA 4QX5A 2VVEA 4BQ1A 4NN0A 2A71A 2XJVA 3AFGA 1VBE1 1TVGA 2DVFA 3N7KA 4JKMA 3ORJA 5F5CA 3RFRA 1UIKA 4AWDA 2GN7A 3HOBA 4COWA 3KGZA 1US2A 2BJSA 2WN2A 3LZZA 1GSLA 1UN1A 4YM0A 3KD4A 5F5AA 4EQVA 1MQTC 1ST8A 4LO8A 2WT2A 1D4VB 1XSQA 1UX7A 5HCFA 3BU7A 3GNEA 2ADDA 4ORFA 1WCUA 4IL7A 4QM9A 2GC1A 1V6LA 5EV7A 2BZDA 1FV3A 5HXVA 3IDEA 1SEFA 1HB1A 3WP4A 3HNMA 4CU8A 1ZX5A 3V0BB 4QKNA 5LY1A 2JE9A 4RN5A 4NPMA 1PO13 5FP9A 5C3OA 3MW4A 2ERFA 2WO3A 1Q56A 4HZFA 4UW5A 1V70A 4QPIB 4XFGA 2R061 1ENRA 4BQXA 1UPSA 1JU4A 1LOCA 2QQUA 3KMHA 5FLIA 5FY1A 5SV8A 2VM9A 1NCRB 2AENA 3AZZA 4DXTA 1W99A 1ZZCA 3WP6A 3AMNA 5JXIA 2B42B 4J1WA 1DGWX 3ZN6A 2W3JA 1CIWA 2Z79A 1HDKA 1S2BA 2VW1A 3U14A 1PIV1 1F9KA 1FMD1 2RE9A 5A3WA 4ES8A 2VOKA 5JI7A 2D5HA 2ZX2A 4AEMA 2J22A 4UW6A 1H8VA 2NP0A 3RI8A 1L7LA 2XKOA 1B09A 4LBLA 1OMIA 2XHKA 4JQRA 4PF1A 2OZ6A 4YFWA 4AGRA 2HH9A 2BUKA 1ZBA2 5DG1A 3WY6A 1V6MA 1REEA 3GJAA 4LBJA 3VKFC 1WLWA 3WZ1A 4BXFA 4E4SA 4Z07A 1ND3B 4C1WA 4CCEA 2WA4A 3MPBA 2WQ8A 4ZZ5A 1HRV1 2RMU2 3OJBA 1V0AA 3VV1A 2NZ9A 5A6QA 1WUVA 2XOMA 2DCZA 4KMQA 3PUSA 3A0NA 2WABA 3GDBA 2E9QA 1W6PB 3NWKA 3N9OA 1WMDA 4JRAA 4EN9B 4RFRB 3M4FA 4CDUA 1GNHA 1ZBE2 2IXHA 4MHUA 4RS5B 1VAVA 1UU5A 2YROA 3GBGA 4A42A 2BWAA 4JCKA 3TAYA 1UL9A 4NROA 2XUEA 3D0SA 1TG7A 4M01A 2A6WA 1NOVA 4D3WA 4Q4W1 4LBNA 4M3CB 1RUC2 3SKVA 5IVVA 2G19A 1O8PA 1O3QA 1BVVA 3W20A 4HT1T 1OF3A 2EF6A 2Q1ZB 1MS1A 3AZWA 4IE5A 2VZTA 2X5IB 3GZUC 4NAOA 4Q0VA 4QT6A 4QU2A 4XTMA 4XHXA 5FUIA 4RYDA 1UPIA 3I3BA 1QQP1 5FZ7A 3IPVB 3M3IA 5GZGA 2WZEA 2XUMA 1W8WA 4XFCA 4HVQA 3VL9A 4INDA 3M3EA 3WQ1A 4I3GA 3DCQA 1XE0A 4OHZA 2RG4A 4QDSA 2RVAA 3THPA 4CCNA 4X6RB 5JOXA 4QQHA 3POBA 3VDDB 3PU3A 1UYXA 2PTMA 1KD7A 2VMGA 3CHXA 3OYWB 1WGPA 5DMYA 4FOQA 3UKNA 4CDWC 2XVGA 5CU1A 4I3PA 2CYFA 4XMIA 3MIHA 1IZ3A 4M00A 1NA1B 1W0OA 1N3QA 2V73A 2XL9A 3DEMA 4OI1A 1QQP2 2WYSA 4YPJA 3OEAA 4AI9A 1OC1A 5T5OA 1CGPA 2BBAA 2QZ3A 3R4SA 4FTSA 1H2LA 3MUY1 3O7OA 4CUGA 1VBB1 4LBKA 1O3TA 5A1AA 1RUC1 1Z7S3 3ETQA 1O3RA 1LNSA 3QACA 5ANNA 5IHRA 1URXA 1J83A 2YZ4A 2E33A 5FZOA 2VNGA 2WL1A 5K9YA 2PHXA 3J7LA 1OQDA 2R32A 5FP7A 1QJY2 1NG0A 4FPCA 3WHUA 2ARCA 3CQOA 1ZBE1 3H7YA 5A7SA 1NXD1 4UFIA 4XBLA 4LIUA 2RM21 4MADA 1AL21 3DPRA 1XYOA 3KT4A 1XU2A 2D40A 4FPHA 2LS6A 3PNAA 3VZKA 4AQ6A 4DNYA 3RZHA 3GZAA 2A6XA 4HL0A 1WW7A 4XBNA 4CCMA 5FCCA 3OY8A 3AXEA 2CAVA 2WBKA 3B9IA 4A3XA 2MHFA 3VN4A 3VBUB 3EB7A 1OOPB 3FC0A 5I8YA 5J36A 2ZGSA 4FAGA 3I59A 1DU3D 2OZJA 2QQOA 3POJA 4W6YA 1C8M2 1HRI2 1SLCA 1Q3EA 1ULOA 4LA2A 3SKJE 5FZLA 1CJDA 4CCJA 1FMD2 1HQWA 1T6BX 3LEGA 3PVEA 4A41A 1PGW2 1ZA4A 2JDHA 3MHZA 2BGOA 5FMOL 4CA9A 1X8MA 2YFZA 1ODMA 3FZ3A 2VJXA 4AFCA 1UWWA 1CESA 1CAXA 2WZR3 3SH3A 3U78A 1N3OA 3NW4A 4Q27A 4Y22B 3ZYHA 3ILRA 1JOPA 3NL1A 3O1MA 2XKPA 3VZLA 3MUZ1 3BOWA 4RHV1 3RVHA 1W3XA 2VBDA 5CFCB 1K42A 2VE1A 3IWZA 1AR73 4QGLA 3CNAA 1TMF3 3KHCA 1VB2A 3UJQA 2CGNA 2XGXA 1EAH3 4LOSA 1DGRN 4CCLA 2Y60A 4QPGC 4A44A 4EN7B 1FPN3 4MGYE 4Q2FA 4K7JA 4GJYA 3WG3A 3D4KA 1DF0A 3I2DA 1ND2C 5C70A 1S0FA 5FMOS 4XDPA 4A7ZA 1YRZA 4LTAA 3I8TA 1S0JA 1JYVA 5FQ0A 2C5DA 4J1XA 1EV12 2W95A 2QQPA 1QXRA 4CUBA 5DUWA 4Y26A 1QJEA 4E4ZA 5IFPA 1LR5A 1LHUA 1BJQA 1UOGA 2RS52 2ZBJA 2VCAA 4LO4B 5L9RA 2VVDA 1R092 3CJIB 1KS5A 4IE4A 4FOWA 2HWB3 4PJYA 1OA2A 2IZWA 2RS32 4XETA 2QE3A 1PZ7A 1YFWA 1AYM1 4K9SA 2G9FA 4C0BA 1Y4WA 2VNVA 4XZUG 2WZR1 3WP3A 2VULA 2OA2A 1QY4A 3CLPA 3ZX7A 1XQNA 3V0BA 1UMHA 4K21A 3SEPA 1L7QA 5FYTA 1FXZA 1PZ9A 3C7FA 2NLRA 4BIFA 1O7FA 4LT5A 2WT1A 4H55A 5GZFA 1RUE1 4PBPA 4ZS3A 4QX7A 5FZ9A 5C3QA 1G6NA 4NIDA 2ZS6B 3CEWA 4A7YA 3I2IA 4PLNA 3NMBA 1OF4A 3J4UH 4DS0A 4AR2A 3A22A 1LAJA 4MXWB 4LBQD 2IXIA 4AXOA 5FZBA 1M4WA 1QJU1 2P17A 1DQ4A 2DV9A 4I0WB 1EPZA 3APBA 3ASIA 4NRQA 3WG1A 4Y5TA 4MYEA 5FBJA 4QKBA 4I01A 4EJRA 3MIBA 1JZ2A 4RQPB 1A34A 1A3KA 1AYN2 1MS4A 2QCSB 1JYWA 3ZXLA 1DCSA 4IW3A 3QD6A 1POV1 4K1YA 3FBYA 5F3CA 1OSGA 4QWNA 3ZYIB 4H7LA 1FPN2 4CE8A 2AR6A 5FYZA 5CFCA 5JVVA 4CCKA 4LBQA 1K5MA 4Y1ZA 4ISRA 4Q8LA 1AL0G 2LUWA 1IGOA 3I2HA 4MGZE 3ZSMA 5FFOC 5CB7A 2XLFA 5JZGA 4HETA 1STMA 4TN7A 1EUTA 2XB6C 2RS53 1GZCA 3D3AA 1NXMA 4YVWB 3OPTA 3E97A 1JZ4A 2PLV1 3GCWA 3VD4A 3H3LA 5LRSA 3E5XA 5SV5A 1SFPA 1NKGA 1PM4A 3LSDA 4WM7C 2DCTA 2WNOA 1RUJ2 4L97A 4NPRA 4DRRA 2H6CA 3H50A 3JBG3 3ZPOA 4DZGA 1O5UA 1VBA3 2X5IA 1VBC2 2R6QA 3AB0A 4OHYA 5BNNB 5A3NA 2Q0AA 3AP9A 2NPIA 4IEZA 4P9WA 3NSTA 3NNMA 3ES1A 4XJ9A 1ENXA 1LHOA 4YVSC 4TXWA 1X36A 5BXXA 1TE1B 1GOHA 1RGSA 1ZM1A 3LD8A 4C0HA 4CTEA 2QUOA 2WAAA 4BHPA 1RUOA 5I0RA 3POSA 4BLIA 1MQTB 5C5UA 4FPFA 3PTRB 3HD8B 5IK5A 1QJU2 1W8ZA 3C3VA 3MI8A 3RZMA 2XJSA 4FPKA 1BQPA 2W39A 3M7AA 2RDQA 3MIGA 5FPLA 1PGL2 5IWFA 3PUQA 3M8LA 1S2EA 3THTA 2AC1A 3ZFGC 4XZPA 2Y6GA 4IE6A 3H1YA 4NWVA 3K75B 4Z92B 3IT8A 5LK5A 4D6RA 2GH2A 1RUE2 1D4M2 3MIEA 1L3JA 2DFBA 3ZR6A
chains in the Genus database with same CATH topology
3GGLA 4BJ0A 5B4NA 4JKLA 1IQDC 2KD7A 3I2GA 1UY4A 2WO2A 5LA1A 2W92A 1WKYA 1CZTA 2RJ2A 4LQRA 4JX0A 2WUHA 2ZEXA 4D0QA 5EIYB 1W9WA 1GOFA 3IB3A 4OMDA 2W1UA 4P08A 4OUEA 2YG0A 1H6XA 3LEIA 3T2PA 2WZ8A 4M4RA 5B4XA 1L7RA 3HJRA 3F2ZA 2QQKA 3IAPA 2QQNA 3C7EA 4QDQA 3CMGA 3T0BA 5IFTA 3DYMA 4D8MA 1W8OA 3DYOA 1JZ5A 2VQUA 3FL7A 4BK5A 4IUGA 2ORZA 3WF1A 2ZXQA 1JZ8A 1K12A 4W8JA 5HXMA 4CVUA 2J1UA 4QB1A 4P02B 2VC9A 1W0NA 4A4AA 1UY3A 4P00B 3I2KA 2VZVA 3T0AA 4ZZ8A 4MO3M 4MGQA 1NAEA 3ACHA 3A7QA 4PT6A 3OG2A 3WQBA 3U37A 5J1XA 3BGAA 3VDBA 3ETPA 1GNYA 2VZPA 3E1F1 2Y6LA 5CYYA 2QQJA 2Y6KA 5JXHA 3WNNA 2CDOA 2W47A 3SEEA 1UY0A 4DEVA 1R64A 3J7HA 2JE8A 2Y8KA 2VMFA 4QPWA 4Z2AA 2W91A 4PQQA 1XC6A 5IYYA 4CUCA 2BGPA 1MPXA 3I3EA 2J1TA 4CUAA 3EYPA 4DUWA 4QDRA 2YFUA 1JI6A 4ZXEA 1CZVA 1UYYA 2EIEA 3P1IA 2VCBA 3VD3A 2E26A 4ARXA 5IJRA 3WNKA 3WNPA 3OGVA 3HPNA 5EJ1B 3CKHA 2Y6JA 4CU6A 1JU3A 3MO4A 4P5YA 4LPLA 2VZ3A 4JKMA 1TVGA 2B4KA 3HOBA 3WEZA 4KI5M 1US2A 2WN2A 2HLEA 3CZJA 4DUXA 2X10A 1UX7A 2VZ1A 2J1AA 2YC2A 3BN6A 3WF4A 1PX3A 2VZRA 3UESA 2ZEWA 2BZDA 1UMIA 3HNMA 3OB8A 1UXXX 4CU8A 3C7GA 4RN5A 2WO3A 2Y64A 1I5PA 3VD9A 2VZUA 2QBXA 4BDVB 2C26A 4A45A 1JU4A 3THCA 3T08A 2VM9A 4DXTA 1W99A 3VD7A 3ACGA 5JXIA 1NUKA 5JXGA 2W3JA 2CDPA 3HNBM 3K4AA 1W8NA 3C8XA 1JYXA 1KEXA 1SG3A 2C9KA 2J22A 1JZ7A 1XNAA 3WNMA 3UETA 3IIIA 4PF1A 4UOJA 2VZQA 2EIBA 2VZSA 5F7UA 2EIDA 4KWUA 1DLCA 2C4XA 4JHZA 1ULPA 4ZZ5A 2WQ8A 3ECQA 1HN1A 2J7MA 3C7OA 2XOMA 4KMQA 2W87A 2WABA 3ABZA 4DUVA 3GDBA 3OBAA 1W9SA 3I2JA 3OGSA 2DCKA 2J1RA 4A42A 4ET7A 3NJVA 2J1VA 1JYNA 1TG7A 4CU7A 4OYUA 3W5MA 3SKVA 3OEBA 1O8PA 1OF3A 4XUQA 2ZEZA 3T09A 2VZTA 5LA2A 3MV01 5FUIA 4RYDA 3I3BA 4HG6B 1UY1A 3LPGA 3I2FA 2WZEA 3NRUA 1YQ2A 4QDSA 1UXZA 2RVAA 4MGSA 2E31A 3T0DA 4OMCA 1UYXA 1OD3A 5DMYA 2VL4A 4QX0A 1GU3A 1WCQA 2JD9A 5DQ0A 1PMJX 4JKKA 4YPJA 2WYSA 3LQCA 1KGYA 3OEAA 4XUTA 3GXUA 2BBAA 5C71A 3ACFA 3MUY1 2QQLA 2OKXA 5A1AA 3HNYM 1LNSA 3LEKA 3K46A 2WO1A 3MV11 5IHRA 1J83A 2V72A 2E33A 2LW8A 1GMMA 2W1WA 4W4ZA 4QX1A 3CQOA 4MADA 2VCCA 2X05A 1GOGA 2LS6A 3W5NA 3DYPA 2WBKA 4LHSA 4XURA 3EB7A 3OGRA 1CIYA 3WSOA 2XQXA 2ID4A 4E8DA 2QQOA 4A6OA 1CX1A 2W1SA 2VMCA 1ULOA 5HPOA 3PUIA 3SKJE 3LE0A 3NNGA 4GWIA 1EUUA 1US3A 3LEGA 5DN2A 3VDCA 3A23A 4A41A 5JR2A 1BHGA 1UYZA 2BGOA 4GZ9A 4DXRA 2YFZA 3I97A 1D7PM 2VJXA 1UWWA 2PQSA 5EJZB 3JXSA 4BXSV 2L9LA 2W1QA 1PMHX 2VTFA 1OT5A 3LPFA 3MUZ1 2W46A 1K42A 3VDAA 1SHWB 1JZ6A 2XHNA 4E8CA 3P6BA 4DXSA 4A44A 2W94A 3CIHA 2JKXA 3T2OA 1NX9A 5C70A 2YB7A 4QX3A 1JYVA 3WF0A 4CU9A 1SDDB 3C7HA 1DYOA 2W95A 4CUBA 5IFPA 3HN3A 5JXJA 2VCAA 4QAWA 2VZOA 2R7EB 4OZOA 2J1EA 4LKSA 4QB6A 4XZUG 4BK4A 2WAOA 4QB2A 2WN3A 2VO5A 1PX4A 1O59A 3FN9A 3WNOA 1UMHA 2VMEA 3SEPA 1L7QA 2VQTA 4UI9L 2EICA 3C7FA 1UY2A 3VD5A 3ACIA 4L0PA 2B9VA 2ORXA 1GQPA 2QQMA 5G05L 3MBWA 4TTGA 4ARYA 3A21A 4W50A 4GWJA 3I2IA 1OF4A 3IAQA 2VOTA 4A3ZA 3A22A 1JZ3A 3WF2A 3T2QA 1K3IA 3K4DA 1F4AA 4FI9A 1T2XA 3FHQA 2Z4FA 1W9TA 1O8SA 1XPWA 1JZ2A 2QQIA 3DECA 3NQHA 3UNPA 1JYWA 1UZ0A 5LCWL 4M4PA 3ZM8A 2DCJA 2VMDA 2W5FA 4UAPA 5DPNA 1OH4A 3K4ZA 1P8JA 4ZY9A 2HYXA 2WDBA 3I2HA 4DEQA 2V5DA 1EUTA 3D3AA 3K77A 1JZ4A 3VD4A 5JMOA 1NKGA 2YC4A 3NJXA 4MOAA 4QX2A 2RV9A 3HEIA 4AAXA 2ZEYA 1K45A 3THDA 2X09A 1RYYA 4TXWA 5I0DA 3IDAA 1GOHA 4XUNA 1XNTA 1GUIA 2WAAA 2J1SA 3WNLA 3I3DA 5G04L 1J84A 3CDZB 3GM8A 5CZKA 1JHJA 1CZSA 3WF3A 2BERA 5JUVA 5LA0A 2W9XA 2VR4A 4XUPA 4XUOA 2Y6GA 2JDAA 2Y6HA 5C7GA 3PUHA 1F4HA 1DP0A 2V4VA 3CZUA 4XVHA 3K75B 2DDUA 2E32A 3AC0A 3FHAA 1H6YA 4AG4A 2XONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GGL A;  4BJ0 A;  5B4N A;  4JKL A;  1IQD C;  2KD7 A;  3I2G A;  1UY4 A;  2WO2 A;  5LA1 A;  2W92 A;  1WKY A;  1CZT A;  2RJ2 A;  4LQR A;  4JX0 A;  2WUH A;  2ZEX A;  4D0Q A;  5EIY B;  1W9W A;  1GOF A;  3IB3 A;  4OMD A;  2W1U A;  4P08 A;  4OUE A;  2YG0 A;  1H6X A;  3LEI A;  3T2P A;  2WZ8 A;  4M4R A;  5B4X A;  1L7R A;  3HJR A;  3F2Z A;  2QQK A;  3IAP A;  2QQN A;  3C7E A;  4QDQ A;  3CMG A;  3T0B A;  5IFT A;  3DYM A;  4D8M A;  1W8O A;  3DYO A;  1JZ5 A;  2VQU A;  3FL7 A;  4BK5 A;  4IUG A;  2ORZ A;  3WF1 A;  2ZXQ A;  1JZ8 A;  1K12 A;  4W8J A;  5HXM A;  4CVU A;  2J1U A;  4QB1 A;  4P02 B;  2VC9 A;  1W0N A;  4A4A A;  1UY3 A;  4P00 B;  3I2K A;  2VZV A;  3T0A A;  4ZZ8 A;  4MO3 M;  4MGQ A;  1NAE A;  3ACH A;  3A7Q A;  4PT6 A;  3OG2 A;  3WQB A;  3U37 A;  5J1X A;  3BGA A;  3VDB A;  3ETP A;  1GNY A;  2VZP A;  3E1F 1;  2Y6L A;  5CYY A;  2QQJ A;  2Y6K A;  5JXH A;  3WNN A;  2CDO A;  2W47 A;  3SEE A;  1UY0 A;  4DEV A;  1R64 A;  3J7H A;  2JE8 A;  2Y8K A;  2VMF A;  4QPW A;  4Z2A A;  2W91 A;  4PQQ A;  1XC6 A;  5IYY A;  4CUC A;  2BGP A;  1MPX A;  3I3E A;  2J1T A;  4CUA A;  3EYP A;  4DUW A;  4QDR A;  2YFU A;  1JI6 A;  4ZXE A;  1CZV A;  1UYY A;  2EIE A;  3P1I A;  2VCB A;  3VD3 A;  2E26 A;  4ARX A;  5IJR A;  3WNK A;  3WNP A;  3OGV A;  3HPN A;  5EJ1 B;  3CKH A;  2Y6J A;  4CU6 A;  1JU3 A;  3MO4 A;  4P5Y A;  4LPL A;  2VZ3 A;  4JKM A;  1TVG A;  2B4K A;  3HOB A;  3WEZ A;  4KI5 M;  1US2 A;  2WN2 A;  2HLE A;  3CZJ A;  4DUX A;  2X10 A;  1UX7 A;  2VZ1 A;  2J1A A;  2YC2 A;  3BN6 A;  3WF4 A;  1PX3 A;  2VZR A;  3UES A;  2ZEW A;  2BZD A;  1UMI A;  3HNM A;  3OB8 A;  1UXX X;  4CU8 A;  3C7G A;  4RN5 A;  2WO3 A;  2Y64 A;  1I5P A;  3VD9 A;  2VZU A;  2QBX A;  4BDV B;  2C26 A;  4A45 A;  1JU4 A;  3THC A;  3T08 A;  2VM9 A;  4DXT A;  1W99 A;  3VD7 A;  3ACG A;  5JXI A;  1NUK A;  5JXG A;  2W3J A;  2CDP A;  3HNB M;  3K4A A;  1W8N A;  3C8X A;  1JYX A;  1KEX A;  1SG3 A;  2C9K A;  2J22 A;  1JZ7 A;  1XNA A;  3WNM A;  3UET A;  3III A;  4PF1 A;  4UOJ A;  2VZQ A;  2EIB A;  2VZS A;  5F7U A;  2EID A;  4KWU A;  1DLC A;  2C4X A;  4JHZ A;  1ULP A;  4ZZ5 A;  2WQ8 A;  3ECQ A;  1HN1 A;  2J7M A;  3C7O A;  2XOM A;  4KMQ A;  2W87 A;  2WAB A;  3ABZ A;  4DUV A;  3GDB A;  3OBA A;  1W9S A;  3I2J A;  3OGS A;  2DCK A;  2J1R A;  4A42 A;  4ET7 A;  3NJV A;  2J1V A;  1JYN A;  1TG7 A;  4CU7 A;  4OYU A;  3W5M A;  3SKV A;  3OEB A;  1O8P A;  1OF3 A;  4XUQ A;  2ZEZ A;  3T09 A;  2VZT A;  5LA2 A;  3MV0 1;  5FUI A;  4RYD A;  3I3B A;  4HG6 B;  1UY1 A;  3LPG A;  3I2F A;  2WZE A;  3NRU A;  1YQ2 A;  4QDS A;  1UXZ A;  2RVA A;  4MGS A;  2E31 A;  3T0D A;  4OMC A;  1UYX A;  1OD3 A;  5DMY A;  2VL4 A;  4QX0 A;  1GU3 A;  1WCQ A;  2JD9 A;  5DQ0 A;  1PMJ X;  4JKK A;  4YPJ A;  2WYS A;  3LQC A;  1KGY A;  3OEA A;  4XUT A;  3GXU A;  2BBA A;  5C71 A;  3ACF A;  3MUY 1;  2QQL A;  2OKX A;  5A1A A;  3HNY M;  1LNS A;  3LEK A;  3K46 A;  2WO1 A;  3MV1 1;  5IHR A;  1J83 A;  2V72 A;  2E33 A;  2LW8 A;  1GMM A;  2W1W A;  4W4Z A;  4QX1 A;  3CQO A;  4MAD A;  2VCC A;  2X05 A;  1GOG A;  2LS6 A;  3W5N A;  3DYP A;  2WBK A;  4LHS A;  4XUR A;  3EB7 A;  3OGR A;  1CIY A;  3WSO A;  2XQX A;  2ID4 A;  4E8D A;  2QQO A;  4A6O A;  1CX1 A;  2W1S A;  2VMC A;  1ULO A;  5HPO A;  3PUI A;  3SKJ E;  3LE0 A;  3NNG A;  4GWI A;  1EUU A;  1US3 A;  3LEG A;  5DN2 A;  3VDC A;  3A23 A;  4A41 A;  5JR2 A;  1BHG A;  1UYZ A;  2BGO A;  4GZ9 A;  4DXR A;  2YFZ A;  3I97 A;  1D7P M;  2VJX A;  1UWW A;  2PQS A;  5EJZ B;  3JXS A;  4BXS V;  2L9L A;  2W1Q A;  1PMH X;  2VTF A;  1OT5 A;  3LPF A;  3MUZ 1;  2W46 A;  1K42 A;  3VDA A;  1SHW B;  1JZ6 A;  2XHN A;  4E8C A;  3P6B A;  4DXS A;  4A44 A;  2W94 A;  3CIH A;  2JKX A;  3T2O A;  1NX9 A;  5C70 A;  2YB7 A;  4QX3 A;  1JYV A;  3WF0 A;  4CU9 A;  1SDD B;  3C7H A;  1DYO A;  2W95 A;  4CUB A;  5IFP A;  3HN3 A;  5JXJ A;  2VCA A;  4QAW A;  2VZO A;  2R7E B;  4OZO A;  2J1E A;  4LKS A;  4QB6 A;  4XZU G;  4BK4 A;  2WAO A;  4QB2 A;  2WN3 A;  2VO5 A;  1PX4 A;  1O59 A;  3FN9 A;  3WNO A;  1UMH A;  2VME A;  3SEP A;  1L7Q A;  2VQT A;  4UI9 L;  2EIC A;  3C7F A;  1UY2 A;  3VD5 A;  3ACI A;  4L0P A;  2B9V A;  2ORX A;  1GQP A;  2QQM A;  5G05 L;  3MBW A;  4TTG A;  4ARY A;  3A21 A;  4W50 A;  4GWJ A;  3I2I A;  1OF4 A;  3IAQ A;  2VOT A;  4A3Z A;  3A22 A;  1JZ3 A;  3WF2 A;  3T2Q A;  1K3I A;  3K4D A;  1F4A A;  4FI9 A;  1T2X A;  3FHQ A;  2Z4F A;  1W9T A;  1O8S A;  1XPW A;  1JZ2 A;  2QQI A;  3DEC A;  3NQH A;  3UNP A;  1JYW A;  1UZ0 A;  5LCW L;  4M4P A;  3ZM8 A;  2DCJ A;  2VMD A;  2W5F A;  4UAP A;  5DPN A;  1OH4 A;  3K4Z A;  1P8J A;  4ZY9 A;  2HYX A;  2WDB A;  3I2H A;  4DEQ A;  2V5D A;  1EUT A;  3D3A A;  3K77 A;  1JZ4 A;  3VD4 A;  5JMO A;  1NKG A;  2YC4 A;  3NJX A;  4MOA A;  4QX2 A;  2RV9 A;  3HEI A;  4AAX A;  2ZEY A;  1K45 A;  3THD A;  2X09 A;  1RYY A;  4TXW A;  5I0D A;  3IDA A;  1GOH A;  4XUN A;  1XNT A;  1GUI A;  2WAA A;  2J1S A;  3WNL A;  3I3D A;  5G04 L;  1J84 A;  3CDZ B;  3GM8 A;  5CZK A;  1JHJ A;  1CZS A;  3WF3 A;  2BER A;  5JUV A;  5LA0 A;  2W9X A;  2VR4 A;  4XUP A;  4XUO A;  2Y6G A;  2JDA A;  2Y6H A;  5C7G A;  3PUH A;  1F4H A;  1DP0 A;  2V4V A;  3CZU A;  4XVH A;  3K75 B;  2DDU A;  2E32 A;  3AC0 A;  3FHA A;  1H6Y A;  4AG4 A;  2XON A; 
#chains in the Genus database with same CATH topology
 3GGL A;  4BJ0 A;  1HQN A;  1PO1 2;  5B4N A;  5HCH A;  5EJ3 A;  4GA9 A;  3WT3 A;  3M70 A;  1GQG A;  1GYK A;  5LA1 A;  5ISL A;  4UF0 A;  1UNB A;  2W92 A;  4LBM A;  4X8P A;  3U0Z A;  1CZT A;  3NNJ A;  4YAR A;  1FT9 A;  2VVF A;  4O7X A;  4D0Q A;  1VAK A;  2CWM A;  1UF2 C;  2RS3 1;  2ZAA A;  5F5Q A;  3DN7 A;  3WR0 A;  2VU9 A;  3QBQ A;  4HK8 A;  3IB3 A;  3DPR B;  3JUU A;  1AL2 3;  5CVR A;  3KF5 A;  4GMP 1;  2ZHK A;  1C8M 3;  3I3M A;  2WNV B;  4LHN A;  1C4R A;  2ARA A;  4R9A A;  3W59 A;  1SLL A;  2IXK A;  1QDC A;  3TRS B;  4GD4 A;  2FZ1 A;  4LMF A;  3OY8 B;  1BVP 1;  2B8M A;  4E9K A;  1YYN A;  3R05 A;  4HAN A;  4N7U A;  4QXK A;  1S0D A;  3V64 A;  2F4P A;  3C7E A;  1Z7S 2;  3RDI A;  4Q4Y 1;  1AVB A;  5ERL A;  4JGY B;  1HRV 3;  3GZE A;  1H1I A;  3CMG A;  4RR3 C;  3N9Q A;  3S7I A;  3T0B A;  2GN3 A;  4YGC A;  3DYO A;  3AP7 A;  1YCI A;  2G1M A;  2VQU A;  5FYU A;  4QGM A;  4AI3 A;  1PMI A;  3GAL A;  1TZO A;  3FL7 A;  2PHL A;  4FAH A;  4DOU A;  2YBS A;  3D6E A;  5FZM A;  1DGR A;  5KHI A;  2W68 A;  4E2S A;  5JDB A;  3AK0 A;  1JZ8 A;  1BK0 A;  1C5I A;  3W21 A;  3N36 A;  4KG8 A;  3FFZ A;  5LEJ A;  3BPS A;  4BQ2 A;  1K12 A;  4DMI A;  4AFD A;  4XBQ A;  1YUD A;  1GP4 A;  1R1A 2;  4RQP C;  5GJ6 A;  1QOT A;  3AKT A;  2VC9 A;  5FZ8 A;  1WD3 A;  4A4A A;  1XJA A;  5F1R A;  1UY3 A;  2K0G A;  2R16 A;  2VZV A;  4X8N A;  3JQX A;  4IQP A;  1Y9G A;  4MO3 M;  2D6N A;  1C8M 1;  4NAM A;  5JOW A;  5L19 A;  2Z42 A;  3H1M A;  5A33 B;  1NAE A;  1WMF A;  3AYE A;  3BOD A;  3KHB A;  1VRH 2;  4DY3 A;  1MZE A;  3S0M A;  2VBP A;  2W0X A;  4MGI E;  1JN2 P;  4OCT A;  1XNB A;  3NVC A;  3VDB A;  1JUH A;  2BDR A;  1LHV A;  3ETP A;  1YLL A;  5EHD A;  4GJZ A;  4YVW C;  5J7M A;  2GC2 A;  1IKP A;  2XVK A;  3E1F 1;  2MNG A;  5ABJ C;  5EWS A;  3H1W A;  4H3W A;  4DIN B;  1W6Q A;  5CIS A;  2QQJ A;  4N9H A;  1WWY A;  4C90 A;  1M06 G;  1AL2 2;  2DF7 A;  4W65 A;  1G8W A;  5JXH A;  2I74 A;  1A8M A;  2W47 A;  3T4V A;  4TWT A;  4AEJ A;  1GZT A;  1QQP 3;  3LA2 A;  4WZC A;  1MS3 A;  3FLT A;  1QJY 1;  3WW3 A;  4QX8 A;  3AP5 A;  2W91 A;  4PQQ A;  3ZDS A;  1XC6 A;  2WS9 2;  2WII B;  4Q4V 2;  3LAG A;  5FZ6 A;  2WNU C;  3MLJ A;  3FWE A;  3U07 A;  1NZI A;  2QDN A;  2TEP A;  2J1T A;  4IGP A;  4SLI A;  2VW2 A;  1QMJ A;  4DUW A;  2VPV A;  2YFU A;  3KV5 A;  4ZXE A;  4GMP 3;  1SBF A;  2ZGU A;  3AX4 A;  2GU9 A;  5CG9 A;  5GKA C;  4EE2 A;  1UD1 A;  1X8E A;  4MH0 E;  4CPB D;  1WW6 A;  2EXI A;  5FWE A;  5IJR A;  5IVJ A;  2UYA A;  3DGT A;  2JJ6 A;  3HPN A;  4Q1R A;  3KV6 A;  5GZD A;  1VBA 2;  3FLP A;  3CKH A;  3U4X A;  2CL2 A;  2XJU A;  4LOT A;  2OQ6 A;  2JEN A;  2BTV C;  2PHT A;  1KJL A;  4QQO A;  1S0C A;  4P5Y A;  1JW6 A;  4SBV A;  4UXA A;  2VZ3 A;  5K4L A;  3AZX A;  4LNV A;  2B4K A;  2VTX J;  3BUC A;  2ZML A;  3O0W A;  2ZGM A;  2HWE 2;  3WQ7 A;  5A3M A;  4CXX A;  3H3Z A;  5A70 A;  5A7W B;  4EZH A;  3GYD A;  1CAU B;  5JOZ A;  2X10 A;  3EJK A;  1RUG 3;  3BN6 A;  2VD7 A;  2H0B A;  1QDO A;  4KWJ A;  4XIO A;  3RNS A;  3WF4 A;  5KR7 A;  3MEP A;  5FBZ A;  4CDX B;  5C33 A;  1DZT A;  3PJY A;  3UES A;  1SDW A;  2YV8 A;  2ZEW A;  5JZG B;  5JLV A;  4GAL A;  3USS A;  4BCU A;  1LGN A;  1UMI A;  2IVJ A;  4WM7 A;  3OB8 A;  1UXX X;  1ZA7 A;  4GXL A;  3MLL A;  1WME A;  1U5Y A;  3KGL A;  1W3V A;  2JIG A;  4AE2 A;  2A6V A;  4HMZ A;  5E1R A;  4OUL A;  5BNO B;  5F37 A;  1RUN A;  1I5P A;  2VZU A;  1RUI 3;  2C26 A;  2JG9 B;  5C9A B;  5FK8 A;  1BZW A;  4CEW B;  3THC A;  3T08 A;  3POF A;  1XE8 A;  1KIT A;  1CWP A;  1HLC A;  2B9U A;  3PUA A;  3VD7 A;  1Y9Q A;  2A70 A;  1F35 A;  4NJ4 A;  1MZ6 A;  3NV4 A;  3HNB M;  1ZBA 1;  4QXH A;  5J37 A;  1RVF 2;  4Y1Y A;  1W8N A;  4YGD A;  1JYX A;  3RPQ A;  3IIA A;  1GP5 A;  1KEX A;  1SG3 A;  3N7J A;  4JDN A;  2TBV A;  5FOJ B;  3J7M A;  3WNM A;  1VBD 2;  2PYT A;  2VNR A;  1H2K A;  1QEX A;  2C24 A;  2F4L A;  3III A;  4PLO A;  3RG0 A;  3MGU A;  3H8R A;  2FDJ A;  1H9W A;  4UOJ A;  5CFD C;  2VZQ A;  2V5Y A;  5C3S A;  4Y3O A;  5DAV A;  1IQA A;  5FJH A;  3T1M A;  3P5B A;  1EAH 1;  3WLU A;  1COV 3;  2VOW A;  5JAX A;  2O0O A;  2J7M A;  1HB2 A;  2JDK A;  3C7O A;  4JZR A;  1W04 A;  2W87 A;  1GWM A;  2ZPX A;  3NV2 A;  5DZG A;  5A3T A;  4DUV A;  4FQZ A;  4ASK A;  1PIV 3;  5LZ6 A;  1J1L A;  4JRL A;  1ASJ 3;  4P9J A;  4HSJ A;  4BM8 A;  4Z82 A;  1E5H A;  1FNZ A;  1HV1 A;  4UF0 B;  2FCT A;  2DCK A;  4RGG A;  1RUF 3;  5FZE A;  3V0A A;  4Z8B A;  4XEZ A;  2VUC A;  1BBT 3;  1D2S A;  1OLM A;  4K8F A;  4RS5 C;  2CTV A;  4AVT A;  4Q4X 2;  4IV1 C;  4OYU A;  3ZN5 A;  2OVU A;  3H7J A;  1AYM 3;  2HWB 2;  3ROU A;  5L9V A;  1QIQ A;  2WNV C;  3OBZ A;  2PHR A;  3V65 A;  4XUQ A;  2ZEZ A;  2XG3 A;  2EA7 A;  3N9P A;  4FOV A;  4AI0 A;  3PIG A;  1HXS 3;  2VQA A;  2XML A;  4XXA A;  1TNF A;  5FIX A;  5FYC A;  4YZ3 A;  4ATF A;  2GDF A;  1UY1 A;  2K9Z A;  1XU1 A;  3I2F A;  2VG9 A;  4LLO A;  5CIR A;  1ENQ A;  4LE3 A;  1QGL A;  3UT0 A;  4LO6 B;  3O1P A;  2A5Z A;  1VBE 2;  4FP2 A;  4XIK A;  2YPD A;  3X29 B;  5AC9 2;  4FPE A;  2JWP A;  4Z1V A;  4WM7 B;  2CNA A;  5IK8 A;  4MGS A;  3T0D A;  4OMC A;  5LBF A;  4DPN A;  4JGY A;  4AOC A;  2E7A A;  5D8A C;  1SQ4 A;  2O1Q A;  3LGR A;  3LSE A;  4IEW A;  3KCC A;  3HMY A;  2P3J A;  2JG8 A;  4QX0 A;  1RUH 2;  2JG9 A;  1N1T A;  1RUG 2;  1WCQ A;  2JD9 A;  3A4U A;  1LJ7 A;  4L9B A;  5DQ0 A;  1PMJ X;  4IV3 A;  4LHK A;  5JZG C;  1RHI 1;  2OW4 A;  3I2O A;  3LQC A;  1J3R A;  1DHK B;  4XUT A;  3GXU A;  2FCU A;  2ARE A;  4XIL A;  3ENR A;  1W39 A;  4GH4 B;  4BB3 A;  1OQ1 A;  1YFX A;  3MW3 A;  1W6O B;  1C57 A;  1VLN A;  4IEQ A;  5FY8 A;  5H9P A;  1G9A A;  3HNY M;  4XOG A;  5D8A A;  4AFM A;  2WO1 A;  2ENR A;  1RUJ 3;  2UY8 A;  2ZX0 A;  2GH8 A;  4OVE A;  4UWD A;  1SLI A;  1BMV 1;  1S0G A;  1G9D A;  5CKN A;  1VBE 3;  5CKQ A;  4PQ9 A;  2OUH A;  1SAC A;  4AI1 A;  3FFQ A;  4W4Z A;  2WR9 A;  4QX1 A;  5CEH A;  5JSP A;  1GR3 A;  1Q8V A;  2ZX3 A;  3AXD A;  3VBS B;  2E63 A;  2LAL A;  4YW5 A;  1RL3 A;  4GAZ A;  3RRD A;  5KHJ A;  4Y4Y A;  3EHK A;  1XBF A;  4GB3 2;  2VCC A;  3JZV A;  2ZKN A;  2IVI B;  3B3Q E;  5T54 A;  5BNO C;  1C3H A;  3VBH C;  1Q43 A;  4KQ7 A;  3DYP A;  3VKO A;  1YWK A;  4Q4X 3;  2B46 X;  3PVB B;  5M0T A;  1HN0 A;  3RWN A;  1VMJ A;  2ETE A;  2IFW A;  1R08 2;  5FZD A;  5LBB A;  1Y3T A;  2VGD A;  2XXZ A;  1BEV 2;  1PK6 B;  3JQW A;  1S1A A;  1GP6 A;  2XJT A;  1RIN A;  4I0A A;  4RHV 3;  3ZFE C;  1PNG A;  1QNW A;  4W6W A;  5DZE A;  3ZYG A;  1BYH A;  5CAZ A;  1V00 A;  1AR6 3;  1E5R A;  1UZZ A;  2XWJ B;  3L2Y A;  4PIY A;  5FV3 A;  1DYK A;  2O14 A;  5AVP A;  2A7A A;  1RMU 2;  4S2D A;  3SXW A;  5HPO A;  3PUI A;  3O1R A;  3NNG A;  2P4E A;  4NWW A;  1CN1 A;  1YXW A;  3PLQ A;  5F3E A;  5GZE A;  4AGG A;  5DN2 A;  3A23 A;  5BNP B;  4DXR A;  2GP3 A;  4N53 C;  3O1V A;  3I97 A;  2WSU A;  4HVO A;  5J3U A;  4MG2 A;  1ND2 A;  2A73 B;  4QKD A;  2PQQ A;  1VRB A;  4QHZ A;  4Y20 B;  4M3C E;  5DAX A;  1LTE A;  4NO4 A;  2YMZ A;  5ACA 2;  1GKB A;  2VNO A;  2XR4 A;  4AGV A;  2W46 A;  3WXP A;  4BIS A;  1JXN A;  2OT7 A;  5K7P A;  1ODN A;  4PLM A;  3WIN E;  3CL1 A;  1JZ6 A;  5FYV A;  1ONA A;  1DLL A;  4L2N A;  4DO0 A;  3FBM A;  4B1L A;  4DXS A;  2TUN A;  5DAP A;  2JG8 C;  2RDN A;  2W94 A;  3CIH A;  4BIO A;  3WUC A;  1V6K A;  1DFQ A;  4A2U A;  1RUI 2;  4FPG A;  2AZ5 A;  2JKX A;  3PME A;  3AVS A;  3E6D A;  3QH7 A;  3WF0 A;  4WZF A;  1FAY A;  4CU9 A;  1R09 3;  3C7H A;  4QPI A;  1C5H A;  1UCX A;  3TWI A;  4BQ4 A;  2N7G A;  4NRM A;  4FBF A;  1CAU A;  4ERO A;  5I8S A;  1G86 A;  5JXJ A;  4NHM A;  2ZGR A;  4QAW A;  2VZO A;  4DY5 A;  3GF6 A;  4P14 A;  3ZVX A;  1S0B A;  2J1E A;  4Q4W 3;  5DDJ 1;  2QZ2 A;  4N53 A;  2NMO A;  4AVS A;  4XAB A;  1BLZ A;  4UFL A;  5GLW A;  1POV 0;  3BVC A;  4XQ4 A;  5ABJ B;  1FX5 A;  1PX4 A;  2QKD A;  2VO5 A;  3FN9 A;  3K3N A;  5E88 A;  2P5B A;  4WV8 A;  4JTN A;  1B35 B;  4UI9 L;  2VQT A;  3TOJ A;  4XCA A;  4K6B A;  2DBI A;  3QCW A;  5BNO A;  2AUY A;  1AHS A;  4A7K A;  2ARX A;  2D93 A;  3ACI A;  2B9V A;  4ATE A;  1UIJ A;  2VY0 A;  5C9A A;  3MBW A;  4CP9 A;  4QPY A;  4ITC A;  1PK6 A;  4L11 A;  3A21 A;  5LEK A;  2P3K A;  2PAK A;  2UYB A;  4MVT A;  5I91 A;  1RUH 3;  2XDV A;  3ST7 A;  4GH4 C;  4FP3 A;  2X5I C;  3WF2 A;  4D7S A;  1ZBA 3;  3S5Q A;  1I1E A;  2J42 A;  4LXL A;  3WDU A;  4FI9 A;  4RL7 A;  5FRA A;  3I4I A;  4K40 A;  5CFD A;  4KGQ A;  1Q8Q A;  3V56 A;  3NQH A;  3TN9 1;  2QTW B;  5AC9 3;  2PFW A;  1VAM A;  1ND2 B;  2HEV F;  2B39 A;  2WNU B;  1PVC 2;  3POY A;  2JDY A;  1KDM A;  1LU2 A;  3PIJ A;  4M4P A;  5C8C B;  5F9T A;  2R07 2;  1MS8 A;  3ZXG A;  4UAP A;  4D7Y A;  1BKZ A;  1IHM A;  2D6M A;  3VBS C;  2TNF A;  4RD7 A;  4PF5 A;  4IEO A;  2OPK A;  3GHN A;  1P8J A;  1DYP A;  1N47 A;  2FHR A;  3ZMN A;  3K2O A;  4HXC A;  1KJR A;  4JGY C;  5T5J A;  5L7O A;  3EBR A;  4ZXK A;  3CO2 A;  5HI0 A;  1F8V A;  2R07 3;  2V5D A;  5FO9 B;  3NNF A;  3PUR A;  2Q5T A;  5DAB A;  1H30 A;  5KC6 A;  1U12 A;  1BK1 A;  4ZHN A;  2NN8 A;  5JMO A;  4BWO A;  2YC4 A;  2GAL A;  3WDW A;  3HEI A;  4N9I A;  4Y1U A;  4AAX A;  2HWF 1;  1R08 1;  4BZ4 A;  4QGN A;  2Y0O A;  1VRH 3;  3HQU A;  4C91 A;  3KQR A;  1CON A;  3DV8 A;  3ATG A;  2CGO A;  3BB6 A;  3ZIW A;  4V1P A;  2AEZ A;  4YWA A;  1YJK A;  1XNT A;  3VDD C;  2J1S A;  2I2S A;  5FZO B;  3ZFF A;  2O8Q A;  2DFC A;  5FMB A;  5G04 L;  2R1D A;  4COU A;  4CP1 A;  3O1T A;  3GM8 A;  3T2T A;  4R9C A;  1OKQ A;  2GC0 A;  3PDQ A;  3JD7 2;  2YU2 A;  4R52 A;  2BER A;  1WMX A;  5JUV A;  5LA0 A;  4XUP A;  3VBH A;  4MX3 A;  4S2F A;  2JDA A;  1R1A 3;  3HR9 A;  2V4V A;  4XVH A;  4AK3 A;  2G4I A;  5GLT A;  2DDU A;  1OVS A;  3AC0 A;  3FHA A;  1XRU A;  3ZN4 A;  1NT0 A;  4YYO A;  4O9G A;  3RS6 A;  4HKW A;  1WLT A;  4JKL A;  4F8A A;  3LKJ A;  3LA3 A;  1RTV A;  2D5F A;  5FZK A;  1YJL A;  1RUH 1;  2ZZJ A;  1UY4 A;  3E5U A;  3ELN A;  3IMN A;  4GKY A;  4RGA A;  2FZ2 A;  4AQ2 A;  2YPJ A;  3HQX A;  2P37 A;  1BCX A;  3I59 B;  4OFG A;  4OZX A;  4QPI C;  3KV9 A;  5FZ4 A;  2ZGP A;  5A6Z A;  1CAV A;  4Q4Y 3;  1MZ5 A;  5FYS A;  5IVC A;  2WUH A;  2ZEX A;  3CU7 A;  3OD0 A;  4URA A;  2QVS B;  4NHK A;  4FPL A;  3P3P A;  4P5H A;  1GOF A;  4YNI A;  4BOW A;  4CYD A;  4YRD A;  3AL5 A;  1ZYB A;  4GWN A;  3ZXE A;  4LBO A;  4P08 A;  4GUL A;  3TEW A;  1ZZ6 A;  1PHM A;  4PDW C;  1OUR A;  2XJQ A;  5LAS A;  2VTX A;  2WZ8 A;  4YG3 A;  4M4R A;  3AJY A;  5L7O B;  4XF3 A;  2ZAH A;  4IV1 B;  1K5J A;  4L99 A;  1NQJ A;  1WLD A;  3RMX A;  1J58 A;  4B7K A;  5F39 A;  2D6O X;  3WUD A;  1N3P A;  2QQK A;  1LOE A;  2QQN A;  4N43 C;  2DWR A;  3LOI A;  4NII A;  2PEL A;  1RIR A;  2FCV A;  2EVX A;  3J8F 2;  3RI9 A;  3RZG A;  2IXC A;  5IFT A;  3DYM A;  1RUE 3;  1NY7 1;  1W8O A;  2D3R A;  3ZSE A;  1LRH A;  1OQE A;  1OA3 A;  5KXB A;  1JH5 A;  2CU5 A;  2QFE A;  1IPS A;  3WF1 A;  3ZMO A;  4URT A;  1H1A A;  1CD3 G;  2ZKL A;  1RXF A;  2JD4 A;  2P1B A;  3LB9 A;  1KQR A;  4XFF A;  4DIQ A;  1W6M A;  3AKR A;  5JOY A;  3RZL A;  1ULF A;  2Y0I A;  1BEV 3;  5FYI A;  5FRE A;  5C3R A;  2C0Z A;  2EXJ A;  3IDB B;  4PHZ A;  4AEK A;  1PVC 3;  4Q5O A;  3RYR A;  2CY6 A;  3MF9 A;  4P00 B;  3FLR A;  3PVN A;  4OI0 A;  2ZMN A;  2C6S A;  3GZT B;  1VBD 1;  4QM8 A;  4AI8 A;  2ZGT A;  4ZZ8 A;  1PO2 2;  2BVB A;  4MGQ A;  1GWK A;  5BNN C;  1ZRD A;  1ZBE 3;  1AR7 2;  1WCK A;  3UKV A;  2XJR A;  1WZX A;  3ZXF A;  1GIC A;  2JDP A;  3JBG 2;  2GME A;  5IAV A;  3U37 A;  3RWK X;  5J1X A;  4N90 A;  3FHI B;  1FOD 1;  1GQH A;  3OPZ A;  2ZX4 A;  3G7D A;  4M0N A;  3JU9 A;  4XTP A;  2ET1 A;  2P3Y A;  4N43 A;  1QJU 3;  4QHO A;  2Y6L A;  5H9Q A;  2DU0 A;  1N1V A;  1HQL A;  3T30 A;  5F3G A;  1C28 A;  2EAK A;  2RS1 1;  2BGC A;  2Y33 A;  1W05 A;  2Q8C A;  4OHW A;  3WCR A;  1CAV B;  1O4Z A;  4LOR A;  4AI2 A;  4CCO A;  3D0J A;  1QXP A;  3U10 A;  4WM8 B;  4DEV A;  1NY7 2;  1R64 A;  1HXS 2;  3J7H A;  4HBN A;  4Y5S A;  2Y8K A;  2VMF A;  4PDW B;  4Y5Z 0;  5FZH A;  3TB0 A;  3U1X A;  1C1L A;  5K0U C;  3WD5 A;  5JWP A;  1V9U 3;  5ABJ A;  1JBC A;  3KVB A;  5J98 B;  4E4H A;  4D94 A;  5IYY A;  2BGP A;  1MPX A;  2BQP A;  5K0U A;  3U75 A;  4CUA A;  1HV0 A;  2R30 A;  4QDR A;  1BBT 2;  1N1Y A;  1NLS A;  3H8U A;  2GAU A;  1AR9 3;  3CJX A;  1XOY A;  1TNR A;  3AP4 A;  3GBW A;  4LBQ B;  4XW3 A;  4DFS A;  5K8S A;  2VQ0 A;  2IC1 A;  4GIQ A;  1UOB A;  1ZVF A;  4ARX A;  4NPL A;  1QJY 3;  2PHW A;  2YUE A;  3WNP A;  1FOD 3;  5JIU A;  3OGG A;  1KFX L;  1QJX 3;  1WA4 A;  2WFF 2;  5EJ1 B;  5FTT C;  4BU2 A;  1VBA 1;  3BOP A;  3N9M A;  3R4D B;  2FDI A;  4CXY A;  2HWD 3;  5DAQ A;  2ZGK A;  3VKM A;  4UT5 A;  1PK6 C;  1TME 3;  2DYC A;  3ON7 A;  3WDY A;  5FKB A;  4LPL A;  3AYD A;  1UKG A;  1EPW A;  1QNY A;  2VAU A;  2EAL A;  3ZKY A;  1AJK A;  1CR7 A;  3WEZ A;  3ZFE A;  5FZA A;  4KI5 M;  4YZ5 A;  2UY9 A;  1LOF C;  1W2U A;  2HLE A;  2WWU A;  3FMG A;  5B2G B;  2HWC 1;  2XPJ A;  4V2V A;  2JKB A;  1QJF A;  4B29 A;  2RJL A;  3H8X A;  4IER A;  2VZ1 A;  2YC2 A;  2Y26 A;  3H9A A;  2HWD 1;  4E4D X;  2OUJ A;  5DAW A;  3VBR C;  4FPO B;  2ZCW A;  4Q4V 1;  4KBZ A;  5HV4 A;  1JOJ A;  4AFA A;  4AW7 A;  2JB8 A;  3SCF A;  2HEY F;  1YFY A;  4B4R A;  1I6X A;  1NQD A;  4YW1 A;  3C7G A;  1AXK A;  4N43 B;  3VHO A;  1AUY A;  3BKZ A;  1SMV A;  3Q8A A;  4RR3 A;  5F6L B;  1RHI 3;  2Y64 A;  1X9P A;  5IVB A;  3VD9 A;  1IKQ A;  4FT8 A;  5FXW A;  5A7N A;  3KT7 A;  3ZN6 B;  4Q4V 3;  3TEZ A;  3RZK A;  1VBB 3;  5LAT A;  2D3P A;  4AFB A;  1NCQ C;  1H4G A;  1IS6 A;  1YEW A;  2JIC A;  3LFM A;  4I30 A;  1NUK A;  2A3W A;  4NHY A;  2XL7 A;  3SIS A;  4EN8 B;  1UYP A;  3K4A A;  4PDW A;  1OPM A;  4XDQ A;  4LJH A;  4J25 A;  4O65 A;  2WSV A;  4JVA A;  1ASJ 1;  3PTY A;  3ZFF B;  1H2M A;  1UX6 A;  2ET7 A;  1XNA A;  4ZU5 A;  1DQ0 A;  3UET A;  4D7T A;  3DF0 A;  2P2K A;  1SLA A;  1AXY A;  2H0V A;  5I93 A;  4AF9 A;  2VH9 A;  4Q0Q A;  3WW2 A;  4XJA A;  4IES A;  4ZON A;  5FP3 A;  5F7U A;  2EID A;  3VBH B;  1DLC A;  2C4X A;  4JHZ A;  2WNV A;  3VGI A;  5JI9 A;  2DBN A;  2Q8O A;  2I07 B;  3SH5 A;  5JSO A;  5TSW A;  1YIP A;  3B94 A;  5FXZ A;  3TBD A;  3NJZ A;  1W9Y A;  4YGE A;  1GZ9 A;  2YDE A;  4COZ A;  3S7E A;  1LEC A;  4RS5 A;  3OBA A;  1QJZ A;  5A7Q A;  3I2J A;  4Y24 A;  3TN9 2;  1XSR A;  1W8T A;  1AR6 1;  2QDR A;  1W6P A;  3OGS A;  2J1R A;  1V6O A;  2A6Y A;  2H6B A;  3J7N A;  3POW A;  4E27 A;  3N4M A;  1HJG A;  4QQL A;  5FYM A;  2B45 X;  2VOV A;  5IVE A;  4ET7 A;  4CDU B;  1N1S A;  2BYV E;  4M3C A;  3WX5 A;  5ANQ A;  3W5M A;  4QQ2 A;  3KF3 A;  2BNM A;  3HQR A;  3KVA A;  3OEB A;  1QOS A;  3ZFG B;  2BV4 A;  2OX0 A;  2YC0 A;  1FMD 3;  1NYW A;  4WVW A;  2WFP A;  3T09 A;  5LA2 A;  3ZSL A;  2PHD A;  3L2H A;  4HG6 B;  4V2W A;  4EN0 A;  4TLF A;  4AED A;  2SLI A;  3NRU A;  4CDW B;  5A3L A;  5BNQ A;  5J48 A;  4HN1 A;  1XXN A;  3SH4 A;  1YQ2 A;  3WV6 A;  1UXZ A;  3WG4 A;  1RUF 1;  4YGB A;  2E31 A;  2G9Z A;  2YYO A;  3URF A;  2FBE A;  2GSY A;  4AQS A;  2Q30 A;  2MEV 3;  5EYY A;  4CRQ A;  1IS3 A;  3NV1 A;  4LEJ A;  3TNQ A;  3AMM A;  1RUF 2;  4BQW A;  1GU3 A;  2A3X A;  2O8O A;  2WS9 3;  2FDG A;  1MEC 3;  1DGW A;  3PMS A;  3WNX A;  1D4M 1;  1REF A;  3HIF A;  2VUJ A;  1W28 A;  2WT0 A;  1CQ9 A;  1W6M B;  4XJ8 A;  5DUV A;  5GM0 A;  5C71 A;  3ZPY A;  3WHT A;  3ACF A;  5APA A;  1W6Q B;  2OKX A;  2Q4S A;  5BUV A;  1F5J A;  2RJK A;  3BTY A;  2FDF A;  4CPB A;  4M0H A;  4HK9 A;  4I0B A;  5A6Y A;  1S55 A;  3RZZ A;  1SBD A;  2ZGN A;  3KWV A;  1GMM A;  2BOJ A;  2HEW F;  3BCW A;  5I8T A;  3KV4 A;  1S4C A;  3VHN A;  2VUD A;  2WQZ C;  1B35 C;  1LHW A;  1NCQ B;  4GB3 3;  1AR6 2;  1X82 A;  1KFU L;  2BBV A;  5FXX A;  5ACA 1;  2VXR A;  2NQY A;  4Y33 A;  2BW8 A;  4GWM A;  2Q1F A;  1A8D A;  1MZF A;  1RED A;  3MFC A;  3W5N A;  3OOX A;  2V4A A;  2MEV 1;  3EO6 A;  4YG6 A;  1SPP B;  1IPJ A;  1RUJ 1;  4XUR A;  2RS1 3;  5J96 B;  3OGR A;  1CIY A;  3WSO A;  2XQX A;  1SLT A;  3ZXD A;  1MEC 1;  2ID4 A;  1UU6 A;  2PLV 2;  2FMD A;  3VBU A;  1MVE A;  5FY4 A;  1BXH A;  3ZDV A;  4E8D A;  4DXZ A;  3BIW E;  1CX1 A;  1KRI A;  2VMC A;  5HCA A;  2X53 S;  2YBP A;  4K8R B;  3LE0 A;  4GWI A;  1CAX B;  5FMC A;  5JR2 A;  4RA0 A;  4Y22 A;  3R0R A;  4H14 A;  5C8C C;  3RJR A;  2LRO A;  2ZHM A;  4IGO A;  4QKF A;  2BFU S;  2OPW A;  3RJ2 X;  5EJZ B;  2HJI A;  1MVQ A;  1DQ6 A;  1W90 A;  4Q1P A;  5EFU A;  3AMH A;  2W1Q A;  1PMH X;  1F31 A;  1OT5 A;  4GB3 1;  2ZHN A;  4UFJ A;  5C4W A;  4AZZ A;  1ENS A;  4EYU A;  1ULC A;  4LKF A;  1FNY A;  1IG0 A;  1F5F A;  5EQU A;  3VDA A;  1O4Y A;  3IDC B;  3AZV A;  3F95 A;  4JQT A;  1V6J A;  1U5X A;  2A3Y A;  4CXW A;  3OBR A;  4G3Y C;  5KXC A;  1X9T A;  2XHN A;  1Y7B A;  4G9S B;  4U2A A;  5I0U A;  1OFN A;  3MID A;  1NE4 A;  3FE5 A;  3VKN A;  2VW0 A;  1BMV 2;  4F3J A;  2OYZ A;  1IOA A;  2WLP A;  2Z2S B;  3H42 B;  1NX9 A;  3IM0 A;  1GBG A;  2YB7 A;  4LHL A;  4QX3 A;  3T2O A;  1O91 A;  4O9E A;  5KBF A;  1U5I A;  1DYO A;  3SQO A;  3MW2 A;  3NV3 A;  2R0H A;  3I54 A;  2A1X A;  2G9G A;  1WD4 A;  2HWC 2;  3UGH A;  1XYN A;  1O6U A;  1IS4 A;  2ES3 A;  2IFR A;  3CJI A;  3OUI A;  4P9L A;  1RHI 2;  4WBB A;  4YW4 A;  3ZKU A;  1F15 A;  3SNM A;  1DIW A;  2K46 A;  1YI7 A;  4NR1 A;  1SZB A;  2YXS A;  4OZO A;  4ONU A;  1QHD A;  1YQ8 A;  5A3O A;  1DZR A;  1VBC 3;  2QJV A;  4QB6 A;  4JAA A;  4FTB A;  4IEP A;  3UJO A;  4EWD A;  4BK4 A;  5D1I A;  2WAO A;  1OLM E;  4H7M A;  2WN3 A;  4QB2 A;  1AYM 2;  3USU B;  3WNO A;  3AMQ A;  1JOB A;  2EIC A;  1R09 1;  2UU8 A;  4B3N A;  2BEO A;  1XNC A;  1A6C A;  5AC9 1;  4KNC A;  4RR3 B;  4L8Q A;  3NKG A;  4L0P A;  2RS5 1;  1GQP A;  4KU8 A;  2QQM A;  1Q8O A;  3HBK A;  5G05 L;  4LK7 A;  4TTG A;  1ULD A;  3BTZ A;  4AHY A;  1UQX A;  4W50 A;  1JTZ X;  2UUR A;  4XHB A;  3SMH A;  5C8W A;  4G4F A;  1IS5 A;  1JZ3 A;  3MIC A;  4AHZ A;  1K3I A;  3K4D A;  4XE9 A;  4FTE A;  3WQ0 A;  3MZH A;  1CAW A;  3NAP B;  3CF6 E;  2D44 A;  5FLJ A;  4DQA A;  1T2X A;  4NIG A;  1HXS 1;  4MXW A;  1LOB A;  2JDZ A;  1O8S A;  1Q5O A;  2VCM A;  3MF6 A;  4FFH A;  1AZD A;  1IG3 A;  2QQI A;  3DEC A;  5L73 A;  4COV A;  3UNP A;  4XDO A;  4JC1 A;  4RHV 2;  1RVF 3;  2P6H A;  2EXH A;  2ZTN A;  5A80 A;  2VXJ A;  2DU1 A;  5FUN A;  1QF3 A;  5FDB A;  5LCW L;  4P9X A;  3ZM8 A;  5L7O C;  1R08 3;  4WVZ A;  2DCJ A;  1WW5 A;  2W5F A;  4WVM A;  1QOO A;  1W06 A;  4N8M A;  1OH4 A;  1EAH 2;  3K4Z A;  1CJP A;  2YY1 A;  1W2T A;  1FOD 2;  3B93 A;  4KL1 A;  4XJU A;  5CA6 A;  1AJO A;  1PGW 1;  1YQ6 A;  1LGB A;  2WYF A;  3AZY A;  1Y9M A;  4DEQ A;  1CPN A;  1K5M B;  4AVV A;  1AR7 1;  1HRI 1;  3UV9 A;  1AR9 1;  1J1T A;  2DVA A;  1QWR A;  1PO2 1;  5IK4 A;  1AR9 2;  3BTA A;  3OPW A;  2JG9 C;  3TN9 3;  4IEX A;  3S57 A;  2D43 A;  3LIG A;  3K77 A;  4B4P A;  1J59 A;  1A78 A;  1EV1 3;  3VZM A;  3NJX A;  4YVW A;  5IAX A;  5IW0 A;  4Q8K A;  4FXK B;  5A3P A;  2ZEY A;  4IV3 B;  2VBB A;  3ZFG A;  1ZRE A;  4QHB A;  3TEY A;  4M3C F;  1JOD A;  1DBN A;  1HRI 3;  4GH4 A;  2RS3 3;  1W6O A;  1UKR A;  2A75 A;  5I0D A;  1MQT A;  3ITQ A;  1VPH A;  2FQP A;  2RM2 2;  2HBT A;  2NYY A;  3IDA A;  4XUN A;  5BNN A;  4KH9 A;  3Q9O A;  1GUI A;  3QH6 A;  1J84 A;  3CDZ B;  4OLL A;  5FLH A;  3KLS A;  5FZC A;  3BTX A;  2ARB A;  2OS2 A;  3J8F 1;  1EY2 A;  4LO5 B;  1WBF A;  1JHJ A;  1EP0 A;  2JDN A;  2V09 A;  1DQ2 A;  4L92 A;  2JX9 A;  1CPM A;  2HYK A;  3HBZ A;  4PI0 A;  5J09 A;  2VR4 A;  3JB4 C;  1LOD A;  1VBB 2;  2GC3 A;  5CNA A;  1VE0 A;  2Y6H A;  3ZFF C;  4CP2 A;  5C7G A;  1NA1 C;  4FPJ A;  3LOB A;  1F4H A;  1DQ1 A;  1HB3 A;  2LM3 A;  1MS9 A;  1NCR A;  1H6Y A;  3LWC A;  4AG4 A;  2HWE 1;  2XON A;  1JYC A;  3FUQ A;  2EIG A;  3GJB A;  3NAP A;  1IQD C;  3G6J B;  5FPB A;  4JGZ C;  1E5S A;  2WO2 A;  5CAD A;  5IVF A;  3VBO B;  1RIT A;  3I3Q A;  4FSJ A;  5A1L A;  2RJ2 A;  3JCI A;  4CZS A;  4LQR A;  4JX0 A;  4XMA A;  4P9Y A;  5FR3 A;  2D7F A;  1NCQ A;  3LF7 A;  3PL0 A;  1W9W A;  2HKX A;  3ZXA C;  1ND3 C;  3FX3 A;  1H4H A;  1I3H A;  3M2M A;  3WW1 A;  2WZP P;  5IK7 A;  1ND3 A;  1JS9 A;  4OUE A;  5LA9 A;  4E2Q A;  5GLV A;  5FOB B;  2YG0 A;  5DDJ 3;  1VIW B;  1UOF A;  4MXV A;  4FFF A;  3DKW A;  1JHN A;  5FZ3 A;  2WRA A;  4I09 A;  1SPP A;  1UO9 A;  4UFH A;  1L7R A;  4MHR A;  4HOO A;  2FD8 A;  5EPA A;  5GLU A;  1W8F A;  2F6B A;  3IAP A;  3O12 A;  4QDQ A;  1OI6 A;  3O5S A;  5DZF A;  2DTY A;  3JD7 1;  5BYN A;  3HT2 A;  3N9N A;  4HFS A;  4KU7 A;  3POI A;  4QD2 A;  2SBA A;  1LOG A;  4XJZ A;  3NO8 A;  1Z0H A;  3VKL A;  4AL9 A;  4IUG A;  1W0P A;  4BK5 A;  2XQR A;  4AVA A;  2WNE A;  3M3O A;  4R8H A;  2ZXQ A;  4IGQ A;  5I0S A;  1H8T C;  2Z69 A;  4ZU4 A;  1LUL A;  5FPU A;  3JD7 3;  1HRV 2;  2RMU 1;  1UMZ A;  4W8J A;  4CVU A;  2ZZQ A;  5HXM A;  2DVG A;  4I02 A;  4QB1 A;  2HWF 2;  4GMP 0;  4QU1 A;  4IEU A;  4XXP A;  5F3I A;  5A7P A;  5C4W B;  1VJ2 A;  1I9R A;  1W0N A;  2R04 3;  4C8D A;  3DL3 A;  3T3Y A;  3E6B A;  4E2G A;  1XND A;  3BAL A;  3KB5 A;  3VL8 A;  3I2K A;  1Z78 A;  3VDD A;  4XQD A;  4MV2 A;  4Y4R A;  1OD5 A;  4X6Q B;  3OYW A;  4BQ3 A;  1EYB A;  1MEC 2;  1B35 A;  1UOJ A;  3AKP A;  3E5Q A;  4B8E A;  4ISQ A;  2OII A;  4MGT A;  5T52 A;  4LUK A;  1SFN A;  4HPK B;  3IMM A;  1GNY A;  2WIN B;  5FPX A;  4UBH A;  2MEV 2;  1R1A 1;  1YI9 A;  5JPN B;  3Q8E A;  3Q8C A;  2R06 2;  2YBK A;  2XH6 A;  5CYY A;  1PVC 1;  2Y6K A;  3ZOI A;  4CDQ C;  2CDO A;  4OUS A;  4R4X A;  3B02 A;  5FJK A;  3SEE A;  1D4M 3;  4MZU A;  1VB4 A;  3OSD A;  3VBF A;  1UY0 A;  4YZ4 A;  3W58 A;  2ZHL A;  4JDO A;  3B01 A;  4QPW A;  4WM8 C;  2XWB B;  1DQ5 A;  3U11 A;  4Z2A A;  2B7Y A;  2DTW A;  2RMU 3;  3FJS A;  3LDR A;  4P9I A;  3USU A;  4IE0 A;  1Z7S 1;  4CUC A;  3I3E A;  3RSJ A;  1GZW B;  2DUO A;  2LRP A;  5E16 A;  4EWA A;  5A3U A;  3KM5 A;  4O61 A;  5IUQ A;  1LEM A;  1V6N A;  4ES9 A;  3BIE A;  3T4H B;  2Q1M A;  5C8C A;  1YNA A;  5IAT A;  3VZO A;  2YGL A;  1CZV A;  3J26 N;  4FOY A;  1UYY A;  2HWC 3;  4BMB A;  1ZRI A;  1X50 A;  2JDM A;  2WKK A;  1C1F A;  3D8C A;  4TSV A;  3VD3 A;  1SCS A;  5H9R A;  1OXC A;  3ZIX A;  2E26 A;  2JB4 A;  1G9F A;  1LHN A;  1OOP A;  5LBC A;  3S6P A;  1LGC A;  5FYH A;  3WNK A;  4YW6 A;  3TNP B;  3VBR A;  5BV6 A;  2JEM A;  5FZ1 A;  5FZG A;  1PM7 A;  1NE6 A;  2Y6J A;  1H9P A;  1X33 A;  2CSG A;  3CBN A;  4IET A;  3FUO A;  4NHX A;  4COY A;  2BWC A;  1FI2 A;  1AXZ A;  3KS7 A;  5DUU A;  2QNK A;  5A7W A;  5CKM A;  1PO1 1;  3VBU C;  1J3P A;  2WC2 A;  4JTO A;  3Q8F A;  1ZRC A;  4UYB A;  4IEV A;  2PHU A;  4CEY C;  1MS0 A;  3CZJ A;  4DUX A;  2QQW A;  2AYH A;  4WVM B;  3ZYP A;  3AYC A;  3N7L A;  2J1A A;  3ES4 A;  4LKD A;  4MET A;  5H9S A;  4RGK A;  1RC6 A;  1PX3 A;  2E51 A;  1CX4 A;  2VZR A;  2ZGQ A;  1COV 1;  1OFS A;  3SCG A;  4NVP A;  3UGF A;  5CG8 A;  1UU4 A;  5E8A A;  2FDK A;  4P9G A;  4S2G A;  2UWA A;  3QOP A;  5FYB A;  1GAN A;  2FDH A;  4CEW A;  1VAL A;  5D2A A;  3ME2 A;  2ATF A;  1UZW A;  4BDV B;  1TME 2;  2QBX A;  5FQ0 B;  1ACC A;  4A45 A;  3ZR5 A;  3O14 A;  1UZV A;  4UFK A;  3UKT A;  5F2W A;  5A6X A;  3BI3 A;  3GBF A;  2DUQ A;  3ACG A;  2ZA9 A;  5HV0 A;  5FPZ A;  5JXG A;  1XYP A;  2CDP A;  1RXG A;  3VUO A;  3C8X A;  1WBL A;  2BOI A;  2CGP A;  2C9K A;  4BQY A;  3KZ4 C;  4AYU A;  4BA6 A;  1JZ7 A;  1Q8S A;  3VZN A;  4CEW C;  1GZW A;  3E6C C;  4YG0 A;  5C4W C;  4KWK A;  3LEM A;  3ZSK A;  5E89 A;  1ASJ 2;  1ZRR A;  3D82 A;  4R4Z A;  1LOA A;  4BPZ A;  5EYX A;  1OPO A;  4LLF A;  3QLQ A;  2EIB A;  2VZS A;  1SBE A;  5EZW A;  2KXL A;  1C8N A;  2B5H A;  4KWU A;  5KXE A;  3SIT A;  2E6V A;  3R6S A;  4TLG A;  1ULP A;  2CAU A;  3ECQ A;  4LA3 A;  1HN1 A;  4QQP A;  1FPN 1;  4AVB A;  4YZ1 A;  1VMF A;  4MUV A;  4U36 A;  4IV1 A;  2ADE A;  2DUP A;  1DGL A;  1GLH A;  3ABZ A;  1V6I A;  3B69 A;  3UGG A;  3NJY A;  5AFE A;  5EP9 A;  1AX1 A;  1W9S A;  1KDK A;  3LCP A;  5JIA A;  3VBO C;  3AYA A;  5C9A C;  5LK7 B;  1DZQ A;  4LKE A;  3VBO A;  1HKD A;  2A6Z A;  2VUA A;  4HN0 A;  4Y1V A;  5JMC A;  4W6X A;  1HJF A;  3NJV A;  3LDB A;  2J1V A;  1JYN A;  4D69 A;  4CU7 A;  3V0A B;  4RQP A;  2W2I A;  4XFA A;  1S0I A;  1W9F A;  1PVX A;  2HWD 2;  2XBO 1;  1S0E A;  2XLG A;  4XAA A;  4A6S A;  4FO9 A;  1AR8 3;  1VR3 A;  2WFF 3;  4XF4 A;  1E57 A;  3DPR C;  3OUJ A;  2BP6 A;  4FCA A;  1OLR A;  1RMU 3;  3MV0 1;  3HN1 A;  4XFI A;  3LPG A;  3C2U A;  3BYW A;  1WA6 X;  4GKX A;  3H0O A;  2AEY A;  1RUG 1;  5FP4 A;  3ILF A;  4Q26 A;  5T5P A;  2RR1 1;  4MLO A;  1W6N B;  1ZZ9 A;  3KCX A;  1OD3 A;  2UWB A;  2WZR 2;  3AKQ A;  4I2O A;  3ALQ A;  2WFF 1;  1K5M C;  5HCB A;  5JPM B;  1XE7 A;  2VL4 A;  1KXG A;  4QPG A;  2KA3 A;  4C1X A;  2KM2 A;  2AH2 A;  2RM2 3;  1LU1 A;  4JKK A;  1ULE A;  5KHK A;  1KGY A;  3OUH A;  1TMF 2;  4IEY A;  5D8A B;  5F32 A;  3VB9 A;  5T5L A;  1QJX 1;  1BBT 1;  1EV1 1;  4XF9 A;  3DXT A;  2QQL A;  1ZNP A;  1QH7 A;  4YW7 A;  2GNM A;  5AVA A;  2HWB 1;  4Y1X A;  3K46 A;  3LEK A;  5A32 B;  4S2H A;  3S30 A;  1XNK A;  4N7I A;  3MV1 1;  3ZYR A;  1IPK A;  2R04 1;  2V72 A;  2XBO 3;  4Q4X 1;  2NMN A;  4JGZ A;  4XF0 A;  5C3P A;  2LW8 A;  5FY9 A;  3NKT A;  3ZO0 B;  3NAP C;  2W1W A;  3INA A;  1W8H A;  4CSW A;  3LIH A;  4KBB A;  1S2K A;  1AX2 A;  4IDZ A;  4LR4 A;  5K0U B;  1W2A X;  2QQV A;  3MDP A;  4ZS2 A;  1Y43 B;  1QXJ A;  1OKO A;  3UYJ A;  2RS1 2;  2BNO A;  2X05 A;  1UAI A;  1GOG A;  3B00 A;  4HPK A;  3EQE A;  1NLR A;  3MYX A;  2VEC A;  3H3U A;  4IXL A;  2OQ7 A;  3KCY A;  5FMD A;  1FAT A;  2PLV 3;  4XFH A;  1JUI A;  1ZZ7 A;  3RYP A;  3O1O A;  1YHF A;  4NE9 A;  4LHS A;  4UW4 A;  3VHR A;  1GNZ A;  5FYY A;  3JBG 1;  4AQT A;  4EV0 A;  4CP0 A;  3K51 A;  2BVV A;  1H2N A;  1NZC A;  5GAL A;  1YQ5 A;  3VBF B;  3U4S A;  2D98 A;  4OQ8 A;  3A0K A;  4A6O A;  4XAE A;  2W1S A;  5FAX A;  5BNP A;  2IXL A;  4F7Z A;  3PVO A;  4RSU A;  5FKC A;  1EUU A;  4EN6 B;  1RVF 1;  1US3 A;  3POE A;  3VDC A;  2ZAC A;  4ASL A;  1BHG A;  1UYZ A;  1G9C A;  2Y34 A;  1OA4 A;  3Q8B A;  3AM2 A;  4GZ9 A;  1D7P M;  3ZFE B;  2WLQ A;  4AVC A;  3ZXJ A;  3WG2 A;  2PQS A;  3B5L B;  5F2S A;  3OF1 A;  4NRP A;  3JXS A;  4BXS V;  2L9L A;  3WDT A;  1ULG A;  1W2N A;  1YC6 1;  2VTF A;  3LPF A;  4BLJ A;  4XJW A;  1KS4 A;  3ZSJ A;  5F6K A;  1WW4 A;  2PN5 A;  4LE4 A;  4Y20 A;  2WJS A;  1H8T B;  3ZYJ B;  2CHH A;  2FMY A;  4F83 A;  1SHW B;  2F17 A;  5DG2 A;  3VBR B;  2ZJC A;  5HBA A;  3AMP A;  4QPG B;  4CDQ A;  4E8C A;  2Y6F A;  3P6B A;  4NMI A;  4YM1 A;  5LW9 A;  1YIF A;  4FQ4 A;  3OGJ A;  2HWF 3;  4XC9 A;  3O1U A;  2XJP A;  3B9C A;  2GMM A;  3PJQ A;  3KSC A;  2C9A A;  1SDD B;  2PMW B;  4OUM A;  3IZO A;  5DUX A;  5EXO A;  4HLT A;  5IT6 A;  1MR5 A;  5FXV A;  4TZD A;  1JMU B;  1GFF 2;  5FY0 A;  5L9B A;  3N7M A;  5KHG A;  5A32 A;  1YQC A;  4PI2 A;  4DB5 A;  1LKN A;  1RUD 2;  1QKQ A;  1GV9 A;  3HN3 A;  4FVV A;  3K48 A;  3O0V A;  5BNP C;  2AGS A;  1PGS A;  5F8P A;  1AYN 3;  4N53 B;  5FO8 B;  2R7E B;  1RUC 3;  5JR7 B;  1U5Z A;  5FZI A;  5AFB A;  4LKS A;  5FZF A;  2JE7 A;  3EXU A;  2Q8D A;  1JYI A;  5KC5 A;  5A33 A;  3ILN A;  1OHF A;  1O59 A;  4XYX A;  2VME A;  4JV4 A;  4Q29 A;  1DG6 A;  5LBE A;  1UY2 A;  5KXD A;  5FO7 B;  3VD5 A;  5FPA A;  3UL2 A;  1RUD 1;  5GLZ A;  2DCY A;  2ORX A;  2W52 A;  2ZOE B;  3T1L A;  4CDU C;  3AP6 A;  4ASM B;  4ARY A;  2GMP A;  4YZ2 A;  4QMA A;  3OTF A;  3RYK A;  3TEX A;  3PU8 A;  4GWJ A;  4MGK E;  4CCC A;  4K20 A;  4A3Z A;  3IAQ A;  2VOT A;  5A7O A;  4Q4W 2;  3WCS A;  4CP9 B;  3RGB A;  4UBG A;  2PHF A;  3T2Q A;  4BYY A;  2YU1 A;  2WS9 1;  1F4A A;  1OOP C;  2P3I A;  3LDK A;  3I7D A;  4NHL A;  1G9B A;  1LED A;  3FHQ A;  2Z4F A;  5LB6 A;  1W9T A;  4RFT 0;  1XPW A;  5F5I A;  3VZJ A;  5CBL A;  1PO2 3;  2PA7 A;  2BRT A;  1SFY A;  2DVB A;  5CFD B;  1UZ0 A;  1Q8P A;  4LUL A;  1ZZ8 A;  5FY5 A;  4CCD A;  4YM3 A;  3D5O A;  4HKO A;  2VMD A;  2WNU A;  2JEC A;  4WVV A;  4BME A;  4OHX A;  2UWC A;  3J9S A;  5JSR A;  5DPN A;  4AED B;  3ACL A;  3N35 A;  4CDW A;  3B7M A;  3ZXK A;  4ZY9 A;  3M3C A;  2HYX A;  1D0G A;  5T55 A;  2JXA A;  4CDQ B;  4UW3 A;  2WDB A;  4XPV A;  1D0H A;  2RDR A;  4DRV A;  4H2A A;  3HT1 A;  4IV3 C;  1VRH 1;  2ZAB A;  5FZ0 A;  4LIT A;  2DUR A;  2XLA A;  1QU0 A;  4MSV A;  1RUD 3;  1VP6 A;  3MPP G;  1ALY A;  1U0A A;  1FYU A;  1R1Z A;  3JB8 A;  1VMH A;  4PIZ A;  3GCX A;  1OUS A;  1LCL A;  3J8F 3;  1PIV 2;  5LWB A;  4MOA A;  3LA7 A;  4QX2 A;  3WDX A;  3O1S A;  2ZGO A;  2RV9 A;  2DVD A;  2K2S A;  1YO8 A;  3SHR A;  2R06 3;  1K45 A;  3WDV A;  1RJ7 A;  1W8U A;  2GP5 A;  1UW8 A;  2R49 A;  1T6G C;  3DXU A;  4LK6 A;  4XCB A;  3THD A;  3POG A;  2WWJ A;  2R07 1;  1O3S A;  1LEN A;  3H8O A;  4AHW A;  5T50 A;  5T3N A;  1E5I A;  2X09 A;  1RYY A;  4YSF A;  4D6S A;  1LES A;  2CWS A;  1NCR C;  2YGM A;  2GNB A;  3HWJ A;  2P6C A;  4ZKT B;  3M3Q A;  1LOF A;  1AX0 A;  1VBD 3;  1ZZB A;  2ZGL A;  4CDX A;  4R9D A;  5C5T A;  3WNL A;  5JCT A;  2YHJ A;  3I3D A;  3M1H A;  5ACA 3;  1W6N A;  3HVD A;  3RMY A;  5CZK A;  4XAC A;  4YVS A;  2WO7 A;  1D2Q A;  1GWL A;  1CZS A;  2VOX A;  4Q4Y 2;  2R04 2;  4XFB A;  5BPX A;  3WF3 A;  2W9X A;  2ZMK A;  2Y38 A;  4B7E A;  4XUO A;  4JDM A;  2R0F A;  3AFK A;  3L9J T;  4OI2 A;  3ZLI A;  4ZU7 A;  1H0B A;  4HON A;  1QJX 2;  3PUH A;  4KGG A;  1DP0 A;  1UZY A;  3CZU A;  2IUW A;  4PBO A;  1TMF 1;  5FWJ A;  1W03 A;  4FXG B;  2E32 A;  3IKW A;  1POQ A;  1QH6 A;  2IXJ A;  3AKS A;  4NIH A;  1ZRF A;  2KR2 A;  1FV2 A;  3CJI C;  2RDS A;  1O4T A;  2KD7 A;  2XVL A;  3I2G A;  1O5L A;  4NUB A;  3HAG A;  3WW4 A;  4PCR A;  3I49 A;  2BFU L;  2P34 A;  2CV6 A;  4JGZ B;  4BE3 A;  5FK7 A;  1WKY A;  3SLI A;  1G7Y A;  1V9U 1;  2E7Q A;  3MFA A;  4JHT A;  3K3O A;  3O0X A;  4YM2 A;  4UFM A;  5DDJ 2;  2I45 A;  2RR1 2;  5EIY B;  2D97 A;  3KQ4 B;  3EMR A;  3IN9 A;  3S5A A;  2VMH A;  2PAE A;  3GHM A;  5D21 A;  4YW2 A;  1TEI A;  4OMD A;  2EAA A;  2W1U A;  4BQ5 A;  4YLZ A;  3RZJ A;  3BU0 A;  1JYT A;  1POV 3;  2JIJ A;  4HKL A;  1OUX A;  5A1F A;  2X8K A;  1H6X A;  4Q0P A;  2HWE 3;  4FFI A;  3LEI A;  3T2P A;  3IPV A;  1OLQ A;  4NOT A;  1SLB A;  1OH3 A;  5B4X A;  4OQ9 A;  3DUI A;  1HB4 A;  1X7N A;  2BNN A;  2XBO 2;  4K3U A;  1YFU A;  3HJR A;  3F2Z A;  1PGL 1;  5LRR A;  3DKQ A;  1RUI 1;  4B1M A;  1OVP A;  1SCR A;  2MPF A;  4YW3 A;  4PIX A;  2WWS A;  4D8M A;  4FPY A;  3VHP A;  4AED C;  1PNF A;  5C6C A;  1HX6 A;  1JZ5 A;  2W08 A;  1MS5 A;  3SCH A;  4Z2W A;  4CEY A;  1AR8 2;  2ORZ A;  4OI4 A;  4XF1 A;  2VMI A;  2WA3 A;  1NA1 A;  3P3N A;  4KWL A;  2NM1 A;  1WCD J;  1PZ8 A;  1VBC 1;  3UK9 A;  2J1U A;  3IBM A;  4P02 B;  2BPA 2;  2BU9 A;  5FPV A;  5IVY A;  5E6H A;  4YVS B;  2R1B A;  2LTN A;  3AL6 A;  4Q0U A;  3AVR A;  1W2O A;  5DXD A;  5KWR A;  3T0A A;  5FY7 A;  1H8T A;  1RMU 1;  4CDX C;  2GZW A;  4B4Q A;  3MIF A;  1XB9 A;  3N9L A;  3ACH A;  3A7Q A;  4FFG A;  1DDL A;  4PT6 A;  3OG2 A;  2D6L X;  4XQW A;  1H1M A;  2C1F A;  2JG8 B;  3WQB A;  1BEV 1;  4Q0S A;  1OBN A;  1TQ5 A;  2RR1 3;  3BGA A;  4OHV A;  1HW5 A;  5LY2 A;  4EWE A;  4J6G A;  5I0T A;  2E7T A;  3BPZ A;  2VZP A;  4R9B A;  3OD4 A;  3VLB B;  2AAC A;  3KT1 A;  4QXC A;  1TME 1;  2WQ4 A;  2X29 A;  4WM8 A;  2JDU A;  3MLK A;  1AR8 1;  3WVJ A;  2PXJ A;  3NNL A;  1AYN 1;  3WNN A;  3RQ0 A;  2HBU A;  2RHP A;  2Q8E A;  1HIX A;  4D6Q A;  1CAW B;  2JE8 A;  5GZC A;  4TYS A;  3SC7 X;  3OCP A;  4YFZ A;  3LFI A;  4HVR A;  1COV 2;  2GNT A;  2ZX1 A;  3VBS A;  4BH9 A;  3R4U A;  5CFC C;  1CVN A;  4AAP A;  1MAC A;  3WOG A;  4LUM A;  3EYP A;  1LB2 A;  4QXB A;  5L36 A;  1J3Q A;  1RB8 G;  3AJZ A;  1JI6 A;  1NLQ A;  4NIA A;  3VBF C;  4EZ4 A;  2Z5W A;  2OXB A;  2IWG B;  3PHM A;  4HSL A;  4ZPI A;  3ZYF A;  2EIE A;  4AHX A;  3P1I A;  2VCB A;  1WLC A;  1I5Z A;  4KG0 A;  5FP8 A;  2ILM A;  1WCS A;  2GND A;  4IE7 A;  2EXK A;  2D6P A;  5KHH A;  1AF9 A;  3TYJ A;  2D6K A;  2E53 A;  1RJ8 A;  3OGV A;  2D3S A;  1F2N A;  3N3H A;  4GQ7 A;  3ZYB A;  1V9U 2;  3W9A A;  4CEY B;  5BY5 A;  4CU6 A;  1JU3 A;  5FUP A;  3WP5 A;  4K1Z A;  1APN A;  4LIV A;  3MO4 A;  3OBT A;  4LO7 A;  2PAM A;  4QX5 A;  2VVE A;  4BQ1 A;  4NN0 A;  2A71 A;  2XJV A;  3AFG A;  1VBE 1;  1TVG A;  2DVF A;  3N7K A;  4JKM A;  3ORJ A;  5F5C A;  3RFR A;  1UIK A;  4AWD A;  2GN7 A;  3HOB A;  4COW A;  3KGZ A;  1US2 A;  2BJS A;  2WN2 A;  3LZZ A;  1GSL A;  1UN1 A;  4YM0 A;  3KD4 A;  5F5A A;  4EQV A;  1MQT C;  1ST8 A;  4LO8 A;  2WT2 A;  1D4V B;  1XSQ A;  1UX7 A;  5HCF A;  3BU7 A;  3GNE A;  2ADD A;  4ORF A;  1WCU A;  4IL7 A;  4QM9 A;  2GC1 A;  1V6L A;  5EV7 A;  2BZD A;  1FV3 A;  5HXV A;  3IDE A;  1SEF A;  1HB1 A;  3WP4 A;  3HNM A;  4CU8 A;  1ZX5 A;  3V0B B;  4QKN A;  5LY1 A;  2JE9 A;  4RN5 A;  4NPM A;  1PO1 3;  5FP9 A;  5C3O A;  3MW4 A;  2ERF A;  2WO3 A;  1Q56 A;  4HZF A;  4UW5 A;  1V70 A;  4QPI B;  4XFG A;  2R06 1;  1ENR A;  4BQX A;  1UPS A;  1JU4 A;  1LOC A;  2QQU A;  3KMH A;  5FLI A;  5FY1 A;  5SV8 A;  2VM9 A;  1NCR B;  2AEN A;  3AZZ A;  4DXT A;  1W99 A;  1ZZC A;  3WP6 A;  3AMN A;  5JXI A;  2B42 B;  4J1W A;  1DGW X;  3ZN6 A;  2W3J A;  1CIW A;  2Z79 A;  1HDK A;  1S2B A;  2VW1 A;  3U14 A;  1PIV 1;  1F9K A;  1FMD 1;  2RE9 A;  5A3W A;  4ES8 A;  2VOK A;  5JI7 A;  2D5H A;  2ZX2 A;  4AEM A;  2J22 A;  4UW6 A;  1H8V A;  2NP0 A;  3RI8 A;  1L7L A;  2XKO A;  1B09 A;  4LBL A;  1OMI A;  2XHK A;  4JQR A;  4PF1 A;  2OZ6 A;  4YFW A;  4AGR A;  2HH9 A;  2BUK A;  1ZBA 2;  5DG1 A;  3WY6 A;  1V6M A;  1REE A;  3GJA A;  4LBJ A;  3VKF C;  1WLW A;  3WZ1 A;  4BXF A;  4E4S A;  4Z07 A;  1ND3 B;  4C1W A;  4CCE A;  2WA4 A;  3MPB A;  2WQ8 A;  4ZZ5 A;  1HRV 1;  2RMU 2;  3OJB A;  1V0A A;  3VV1 A;  2NZ9 A;  5A6Q A;  1WUV A;  2XOM A;  2DCZ A;  4KMQ A;  3PUS A;  3A0N A;  2WAB A;  3GDB A;  2E9Q A;  1W6P B;  3NWK A;  3N9O A;  1WMD A;  4JRA A;  4EN9 B;  4RFR B;  3M4F A;  4CDU A;  1GNH A;  1ZBE 2;  2IXH A;  4MHU A;  4RS5 B;  1VAV A;  1UU5 A;  2YRO A;  3GBG A;  4A42 A;  2BWA A;  4JCK A;  3TAY A;  1UL9 A;  4NRO A;  2XUE A;  3D0S A;  1TG7 A;  4M01 A;  2A6W A;  1NOV A;  4D3W A;  4Q4W 1;  4LBN A;  4M3C B;  1RUC 2;  3SKV A;  5IVV A;  2G19 A;  1O8P A;  1O3Q A;  1BVV A;  3W20 A;  4HT1 T;  1OF3 A;  2EF6 A;  2Q1Z B;  1MS1 A;  3AZW A;  4IE5 A;  2VZT A;  2X5I B;  3GZU C;  4NAO A;  4Q0V A;  4QT6 A;  4QU2 A;  4XTM A;  4XHX A;  5FUI A;  4RYD A;  1UPI A;  3I3B A;  1QQP 1;  5FZ7 A;  3IPV B;  3M3I A;  5GZG A;  2WZE A;  2XUM A;  1W8W A;  4XFC A;  4HVQ A;  3VL9 A;  4IND A;  3M3E A;  3WQ1 A;  4I3G A;  3DCQ A;  1XE0 A;  4OHZ A;  2RG4 A;  4QDS A;  2RVA A;  3THP A;  4CCN A;  4X6R B;  5JOX A;  4QQH A;  3POB A;  3VDD B;  3PU3 A;  1UYX A;  2PTM A;  1KD7 A;  2VMG A;  3CHX A;  3OYW B;  1WGP A;  5DMY A;  4FOQ A;  3UKN A;  4CDW C;  2XVG A;  5CU1 A;  4I3P A;  2CYF A;  4XMI A;  3MIH A;  1IZ3 A;  4M00 A;  1NA1 B;  1W0O A;  1N3Q A;  2V73 A;  2XL9 A;  3DEM A;  4OI1 A;  1QQP 2;  2WYS A;  4YPJ A;  3OEA A;  4AI9 A;  1OC1 A;  5T5O A;  1CGP A;  2BBA A;  2QZ3 A;  3R4S A;  4FTS A;  1H2L A;  3MUY 1;  3O7O A;  4CUG A;  1VBB 1;  4LBK A;  1O3T A;  5A1A A;  1RUC 1;  1Z7S 3;  3ETQ A;  1O3R A;  1LNS A;  3QAC A;  5ANN A;  5IHR A;  1URX A;  1J83 A;  2YZ4 A;  2E33 A;  5FZO A;  2VNG A;  2WL1 A;  5K9Y A;  2PHX A;  3J7L A;  1OQD A;  2R32 A;  5FP7 A;  1QJY 2;  1NG0 A;  4FPC A;  3WHU A;  2ARC A;  3CQO A;  1ZBE 1;  3H7Y A;  5A7S A;  1NXD 1;  4UFI A;  4XBL A;  4LIU A;  2RM2 1;  4MAD A;  1AL2 1;  3DPR A;  1XYO A;  3KT4 A;  1XU2 A;  2D40 A;  4FPH A;  2LS6 A;  3PNA A;  3VZK A;  4AQ6 A;  4DNY A;  3RZH A;  3GZA A;  2A6X A;  4HL0 A;  1WW7 A;  4XBN A;  4CCM A;  5FCC A;  3OY8 A;  3AXE A;  2CAV A;  2WBK A;  3B9I A;  4A3X A;  2MHF A;  3VN4 A;  3VBU B;  3EB7 A;  1OOP B;  3FC0 A;  5I8Y A;  5J36 A;  2ZGS A;  4FAG A;  3I59 A;  1DU3 D;  2OZJ A;  2QQO A;  3POJ A;  4W6Y A;  1C8M 2;  1HRI 2;  1SLC A;  1Q3E A;  1ULO A;  4LA2 A;  3SKJ E;  5FZL A;  1CJD A;  4CCJ A;  1FMD 2;  1HQW A;  1T6B X;  3LEG A;  3PVE A;  4A41 A;  1PGW 2;  1ZA4 A;  2JDH A;  3MHZ A;  2BGO A;  5FMO L;  4CA9 A;  1X8M A;  2YFZ A;  1ODM A;  3FZ3 A;  2VJX A;  4AFC A;  1UWW A;  1CES A;  1CAX A;  2WZR 3;  3SH3 A;  3U78 A;  1N3O A;  3NW4 A;  4Q27 A;  4Y22 B;  3ZYH A;  3ILR A;  1JOP A;  3NL1 A;  3O1M A;  2XKP A;  3VZL A;  3MUZ 1;  3BOW A;  4RHV 1;  3RVH A;  1W3X A;  2VBD A;  5CFC B;  1K42 A;  2VE1 A;  3IWZ A;  1AR7 3;  4QGL A;  3CNA A;  1TMF 3;  3KHC A;  1VB2 A;  3UJQ A;  2CGN A;  2XGX A;  1EAH 3;  4LOS A;  1DGR N;  4CCL A;  2Y60 A;  4QPG C;  4A44 A;  4EN7 B;  1FPN 3;  4MGY E;  4Q2F A;  4K7J A;  4GJY A;  3WG3 A;  3D4K A;  1DF0 A;  3I2D A;  1ND2 C;  5C70 A;  1S0F A;  5FMO S;  4XDP A;  4A7Z A;  1YRZ A;  4LTA A;  3I8T A;  1S0J A;  1JYV A;  5FQ0 A;  2C5D A;  4J1X A;  1EV1 2;  2W95 A;  2QQP A;  1QXR A;  4CUB A;  5DUW A;  4Y26 A;  1QJE A;  4E4Z A;  5IFP A;  1LR5 A;  1LHU A;  1BJQ A;  1UOG A;  2RS5 2;  2ZBJ A;  2VCA A;  4LO4 B;  5L9R A;  2VVD A;  1R09 2;  3CJI B;  1KS5 A;  4IE4 A;  4FOW A;  2HWB 3;  4PJY A;  1OA2 A;  2IZW A;  2RS3 2;  4XET A;  2QE3 A;  1PZ7 A;  1YFW A;  1AYM 1;  4K9S A;  2G9F A;  4C0B A;  1Y4W A;  2VNV A;  4XZU G;  2WZR 1;  3WP3 A;  2VUL A;  2OA2 A;  1QY4 A;  3CLP A;  3ZX7 A;  1XQN A;  3V0B A;  1UMH A;  4K21 A;  3SEP A;  1L7Q A;  5FYT A;  1FXZ A;  1PZ9 A;  3C7F A;  2NLR A;  4BIF A;  1O7F A;  4LT5 A;  2WT1 A;  4H55 A;  5GZF A;  1RUE 1;  4PBP A;  4ZS3 A;  4QX7 A;  5FZ9 A;  5C3Q A;  1G6N A;  4NID A;  2ZS6 B;  3CEW A;  4A7Y A;  3I2I A;  4PLN A;  3NMB A;  1OF4 A;  3J4U H;  4DS0 A;  4AR2 A;  3A22 A;  1LAJ A;  4MXW B;  4LBQ D;  2IXI A;  4AXO A;  5FZB A;  1M4W A;  1QJU 1;  2P17 A;  1DQ4 A;  2DV9 A;  4I0W B;  1EPZ A;  3APB A;  3ASI A;  4NRQ A;  3WG1 A;  4Y5T A;  4MYE A;  5FBJ A;  4QKB A;  4I01 A;  4EJR A;  3MIB A;  1JZ2 A;  4RQP B;  1A34 A;  1A3K A;  1AYN 2;  1MS4 A;  2QCS B;  1JYW A;  3ZXL A;  1DCS A;  4IW3 A;  3QD6 A;  1POV 1;  4K1Y A;  3FBY A;  5F3C A;  1OSG A;  4QWN A;  3ZYI B;  4H7L A;  1FPN 2;  4CE8 A;  2AR6 A;  5FYZ A;  5CFC A;  5JVV A;  4CCK A;  4LBQ A;  1K5M A;  4Y1Z A;  4ISR A;  4Q8L A;  1AL0 G;  2LUW A;  1IGO A;  3I2H A;  4MGZ E;  3ZSM A;  5FFO C;  5CB7 A;  2XLF A;  5JZG A;  4HET A;  1STM A;  4TN7 A;  1EUT A;  2XB6 C;  2RS5 3;  1GZC A;  3D3A A;  1NXM A;  4YVW B;  3OPT A;  3E97 A;  1JZ4 A;  2PLV 1;  3GCW A;  3VD4 A;  3H3L A;  5LRS A;  3E5X A;  5SV5 A;  1SFP A;  1NKG A;  1PM4 A;  3LSD A;  4WM7 C;  2DCT A;  2WNO A;  1RUJ 2;  4L97 A;  4NPR A;  4DRR A;  2H6C A;  3H50 A;  3JBG 3;  3ZPO A;  4DZG A;  1O5U A;  1VBA 3;  2X5I A;  1VBC 2;  2R6Q A;  3AB0 A;  4OHY A;  5BNN B;  5A3N A;  2Q0A A;  3AP9 A;  2NPI A;  4IEZ A;  4P9W A;  3NST A;  3NNM A;  3ES1 A;  4XJ9 A;  1ENX A;  1LHO A;  4YVS C;  4TXW A;  1X36 A;  5BXX A;  1TE1 B;  1GOH A;  1RGS A;  1ZM1 A;  3LD8 A;  4C0H A;  4CTE A;  2QUO A;  2WAA A;  4BHP A;  1RUO A;  5I0R A;  3POS A;  4BLI A;  1MQT B;  5C5U A;  4FPF A;  3PTR B;  3HD8 B;  5IK5 A;  1QJU 2;  1W8Z A;  3C3V A;  3MI8 A;  3RZM A;  2XJS A;  4FPK A;  1BQP A;  2W39 A;  3M7A A;  2RDQ A;  3MIG A;  5FPL A;  1PGL 2;  5IWF A;  3PUQ A;  3M8L A;  1S2E A;  3THT A;  2AC1 A;  3ZFG C;  4XZP A;  2Y6G A;  4IE6 A;  3H1Y A;  4NWV A;  3K75 B;  4Z92 B;  3IT8 A;  5LK5 A;  4D6R A;  2GH2 A;  1RUE 2;  1D4M 2;  3MIE A;  1L3J A;  2DFB A;  3ZR6 A; 
#chains in the Genus database with same CATH homology
 3GGL A;  4BJ0 A;  5B4N A;  4JKL A;  1IQD C;  2KD7 A;  3I2G A;  1UY4 A;  2WO2 A;  5LA1 A;  2W92 A;  1WKY A;  1CZT A;  2RJ2 A;  4LQR A;  4JX0 A;  2WUH A;  2ZEX A;  4D0Q A;  5EIY B;  1W9W A;  1GOF A;  3IB3 A;  4OMD A;  2W1U A;  4P08 A;  4OUE A;  2YG0 A;  1H6X A;  3LEI A;  3T2P A;  2WZ8 A;  4M4R A;  5B4X A;  1L7R A;  3HJR A;  3F2Z A;  2QQK A;  3IAP A;  2QQN A;  3C7E A;  4QDQ A;  3CMG A;  3T0B A;  5IFT A;  3DYM A;  4D8M A;  1W8O A;  3DYO A;  1JZ5 A;  2VQU A;  3FL7 A;  4BK5 A;  4IUG A;  2ORZ A;  3WF1 A;  2ZXQ A;  1JZ8 A;  1K12 A;  4W8J A;  5HXM A;  4CVU A;  2J1U A;  4QB1 A;  4P02 B;  2VC9 A;  1W0N A;  4A4A A;  1UY3 A;  4P00 B;  3I2K A;  2VZV A;  3T0A A;  4ZZ8 A;  4MO3 M;  4MGQ A;  1NAE A;  3ACH A;  3A7Q A;  4PT6 A;  3OG2 A;  3WQB A;  3U37 A;  5J1X A;  3BGA A;  3VDB A;  3ETP A;  1GNY A;  2VZP A;  3E1F 1;  2Y6L A;  5CYY A;  2QQJ A;  2Y6K A;  5JXH A;  3WNN A;  2CDO A;  2W47 A;  3SEE A;  1UY0 A;  4DEV A;  1R64 A;  3J7H A;  2JE8 A;  2Y8K A;  2VMF A;  4QPW A;  4Z2A A;  2W91 A;  4PQQ A;  1XC6 A;  5IYY A;  4CUC A;  2BGP A;  1MPX A;  3I3E A;  2J1T A;  4CUA A;  3EYP A;  4DUW A;  4QDR A;  2YFU A;  1JI6 A;  4ZXE A;  1CZV A;  1UYY A;  2EIE A;  3P1I A;  2VCB A;  3VD3 A;  2E26 A;  4ARX A;  5IJR A;  3WNK A;  3WNP A;  3OGV A;  3HPN A;  5EJ1 B;  3CKH A;  2Y6J A;  4CU6 A;  1JU3 A;  3MO4 A;  4P5Y A;  4LPL A;  2VZ3 A;  4JKM A;  1TVG A;  2B4K A;  3HOB A;  3WEZ A;  4KI5 M;  1US2 A;  2WN2 A;  2HLE A;  3CZJ A;  4DUX A;  2X10 A;  1UX7 A;  2VZ1 A;  2J1A A;  2YC2 A;  3BN6 A;  3WF4 A;  1PX3 A;  2VZR A;  3UES A;  2ZEW A;  2BZD A;  1UMI A;  3HNM A;  3OB8 A;  1UXX X;  4CU8 A;  3C7G A;  4RN5 A;  2WO3 A;  2Y64 A;  1I5P A;  3VD9 A;  2VZU A;  2QBX A;  4BDV B;  2C26 A;  4A45 A;  1JU4 A;  3THC A;  3T08 A;  2VM9 A;  4DXT A;  1W99 A;  3VD7 A;  3ACG A;  5JXI A;  1NUK A;  5JXG A;  2W3J A;  2CDP A;  3HNB M;  3K4A A;  1W8N A;  3C8X A;  1JYX A;  1KEX A;  1SG3 A;  2C9K A;  2J22 A;  1JZ7 A;  1XNA A;  3WNM A;  3UET A;  3III A;  4PF1 A;  4UOJ A;  2VZQ A;  2EIB A;  2VZS A;  5F7U A;  2EID A;  4KWU A;  1DLC A;  2C4X A;  4JHZ A;  1ULP A;  4ZZ5 A;  2WQ8 A;  3ECQ A;  1HN1 A;  2J7M A;  3C7O A;  2XOM A;  4KMQ A;  2W87 A;  2WAB A;  3ABZ A;  4DUV A;  3GDB A;  3OBA A;  1W9S A;  3I2J A;  3OGS A;  2DCK A;  2J1R A;  4A42 A;  4ET7 A;  3NJV A;  2J1V A;  1JYN A;  1TG7 A;  4CU7 A;  4OYU A;  3W5M A;  3SKV A;  3OEB A;  1O8P A;  1OF3 A;  4XUQ A;  2ZEZ A;  3T09 A;  2VZT A;  5LA2 A;  3MV0 1;  5FUI A;  4RYD A;  3I3B A;  4HG6 B;  1UY1 A;  3LPG A;  3I2F A;  2WZE A;  3NRU A;  1YQ2 A;  4QDS A;  1UXZ A;  2RVA A;  4MGS A;  2E31 A;  3T0D A;  4OMC A;  1UYX A;  1OD3 A;  5DMY A;  2VL4 A;  4QX0 A;  1GU3 A;  1WCQ A;  2JD9 A;  5DQ0 A;  1PMJ X;  4JKK A;  4YPJ A;  2WYS A;  3LQC A;  1KGY A;  3OEA A;  4XUT A;  3GXU A;  2BBA A;  5C71 A;  3ACF A;  3MUY 1;  2QQL A;  2OKX A;  5A1A A;  3HNY M;  1LNS A;  3LEK A;  3K46 A;  2WO1 A;  3MV1 1;  5IHR A;  1J83 A;  2V72 A;  2E33 A;  2LW8 A;  1GMM A;  2W1W A;  4W4Z A;  4QX1 A;  3CQO A;  4MAD A;  2VCC A;  2X05 A;  1GOG A;  2LS6 A;  3W5N A;  3DYP A;  2WBK A;  4LHS A;  4XUR A;  3EB7 A;  3OGR A;  1CIY A;  3WSO A;  2XQX A;  2ID4 A;  4E8D A;  2QQO A;  4A6O A;  1CX1 A;  2W1S A;  2VMC A;  1ULO A;  5HPO A;  3PUI A;  3SKJ E;  3LE0 A;  3NNG A;  4GWI A;  1EUU A;  1US3 A;  3LEG A;  5DN2 A;  3VDC A;  3A23 A;  4A41 A;  5JR2 A;  1BHG A;  1UYZ A;  2BGO A;  4GZ9 A;  4DXR A;  2YFZ A;  3I97 A;  1D7P M;  2VJX A;  1UWW A;  2PQS A;  5EJZ B;  3JXS A;  4BXS V;  2L9L A;  2W1Q A;  1PMH X;  2VTF A;  1OT5 A;  3LPF A;  3MUZ 1;  2W46 A;  1K42 A;  3VDA A;  1SHW B;  1JZ6 A;  2XHN A;  4E8C A;  3P6B A;  4DXS A;  4A44 A;  2W94 A;  3CIH A;  2JKX A;  3T2O A;  1NX9 A;  5C70 A;  2YB7 A;  4QX3 A;  1JYV A;  3WF0 A;  4CU9 A;  1SDD B;  3C7H A;  1DYO A;  2W95 A;  4CUB A;  5IFP A;  3HN3 A;  5JXJ A;  2VCA A;  4QAW A;  2VZO A;  2R7E B;  4OZO A;  2J1E A;  4LKS A;  4QB6 A;  4XZU G;  4BK4 A;  2WAO A;  4QB2 A;  2WN3 A;  2VO5 A;  1PX4 A;  1O59 A;  3FN9 A;  3WNO A;  1UMH A;  2VME A;  3SEP A;  1L7Q A;  2VQT A;  4UI9 L;  2EIC A;  3C7F A;  1UY2 A;  3VD5 A;  3ACI A;  4L0P A;  2B9V A;  2ORX A;  1GQP A;  2QQM A;  5G05 L;  3MBW A;  4TTG A;  4ARY A;  3A21 A;  4W50 A;  4GWJ A;  3I2I A;  1OF4 A;  3IAQ A;  2VOT A;  4A3Z A;  3A22 A;  1JZ3 A;  3WF2 A;  3T2Q A;  1K3I A;  3K4D A;  1F4A A;  4FI9 A;  1T2X A;  3FHQ A;  2Z4F A;  1W9T A;  1O8S A;  1XPW A;  1JZ2 A;  2QQI A;  3DEC A;  3NQH A;  3UNP A;  1JYW A;  1UZ0 A;  5LCW L;  4M4P A;  3ZM8 A;  2DCJ A;  2VMD A;  2W5F A;  4UAP A;  5DPN A;  1OH4 A;  3K4Z A;  1P8J A;  4ZY9 A;  2HYX A;  2WDB A;  3I2H A;  4DEQ A;  2V5D A;  1EUT A;  3D3A A;  3K77 A;  1JZ4 A;  3VD4 A;  5JMO A;  1NKG A;  2YC4 A;  3NJX A;  4MOA A;  4QX2 A;  2RV9 A;  3HEI A;  4AAX A;  2ZEY A;  1K45 A;  3THD A;  2X09 A;  1RYY A;  4TXW A;  5I0D A;  3IDA A;  1GOH A;  4XUN A;  1XNT A;  1GUI A;  2WAA A;  2J1S A;  3WNL A;  3I3D A;  5G04 L;  1J84 A;  3CDZ B;  3GM8 A;  5CZK A;  1JHJ A;  1CZS A;  3WF3 A;  2BER A;  5JUV A;  5LA0 A;  2W9X A;  2VR4 A;  4XUP A;  4XUO A;  2Y6G A;  2JDA A;  2Y6H A;  5C7G A;  3PUH A;  1F4H A;  1DP0 A;  2V4V A;  3CZU A;  4XVH A;  3K75 B;  2DDU A;  2E32 A;  3AC0 A;  3FHA A;  1H6Y A;  4AG4 A;  2XON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...