3LEKA

Lectin domain of lectinolysin complexed with lewis b antigen
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
VETENIARGKQASQSSTAYGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the lectin regulatory domain of the cholesterol-dependent cytolysin lectinolysin reveals the basis for its lewis antigen specificity.
pubmed doi rcsb
source organism Streptococcus mitis
molecule tags Blood clotting
molecule keywords Platelet aggregation factor Sm-hPAF
total genus 39
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3lekA00
3VD4A 3WNNA 4TXWA 3A22A 2XQXA 3K4DA 3HNMA 5JMOA 1J84A 2QQJA 1W9SA 1UYXA 3LE0A 1JZ6A 5JXGA 1H6YA 2QQIA 1JYNA 2ZEXA 1UWWA 3DECA 4QX3A 3D3AA 2JE8A 4BXSV 4XUTA 4HG6B 2KD7A 4P00B 4OMCA 2VM9A 1JYWA 1F4AA 2R7EB 1UZ0A 3MV01 3BN6A 2ZEZA 2DCJA 2VMDA 1TG7A 4A4AA 1MPXA 2VC9A 3VDBA 3GGLA 4A44A 5JXJA 1K42A 5A1AA 2JD9A 4RYDA 2VZTA 4LHSA 3OGRA 3OBAA 3A7QA 3WNLA 2QBXA 1UY4A 3GXUA 3OEBA 1RYYA 4UOJA 3VD5A 4CUCA 1JZ2A 3IAPA 2CDPA 1HN1A 1IQDC 2BGPA 5F7UA 4LKSA 2VJXA 5HPOA 1EUUA 3OGSA 5DQ0A 2X09A 3T09A 1GNYA 1K45A 3BGAA 2V72A 3ABZA 1CIYA 3C7GA 4DUWA 4QX1A 1PMHX 3IDAA 5C70A 4CU7A 4CUAA 4XUQA 1NX9A 2LS6A 5G05L 3ACFA 2VZVA 1NUKA 2QQNA 4DEVA 1O8PA 1L7QA 3VD9A 1JZ3A 2E26A 1OF4A 1GU3A 4AG4A 2X05A 1NAEA 4MO3M 3K4ZA 2W1UA 4JKMA 3SKJE 5FUIA 3GDBA 2VMCA 2Z4FA 2J1AA 2WO1A 4A42A 2VR4A 4P08A 3I2KA 5J1XA 3WSOA 1OH4A 2BGOA 5LA2A 2WZ8A 3UESA 2BERA 3J7HA 4QB2A 3WNKA 3FL7A 3MBWA 5DN2A 2OKXA 1T2XA 2WZEA 2XONA 4CU6A 1W9TA 5CZKA 4E8CA 5IFTA 5JR2A 2W94A 3ACIA 3DYPA 2YG0A 3WQBA 1SHWB 1UXZA 4DXTA 4LQRA 1KGYA 2ZEYA 3NJXA 3I3DA 2W5FA 2VZRA 5EJ1B 3T2PA 4KI5M 3VD3A 3C7EA 4FI9A 1WCQA 1W9WA 4YPJA 2BZDA 5JUVA 2J22A 2J1VA 2VZQA 3THCA 4XUNA 2VQTA 2W91A 5JXHA 3HN3A 2ZEWA 3K46A 5IYYA 3P1IA 4JX0A 2VCCA 3MO4A 3I3EA 1O59A 1UY3A 2QQKA 4A45A 3K75B 1JHJA 4BJ0A 1W99A 3F2ZA 4XZUG 3I3BA 1R64A 4LPLA 3CIHA 5DPNA 4PF1A 4GZ9A 2RJ2A 4CU9A 1US3A 3HJRA 1TVGA 3U37A 4Z2AA 1GQPA 2WO2A 2E31A 3PUIA 2W1QA 4QB6A 2Y6JA 3K4AA 2Y64A 3ZM8A 3HNYM 1JU4A 1JZ4A 2VMEA 2WQ8A 2WN2A 3I2GA 1D7PM 4OZOA 4QDQA 3W5MA 1PX4A 3FN9A 4MGQA 3UNPA 2JDAA 2EICA 2EIBA 2LW8A 4DUXA 3LEKA 5DMYA 1JI6A 2EIDA 3T0DA 4L0PA 1JZ5A 3WF2A 4KWUA 1SG3A 3CMGA 2RVAA 1W8NA 3NJVA 3EB7A 4P02B 3SEEA 3A21A 2RV9A 4ARYA 2J7MA 3I97A 1CX1A 3DYOA 1O8SA 3FHAA 4MOAA 1CZTA 1KEXA 2VO5A 5HXMA 4XUPA 2VZPA 3ACGA 3CQOA 1UY0A 1UMHA 1DYOA 5IJRA 3OEAA 2WABA 5IFPA 2J1TA 2J1SA 3OGVA 4OMDA 4QX2A 2VZSA 5LA1A 2YC4A 4ZXEA 3WNMA 1JZ7A 2WBKA 2Y6HA 2Y8KA 3HNBM 3OG2A 2E32A 1CZSA 4A41A 1PMJX 2EIEA 2VZ3A 4JHZA 4W50A 4ARXA 3C7HA 4UAPA 3AC0A 3LPGA 2VTFA 1I5PA 1GOHA 4QAWA 2WYSA 1UX7A 4M4PA 1OD3A 3CDZB 1XNAA 3P6BA 4QB1A 1JYXA 2HYXA 3FHQA 2VCAA 2VZOA 3WF0A 1J83A 1BHGA 3PUHA 3T0BA 4PT6A 2C4XA 4DEQA 3VDAA 5B4NA 3HPNA 1XNTA 2WN3A 5CYYA 3WEZA 1L7RA 4XURA 1H6XA 1LNSA 2ID4A 1UYYA 1GOFA 3C7OA 4DUVA 4RN5A 3GM8A 4BK4A 3MUY1 2WO3A 3LEIA 2XHNA 3OB8A 2X10A 3IAQA 1JZ8A 1XC6A 5EIYB 3LQCA 4QDSA 3I2IA 1GMMA 3LPFA 4DXRA 2W95A 3WNPA 1JYVA 4JKKA 2QQMA 3T2QA 4PQQA 2J1EA 3T0AA 1UXXX 4OUEA 4M4RA 3SKVA 4D8MA 5LCWL 2VQUA 2J1RA 2JKXA 4W8JA 1UY1A 2HLEA 3NRUA 2VCBA 2WDBA 2ZXQA 4IUGA 2XOMA 2YC2A 3UETA 3VD7A 1WKYA 3MUZ1 2QQOA 1UYZA 5IHRA 3THDA 4CVUA 1P8JA 3I2HA 1ULPA 2W1WA 1W8OA 2W1SA 1W0NA 2CDOA 3SEPA 3E1F1 3WNOA 1ULOA 1XPWA 3C7FA 1NKGA 1CZVA 4ET7A 5B4XA 4ZZ5A 2WAOA 4A6OA 2W9XA 1PX3A 3I2FA 3LEGA 2V4VA 4UI9L 3NQHA 4MADA 3HOBA 3A23A 4W4ZA 2ORXA 4JKLA 5C71A 3EYPA 1GOGA 2J1UA 2W47A 2VL4A 2W3JA 4TTGA 4MGSA 2BBAA 3W5NA 1EUTA 1DP0A 3IIIA 4XVHA 3WF4A 1K12A 2C26A 4GWJA 2B4KA 3CKHA 3WF1A 4XUOA 1SDDB 3CZUA 5LA0A 2W46A 1DLCA 4BDVB 3ECQA 4P5YA 2PQSA 3T2OA 4QDRA 4ZZ8A 3K77A 1UMIA 2VZUA 2E33A 2Y6LA 4GWIA 2YFUA 4CU8A 3C8XA 3DYMA 4AAXA 4BK5A 1OT5A 3ETPA 2WAAA 4QPWA 1K3IA 4A3ZA 2W87A 2B9VA 3WF3A 2YFZA 4KMQA 2Y6KA 2V5DA 3MV11 2VMFA 1UY2A 4ZY9A 2YB7A 2C9KA 1JU3A 3I2JA 3ACHA 3CZJA 4OYUA 2DCKA 2ORZA 3VDCA 5JXIA 1US2A 1GUIA 4D0QA 4DXSA 2L9LA 4CUBA 1F4HA 2W92A 3NNGA 2DDUA 5G04L 5EJZB 1YQ2A 3IB3A 5C7GA 1OF3A 2WUHA 2Y6GA 4QX0A 3T08A 2QQLA 3HEIA 2VZ1A 5I0DA 3JXSA 2VOTA 4E8DA
chains in the Genus database with same CATH superfamily
1F8VA 3WNNA 5FYCA 3S0MA 4HSJA 2ZX3A 2CYFA 1KXGA 1UX6A 3K4DA 2RHPA 1LEMA 3HNMA 1EP0A 3N9OA 2QQJA 2ZGLA 2GH8A 4YFWA 4M3CF 2OUJA 5IATA 4LMFA 3FE5A 3LE0A 1K5JA 2WRAA 5BUVA 1JZ6A 1D4VB 3PNAA 3ZR6A 5I0RA 4QXBA 3Q8FA 2D93A 2QQIA 3H7JA 4CDUB 2ZEXA 3NAPC 4IEPA 3H8RA 5DDJ1 1QHDA 1LOEA 3AZYA 5LK5A 1PNFA 1PGW2 1AR82 3IKWA 2YY1A 2Q8EA 2ADDA 4LBNA 5F37A 5JCTA 4OHVA 5JPNB 4XUTA 4Y1UA 1Q8VA 1EV11 2BWAA 4JV4A 4BPZA 4C8DA 4UW5A 2GN3A 2IFWA 4NHLA 1TMF1 2Q1ZB 5BNOC 3B94A 1MZ6A 5FZ7A 2DCJA 4YW4A 3SH3A 3EMRA 5FY1A 1AR72 4A4AA 1ST8A 1NCRC 4J25A 1MPXA 1QOSA 4PBPA 1DGLA 1YXWA 1VRH2 1R083 2VC9A 5I8SA 3VDBA 5AC93 2JD9A 4RYDA 1ZZCA 4QX7A 3OBAA 1S0CA 2R30A 4DMIA 4JZRA 2QBXA 1W28A 2PHTA 1OA3A 2NPIA 3KQRA 1W2UA 4FT8A 4LBLA 3TBDA 4AAPA 2CWMA 4AE2A 3ZOIA 3IAPA 1RXGA 1SLIA 4NR1A 2FDIA 2ZX4A 1BLZA 4GJYA 1LGCA 3CLPA 3V0AA 1HQWA 2B8MA 3RGBA 2VJXA 5A3LA 1HRV1 1EUUA 3Q9OA 3OGSA 1ND2A 2YZ4A 5FWEA 4FOWA 4IE0A 1RHI1 4Y22B 3UGGA 4XFGA 4P9JA 5LBCA 5FWJA 1K45A 1NY72 4WV8A 2EXHA 1Y3TA 4X6QB 2YU2A 3BIWE 1QXPA 4LA3A 4CTEA 4DZGA 1PIV1 2EAKA 3NJZA 4QX1A 1X9PA 2GDFA 3CHXA 1VE0A 1RUF1 3N9MA 1UKGA 3UL2A 3VBSA 1I6XA 5FPAA 1FOD3 1NG0A 3AL6A 1GZ9A 1YO8A 5FXWA 2DV9A 4FO9A 1NX9A 2LS6A 5F5QA 2R073 3DCQA 1C4RA 3ME2A 2OYZA 5FPBA 1W6QA 5CFCA 3ACFA 5K7PA 3VN4A 2VZVA 4EWDA 1NUKA 4OUMA 3B3QE 1O8PA 3CF6E 2FZ1A 4LE4A 4UW4A 1OQDA 2MEV2 2RDRA 4YVWB 4CCDA 1JODA 2ZGRA 3NVCA 4LEJA 1E57A 3AM2A 1B35A 3Q8BA 1NAEA 3WG2A 3DEMA 1RUE2 1IHMA 3Q8AA 4RQPC 2YMZA 3K4ZA 1XNDA 5CB7A 3TNPB 4BA6A 1YQ5A 4CXXA 2VUJA 2VMCA 5T5OA 1COV3 2XJTA 4BLJA 1W6PB 3PUQA 1H4HA 1WBLA 2J1AA 5F3EA 4A42A 1UOJA 1V6MA 2A6VA 4LNVA 4Q8LA 5FYSA 4XBLA 4A7ZA 1ZYBA 4LBQD 4YVSA 3H3ZA 2PHLA 3BPZA 4PBOA 5CFDA 3WSOA 3DV8A 5LA2A 2OXBA 5FYYA 2CHHA 2CNAA 3N3HA 3FL7A 1Z7S3 3MBWA 4IEWA 4LBKA 4ATFA 1LR5A 4OHXA 2D3SA 2XONA 1UNBA 3MLKA 3RMXA 3CJXA 5GJ6A 4CU6A 1W9TA 2P3JA 4LUMA 1ZZBA 2R6QA 2WR9A 3ACIA 2XHKA 1SACA 2J42A 1ZZ6A 4DXTA 4YZ3A 4E4ZA 5CISA 4LO7A 3WHUA 3VBRC 1DDLA 5F5AA 2DBNA 4AF9A 2VCMA 5EJ1B 3T2PA 3FHIB 3LDRA 4L11A 1S55A 2G9FA 4ES9A 2D6OX 4XILA 3MPPG 4YG0A 3N9QA 4YPJA 4EWEA 5JUVA 1MQTC 1O5UA 4Z92B 3FMGA 4YW5A 2FZ2A 2IXJA 5FMBA 1N1TA 4V1PA 3WDUA 3HN3A 3P1IA 4NPMA 1G7YA 4GQ7A 1ZBA1 3I3EA 3ZXEA 2XVLA 1ASJ3 2ZGMA 5BY5A 3FC0A 1W6OB 3K75B 1L7LA 1V9U2 5CU1A 4XHXA 1YIPA 4QPIB 4EN9B 3H8OA 2D6LX 1JTZX 4W6YA 1JOPA 3F2ZA 3H0OA 3TEXA 3HR9A 1R64A 4LPLA 1Z7S2 5DPNA 4K6BA 3TEWA 3AFGA 2RJ2A 4MVTA 5FREA 4DRVA 4BQYA 1CPMA 3VUOA 2C5DA 2RM21 4AFBA 4CP9B 2V73A 1KFXL 1C8M1 2DCZA 3U37A 3PTYA 5JDBA 1BK0A 1ENSA 1GANA 3BTYA 3VDDA 4Z2AA 1GQPA 5K0UC 3ZYRA 3ROUA 2P34A 1UOGA 1NE4A 2W1QA 1UO9A 3K4AA 2Z69A 4RR3A 1SPPB 2WO7A 1RITA 1JZ4A 3QCWA 4NMIA 2XBO2 1IPSA 1VB2A 1J3PA 2VECA 1X33A 1D7PM 2R071 2DCTA 3VBOB 2W2IA 3BVCA 1BKZA 2LW8A 2BOJA 3MZHA 5JIAA 1S0BA 4YW6A 2R0FA 1W8NA 4HK8A 2FDHA 2OPWA 4OUSA 2PHUA 3A21A 4EWAA 1W2AX 4Q0VA 4XF4A 2Y38A 4LHLA 3VBHB 1K5MC 3FHAA 3H7YA 2QZ2A 1FAYA 4JGYC 3PMSA 4EQVA 5CKNA 2SLIA 4OI0A 3ZN6A 2VO5A 1RUI1 5HXMA 5F6LB 3H50A 3ACGA 4W6XA 5GZEA 4LBOA 2RS12 1IS5A 2Z79A 3TB0A 3ZKYA 3SH5A 3EQEA 3R6SA 3VV1A 4XXPA 1S0DA 1XE7A 2JDMA 5FJHA 4I2OA 2NLRA 2WABA 2OW4A 5KXCA 2JXAA 5AVAA 3E5QA 3ES1A 3AXEA 2C1FA 1O6UA 1OI6A 1SBEA 2VNOA 4XEZA 1EPWA 5KHHA 4XIKA 1DGRN 4Y4RA 3POJA 4C1WA 3D82A 4QX2A 1REEA 2VZSA 1POV3 5LA1A 2D43A 2RR12 1MVQA 1YUDA 2RJKA 2W68A 4PLNA 4QXKA 3RG0A 2FDFA 2ZGTA 2ZX2A 1UW8A 2Q1MA 1H8TC 2MNGA 3ZKUA 4CCEA 4E4HA 2XLFA 2VG9A 5FK7A 4P9WA 5T54A 4DY5A 5I93A 4OQ8A 1RUI3 3HNBM 1QH7A 3OG2A 1OLMA 1YQ6A 2D98A 1CZSA 3OD4A 5LB6A 4XXAA 1TNFA 2YV8A 2DU1A 2VZ3A 4QPGB 1MEC2 3ZIXA 2C0ZA 4ZS2A 5I8TA 1F35A 3A0KA 4CA9A 2VTFA 3DN7A 4MXWA 4PI0A 1I5PA 1GOHA 3ZYJB 4CEYB 4YZ1A 4RFT0 1NCQA 1W9FA 1JMUB 2FHRA 3FHQA 2VZOA 1J83A 1XB9A 4AEDB 1K5MB 2EXKA 2ZKLA 4JGYB 3ES4A 3ZSMA 3IDCB 1LECA 2C4XA 1ASJ1 4WVMA 4A7KA 4FVVA 4DEQA 1DQ6A 3HPNA 4K3UA 3WEZA 4NHMA 1OVPA 2WNUB 4GH4A 2ID4A 1ZNPA 4CZSA 4B8EA 1O3TA 4YW1A 2DYCA 4RN5A 2RS51 3VBFA 2W39A 4GB31 4KG0A 5C3OA 5FMDA 1J59A 1V6IA 3D8CA 5FMOS 4BK4A 1W2NA 3MUY1 1HJFA 4XW3A 1T6GC 3TWIA 3LEIA 3LOIA 4LT5A 3IAQA 2WZR3 1ZVFA 5EIYB 2DU0A 4IV1C 4UFIA 5EXOA 3ZFGC 3ZSLA 3UKTA 5LBEA 1E5HA 1U0AA 2VUCA 3LPFA 5I0UA 4DS0A 2NMOA 3WNPA 5FP3A 3ZXAC 1QJEA 3DUIA 1LHOA 3GJAA 4JKKA 2OS2A 4CDXA 2FBEA 1YQCA 5LK7B 4FPCA 5T3NA 1PM7A 4M4RA 3SKVA 4HPKB 5LCWL 1Y4WA 3USSA 1YHFA 2J1RA 3FZ3A 2HWE2 3GZAA 5APAA 2Q8OA 2HLEA 1VBC1 4CDQC 3AP7A 5FKCA 1BCXA 2RS52 2ZHNA 3LA3A 1OLRA 2WDBA 1KJRA 4IUGA 4BISA 4MXVA 3LA7A 1CWPA 3ZFEB 2TEPA 3NNFA 2IXCA 4I0BA 3UETA 3AMPA 4AHWA 1REDA 1UKRA 1VBD3 1S4CA 5FZIA 1QJU2 1OD5A 4YSFA 5IVJA 1C1FA 3THDA 2E53A 2UU8A 4MLOA 1IS6A 1NOVA 2GMEA 2WS93 5JVVA 3J9SA 3SISA 1R092 2CSGA 4A7YA 4ISRA 5IVVA 1W8OA 1XU2A 2CDOA 1XU1A 4RFRB 2DWRA 3O0WA 1DQ0A 4KGQA 4NVPA 5E6HA 3C7FA 2X29A 3SH4A 2IZWA 2P3KA 1CZVA 1NT0A 1RVF3 1V6KA 2YPJA 4GAZA 1XSQA 2R16A 3GF6A 3MW4A 1RMU2 1SLCA 4S2DA 1RTVA 2FQPA 2BNNA 2OT7A 4UF0A 1AR63 2KR2A 5JI9A 1OKQA 1O3QA 5KHIA 1LESA 2F6BA 4I0AA 1W2OA 2V4VA 2VW2A 2GNBA 3PVBB 1VBB3 3PJYA 4NN0A 3M3IA 2ZPXA 4FXKB 4BIOA 1BVP1 1LOAA 3WP6A 3GCWA 1O4TA 2H0VA 3KGZA 2ORXA 4QGLA 5A7WB 1QJU1 2I45A 2HKXA 3N36A 2ARBA 4CDWA 2VVFA 1G86A 1GOGA 3ORJA 4XZPA 2D6PA 4DO0A 2DCYA 4A2UA 1HB3A 1Q8OA 5HCAA 5FZOA 1PMIA 3N9LA 1W6OA 4LE3A 4MGSA 4KH9A 4Q0PA 5IW0A 2SBAA 1VBD2 4XFIA 5KC6A 3W5NA 4MGIE 2HEWF 5LATA 3IIIA 4NPLA 4K7JA 1HN0A 3A0NA 3J7MA 4NROA 3J26N 2R062 1K12A 4E2GA 3IMNA 4M01A 2Z42A 1RGSA 4M00A 1VBE3 3MIBA 4B4PA 2BDRA 1NA1C 2G4IA 2B4KA 1DHKB 4XUOA 2R042 3WF1A 4Y24A 1GLHA 3ALQA 3CZUA 3PU8A 1F2NA 4Q0SA 1PGL1 3T3YA 1DLCA 4N90A 1LGNA 2G1MA 2VUDA 3FFZA 3JD73 4C1XA 4UBGA 3O1VA 4LIVA 2PQSA 4IGOA 5LASA 5K4LA 3L2HA 3K77A 3I59B 2VZUA 4LO8A 2WFF1 1Q3EA 1URXA 3O5SA 4XOGA 2BJSA 2K2SA 2W52A 4LJHA 1MS4A 5T50A 2XMLA 1N1SA 4D6QA 3NJYA 3U4SA 4B3NA 3C8XA 1OT5A 3OGJA 4OCTA 2JG9A 2XJRA 5FZBA 1Y9MA 4Y22A 3WF3A 1RUH2 4KMQA 1ULCA 3IN9A 2JJ6A 1FI2A 2Y6KA 4M3CA 3MLJA 4WM7A 1CX4A 3OY8A 4Q8KA 2YB7A 1CR7A 5KHKA 5CNAA 4WBBA 2IXLA 2VNVA 3CNAA 2QJVA 3ACHA 2DCKA 1XNBA 3USUB 2RS31 3PJQA 2NN8A 2ARXA 4DXSA 2L9LA 2IC1A 4S2GA 4XETA 1H4GA 2D6MA 3EHKA 4QKBA 5F6KA 5LA9A 3THTA 3OGGA 3D4KA 1LEDA 5FYBA 4JVAA 4WVWA 4XF0A 4AR2A 4XCBA 5GLUA 1JOJA 2MEV3 1YQ2A 3IB3A 4GIQA 2TUNA 4OHWA 4CPBA 5LY2A 4Q4V2 4PIZA 2QKDA 1W8ZA 3BPSA 3JB8A 4YVWA 4LTAA 5T5PA 1KD7A 1VR3A 2CAUA 4G3YC 1TMF2 2JENA 2QQLA 3LZZA 3M7AA 4FFGA 2QTWB 2K46A 1IZ3A 2E7AA 2YC0A 3VD4A 1ZRDA 5J37A 4TXWA 3IPVA 1ZBE3 1X8EA 2XQXA 4ZKTB 2NP0A 1GQGA 1RVF1 2HYKA 1UYXA 4R4ZA 4Y1VA 5IK4A 3QBQA 2PXJA 4H7MA 1ZREA 4JGZB 5JXGA 2XPJA 3LEMA 1EV13 4BQ5A 4XJUA 3BTAA 5FUPA 1H6YA 3N9NA 3HT2A 3POBA 3GNEA 3O1MA 1SDWA 1JYNA 3ZLIA 1A78A 3MI8A 3DECA 1ZA7A 3S5QA 2WFPA 2WIIB 3SLIA 3LAGA 1LKNA 3H9AA 2JE8A 2WNOA 5FXZA 4YM1A 4Q4V1 2KD7A 3GHMA 3NAPB 2VM9A 4OMCA 4CDUC 5EZWA 1JYWA 2WLPA 3MV01 3I54A 4AVSA 1RUC1 2P17A 4COWA 5ACA3 4YZ2A 5FLIA 2D5HA 2VBBA 1TG7A 2Y33A 2A6WA 3BTXA 3VBHA 2DVBA 4JHTA 1RC6A 3SXWA 3GCXA 1KITA 4HPKA 3DKQA 4HN1A 3POGA 1PIV2 4TN7A 1VRH3 4AEMA 2UURA 2VZTA 3E5XA 1TEIA 1Y9QA 5IVEA 3OGRA 1YJLA 2NYYA 4D6RA 4RS5A 2IFRA 4XF1A 2XJPA 4BHPA 5ABJB 1G6NA 2F4PA 4LK6A 5FPZA 5FQ0A 1KRIA 4N43A 5A6QA 4UXAA 1S1AA 4BQ1A 1ZX5A 1RYYA 4AFDA 3ZSKA 3JD71 3VD5A 1X7NA 2ZABA 4MV2A 1PGW1 1OBNA 2BVBA 2ETEA 2ZX0A 3O1RA 4HKWA 2PLV3 3WP3A 1HN1A 1PK6B 1EV12 1KDMA 4IGPA 1GWLA 1LOBA 4EJRA 3KMHA 5F7UA 1RUC3 2NZ9A 4LKSA 5KXEA 3N4MA 1R1A2 2GP3A 1EY2A 1J58A 4QQOA 2FMYA 3QH7A 2VUAA 2JWPA 2WKKA 5FK8A 2XXZA 5ANNA 1TME3 4K8RB 1AYN3 5JSRA 3WW1A 4AEDA 1PMHX 4NOTA 1S0GA 3BODA 3IDAA 5C70A 3MIFA 3W21A 1V0AA 5LBBA 1O7FA 1FATA 4IV1B 4CUAA 4XUQA 5A33B 1AL21 1LU1A 1AHSA 1OUSA 3CJIC 3CO2A 2FD8A 2XJQA 1ND3C 2VE1A 4NUBA 3SCHA 4Z82A 3VD9A 1L7QA 2ZZJA 4QPGA 5CKQA 3VB9A 4AVTA 4XJZA 1C28A 3AMQA 1X36A 3G6JB 1GFF2 1TME2 3ZN5A 1R1A1 3BALA 1QXJA 4HANA 3RWKX 5D21A 3NNJA 4E4SA 2RDQA 3H1YA 3D5OA 1NLQA 3SKJE 1G9CA 3AKRA 3GBFA 5E89A 3RI9A 1W3XA 2A6XA 2RM23 2Z4FA 2Y0IA 1GKBA 2RDNA 4Q4W1 2VBPA 2AREA 4DY3A 2Z2SB 4YNIA 2VR4A 4P08A 3I2KA 3KT1A 5A32B 5J1XA 4OHZA 4LITA 4EROA 4KU7A 3I49A 2QDRA 4XJAA 3B5LB 4J6GA 4AI3A 2BERA 4IERA 3J7HA 4XIOA 3VLBB 1DGWX 3WNKA 2A3WA 4LHKA 5DN2A 2P6HA 2OKXA 2A71A 4KBZA 5F5IA 2JG8C 3LA2A 2KXLA 3LDBA 1N3PA 5SV5A 2WT1A 4FTSA 3O12A 3KVAA 5CZKA 2WINB 1W90A 1WLWA 2WA3A 3T2TA 3DYPA 3WQ7A 5IFTA 4QHBA 5JR2A 5IK8A 2VXJA 3PTRB 3WQBA 1SHWB 1UXZA 3WUCA 4Q4W3 3WQ1A 1XRUA 2ZHKA 1RHI3 2VNRA 2JKBA 1YYNA 3S6PA 4A6SA 2BV4A 3ZYHA 1OH3A 1SFPA 2D6NA 1I5ZA 3KLSA 4RGKA 5LW9A 5D2AA 1H9PA 3JQWA 3VD3A 3C7EA 5DUWA 4TYSA 1W9WA 2PHDA 3KCXA 2BZDA 5JSPA 5BNPC 4Q0UA 2J1VA 4OI4A 2OX0A 2DFBA 2VZQA 4OI1A 3WUDA 3J7LA 4Q27A 4QX5A 3W20A 5KR7A 3LWCA 5IYYA 3K46A 3ITQA 3VZNA 3GHNA 2XJUA 3FFQA 2RS13 1SFYA 3MO4A 4OULA 1GBGA 1BMV2 3GJBA 1D2QA 1UY3A 4XCAA 1S0EA 2R072 3ETQA 3LSEA 3ZYFA 1W6MB 1JHJA 3KCCA 3KF5A 1AVBA 3OOXA 4M3CE 2XVKA 2K0GA 2Q5TA 2A75A 1PHMA 1U5IA 1UZZA 3FBYA 3MIDA 4XZUG 2Q30A 5SV8A 4LR4A 4PDWA 1V6NA 3KSCA 4GZ9A 4RHV1 2V5YA 1US3A 3WINE 1GZWA 2EF6A 1OA2A 2BEOA 3E97A 3HJRA 1J1LA 5A3OA 3T1MA 5A32A 4XBQA 4YGCA 1W39A 3WX5A 4LKFA 3ZDSA 2E7QA 1EPZA 3PIJA 4HT1T 5BXXA 3AP5A 2WO2A 3AVSA 3AB0A 5EV7A 5A7OA 4TLFA 1SLBA 5C9AA 2G9GA 2YHJA 2RS11 4QB6A 3ZXJA 5H9PA 3LKJA 3URFA 3HNYM 5AFEA 5L36A 1HXS2 3GBWA 3AMNA 3NV3A 1BMV1 1ENQA 1ZBA2 2XB6C 3LD8A 4XMIA 1MR5A 2WQ8A 4K1YA 5F3CA 4QDQA 5FP9A 1BXHA 1UZYA 1H2LA 2P4EA 1KDKA 3FN9A 3E6BA 3IDEA 1H8TB 1V9U1 2EICA 5HV4A 4AI2A 5J7MA 2JDPA 1A6CA 5J09A 3RZJA 1W03A 4L0PA 2D7FA 2HWE3 2WC2A 3CMGA 4IEQA 4NE9A 4KWUA 4HOOA 3NJVA 2HWD2 3Q8CA 4ZXKA 5JR7B 4YZ5A 5A3TA 2GNMA 4HK9A 4E4DX 3R0RA 3HWJA 3NL1A 4HZFA 1DZRA 1JH5A 3EXUA 3CEWA 2ZGNA 1O8SA 1ODMA 1ULDA 1FX5A 1PO22 1UPSA 1CZTA 3S7IA 3O1UA 1DYPA 1KEXA 4XQWA 2KA3A 4FXGB 3T1LA 4URTA 3SHRA 1WD3A 2VZPA 3LIGA 4XFAA 4CYDA 5JZGA 4YYOA 3WD5A 1UMHA 1VJ2A 1IG3A 2RMU2 3FLRA 5FY9A 1DYOA 4LLFA 3WNXA 2XQRA 5HBAA 1QY4A 1STMA 1H1AA 5FZDA 2YU1A 4FOYA 4AQ6A 5IFPA 3WXPA 2GNTA 3ZXDA 2GU9A 3R4SA 1SMVA 2BW8A 3WY6A 3WW4A 3OGVA 4OMDA 2WNEA 1AF9A 1DYKA 5D8AC 1RMU3 1SEFA 2YUEA 2HBUA 2D6KA 5ERLA 1CAXA 1MS0A 4RS5C 4R9AA 2YC4A 3KQ4B 3H8XA 3FJSA 4ZXEA 1SBDA 4QU1A 3UK9A 3WNMA 1JZ7A 2RR13 4IE5A 4NJ4A 3KHCA 3AKTA 2WNVC 4GB32 4R4XA 2E32A 3UJOA 2GC2A 5J36A 2V4AA 4OHYA 3HQRA 5FR3A 1RUI2 4JHZA 2HWD3 1GWMA 1LU2A 2ZMNA 4I3GA 1IKPA 1DFQA 1ENXA 4W50A 5CIRA 3C7HA 3ZDVA 4HETA 3H8UA 1MEC3 5I0TA 1JUIA 2AUYA 4QAWA 4XC9A 1UX7A 4M4PA 5DAQA 3TN91 1Z0HA 3AZZA 4CRQA 1OQEA 2JDKA 3I2OA 4QB1A 2HWB3 1WBFA 2XG3A 2RE9A 2HYXA 5FZAA 2VCAA 3WF0A 4BCUA 5KBFA 5FZ9A 3KT4A 2MPFA 3NWKA 3PUHA 2IVIB 2VPVA 2YGMA 2AGSA 4UBHA 3ST7A 3T0BA 4OZXA 2RR11 5FY8A 3VZKA 3ON7A 3VDAA 3ZXLA 4FPYA 2VVEA 1S0IA 3IDBB 1L7RA 3M70A 1H6XA 2ZA9A 3CL1A 4XURA 5DZFA 3CJIA 1S0JA 3AZXA 1VBB1 3PU3A 2H6CA 2XUMA 4UW6A 4OQ9A 3K2OA 4AW7A 2FDKA 4NWVA 1HLCA 1D4M2 1QXRA 3J8F3 3BUCA 2JICA 2LALA 2WO3A 1JZ8A 2E7TA 5TSWA 3H1MA 3IWZA 1IOAA 2IXKA 1W0PA 4WVVA 1MQTB 3RYRA 3LQCA 4JGZA 1Q8QA 1WMEA 2XL7A 3WR0A 3SNMA 1W2TA 3ZN6B 1GMMA 2CGPA 2JB8A 2FMDA 1K5MA 4JGYA 1S2KA 4U36A 4L99A 2ERFA 2OZJA 4Q26A 1JYVA 1ZRCA 4I3PA 5H9SA 2CAVA 1CAUB 4BMBA 5K9YA 5A3PA 2J1EA 2OZ6A 5FYZA 4D8MA 2VQUA 1HIXA 3P3NA 5FZHA 2B46X 2JKXA 4W8JA 3DGTA 1RJ8A 2R063 1UY1A 3ZXGA 4H3WA 3SQOA 5A6XA 3J4UH 4JAAA 1QJX1 1FNZA 2YC2A 5C8CA 1RB8G 1W8HA 1Q5OA 4IW3A 2OVUA 1G9DA 3VD7A 2DVDA 3TEYA 2ZBJA 4QM8A 4ASLA 2JDYA 1U5XA 3VBUB 1XXNA 2AC1A 5C33A 4LA2A 5IHRA 2GN7A 1HQNA 4HKLA 4XF3A 3FX3A 4DQAA 4CVUA 1POV0 1P8JA 2ZMKA 3AK0A 4YM2A 3O1SA 1CJPA 4Z2WA 5T55A 3WDWA 3E1F1 2CGOA 5HI0A 1ULOA 3NV4A 2QE3A 2C9AA 1HX6A 2PAMA 1RUD3 2WQ4A 3AZWA 3H1WA 3IIAA 4FOVA 5L19A 2KM2A 4ZZ5A 2UWCA 1G9AA 3O1PA 1RUH3 4QPYA 4LUKA 2EXJA 4RQPB 4A6OA 2JDHA 2W9XA 5AVPA 3AYAA 5FRAA 1YI9A 2R041 4GMP0 2Q4SA 3HD8B 1GR3A 2I07B 3WZ1A 1QJX3 1YRZA 2OIIA 4OLLA 3ZR5A 1PGL2 3LEGA 1MZFA 3IMMA 4RQPA 4BQXA 1R1ZA 4Q2FA 4UI9L 3WW3A 4YVWC 4MADA 2IXIA 4F3JA 3A23A 3OUJA 1IS3A 1RIRA 4W4ZA 2Y6FA 4IEZA 2WFF2 2VAUA 5C71A 4YM0A 4K9SA 5ANQA 5D8AB 4DXZA 3LIHA 4TTGA 5C5UA 5FPLA 4BE3A 1VBE1 4EN0A 4FTEA 3UV9A 2ZGQA 4NIIA 5CFDC 1JYCA 1PGSA 1FT9A 1ZRIA 1FPN2 1LHUA 3V65A 2VULA 1EAH2 2E9QA 4NRQA 2JEMA 4UW3A 4AEKA 4AI8A 4XVHA 4CCJA 4INDA 1WCDJ 3DPRB 3IBMA 4YGDA 3N7JA 3WG1A 3BTZA 3CKHA 1D2SA 2WQZC 1SPPA 4P9GA 2ARAA 4N9IA 4MGZE 4QHOA 1J1TA 1LRHA 2V09A 4QDRA 3VBRA 4EN7B 3VZJA 4LXLA 3HT1A 3ZFFC 1OHFA 2B7YA 2JIGA 5K8SA 4YG6A 5AFBA 4CDQB 1HRV3 3MFCA 3K3OA 4FPHA 2GP5A 4CDQA 2YFUA 4XFBA 1UPIA 4CU8A 4AAXA 1QDOA 2VW1A 3ETPA 3J8F1 3WW2A 3MFAA 1TZOA 3MLLA 4A3ZA 2W87A 1G9BA 1HW5A 1JBCA 2WFF3 2B9VA 3DXUA 3KZ4C 1VBA2 1OXCA 3P3PA 4P14A 3UKVA 4BZ4A 4FSJA 1XE0A 3OBTA 1LHNA 2VMFA 4ZY9A 1VP6A 1WLCA 4YFZA 5A3NA 2C9KA 1RUG3 1JU3A 1NE6A 1ONAA 2JB4A 5FBJA 2D3PA 3U07A 3U78A 2BP6A 3M8LA 5E16A 3VDCA 5JXIA 5DZEA 4COYA 1C57A 1GUIA 3CBNA 3VKMA 4D0QA 4CUBA 3FUOA 4I01A 4DINB 1N1YA 1OLQA 2DDUA 2YPDA 5G04L 4I02A 5EJZB 4NIAA 4CP2A 5EPAA 5DDJ3 4ZONA 3U4XA 4COUA 1GP6A 4LOTA 1GSLA 1YIFA 1EYBA 3ATGA 3KD4A 5FZ6A 5C4WA 3T08A 3HEIA 2VZ1A 5IT6A 2G9ZA 4GJZA 4AQ2A 5I0DA 4MGKE 2PHXA 4MG2A 3N35A 3WQ0A 3W59A 4E8DA 5E8AA 1AR71 4PJYA 2GMMA 1WCSA 2ILMA 3A22A 3PL0A 4D7SA 1F31A 4AHXA 1ND3A 5JMOA 4XDOA 1J84A 1W9SA 2DVGA 1UOBA 3SC7X 3VBFB 5HCBA 2ARCA 1UZVA 5FUNA 2P1BA 3BOPA 4COZA 5M0TA 5LBFA 3WCSA 3JB4C 2CWSA 2WLQA 1NA1A 4AVVA 1H30A 2LTNA 5FZ1A 3JD72 1TQ5A 3D3AA 4M0NA 3T4VA 2HWC1 5T5JA 1AJKA 1NQDA 4B7KA 4QQLA 1XNKA 1NCQB 2WNUA 4GH4B 3KF3A 1F4AA 2R7EB 4HBNA 4LK7A 3BN6A 4HFSA 1HV1A 1DCSA 3LFIA 1A3KA 5DUVA 5FOJB 5FZMA 5A7NA 1F5JA 1GYKA 3AYDA 3JUUA 4AI0A 4CCOA 1NY71 2QFEA 4CE8A 3GGLA 1LOCA 1TNRA 2JG9C 4IE4A 1CD3G 1VMJA 2UYBA 4A44A 4BB3A 4DNYA 1K42A 4CEYA 1CAUA 1DF0A 4Y1ZA 4LHSA 1RUF2 3VZOA 3WDYA 5C5TA 1DG6A 4RGGA 3KHBA 4OFGA 2AZ5A 4WM7C 1H8TA 1UY4A 4KQ7A 4PIXA 3POIA 3OEBA 2QQUA 4R52A 4EZ4A 3USUA 4UOJA 3RZKA 2XWJB 3HAGA 1AZDA 4CUCA 2CDPA 4FCAA 1PVC1 3UKNA 4Q4X2 3UJQA 3VKLA 2MEV1 1JW6A 1IQDC 1NLSA 4ZU5A 1TME1 4WM7B 1W0OA 1NXMA 4JDNA 1ZRRA 1FMD2 1W6NB 2Y34A 1ND3B 5L73A 5F1RA 5LWBA 4G4FA 5DQ0A 3EJKA 1C8M3 2K9ZA 3ENRA 4LOSA 2ZS6B 2PELA 3T09A 1AL23 3P5BA 2LM3A 2AEZA 5FZCA 3MW3A 5CEHA 3PIGA 1CIYA 1RUJ2 4MHUA 3WP5A 3VL8A 5KHJA 3WDXA 4GWNA 2EXIA 2GC0A 4Z8BA 4O9EA 3AXDA 2IUWA 1BQPA 1RUG1 1ZRFA 4HVQA 1UL9A 1LOFA 4NRMA 3BKZA 3VGIA 4GH4C 1D0GA 4GULA 2OA2A 3B9CA 4O7XA 5F3IA 1HXS3 5G05L 3OUIA 4AQSA 4IEVA 5IUQA 4Q0QA 4N9HA 3ACLA 5FIXA 4WZFA 1W05A 3ZIWA 4Q4X1 2FCUA 3NSTA 2E26A 3QLQA 5EHDA 1GU3A 3AL5A 2PLV2 1VMFA 3GALA 3M3QA 2X05A 3PLQA 4OVEA 1V6JA 2BU9A 4HL0A 3ZFGA 5FYHA 3INAA 1WGPA 3R05A 4JKMA 5FZKA 2NQYA 3ZYGA 4JC1A 3GDBA 5A7SA 1FV3A 5D1IA 2PYTA 5ACA1 5IVCA 4YW7A 1UN1A 1DU3D 3VDDB 3HBKA 4CDUA 1SCRA 4H7LA 1MZ5A 1Q8SA 2IXHA 2D40A 2VY0A 4RL7A 3THPA 2BNMA 5CKMA 1AXKA 2VMIA 3AZVA 3BI3A 4B4RA 1AL22 2BGOA 2PA7A 4LBMA 3OBRA 2WZ8A 1Y43B 2O0OA 4M3CB 3VBHC 4QB2A 4XABA 1VIWB 3F95A 2A6YA 4OI2A 4FQ4A 3POYA 1UU5A 3VBRB 3O1OA 1N47A 1V9U3 4AHZA 2PLV1 4IETA 3U10A 5FO7B 3L9JT 1TE1B 4E8CA 5C4WB 4F8AA 4HONA 3M3CA 1OOPA 2W94A 4E2QA 1WWYA 1QWRA 2YG0A 4KL1A 3PURA 1KGYA 4CXYA 1H8VA 5FMOL 2VH9A 1ZM1A 2CV6A 3RS6A 5HXVA 4Q29A 4XJ8A 3I2DA 3NJXA 4Q4W2 1VALA 2RM22 4WM8A 5FZ3A 3I3DA 3AJZA 3D0SA 5CBLA 2ES3A 1C1LA 4XJ9A 5AC92 4KI5M 2HWF2 5JOYA 4X8NA 2J22A 5A6YA 1ZZ8A 5D8AA 3ZFEA 3THCA 2VQTA 5JXHA 4XHBA 1VLNA 2HJIA 4LIUA 2JECA 3Q8EA 1LOGA 1XSRA 3RMYA 4BQ3A 1HRI3 2VCCA 4Y5TA 3MEPA 2P5BA 3E6DA 3VHNA 5A6ZA 4FPJA 2JE9A 1DGWA 3ZMNA 4H55A 2AH2A 4KWJA 1MS8A 1XYNA 2ZZQA 4CDWB 4N8MA 5GZDA 5L7OA 3I3BA 4DB5A 5FPVA 2ZAAA 1H2NA 1G9FA 3CIHA 5C3QA 1GZWB 1Z78A 2UYAA 4GALA 1CONA 1SCSA 4UFKA 1CJDA 4AWDA 5FZ8A 1TVGA 2WSUA 2WYFA 3RZGA 2HWF1 3KWVA 4UF0B 3PUSA 4KNCA 3AP6A 2E31A 4JTOA 1FOD2 3MIEA 2R32A 3N7LA 2Y64A 5DXDA 3ZM8A 1WLTA 1UU4A 5CFDB 1WW6A 4MYEA 2ZHMA 1JU4A 1QNWA 2ZGUA 4QX8A 4QXHA 4GD4A 3OPTA 3DPRA 3SCGA 2VMEA 1B35B 4XFFA 3I2GA 3NKGA 4OZOA 5FY7A 4ZS3A 3W5MA 1PX4A 4FP2A 4MGQA 4MUVA 3ZSEA 2YYOA 2DUPA 2VMHA 5FZEA 4DUXA 4E9KA 5DMYA 4HKOA 3T0DA 2PHFA 4AZZA 1JZ5A 5C3SA 1SG3A 1WA4A 2DTWA 2RVAA 5A7QA 4NIDA 3AFKA 3EB7A 1GWKA 1JS9A 4P02B 4C90A 3SEEA 5L9RA 2W08A 1YFXA 2RV9A 4ARYA 1AL0G 2HWF3 2FDJA 4AEJA 2VQ0A 3I97A 2MHFA 1OFSA 3JQXA 4XMAA 5IWFA 4NPRA 1ACCA 3RNSA 2I74A 1F15A 1W6QB 1COV1 3D0JA 4XJWA 1N3QA 1OPOA 3CQOA 3SITA 2ZGSA 1BBT3 3V64A 1QQP2 1Q8PA 3ZX7A 2X8KA 2EAAA 5BNOA 1LJ7A 4GKXA 2QQPA 1ND2B 5IJRA 1PO11 4ZU4A 4ZHNA 3OEAA 2XBO1 2EIGA 1YJKA 3KV6A 2WWUA 1DQ1A 1NCRA 2UWBA 4QKNA 1AR61 2J1SA 1RUD2 2W0XA 3RJ2X 2OQ6A 3ILRA 4FQZA 4NIHA 3K48A 4DRRA 4CCMA 2AENA 1SLTA 4LBQA 4CCNA 4UFLA 2HWD1 2DFCA 3VBUA 3UGFA 1VBB2 3ZSJA 5FKBA 2B9UA 3R4DB 3U14A 4W65A 3JU9A 2WL1A 1PO21 3JBG2 2VOXA 5C8CB 1BYHA 3AJYA 3OYWA 2IVJA 4MZUA 1CIWA 1COV2 1PMJX 4YRDA 5FO8B 4WVMB 5F9TA 1PO13 1BVVA 1E5RA 2P3YA 2RMU1 2XLGA 4UAPA 1AYM1 3AKQA 4M0HA 4N53A 3LPGA 4O65A 1V6LA 1ZA4A 5GKAC 3U75A 2QUOA 1LODA 2WYSA 3UYJA 4A3XA 2R1BA 1FPN3 1GZCA 4BWOA 3RFRA 2Q0AA 2RDSA 1OD3A 4XYXA 1MACA 3P6BA 1RUD1 2PHRA 5GM0A 3OPWA 4LBJA 2VXRA 1QQP3 4IE7A 4CP1A 1JYXA 1BHGA 1W3VA 2I2SA 2ZMLA 2E6VA 1ZBA3 4V2VA 2YDEA 3S30A 2XKPA 3VBSC 1OC1A 1PVXA 4Z07A 1CAXB 3I8TA 1XNTA 2HWE1 1E5IA 5FO9B 4K40A 1LOFC 2AR6A 2D97A 5J96B 1LNSA 1QMJA 2HWB1 1UYYA 3O14A 1GOFA 3C7OA 2VD7A 3HQXA 2RJLA 1M06G 1M4WA 2QVSB 1ENRA 3MICA 3JBG1 4IEYA 1VBC3 5FZ4A 1QJX2 2B45X 5FP4A 1WW4A 3AP9A 4META 2ET7A 2F17A 1NA1B 1AYM3 3RDIA 1YFYA 4IQPA 2XHNA 4HSLA 2X10A 2BTVC 1B35C 1LENA 1XC6A 3LSDA 3MDPA 4G9SB 4LO4B 4TSVA 4UWDA 5FZFA 1FNYA 3I2IA 4UYBA 1WUVA 5FMCA 3OF1A 5GALA 1R091 4CCLA 4AVBA 1IPKA 4DXRA 3BU0A 2FDGA 2W95A 2JDUA 3APBA 4NWWA 2QQMA 4QXCA 3T2QA 1KQRA 2VOVA 3BU7A 4P5HA 4W6WA 1PZ8A 1OVSA 1UXXX 1YWKA 2JX9A 1CAWA 4EV0A 3TAYA 1RMU1 1DQ5A 2WZPP 1ASJ2 4DFSA 1NZIA 3O1TA 3S57A 1UCXA 2RS53 5BNNA 2IWGB 1JN2P 1N3OA 1UOFA 3RVHA 5KHGA 1VAVA 2HWB2 3NRUA 4IGQA 4AOCA 2VCBA 4QT6A 5F2WA 4MSVA 2XOMA 5KXDA 4MGYE 1BEV2 5IAXA 2WA4A 3MUZ1 2QQOA 1OUXA 3AX4A 5A1LA 4P9LA 4AEDC 1R093 1VPHA 2F4LA 3PDQA 5FTTC 3WDTA 3V0BB 3I2HA 3U0ZA 3RZMA 5FZOB 1H2KA 1ULPA 2W1SA 5EYYA 3SEPA 3WNOA 3WV6A 2X5IB 4Q4Y1 4XQ4A 1XPWA 5HV0A 1YFUA 1NKGA 3RYKA 1AX1A 1HJGA 2GH2A 2BWCA 4Y4YA 2UY9A 4ET7A 1CGPA 5B4XA 1FYUA 4IV3B 1BEV3 2WAOA 4QPGC 1QJY2 1C5HA 1HB4A 3MF6A 4ASMB 3NNMA 4XAAA 3IPVB 3W58A 4PLMA 1VBC2 2VBDA 3ZFEC 3NKTA 5BPXA 1HDKA 1W6MA 1AXZA 5CVRA 4CP9A 1VRBA 4FFHA 3NQHA 1DIWA 5ISLA 3RYPA 2PTMA 1NQJA 3BYWA 4YARA 5IK5A 1WCUA 5C4WC 1MVEA 2OQ7A 5FP7A 2WS91 3ZO0B 5FOBB 2X5IA 1YNAA 2BFUS 2BNOA 2N7GA 3EYPA 4JKLA 3WDVA 4JDOA 2ET1A 5FZ0A 1PO23 4CEWA 4QGNA 5L7OC 4Q4Y3 1GP4A 3J8F2 1MS3A 2BBAA 4E27A 1F9KA 1AYN2 3ZFGB 1EUTA 4BOWA 1DP0A 5FYMA 5CADA 3KCYA 4KBBA 5CAZA 2CU5A 1ULFA 5A80A 3WLUA 4UFJA 3WF4A 3ZVXA 5JAXA 2OUHA 1X9TA 1QJY1 3VDDC 1HV0A 1IPJA 1AJOA 5K0UA 2A70A 2PFWA 3LFMA 4PCRA 3OJBA 1SDDB 1XBFA 4R9DA 2XL9A 4FPOB 2W46A 3MIHA 1VMHA 3KT7A 4YGBA 4BDVB 4WM8B 1QOOA 3ECQA 2P2KA 4FPEA 2UY8A 2ZGKA 3SCFA 3I3MA 2WNUC 1HB2A 1YFWA 3T2OA 4DPNA 4ZZ8A 4CSWA 4ATEA 5F8PA 2E33A 4JQRA 4PIYA 4IEXA 2LUWA 4K20A 3WCRA 1OOPB 4Q1PA 1Y9GA 5GZCA 1RUE3 2WZR2 3MPBA 2XH6A 3VBOC 2JD4A 3DYMA 5C3PA 4BK5A 4TLGA 4GWMA 5LRSA 1O5LA 5HCHA 1ZZ7A 3LGRA 3RWNA 2BBVA 2GC3A 2JDZA 2VU9A 4QPWA 4CEYC 4LO6B 5BNPB 4JRAA 4QQHA 1AYN1 1RINA 4BQ4A 1VAKA 2O8QA 5FZLA 2ADEA 3NNLA 1EAH3 3MV11 2XVGA 5FXXA 3V0AB 3VZLA 5LEJA 4NHXA 5K0UB 5DAVA 5H9RA 5FCCA 2YROA 3I2JA 5GZFA 4WVZA 3N9PA 5IVBA 1KJLA 2R043 4OYUA 1HB1A 2QNKA 2ORZA 3B7MA 1UQXA 4AFCA 1AR93 2A73B 4FOQA 4PHZA 4LULA 4Y1XA 1XE8A 4O61A 1IG0A 2AACA 3VHPA 5FPUA 4R9CA 1F4HA 2W92A 4N7IA 4Y1YA 3NNGA 4XQDA 5LEKA 1VBA3 1QH6A 2CL2A 2JG8B 1VAMA 5BYNA 4QPIC 4BYYA 1JXNA 1CAVB 1SLAA 3PVOA 2BFUL 3GZEA 4KG8A 4MXWB 4IL7A 5A33A 3TYJA 4TZDA 5A7WA 2WUHA 5L9BA 1VB4A 3IT8A 1APNA 1GQHA 2ZTNA 4QX0A 3TRSB 4O9GA 2DUOA 5CFCB 4MX3A 1QJZA 5FJKA 4ASKA 5CA6A 1ZBE2 5FY4A 3JXSA 1AR83 4AQTA 3WG4A 1DQ2A 2XUEA 3QOPA 3DL3A 3LCPA 5CFCC 3U11A 3B00A 4FPFA 3MF9A 5IK7A 1O3SA 5DAPA 1KFUL 4LBQB 5IAVA 3BOWA 3KS7A 1AR73 4LHNA 4XAEA 1RUOA 4FTBA 2Y60A 4P9IA 3QACA 1NCQC 2CGNA 4CP0A 1UWWA 3OSDA 1H9WA 2GZWA 1QJFA 4FBFA 4QX3A 1JOBA 1GNZA 1O4YA 3LB9A 3DXTA 4BXSV 1AR92 2X53S 2Y0OA 2DVAA 3GZTB 2VGDA 3KM5A 4HG6B 4P00B 3ZN4A 3CJIB 4SLIA 4LKEA 4R8HA 1UZ0A 2XLAA 2VOKA 1FMD1 1W04A 4EN6B 1BK1A 1YQ8A 4AGRA 3I3QA 2ZEZA 1ZBE1 4Y26A 2VMDA 3O0VA 4XE9A 5EP9A 4DIQA 1C5IA 4XFCA 5BNQA 2YBPA 4FFIA 5GLTA 3ZYPA 4KWLA 2PAEA 2VQAA 1LCLA 1RVF2 3PHMA 4UFMA 5DUXA 3TNQA 3ZPYA 5A1AA 5JXJA 1J3RA 2D44A 3D6EA 3OCPA 5JWPA 1PVC3 1S2BA 3A7QA 4Q5OA 2BGCA 3WNLA 1RUG2 2NM1A 5F32A 3KV5A 1LHWA 1W8UA 3GXUA 3POWA 3ASIA 5FYUA 2JE7A 4CDXC 2WNVA 2B5HA 1NZCA 2WSVA 1WMXA 1JZ2A 2HWC2 3DKWA 3KGLA 1XYPA 3KB5A 4B7EA 1H1IA 1A34A 1MZEA 2BGPA 4AVAA 1W8WA 1MS1A 4Q1RA 5EFUA 5ABJC 3C2UA 3VZMA 1UIJA 5BNNC 5FV3A 5HPOA 1BJQA 5DAWA 1O4ZA 1RUE1 2JDNA 2BVVA 1RUC2 3M3OA 3ZXFA 4C91A 1RUF3 2X09A 4QMAA 4QKDA 1NYWA 2DF7A 3MYXA 3UT0A 1PZ7A 5ACA2 4XTMA 1GNYA 3BGAA 1VRH1 1Q56A 3ZYIB 2V72A 1YC61 3ABZA 4L8QA 3C7GA 2QZ3A 2YBKA 4DUWA 4QD2A 3ZMOA 3RSJA 4D69A 2ZGPA 5LZ6A 5JOXA 1RUJ3 4CU7A 5L7OB 2D3RA 5CG8A 4LO5B 3T30A 2G19A 2CY6A 2EVXA 4N53B 2GALA 5C3RA 2LRPA 3ILNA 3WHTA 2QQNA 4FPLA 1UZWA 4DEVA 2C24A 1PVC2 4JRLA 5A3MA 4NHKA 1JZ3A 4IEUA 1OF4A 5FZGA 3ZFFB 4AG4A 4EE2A 3OBZA 5T5LA 3LDKA 1LGBA 3E5UA 1HRV2 1QKQA 3NAPA 4H2AA 3J7NA 1V00A 1POQA 4JGZC 4MO3M 4ES8A 2W1UA 5JMCA 5CG9A 4Y5SA 1OLME 1RHI2 3AP4A 2ZACA 5FUIA 3SMHA 4Q4X3 1YI7A 2QDNA 4QQ2A 3NW4A 5C6CA 4XDQA 1O91A 5F2SA 4AGVA 1RUJ1 5FY0A 1CPNA 2WO1A 2X5IC 3WG3A 3M3EA 3TEZA 1R081 1RXFA 4FAHA 3DPRC 4CEWC 1XQNA 4S2HA 4HLTA 1CQ9A 4RGAA 3AVRA 4NO4A 5AC91 5A3UA 1CN1A 2O1QA 5GLVA 1NCRB 1OH4A 4P9XA 4RSUA 4K21A 3UESA 1X50A 4URAA 5BNOB 3B02A 4X6RB 5C8CC 4Z1VA 1T2XA 2WZEA 1I1EA 1O3RA 3K3NA 4ORFA 4I09A 4U2AA 1PNGA 3HVDA 2ENRA 4PLOA 3WP4A 2PN5A 3FLPA 4CCCA 4MHRA 4NIGA 3ELNA 4FP3A 4CXWA 4YVSB 2HH9A 2XWBB 1Z7S1 2A3XA 3OUHA 2AYHA 4HMZA 1CAVA 4LQRA 2ZEYA 4Q4V3 4XBNA 1S2EA 1YCIA 1ALYA 2GC1A 1H1MA 4EZHA 1L3JA 1LHVA 1OFNA 1SFNA 1KS5A 4Y3OA 5J98B 2DUQA 3M1HA 2W5FA 2VZRA 1R082 3BCWA 4AL9A 4XACA 4COVA 4GMP3 1C8M2 1U12A 4UT5A 1PIV3 4YLZA 4FI9A 1PM4A 1WCQA 3WVJA 1ND2C 2VTXJ 3KV4A 4EN8B 5JLVA 3PUAA 4CEWB 3PMEA 1FOD1 4X8PA 4XUNA 3S7EA 2W91A 3IM0A 5JSOA 4J1WA 1QU0A 2XBO3 2ZEWA 5EYXA 1HXS1 1ULGA 2R1DA 3NMBA 3HQUA 4JX0A 4RR3B 2QCSB 5A70A 5JOZA 2DBIA 1O59A 3VBUC 1OSGA 2QQKA 4A45A 3JCIA 2XGXA 4MGTA 5GZGA 4D7TA 4IEOA 1WW7A 3N7KA 4L92A 4LORA 4BJ0A 1W99A 4QKFA 4C0HA 4PF1A 2A5ZA 1NXD1 4XFHA 4IV3A 4CU9A 4F83A 4GMP1 1YLLA 4KU8A 4B4QA 1W8TA 4CUGA 4KWKA 4N7UA 4XF9A 5FAXA 4N53C 4PQ9A 3FUQA 4HN0A 3OD0A 3ZXKA 4GXLA 5FY5A 1QGLA 2E63A 1SBFA 3B9IA 5GLZA 1WCKA 1LAJA 3WT3A 5I0SA 4IDZA 1N1VA 1UAIA 2RMU3 1W6NA 3PUIA 3VKNA 1WA6X 2Y6JA 1OQ1A 3BB6A 4GA9A 4IXLA 2ATFA 4QHZA 2DVFA 3ZPOA 2DTYA 3E6CC 2O14A 1HRI2 1SZBA 2WN2A 1A8DA 5EQUA 4B29A 5FXVA 3ZFFA 3UNPA 4YVSC 1JHNA 2JDAA 2VNGA 3MIGA 1NLRA 2EIBA 2P3IA 2VVDA 3LEKA 5BNNB 3RPQA 5FFOC 1JI6A 2EIDA 5IVFA 1YEWA 4JTNA 3WF2A 4L9BA 1UU6A 4RHV2 4QWNA 4XPVA 2A6ZA 4YGEA 3VHRA 5DZGA 4NAOA 1BBT1 1R1A3 4BQ2A 3H3UA 4IV1A 2EA7A 4GB33 3MGUA 2J7MA 3UGHA 4CDXB 1A8MA 4RA0A 4AHYA 3DYOA 2ZKNA 4MOAA 2QQWA 4B1LA 1CX1A 3L2YA 3TOJA 1CESA 3AYEA 2NMNA 5H9QA 4R9BA 1UF2C 2DURA 4XUPA 1UY0A 2XJSA 4ONUA 1DLLA 4XDPA 3ZYBA 3POEA 2JIJA 3PVEA 1POV1 4BH9A 3AMHA 2C6SA 1HRI1 2J1TA 3TN92 2RG4A 2Y26A 3AKPA 1PK6A 2HBTA 4JQTA 1I3HA 1QF3A 4ISQA 5FDBA 4NRPA 4NHYA 2WNVB 1WMFA 1H2MA 2VW0A 1W6PA 3RI8A 3V0BA 4L2NA 5FQ0B 2ZHLA 1OA4A 1BBT2 4N43C 4RS5B 2P6CA 2WBKA 2Y6HA 4JCKA 2CTVA 2VMGA 4YZ4A 2Y8KA 5T52A 4H14A 4D7YA 1ODNA 2FCTA 1AXYA 3A4UA 1JYTA 5BNPA 4I30A 4A41A 5LRRA 3M2MA 5JZGB 2EIEA 5KC5A 2GAUA 4BLIA 1G8WA 4BM8A 4YM3A 4HVRA 3C3VA 1QQP1 4I0WB 4ARXA 4D94A 2YBSA 3AC0A 3GBGA 1H0BA 1PO12 2BRTA 2ZOEB 3OYWB 1KS4A 3CDZB 3POFA 1X82A 1AR62 4AXOA 1XNAA 5I91A 1QEXA 4FFFA 5DABA 1XYOA 3JBG3 3GZUC 5BV6A 1WLDA 4C0BA 5EWSA 3B01A 4PT6A 2P37A 2HEYF 3PVNA 1S0FA 1DZQA 5B4NA 1WMDA 2WN3A 5CYYA 4CDWC 5A7PA 2BOIA 3MW2A 4MH0E 3FWEA 5FPXA 1XOYA 2WT2A 4FPGA 4DUVA 2PMWB 1V6OA 3GM8A 3QD6A 2PQQA 4S2FA 1SLLA 1QNYA 1IGOA 1GP5A 4RHV3 5C9AB 4RD7A 3ILFA 1QJU3 5DAXA 3OTFA 4E2SA 1MEC1 1IQAA 1D4M3 3OB8A 3T4HB 4K1ZA 5FP8A 2ZJCA 1AYM2 1AX0A 3MHZA 4QDSA 3RZZA 3TN93 4Y33A 3GYDA 4LKDA 5JPMB 4F7ZA 3RJRA 4AI9A 4CCKA 1WZXA 1UYPA 2PAKA 2QQVA 4BXFA 4PDWB 4Q4Y2 5E88A 2WT0A 3RQ0A 5L9VA 4PQQA 3T0AA 4OUEA 5HCFA 4FAGA 1OKOA 1BZWA 3NV1A 3U1XA 3NO8A 3O0XA 1GZTA 4YW2A 1I9RA 5JOWA 1DBNA 4YG3A 3LOBA 1U5ZA 3HN1A 4AYUA 4AFMA 3CU7A 3RZLA 3BIEA 2BPA2 2AEYA 5IVYA 2B39A 5F39A 4YWAA 4NAMA 4J1XA 3VBOA 1X8MA 2ZXQA 5FBZA 4Y20A 1GV9A 1HQLA 1OURA 1ZZ9A 2XJVA 1D4M1 4ITCA 2JG8A 4FPKA 4PF5A 1Q43A 4BMEA 1DGRA 1WKYA 5FYIA 2WS92 3O7OA 2BUKA 1UYZA 1IS4A 3AKSA 4XTPA 5KWRA 5A3WA 3OPZA 2WJSA 2GMPA 1VBE2 1IKQA 2W1WA 1W0NA 3S5AA 1DZTA 4Y5Z0 1W8FA 2Q1FA 1RUNA 1FPN1 1VBD1 2EALA 2JG9B 3G7DA 3POSA 4AVCA 1EAH1 3HMYA 3OY8B 1W9YA 3LF7A 2WWSA 1LTEA 2O8OA 2R061 3RRDA 4K8FA 5EJ3A 4D6SA 3I4IA 5DUUA 1XNCA 3I59A 4UFHA 5FYTA 1PX3A 2H0BA 3I2FA 4QPIA 5F5CA 4DOUA 2XKOA 4AK3A 2PHWA 3X29B 4V2WA 5GLWA 2VOWA 1FXZA 2HEVF 1BEV1 3FLTA 3HOBA 5A1FA 2D5FA 1RJ7A 4D3WA 3KVBA 1FV2A 1W06A 1C3HA 1Y7BA 1TMF3 2J1UA 2W47A 2WZR1 3I7DA 2VL4A 2W3JA 1QJY3 4PDWC 1UMZA 4AGGA 3VBFC 4IV3C 4QU2A 2TNFA 4QQPA 1UD1A 1PZ9A 1J3QA 4P9YA 3H42B 4PI2A 1RUH1 3IZOA 2ZCWA 2R0HA 3HBZA 3WOGA 1JYIA 1XJAA 5DG1A 3VKOA 5JIUA 4Y20B 2GSYA 4BU2A 2C26A 2R49A 3AMMA 4GWJA 4HVOA 4JDMA 4BQWA 1HKDA 3K51A 4HXCA 5JI7A 4GKYA 4WZCA 5C9AC 3DF0A 2LROA 1OOPC 5LA0A 3RZHA 3QH6A 4EYUA 3N7MA 3R4UA 5KXBA 1T6BX 2ZGOA 4YW3A 2RS32 2XR4A 4P5YA 2Q8CA 5FLHA 5B2GB 2YGLA 2ZX1A 1UMIA 1JUHA 2ZAHA 1D0HA 4WM8C 4QGMA 4B1MA 2XDVA 1RL3A 1U5YA 3EO6A 4AI1A 4IE6A 2Y6LA 4GWIA 1SQ4A 4TWTA 4CPBD 2OPKA 4IESA 5C8WA 2A7AA 2H6BA 3NV2A 1MQTA 5J48A 1E5SA 1FMD3 2WAAA 3VHOA 1K3IA 2VTXA 2YFZA 2A1XA 3KV9A 4BIFA 5DG2A 3B93A 5FYVA 2RS33 2V5DA 3VKFC 1QIQA 1UY2A 4L97A 3VL9A 1GICA 1WW5A 4ZU7A 1REFA 1UIKA 3V56A 1MS9A 5JZGC 3AYCA 2GNDA 3M4FA 5E1RA 1CVNA 4SBVA 3CZJA 4AFAA 5J3UA 1ULEA 2WWJA 1US2A 1QDCA 2B42B 2Z5WA 4N43B 3EBRA 1WD4A 5F3GA 5ABJA 5FLJA 2UWAA 1F5FA 5DDJ2 1PK6C 1DQ4A 1AX2A 2A3YA 3FBMA 2BYVE 1CAWB 1V70A 4QM9A 1AR81 3JZVA 4LLOA 2BQPA 4ZPIA 5C7GA 1AR91 3H3LA 1C8NA 1OF3A 4KGGA 2Q8DA 2FCVA 3VBSB 3B69A 1QOTA 5LY1A 3HIFA 2Y6GA 2HWC3 2E51A 2YXSA 1MS5A 4RR3C 1VBA1 1OMIA 1OPMA 2TBVA 1LB2A 3W9AA 1B09A 1LULA 5I8YA 2VOTA 1GNHA 1AUYA
chains in the Genus database with same CATH topology
3VD4A 3WNNA 4TXWA 3A22A 2XQXA 3K4DA 3HNMA 5JMOA 1J84A 2QQJA 1W9SA 1UYXA 3LE0A 1JZ6A 5JXGA 1H6YA 2QQIA 1JYNA 2ZEXA 1UWWA 3DECA 4QX3A 3D3AA 2JE8A 4BXSV 4XUTA 4HG6B 2KD7A 4P00B 4OMCA 2VM9A 1JYWA 1F4AA 2R7EB 1UZ0A 3MV01 3BN6A 2ZEZA 2DCJA 2VMDA 1TG7A 4A4AA 1MPXA 2VC9A 3VDBA 3GGLA 4A44A 5JXJA 1K42A 5A1AA 2JD9A 4RYDA 2VZTA 4LHSA 3OGRA 3OBAA 3A7QA 3WNLA 2QBXA 1UY4A 3GXUA 3OEBA 1RYYA 4UOJA 3VD5A 4CUCA 1JZ2A 3IAPA 2CDPA 1HN1A 1IQDC 2BGPA 5F7UA 4LKSA 2VJXA 5HPOA 1EUUA 3OGSA 5DQ0A 2X09A 3T09A 1GNYA 1K45A 3BGAA 2V72A 3ABZA 1CIYA 3C7GA 4DUWA 4QX1A 1PMHX 3IDAA 5C70A 4CU7A 4CUAA 4XUQA 1NX9A 2LS6A 5G05L 3ACFA 2VZVA 1NUKA 2QQNA 4DEVA 1O8PA 1L7QA 3VD9A 1JZ3A 2E26A 1OF4A 1GU3A 4AG4A 2X05A 1NAEA 4MO3M 3K4ZA 2W1UA 4JKMA 3SKJE 5FUIA 3GDBA 2VMCA 2Z4FA 2J1AA 2WO1A 4A42A 2VR4A 4P08A 3I2KA 5J1XA 3WSOA 1OH4A 2BGOA 5LA2A 2WZ8A 3UESA 2BERA 3J7HA 4QB2A 3WNKA 3FL7A 3MBWA 5DN2A 2OKXA 1T2XA 2WZEA 2XONA 4CU6A 1W9TA 5CZKA 4E8CA 5IFTA 5JR2A 2W94A 3ACIA 3DYPA 2YG0A 3WQBA 1SHWB 1UXZA 4DXTA 4LQRA 1KGYA 2ZEYA 3NJXA 3I3DA 2W5FA 2VZRA 5EJ1B 3T2PA 4KI5M 3VD3A 3C7EA 4FI9A 1WCQA 1W9WA 4YPJA 2BZDA 5JUVA 2J22A 2J1VA 2VZQA 3THCA 4XUNA 2VQTA 2W91A 5JXHA 3HN3A 2ZEWA 3K46A 5IYYA 3P1IA 4JX0A 2VCCA 3MO4A 3I3EA 1O59A 1UY3A 2QQKA 4A45A 3K75B 1JHJA 4BJ0A 1W99A 3F2ZA 4XZUG 3I3BA 1R64A 4LPLA 3CIHA 5DPNA 4PF1A 4GZ9A 2RJ2A 4CU9A 1US3A 3HJRA 1TVGA 3U37A 4Z2AA 1GQPA 2WO2A 2E31A 3PUIA 2W1QA 4QB6A 2Y6JA 3K4AA 2Y64A 3ZM8A 3HNYM 1JU4A 1JZ4A 2VMEA 2WQ8A 2WN2A 3I2GA 1D7PM 4OZOA 4QDQA 3W5MA 1PX4A 3FN9A 4MGQA 3UNPA 2JDAA 2EICA 2EIBA 2LW8A 4DUXA 3LEKA 5DMYA 1JI6A 2EIDA 3T0DA 4L0PA 1JZ5A 3WF2A 4KWUA 1SG3A 3CMGA 2RVAA 1W8NA 3NJVA 3EB7A 4P02B 3SEEA 3A21A 2RV9A 4ARYA 2J7MA 3I97A 1CX1A 3DYOA 1O8SA 3FHAA 4MOAA 1CZTA 1KEXA 2VO5A 5HXMA 4XUPA 2VZPA 3ACGA 3CQOA 1UY0A 1UMHA 1DYOA 5IJRA 3OEAA 2WABA 5IFPA 2J1TA 2J1SA 3OGVA 4OMDA 4QX2A 2VZSA 5LA1A 2YC4A 4ZXEA 3WNMA 1JZ7A 2WBKA 2Y6HA 2Y8KA 3HNBM 3OG2A 2E32A 1CZSA 4A41A 1PMJX 2EIEA 2VZ3A 4JHZA 4W50A 4ARXA 3C7HA 4UAPA 3AC0A 3LPGA 2VTFA 1I5PA 1GOHA 4QAWA 2WYSA 1UX7A 4M4PA 1OD3A 3CDZB 1XNAA 3P6BA 4QB1A 1JYXA 2HYXA 3FHQA 2VCAA 2VZOA 3WF0A 1J83A 1BHGA 3PUHA 3T0BA 4PT6A 2C4XA 4DEQA 3VDAA 5B4NA 3HPNA 1XNTA 2WN3A 5CYYA 3WEZA 1L7RA 4XURA 1H6XA 1LNSA 2ID4A 1UYYA 1GOFA 3C7OA 4DUVA 4RN5A 3GM8A 4BK4A 3MUY1 2WO3A 3LEIA 2XHNA 3OB8A 2X10A 3IAQA 1JZ8A 1XC6A 5EIYB 3LQCA 4QDSA 3I2IA 1GMMA 3LPFA 4DXRA 2W95A 3WNPA 1JYVA 4JKKA 2QQMA 3T2QA 4PQQA 2J1EA 3T0AA 1UXXX 4OUEA 4M4RA 3SKVA 4D8MA 5LCWL 2VQUA 2J1RA 2JKXA 4W8JA 1UY1A 2HLEA 3NRUA 2VCBA 2WDBA 2ZXQA 4IUGA 2XOMA 2YC2A 3UETA 3VD7A 1WKYA 3MUZ1 2QQOA 1UYZA 5IHRA 3THDA 4CVUA 1P8JA 3I2HA 1ULPA 2W1WA 1W8OA 2W1SA 1W0NA 2CDOA 3SEPA 3E1F1 3WNOA 1ULOA 1XPWA 3C7FA 1NKGA 1CZVA 4ET7A 5B4XA 4ZZ5A 2WAOA 4A6OA 2W9XA 1PX3A 3I2FA 3LEGA 2V4VA 4UI9L 3NQHA 4MADA 3HOBA 3A23A 4W4ZA 2ORXA 4JKLA 5C71A 3EYPA 1GOGA 2J1UA 2W47A 2VL4A 2W3JA 4TTGA 4MGSA 2BBAA 3W5NA 1EUTA 1DP0A 3IIIA 4XVHA 3WF4A 1K12A 2C26A 4GWJA 2B4KA 3CKHA 3WF1A 4XUOA 1SDDB 3CZUA 5LA0A 2W46A 1DLCA 4BDVB 3ECQA 4P5YA 2PQSA 3T2OA 4QDRA 4ZZ8A 3K77A 1UMIA 2VZUA 2E33A 2Y6LA 4GWIA 2YFUA 4CU8A 3C8XA 3DYMA 4AAXA 4BK5A 1OT5A 3ETPA 2WAAA 4QPWA 1K3IA 4A3ZA 2W87A 2B9VA 3WF3A 2YFZA 4KMQA 2Y6KA 2V5DA 3MV11 2VMFA 1UY2A 4ZY9A 2YB7A 2C9KA 1JU3A 3I2JA 3ACHA 3CZJA 4OYUA 2DCKA 2ORZA 3VDCA 5JXIA 1US2A 1GUIA 4D0QA 4DXSA 2L9LA 4CUBA 1F4HA 2W92A 3NNGA 2DDUA 5G04L 5EJZB 1YQ2A 3IB3A 5C7GA 1OF3A 2WUHA 2Y6GA 4QX0A 3T08A 2QQLA 3HEIA 2VZ1A 5I0DA 3JXSA 2VOTA 4E8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VD4 A;  3WNN A;  4TXW A;  3A22 A;  2XQX A;  3K4D A;  3HNM A;  5JMO A;  1J84 A;  2QQJ A;  1W9S A;  1UYX A;  3LE0 A;  1JZ6 A;  5JXG A;  1H6Y A;  2QQI A;  1JYN A;  2ZEX A;  1UWW A;  3DEC A;  4QX3 A;  3D3A A;  2JE8 A;  4BXS V;  4XUT A;  4HG6 B;  2KD7 A;  4P00 B;  4OMC A;  2VM9 A;  1JYW A;  1F4A A;  2R7E B;  1UZ0 A;  3MV0 1;  3BN6 A;  2ZEZ A;  2DCJ A;  2VMD A;  1TG7 A;  4A4A A;  1MPX A;  2VC9 A;  3VDB A;  3GGL A;  4A44 A;  5JXJ A;  1K42 A;  5A1A A;  2JD9 A;  4RYD A;  2VZT A;  4LHS A;  3OGR A;  3OBA A;  3A7Q A;  3WNL A;  2QBX A;  1UY4 A;  3GXU A;  3OEB A;  1RYY A;  4UOJ A;  3VD5 A;  4CUC A;  1JZ2 A;  3IAP A;  2CDP A;  1HN1 A;  1IQD C;  2BGP A;  5F7U A;  4LKS A;  2VJX A;  5HPO A;  1EUU A;  3OGS A;  5DQ0 A;  2X09 A;  3T09 A;  1GNY A;  1K45 A;  3BGA A;  2V72 A;  3ABZ A;  1CIY A;  3C7G A;  4DUW A;  4QX1 A;  1PMH X;  3IDA A;  5C70 A;  4CU7 A;  4CUA A;  4XUQ A;  1NX9 A;  2LS6 A;  5G05 L;  3ACF A;  2VZV A;  1NUK A;  2QQN A;  4DEV A;  1O8P A;  1L7Q A;  3VD9 A;  1JZ3 A;  2E26 A;  1OF4 A;  1GU3 A;  4AG4 A;  2X05 A;  1NAE A;  4MO3 M;  3K4Z A;  2W1U A;  4JKM A;  3SKJ E;  5FUI A;  3GDB A;  2VMC A;  2Z4F A;  2J1A A;  2WO1 A;  4A42 A;  2VR4 A;  4P08 A;  3I2K A;  5J1X A;  3WSO A;  1OH4 A;  2BGO A;  5LA2 A;  2WZ8 A;  3UES A;  2BER A;  3J7H A;  4QB2 A;  3WNK A;  3FL7 A;  3MBW A;  5DN2 A;  2OKX A;  1T2X A;  2WZE A;  2XON A;  4CU6 A;  1W9T A;  5CZK A;  4E8C A;  5IFT A;  5JR2 A;  2W94 A;  3ACI A;  3DYP A;  2YG0 A;  3WQB A;  1SHW B;  1UXZ A;  4DXT A;  4LQR A;  1KGY A;  2ZEY A;  3NJX A;  3I3D A;  2W5F A;  2VZR A;  5EJ1 B;  3T2P A;  4KI5 M;  3VD3 A;  3C7E A;  4FI9 A;  1WCQ A;  1W9W A;  4YPJ A;  2BZD A;  5JUV A;  2J22 A;  2J1V A;  2VZQ A;  3THC A;  4XUN A;  2VQT A;  2W91 A;  5JXH A;  3HN3 A;  2ZEW A;  3K46 A;  5IYY A;  3P1I A;  4JX0 A;  2VCC A;  3MO4 A;  3I3E A;  1O59 A;  1UY3 A;  2QQK A;  4A45 A;  3K75 B;  1JHJ A;  4BJ0 A;  1W99 A;  3F2Z A;  4XZU G;  3I3B A;  1R64 A;  4LPL A;  3CIH A;  5DPN A;  4PF1 A;  4GZ9 A;  2RJ2 A;  4CU9 A;  1US3 A;  3HJR A;  1TVG A;  3U37 A;  4Z2A A;  1GQP A;  2WO2 A;  2E31 A;  3PUI A;  2W1Q A;  4QB6 A;  2Y6J A;  3K4A A;  2Y64 A;  3ZM8 A;  3HNY M;  1JU4 A;  1JZ4 A;  2VME A;  2WQ8 A;  2WN2 A;  3I2G A;  1D7P M;  4OZO A;  4QDQ A;  3W5M A;  1PX4 A;  3FN9 A;  4MGQ A;  3UNP A;  2JDA A;  2EIC A;  2EIB A;  2LW8 A;  4DUX A;  3LEK A;  5DMY A;  1JI6 A;  2EID A;  3T0D A;  4L0P A;  1JZ5 A;  3WF2 A;  4KWU A;  1SG3 A;  3CMG A;  2RVA A;  1W8N A;  3NJV A;  3EB7 A;  4P02 B;  3SEE A;  3A21 A;  2RV9 A;  4ARY A;  2J7M A;  3I97 A;  1CX1 A;  3DYO A;  1O8S A;  3FHA A;  4MOA A;  1CZT A;  1KEX A;  2VO5 A;  5HXM A;  4XUP A;  2VZP A;  3ACG A;  3CQO A;  1UY0 A;  1UMH A;  1DYO A;  5IJR A;  3OEA A;  2WAB A;  5IFP A;  2J1T A;  2J1S A;  3OGV A;  4OMD A;  4QX2 A;  2VZS A;  5LA1 A;  2YC4 A;  4ZXE A;  3WNM A;  1JZ7 A;  2WBK A;  2Y6H A;  2Y8K A;  3HNB M;  3OG2 A;  2E32 A;  1CZS A;  4A41 A;  1PMJ X;  2EIE A;  2VZ3 A;  4JHZ A;  4W50 A;  4ARX A;  3C7H A;  4UAP A;  3AC0 A;  3LPG A;  2VTF A;  1I5P A;  1GOH A;  4QAW A;  2WYS A;  1UX7 A;  4M4P A;  1OD3 A;  3CDZ B;  1XNA A;  3P6B A;  4QB1 A;  1JYX A;  2HYX A;  3FHQ A;  2VCA A;  2VZO A;  3WF0 A;  1J83 A;  1BHG A;  3PUH A;  3T0B A;  4PT6 A;  2C4X A;  4DEQ A;  3VDA A;  5B4N A;  3HPN A;  1XNT A;  2WN3 A;  5CYY A;  3WEZ A;  1L7R A;  4XUR A;  1H6X A;  1LNS A;  2ID4 A;  1UYY A;  1GOF A;  3C7O A;  4DUV A;  4RN5 A;  3GM8 A;  4BK4 A;  3MUY 1;  2WO3 A;  3LEI A;  2XHN A;  3OB8 A;  2X10 A;  3IAQ A;  1JZ8 A;  1XC6 A;  5EIY B;  3LQC A;  4QDS A;  3I2I A;  1GMM A;  3LPF A;  4DXR A;  2W95 A;  3WNP A;  1JYV A;  4JKK A;  2QQM A;  3T2Q A;  4PQQ A;  2J1E A;  3T0A A;  1UXX X;  4OUE A;  4M4R A;  3SKV A;  4D8M A;  5LCW L;  2VQU A;  2J1R A;  2JKX A;  4W8J A;  1UY1 A;  2HLE A;  3NRU A;  2VCB A;  2WDB A;  2ZXQ A;  4IUG A;  2XOM A;  2YC2 A;  3UET A;  3VD7 A;  1WKY A;  3MUZ 1;  2QQO A;  1UYZ A;  5IHR A;  3THD A;  4CVU A;  1P8J A;  3I2H A;  1ULP A;  2W1W A;  1W8O A;  2W1S A;  1W0N A;  2CDO A;  3SEP A;  3E1F 1;  3WNO A;  1ULO A;  1XPW A;  3C7F A;  1NKG A;  1CZV A;  4ET7 A;  5B4X A;  4ZZ5 A;  2WAO A;  4A6O A;  2W9X A;  1PX3 A;  3I2F A;  3LEG A;  2V4V A;  4UI9 L;  3NQH A;  4MAD A;  3HOB A;  3A23 A;  4W4Z A;  2ORX A;  4JKL A;  5C71 A;  3EYP A;  1GOG A;  2J1U A;  2W47 A;  2VL4 A;  2W3J A;  4TTG A;  4MGS A;  2BBA A;  3W5N A;  1EUT A;  1DP0 A;  3III A;  4XVH A;  3WF4 A;  1K12 A;  2C26 A;  4GWJ A;  2B4K A;  3CKH A;  3WF1 A;  4XUO A;  1SDD B;  3CZU A;  5LA0 A;  2W46 A;  1DLC A;  4BDV B;  3ECQ A;  4P5Y A;  2PQS A;  3T2O A;  4QDR A;  4ZZ8 A;  3K77 A;  1UMI A;  2VZU A;  2E33 A;  2Y6L A;  4GWI A;  2YFU A;  4CU8 A;  3C8X A;  3DYM A;  4AAX A;  4BK5 A;  1OT5 A;  3ETP A;  2WAA A;  4QPW A;  1K3I A;  4A3Z A;  2W87 A;  2B9V A;  3WF3 A;  2YFZ A;  4KMQ A;  2Y6K A;  2V5D A;  3MV1 1;  2VMF A;  1UY2 A;  4ZY9 A;  2YB7 A;  2C9K A;  1JU3 A;  3I2J A;  3ACH A;  3CZJ A;  4OYU A;  2DCK A;  2ORZ A;  3VDC A;  5JXI A;  1US2 A;  1GUI A;  4D0Q A;  4DXS A;  2L9L A;  4CUB A;  1F4H A;  2W92 A;  3NNG A;  2DDU A;  5G04 L;  5EJZ B;  1YQ2 A;  3IB3 A;  5C7G A;  1OF3 A;  2WUH A;  2Y6G A;  4QX0 A;  3T08 A;  2QQL A;  3HEI A;  2VZ1 A;  5I0D A;  3JXS A;  2VOT A;  4E8D A; 
#chains in the Genus database with same CATH topology
 1F8V A;  3WNN A;  5FYC A;  3S0M A;  4HSJ A;  2ZX3 A;  2CYF A;  1KXG A;  1UX6 A;  3K4D A;  2RHP A;  1LEM A;  3HNM A;  1EP0 A;  3N9O A;  2QQJ A;  2ZGL A;  2GH8 A;  4YFW A;  4M3C F;  2OUJ A;  5IAT A;  4LMF A;  3FE5 A;  3LE0 A;  1K5J A;  2WRA A;  5BUV A;  1JZ6 A;  1D4V B;  3PNA A;  3ZR6 A;  5I0R A;  4QXB A;  3Q8F A;  2D93 A;  2QQI A;  3H7J A;  4CDU B;  2ZEX A;  3NAP C;  4IEP A;  3H8R A;  5DDJ 1;  1QHD A;  1LOE A;  3AZY A;  5LK5 A;  1PNF A;  1PGW 2;  1AR8 2;  3IKW A;  2YY1 A;  2Q8E A;  2ADD A;  4LBN A;  5F37 A;  5JCT A;  4OHV A;  5JPN B;  4XUT A;  4Y1U A;  1Q8V A;  1EV1 1;  2BWA A;  4JV4 A;  4BPZ A;  4C8D A;  4UW5 A;  2GN3 A;  2IFW A;  4NHL A;  1TMF 1;  2Q1Z B;  5BNO C;  3B94 A;  1MZ6 A;  5FZ7 A;  2DCJ A;  4YW4 A;  3SH3 A;  3EMR A;  5FY1 A;  1AR7 2;  4A4A A;  1ST8 A;  1NCR C;  4J25 A;  1MPX A;  1QOS A;  4PBP A;  1DGL A;  1YXW A;  1VRH 2;  1R08 3;  2VC9 A;  5I8S A;  3VDB A;  5AC9 3;  2JD9 A;  4RYD A;  1ZZC A;  4QX7 A;  3OBA A;  1S0C A;  2R30 A;  4DMI A;  4JZR A;  2QBX A;  1W28 A;  2PHT A;  1OA3 A;  2NPI A;  3KQR A;  1W2U A;  4FT8 A;  4LBL A;  3TBD A;  4AAP A;  2CWM A;  4AE2 A;  3ZOI A;  3IAP A;  1RXG A;  1SLI A;  4NR1 A;  2FDI A;  2ZX4 A;  1BLZ A;  4GJY A;  1LGC A;  3CLP A;  3V0A A;  1HQW A;  2B8M A;  3RGB A;  2VJX A;  5A3L A;  1HRV 1;  1EUU A;  3Q9O A;  3OGS A;  1ND2 A;  2YZ4 A;  5FWE A;  4FOW A;  4IE0 A;  1RHI 1;  4Y22 B;  3UGG A;  4XFG A;  4P9J A;  5LBC A;  5FWJ A;  1K45 A;  1NY7 2;  4WV8 A;  2EXH A;  1Y3T A;  4X6Q B;  2YU2 A;  3BIW E;  1QXP A;  4LA3 A;  4CTE A;  4DZG A;  1PIV 1;  2EAK A;  3NJZ A;  4QX1 A;  1X9P A;  2GDF A;  3CHX A;  1VE0 A;  1RUF 1;  3N9M A;  1UKG A;  3UL2 A;  3VBS A;  1I6X A;  5FPA A;  1FOD 3;  1NG0 A;  3AL6 A;  1GZ9 A;  1YO8 A;  5FXW A;  2DV9 A;  4FO9 A;  1NX9 A;  2LS6 A;  5F5Q A;  2R07 3;  3DCQ A;  1C4R A;  3ME2 A;  2OYZ A;  5FPB A;  1W6Q A;  5CFC A;  3ACF A;  5K7P A;  3VN4 A;  2VZV A;  4EWD A;  1NUK A;  4OUM A;  3B3Q E;  1O8P A;  3CF6 E;  2FZ1 A;  4LE4 A;  4UW4 A;  1OQD A;  2MEV 2;  2RDR A;  4YVW B;  4CCD A;  1JOD A;  2ZGR A;  3NVC A;  4LEJ A;  1E57 A;  3AM2 A;  1B35 A;  3Q8B A;  1NAE A;  3WG2 A;  3DEM A;  1RUE 2;  1IHM A;  3Q8A A;  4RQP C;  2YMZ A;  3K4Z A;  1XND A;  5CB7 A;  3TNP B;  4BA6 A;  1YQ5 A;  4CXX A;  2VUJ A;  2VMC A;  5T5O A;  1COV 3;  2XJT A;  4BLJ A;  1W6P B;  3PUQ A;  1H4H A;  1WBL A;  2J1A A;  5F3E A;  4A42 A;  1UOJ A;  1V6M A;  2A6V A;  4LNV A;  4Q8L A;  5FYS A;  4XBL A;  4A7Z A;  1ZYB A;  4LBQ D;  4YVS A;  3H3Z A;  2PHL A;  3BPZ A;  4PBO A;  5CFD A;  3WSO A;  3DV8 A;  5LA2 A;  2OXB A;  5FYY A;  2CHH A;  2CNA A;  3N3H A;  3FL7 A;  1Z7S 3;  3MBW A;  4IEW A;  4LBK A;  4ATF A;  1LR5 A;  4OHX A;  2D3S A;  2XON A;  1UNB A;  3MLK A;  3RMX A;  3CJX A;  5GJ6 A;  4CU6 A;  1W9T A;  2P3J A;  4LUM A;  1ZZB A;  2R6Q A;  2WR9 A;  3ACI A;  2XHK A;  1SAC A;  2J42 A;  1ZZ6 A;  4DXT A;  4YZ3 A;  4E4Z A;  5CIS A;  4LO7 A;  3WHU A;  3VBR C;  1DDL A;  5F5A A;  2DBN A;  4AF9 A;  2VCM A;  5EJ1 B;  3T2P A;  3FHI B;  3LDR A;  4L11 A;  1S55 A;  2G9F A;  4ES9 A;  2D6O X;  4XIL A;  3MPP G;  4YG0 A;  3N9Q A;  4YPJ A;  4EWE A;  5JUV A;  1MQT C;  1O5U A;  4Z92 B;  3FMG A;  4YW5 A;  2FZ2 A;  2IXJ A;  5FMB A;  1N1T A;  4V1P A;  3WDU A;  3HN3 A;  3P1I A;  4NPM A;  1G7Y A;  4GQ7 A;  1ZBA 1;  3I3E A;  3ZXE A;  2XVL A;  1ASJ 3;  2ZGM A;  5BY5 A;  3FC0 A;  1W6O B;  3K75 B;  1L7L A;  1V9U 2;  5CU1 A;  4XHX A;  1YIP A;  4QPI B;  4EN9 B;  3H8O A;  2D6L X;  1JTZ X;  4W6Y A;  1JOP A;  3F2Z A;  3H0O A;  3TEX A;  3HR9 A;  1R64 A;  4LPL A;  1Z7S 2;  5DPN A;  4K6B A;  3TEW A;  3AFG A;  2RJ2 A;  4MVT A;  5FRE A;  4DRV A;  4BQY A;  1CPM A;  3VUO A;  2C5D A;  2RM2 1;  4AFB A;  4CP9 B;  2V73 A;  1KFX L;  1C8M 1;  2DCZ A;  3U37 A;  3PTY A;  5JDB A;  1BK0 A;  1ENS A;  1GAN A;  3BTY A;  3VDD A;  4Z2A A;  1GQP A;  5K0U C;  3ZYR A;  3ROU A;  2P34 A;  1UOG A;  1NE4 A;  2W1Q A;  1UO9 A;  3K4A A;  2Z69 A;  4RR3 A;  1SPP B;  2WO7 A;  1RIT A;  1JZ4 A;  3QCW A;  4NMI A;  2XBO 2;  1IPS A;  1VB2 A;  1J3P A;  2VEC A;  1X33 A;  1D7P M;  2R07 1;  2DCT A;  3VBO B;  2W2I A;  3BVC A;  1BKZ A;  2LW8 A;  2BOJ A;  3MZH A;  5JIA A;  1S0B A;  4YW6 A;  2R0F A;  1W8N A;  4HK8 A;  2FDH A;  2OPW A;  4OUS A;  2PHU A;  3A21 A;  4EWA A;  1W2A X;  4Q0V A;  4XF4 A;  2Y38 A;  4LHL A;  3VBH B;  1K5M C;  3FHA A;  3H7Y A;  2QZ2 A;  1FAY A;  4JGY C;  3PMS A;  4EQV A;  5CKN A;  2SLI A;  4OI0 A;  3ZN6 A;  2VO5 A;  1RUI 1;  5HXM A;  5F6L B;  3H50 A;  3ACG A;  4W6X A;  5GZE A;  4LBO A;  2RS1 2;  1IS5 A;  2Z79 A;  3TB0 A;  3ZKY A;  3SH5 A;  3EQE A;  3R6S A;  3VV1 A;  4XXP A;  1S0D A;  1XE7 A;  2JDM A;  5FJH A;  4I2O A;  2NLR A;  2WAB A;  2OW4 A;  5KXC A;  2JXA A;  5AVA A;  3E5Q A;  3ES1 A;  3AXE A;  2C1F A;  1O6U A;  1OI6 A;  1SBE A;  2VNO A;  4XEZ A;  1EPW A;  5KHH A;  4XIK A;  1DGR N;  4Y4R A;  3POJ A;  4C1W A;  3D82 A;  4QX2 A;  1REE A;  2VZS A;  1POV 3;  5LA1 A;  2D43 A;  2RR1 2;  1MVQ A;  1YUD A;  2RJK A;  2W68 A;  4PLN A;  4QXK A;  3RG0 A;  2FDF A;  2ZGT A;  2ZX2 A;  1UW8 A;  2Q1M A;  1H8T C;  2MNG A;  3ZKU A;  4CCE A;  4E4H A;  2XLF A;  2VG9 A;  5FK7 A;  4P9W A;  5T54 A;  4DY5 A;  5I93 A;  4OQ8 A;  1RUI 3;  3HNB M;  1QH7 A;  3OG2 A;  1OLM A;  1YQ6 A;  2D98 A;  1CZS A;  3OD4 A;  5LB6 A;  4XXA A;  1TNF A;  2YV8 A;  2DU1 A;  2VZ3 A;  4QPG B;  1MEC 2;  3ZIX A;  2C0Z A;  4ZS2 A;  5I8T A;  1F35 A;  3A0K A;  4CA9 A;  2VTF A;  3DN7 A;  4MXW A;  4PI0 A;  1I5P A;  1GOH A;  3ZYJ B;  4CEY B;  4YZ1 A;  4RFT 0;  1NCQ A;  1W9F A;  1JMU B;  2FHR A;  3FHQ A;  2VZO A;  1J83 A;  1XB9 A;  4AED B;  1K5M B;  2EXK A;  2ZKL A;  4JGY B;  3ES4 A;  3ZSM A;  3IDC B;  1LEC A;  2C4X A;  1ASJ 1;  4WVM A;  4A7K A;  4FVV A;  4DEQ A;  1DQ6 A;  3HPN A;  4K3U A;  3WEZ A;  4NHM A;  1OVP A;  2WNU B;  4GH4 A;  2ID4 A;  1ZNP A;  4CZS A;  4B8E A;  1O3T A;  4YW1 A;  2DYC A;  4RN5 A;  2RS5 1;  3VBF A;  2W39 A;  4GB3 1;  4KG0 A;  5C3O A;  5FMD A;  1J59 A;  1V6I A;  3D8C A;  5FMO S;  4BK4 A;  1W2N A;  3MUY 1;  1HJF A;  4XW3 A;  1T6G C;  3TWI A;  3LEI A;  3LOI A;  4LT5 A;  3IAQ A;  2WZR 3;  1ZVF A;  5EIY B;  2DU0 A;  4IV1 C;  4UFI A;  5EXO A;  3ZFG C;  3ZSL A;  3UKT A;  5LBE A;  1E5H A;  1U0A A;  2VUC A;  3LPF A;  5I0U A;  4DS0 A;  2NMO A;  3WNP A;  5FP3 A;  3ZXA C;  1QJE A;  3DUI A;  1LHO A;  3GJA A;  4JKK A;  2OS2 A;  4CDX A;  2FBE A;  1YQC A;  5LK7 B;  4FPC A;  5T3N A;  1PM7 A;  4M4R A;  3SKV A;  4HPK B;  5LCW L;  1Y4W A;  3USS A;  1YHF A;  2J1R A;  3FZ3 A;  2HWE 2;  3GZA A;  5APA A;  2Q8O A;  2HLE A;  1VBC 1;  4CDQ C;  3AP7 A;  5FKC A;  1BCX A;  2RS5 2;  2ZHN A;  3LA3 A;  1OLR A;  2WDB A;  1KJR A;  4IUG A;  4BIS A;  4MXV A;  3LA7 A;  1CWP A;  3ZFE B;  2TEP A;  3NNF A;  2IXC A;  4I0B A;  3UET A;  3AMP A;  4AHW A;  1RED A;  1UKR A;  1VBD 3;  1S4C A;  5FZI A;  1QJU 2;  1OD5 A;  4YSF A;  5IVJ A;  1C1F A;  3THD A;  2E53 A;  2UU8 A;  4MLO A;  1IS6 A;  1NOV A;  2GME A;  2WS9 3;  5JVV A;  3J9S A;  3SIS A;  1R09 2;  2CSG A;  4A7Y A;  4ISR A;  5IVV A;  1W8O A;  1XU2 A;  2CDO A;  1XU1 A;  4RFR B;  2DWR A;  3O0W A;  1DQ0 A;  4KGQ A;  4NVP A;  5E6H A;  3C7F A;  2X29 A;  3SH4 A;  2IZW A;  2P3K A;  1CZV A;  1NT0 A;  1RVF 3;  1V6K A;  2YPJ A;  4GAZ A;  1XSQ A;  2R16 A;  3GF6 A;  3MW4 A;  1RMU 2;  1SLC A;  4S2D A;  1RTV A;  2FQP A;  2BNN A;  2OT7 A;  4UF0 A;  1AR6 3;  2KR2 A;  5JI9 A;  1OKQ A;  1O3Q A;  5KHI A;  1LES A;  2F6B A;  4I0A A;  1W2O A;  2V4V A;  2VW2 A;  2GNB A;  3PVB B;  1VBB 3;  3PJY A;  4NN0 A;  3M3I A;  2ZPX A;  4FXK B;  4BIO A;  1BVP 1;  1LOA A;  3WP6 A;  3GCW A;  1O4T A;  2H0V A;  3KGZ A;  2ORX A;  4QGL A;  5A7W B;  1QJU 1;  2I45 A;  2HKX A;  3N36 A;  2ARB A;  4CDW A;  2VVF A;  1G86 A;  1GOG A;  3ORJ A;  4XZP A;  2D6P A;  4DO0 A;  2DCY A;  4A2U A;  1HB3 A;  1Q8O A;  5HCA A;  5FZO A;  1PMI A;  3N9L A;  1W6O A;  4LE3 A;  4MGS A;  4KH9 A;  4Q0P A;  5IW0 A;  2SBA A;  1VBD 2;  4XFI A;  5KC6 A;  3W5N A;  4MGI E;  2HEW F;  5LAT A;  3III A;  4NPL A;  4K7J A;  1HN0 A;  3A0N A;  3J7M A;  4NRO A;  3J26 N;  2R06 2;  1K12 A;  4E2G A;  3IMN A;  4M01 A;  2Z42 A;  1RGS A;  4M00 A;  1VBE 3;  3MIB A;  4B4P A;  2BDR A;  1NA1 C;  2G4I A;  2B4K A;  1DHK B;  4XUO A;  2R04 2;  3WF1 A;  4Y24 A;  1GLH A;  3ALQ A;  3CZU A;  3PU8 A;  1F2N A;  4Q0S A;  1PGL 1;  3T3Y A;  1DLC A;  4N90 A;  1LGN A;  2G1M A;  2VUD A;  3FFZ A;  3JD7 3;  4C1X A;  4UBG A;  3O1V A;  4LIV A;  2PQS A;  4IGO A;  5LAS A;  5K4L A;  3L2H A;  3K77 A;  3I59 B;  2VZU A;  4LO8 A;  2WFF 1;  1Q3E A;  1URX A;  3O5S A;  4XOG A;  2BJS A;  2K2S A;  2W52 A;  4LJH A;  1MS4 A;  5T50 A;  2XML A;  1N1S A;  4D6Q A;  3NJY A;  3U4S A;  4B3N A;  3C8X A;  1OT5 A;  3OGJ A;  4OCT A;  2JG9 A;  2XJR A;  5FZB A;  1Y9M A;  4Y22 A;  3WF3 A;  1RUH 2;  4KMQ A;  1ULC A;  3IN9 A;  2JJ6 A;  1FI2 A;  2Y6K A;  4M3C A;  3MLJ A;  4WM7 A;  1CX4 A;  3OY8 A;  4Q8K A;  2YB7 A;  1CR7 A;  5KHK A;  5CNA A;  4WBB A;  2IXL A;  2VNV A;  3CNA A;  2QJV A;  3ACH A;  2DCK A;  1XNB A;  3USU B;  2RS3 1;  3PJQ A;  2NN8 A;  2ARX A;  4DXS A;  2L9L A;  2IC1 A;  4S2G A;  4XET A;  1H4G A;  2D6M A;  3EHK A;  4QKB A;  5F6K A;  5LA9 A;  3THT A;  3OGG A;  3D4K A;  1LED A;  5FYB A;  4JVA A;  4WVW A;  4XF0 A;  4AR2 A;  4XCB A;  5GLU A;  1JOJ A;  2MEV 3;  1YQ2 A;  3IB3 A;  4GIQ A;  2TUN A;  4OHW A;  4CPB A;  5LY2 A;  4Q4V 2;  4PIZ A;  2QKD A;  1W8Z A;  3BPS A;  3JB8 A;  4YVW A;  4LTA A;  5T5P A;  1KD7 A;  1VR3 A;  2CAU A;  4G3Y C;  1TMF 2;  2JEN A;  2QQL A;  3LZZ A;  3M7A A;  4FFG A;  2QTW B;  2K46 A;  1IZ3 A;  2E7A A;  2YC0 A;  3VD4 A;  1ZRD A;  5J37 A;  4TXW A;  3IPV A;  1ZBE 3;  1X8E A;  2XQX A;  4ZKT B;  2NP0 A;  1GQG A;  1RVF 1;  2HYK A;  1UYX A;  4R4Z A;  4Y1V A;  5IK4 A;  3QBQ A;  2PXJ A;  4H7M A;  1ZRE A;  4JGZ B;  5JXG A;  2XPJ A;  3LEM A;  1EV1 3;  4BQ5 A;  4XJU A;  3BTA A;  5FUP A;  1H6Y A;  3N9N A;  3HT2 A;  3POB A;  3GNE A;  3O1M A;  1SDW A;  1JYN A;  3ZLI A;  1A78 A;  3MI8 A;  3DEC A;  1ZA7 A;  3S5Q A;  2WFP A;  2WII B;  3SLI A;  3LAG A;  1LKN A;  3H9A A;  2JE8 A;  2WNO A;  5FXZ A;  4YM1 A;  4Q4V 1;  2KD7 A;  3GHM A;  3NAP B;  2VM9 A;  4OMC A;  4CDU C;  5EZW A;  1JYW A;  2WLP A;  3MV0 1;  3I54 A;  4AVS A;  1RUC 1;  2P17 A;  4COW A;  5ACA 3;  4YZ2 A;  5FLI A;  2D5H A;  2VBB A;  1TG7 A;  2Y33 A;  2A6W A;  3BTX A;  3VBH A;  2DVB A;  4JHT A;  1RC6 A;  3SXW A;  3GCX A;  1KIT A;  4HPK A;  3DKQ A;  4HN1 A;  3POG A;  1PIV 2;  4TN7 A;  1VRH 3;  4AEM A;  2UUR A;  2VZT A;  3E5X A;  1TEI A;  1Y9Q A;  5IVE A;  3OGR A;  1YJL A;  2NYY A;  4D6R A;  4RS5 A;  2IFR A;  4XF1 A;  2XJP A;  4BHP A;  5ABJ B;  1G6N A;  2F4P A;  4LK6 A;  5FPZ A;  5FQ0 A;  1KRI A;  4N43 A;  5A6Q A;  4UXA A;  1S1A A;  4BQ1 A;  1ZX5 A;  1RYY A;  4AFD A;  3ZSK A;  3JD7 1;  3VD5 A;  1X7N A;  2ZAB A;  4MV2 A;  1PGW 1;  1OBN A;  2BVB A;  2ETE A;  2ZX0 A;  3O1R A;  4HKW A;  2PLV 3;  3WP3 A;  1HN1 A;  1PK6 B;  1EV1 2;  1KDM A;  4IGP A;  1GWL A;  1LOB A;  4EJR A;  3KMH A;  5F7U A;  1RUC 3;  2NZ9 A;  4LKS A;  5KXE A;  3N4M A;  1R1A 2;  2GP3 A;  1EY2 A;  1J58 A;  4QQO A;  2FMY A;  3QH7 A;  2VUA A;  2JWP A;  2WKK A;  5FK8 A;  2XXZ A;  5ANN A;  1TME 3;  4K8R B;  1AYN 3;  5JSR A;  3WW1 A;  4AED A;  1PMH X;  4NOT A;  1S0G A;  3BOD A;  3IDA A;  5C70 A;  3MIF A;  3W21 A;  1V0A A;  5LBB A;  1O7F A;  1FAT A;  4IV1 B;  4CUA A;  4XUQ A;  5A33 B;  1AL2 1;  1LU1 A;  1AHS A;  1OUS A;  3CJI C;  3CO2 A;  2FD8 A;  2XJQ A;  1ND3 C;  2VE1 A;  4NUB A;  3SCH A;  4Z82 A;  3VD9 A;  1L7Q A;  2ZZJ A;  4QPG A;  5CKQ A;  3VB9 A;  4AVT A;  4XJZ A;  1C28 A;  3AMQ A;  1X36 A;  3G6J B;  1GFF 2;  1TME 2;  3ZN5 A;  1R1A 1;  3BAL A;  1QXJ A;  4HAN A;  3RWK X;  5D21 A;  3NNJ A;  4E4S A;  2RDQ A;  3H1Y A;  3D5O A;  1NLQ A;  3SKJ E;  1G9C A;  3AKR A;  3GBF A;  5E89 A;  3RI9 A;  1W3X A;  2A6X A;  2RM2 3;  2Z4F A;  2Y0I A;  1GKB A;  2RDN A;  4Q4W 1;  2VBP A;  2ARE A;  4DY3 A;  2Z2S B;  4YNI A;  2VR4 A;  4P08 A;  3I2K A;  3KT1 A;  5A32 B;  5J1X A;  4OHZ A;  4LIT A;  4ERO A;  4KU7 A;  3I49 A;  2QDR A;  4XJA A;  3B5L B;  4J6G A;  4AI3 A;  2BER A;  4IER A;  3J7H A;  4XIO A;  3VLB B;  1DGW X;  3WNK A;  2A3W A;  4LHK A;  5DN2 A;  2P6H A;  2OKX A;  2A71 A;  4KBZ A;  5F5I A;  2JG8 C;  3LA2 A;  2KXL A;  3LDB A;  1N3P A;  5SV5 A;  2WT1 A;  4FTS A;  3O12 A;  3KVA A;  5CZK A;  2WIN B;  1W90 A;  1WLW A;  2WA3 A;  3T2T A;  3DYP A;  3WQ7 A;  5IFT A;  4QHB A;  5JR2 A;  5IK8 A;  2VXJ A;  3PTR B;  3WQB A;  1SHW B;  1UXZ A;  3WUC A;  4Q4W 3;  3WQ1 A;  1XRU A;  2ZHK A;  1RHI 3;  2VNR A;  2JKB A;  1YYN A;  3S6P A;  4A6S A;  2BV4 A;  3ZYH A;  1OH3 A;  1SFP A;  2D6N A;  1I5Z A;  3KLS A;  4RGK A;  5LW9 A;  5D2A A;  1H9P A;  3JQW A;  3VD3 A;  3C7E A;  5DUW A;  4TYS A;  1W9W A;  2PHD A;  3KCX A;  2BZD A;  5JSP A;  5BNP C;  4Q0U A;  2J1V A;  4OI4 A;  2OX0 A;  2DFB A;  2VZQ A;  4OI1 A;  3WUD A;  3J7L A;  4Q27 A;  4QX5 A;  3W20 A;  5KR7 A;  3LWC A;  5IYY A;  3K46 A;  3ITQ A;  3VZN A;  3GHN A;  2XJU A;  3FFQ A;  2RS1 3;  1SFY A;  3MO4 A;  4OUL A;  1GBG A;  1BMV 2;  3GJB A;  1D2Q A;  1UY3 A;  4XCA A;  1S0E A;  2R07 2;  3ETQ A;  3LSE A;  3ZYF A;  1W6M B;  1JHJ A;  3KCC A;  3KF5 A;  1AVB A;  3OOX A;  4M3C E;  2XVK A;  2K0G A;  2Q5T A;  2A75 A;  1PHM A;  1U5I A;  1UZZ A;  3FBY A;  3MID A;  4XZU G;  2Q30 A;  5SV8 A;  4LR4 A;  4PDW A;  1V6N A;  3KSC A;  4GZ9 A;  4RHV 1;  2V5Y A;  1US3 A;  3WIN E;  1GZW A;  2EF6 A;  1OA2 A;  2BEO A;  3E97 A;  3HJR A;  1J1L A;  5A3O A;  3T1M A;  5A32 A;  4XBQ A;  4YGC A;  1W39 A;  3WX5 A;  4LKF A;  3ZDS A;  2E7Q A;  1EPZ A;  3PIJ A;  4HT1 T;  5BXX A;  3AP5 A;  2WO2 A;  3AVS A;  3AB0 A;  5EV7 A;  5A7O A;  4TLF A;  1SLB A;  5C9A A;  2G9G A;  2YHJ A;  2RS1 1;  4QB6 A;  3ZXJ A;  5H9P A;  3LKJ A;  3URF A;  3HNY M;  5AFE A;  5L36 A;  1HXS 2;  3GBW A;  3AMN A;  3NV3 A;  1BMV 1;  1ENQ A;  1ZBA 2;  2XB6 C;  3LD8 A;  4XMI A;  1MR5 A;  2WQ8 A;  4K1Y A;  5F3C A;  4QDQ A;  5FP9 A;  1BXH A;  1UZY A;  1H2L A;  2P4E A;  1KDK A;  3FN9 A;  3E6B A;  3IDE A;  1H8T B;  1V9U 1;  2EIC A;  5HV4 A;  4AI2 A;  5J7M A;  2JDP A;  1A6C A;  5J09 A;  3RZJ A;  1W03 A;  4L0P A;  2D7F A;  2HWE 3;  2WC2 A;  3CMG A;  4IEQ A;  4NE9 A;  4KWU A;  4HOO A;  3NJV A;  2HWD 2;  3Q8C A;  4ZXK A;  5JR7 B;  4YZ5 A;  5A3T A;  2GNM A;  4HK9 A;  4E4D X;  3R0R A;  3HWJ A;  3NL1 A;  4HZF A;  1DZR A;  1JH5 A;  3EXU A;  3CEW A;  2ZGN A;  1O8S A;  1ODM A;  1ULD A;  1FX5 A;  1PO2 2;  1UPS A;  1CZT A;  3S7I A;  3O1U A;  1DYP A;  1KEX A;  4XQW A;  2KA3 A;  4FXG B;  3T1L A;  4URT A;  3SHR A;  1WD3 A;  2VZP A;  3LIG A;  4XFA A;  4CYD A;  5JZG A;  4YYO A;  3WD5 A;  1UMH A;  1VJ2 A;  1IG3 A;  2RMU 2;  3FLR A;  5FY9 A;  1DYO A;  4LLF A;  3WNX A;  2XQR A;  5HBA A;  1QY4 A;  1STM A;  1H1A A;  5FZD A;  2YU1 A;  4FOY A;  4AQ6 A;  5IFP A;  3WXP A;  2GNT A;  3ZXD A;  2GU9 A;  3R4S A;  1SMV A;  2BW8 A;  3WY6 A;  3WW4 A;  3OGV A;  4OMD A;  2WNE A;  1AF9 A;  1DYK A;  5D8A C;  1RMU 3;  1SEF A;  2YUE A;  2HBU A;  2D6K A;  5ERL A;  1CAX A;  1MS0 A;  4RS5 C;  4R9A A;  2YC4 A;  3KQ4 B;  3H8X A;  3FJS A;  4ZXE A;  1SBD A;  4QU1 A;  3UK9 A;  3WNM A;  1JZ7 A;  2RR1 3;  4IE5 A;  4NJ4 A;  3KHC A;  3AKT A;  2WNV C;  4GB3 2;  4R4X A;  2E32 A;  3UJO A;  2GC2 A;  5J36 A;  2V4A A;  4OHY A;  3HQR A;  5FR3 A;  1RUI 2;  4JHZ A;  2HWD 3;  1GWM A;  1LU2 A;  2ZMN A;  4I3G A;  1IKP A;  1DFQ A;  1ENX A;  4W50 A;  5CIR A;  3C7H A;  3ZDV A;  4HET A;  3H8U A;  1MEC 3;  5I0T A;  1JUI A;  2AUY A;  4QAW A;  4XC9 A;  1UX7 A;  4M4P A;  5DAQ A;  3TN9 1;  1Z0H A;  3AZZ A;  4CRQ A;  1OQE A;  2JDK A;  3I2O A;  4QB1 A;  2HWB 3;  1WBF A;  2XG3 A;  2RE9 A;  2HYX A;  5FZA A;  2VCA A;  3WF0 A;  4BCU A;  5KBF A;  5FZ9 A;  3KT4 A;  2MPF A;  3NWK A;  3PUH A;  2IVI B;  2VPV A;  2YGM A;  2AGS A;  4UBH A;  3ST7 A;  3T0B A;  4OZX A;  2RR1 1;  5FY8 A;  3VZK A;  3ON7 A;  3VDA A;  3ZXL A;  4FPY A;  2VVE A;  1S0I A;  3IDB B;  1L7R A;  3M70 A;  1H6X A;  2ZA9 A;  3CL1 A;  4XUR A;  5DZF A;  3CJI A;  1S0J A;  3AZX A;  1VBB 1;  3PU3 A;  2H6C A;  2XUM A;  4UW6 A;  4OQ9 A;  3K2O A;  4AW7 A;  2FDK A;  4NWV A;  1HLC A;  1D4M 2;  1QXR A;  3J8F 3;  3BUC A;  2JIC A;  2LAL A;  2WO3 A;  1JZ8 A;  2E7T A;  5TSW A;  3H1M A;  3IWZ A;  1IOA A;  2IXK A;  1W0P A;  4WVV A;  1MQT B;  3RYR A;  3LQC A;  4JGZ A;  1Q8Q A;  1WME A;  2XL7 A;  3WR0 A;  3SNM A;  1W2T A;  3ZN6 B;  1GMM A;  2CGP A;  2JB8 A;  2FMD A;  1K5M A;  4JGY A;  1S2K A;  4U36 A;  4L99 A;  2ERF A;  2OZJ A;  4Q26 A;  1JYV A;  1ZRC A;  4I3P A;  5H9S A;  2CAV A;  1CAU B;  4BMB A;  5K9Y A;  5A3P A;  2J1E A;  2OZ6 A;  5FYZ A;  4D8M A;  2VQU A;  1HIX A;  3P3N A;  5FZH A;  2B46 X;  2JKX A;  4W8J A;  3DGT A;  1RJ8 A;  2R06 3;  1UY1 A;  3ZXG A;  4H3W A;  3SQO A;  5A6X A;  3J4U H;  4JAA A;  1QJX 1;  1FNZ A;  2YC2 A;  5C8C A;  1RB8 G;  1W8H A;  1Q5O A;  4IW3 A;  2OVU A;  1G9D A;  3VD7 A;  2DVD A;  3TEY A;  2ZBJ A;  4QM8 A;  4ASL A;  2JDY A;  1U5X A;  3VBU B;  1XXN A;  2AC1 A;  5C33 A;  4LA2 A;  5IHR A;  2GN7 A;  1HQN A;  4HKL A;  4XF3 A;  3FX3 A;  4DQA A;  4CVU A;  1POV 0;  1P8J A;  2ZMK A;  3AK0 A;  4YM2 A;  3O1S A;  1CJP A;  4Z2W A;  5T55 A;  3WDW A;  3E1F 1;  2CGO A;  5HI0 A;  1ULO A;  3NV4 A;  2QE3 A;  2C9A A;  1HX6 A;  2PAM A;  1RUD 3;  2WQ4 A;  3AZW A;  3H1W A;  3IIA A;  4FOV A;  5L19 A;  2KM2 A;  4ZZ5 A;  2UWC A;  1G9A A;  3O1P A;  1RUH 3;  4QPY A;  4LUK A;  2EXJ A;  4RQP B;  4A6O A;  2JDH A;  2W9X A;  5AVP A;  3AYA A;  5FRA A;  1YI9 A;  2R04 1;  4GMP 0;  2Q4S A;  3HD8 B;  1GR3 A;  2I07 B;  3WZ1 A;  1QJX 3;  1YRZ A;  2OII A;  4OLL A;  3ZR5 A;  1PGL 2;  3LEG A;  1MZF A;  3IMM A;  4RQP A;  4BQX A;  1R1Z A;  4Q2F A;  4UI9 L;  3WW3 A;  4YVW C;  4MAD A;  2IXI A;  4F3J A;  3A23 A;  3OUJ A;  1IS3 A;  1RIR A;  4W4Z A;  2Y6F A;  4IEZ A;  2WFF 2;  2VAU A;  5C71 A;  4YM0 A;  4K9S A;  5ANQ A;  5D8A B;  4DXZ A;  3LIH A;  4TTG A;  5C5U A;  5FPL A;  4BE3 A;  1VBE 1;  4EN0 A;  4FTE A;  3UV9 A;  2ZGQ A;  4NII A;  5CFD C;  1JYC A;  1PGS A;  1FT9 A;  1ZRI A;  1FPN 2;  1LHU A;  3V65 A;  2VUL A;  1EAH 2;  2E9Q A;  4NRQ A;  2JEM A;  4UW3 A;  4AEK A;  4AI8 A;  4XVH A;  4CCJ A;  4IND A;  1WCD J;  3DPR B;  3IBM A;  4YGD A;  3N7J A;  3WG1 A;  3BTZ A;  3CKH A;  1D2S A;  2WQZ C;  1SPP A;  4P9G A;  2ARA A;  4N9I A;  4MGZ E;  4QHO A;  1J1T A;  1LRH A;  2V09 A;  4QDR A;  3VBR A;  4EN7 B;  3VZJ A;  4LXL A;  3HT1 A;  3ZFF C;  1OHF A;  2B7Y A;  2JIG A;  5K8S A;  4YG6 A;  5AFB A;  4CDQ B;  1HRV 3;  3MFC A;  3K3O A;  4FPH A;  2GP5 A;  4CDQ A;  2YFU A;  4XFB A;  1UPI A;  4CU8 A;  4AAX A;  1QDO A;  2VW1 A;  3ETP A;  3J8F 1;  3WW2 A;  3MFA A;  1TZO A;  3MLL A;  4A3Z A;  2W87 A;  1G9B A;  1HW5 A;  1JBC A;  2WFF 3;  2B9V A;  3DXU A;  3KZ4 C;  1VBA 2;  1OXC A;  3P3P A;  4P14 A;  3UKV A;  4BZ4 A;  4FSJ A;  1XE0 A;  3OBT A;  1LHN A;  2VMF A;  4ZY9 A;  1VP6 A;  1WLC A;  4YFZ A;  5A3N A;  2C9K A;  1RUG 3;  1JU3 A;  1NE6 A;  1ONA A;  2JB4 A;  5FBJ A;  2D3P A;  3U07 A;  3U78 A;  2BP6 A;  3M8L A;  5E16 A;  3VDC A;  5JXI A;  5DZE A;  4COY A;  1C57 A;  1GUI A;  3CBN A;  3VKM A;  4D0Q A;  4CUB A;  3FUO A;  4I01 A;  4DIN B;  1N1Y A;  1OLQ A;  2DDU A;  2YPD A;  5G04 L;  4I02 A;  5EJZ B;  4NIA A;  4CP2 A;  5EPA A;  5DDJ 3;  4ZON A;  3U4X A;  4COU A;  1GP6 A;  4LOT A;  1GSL A;  1YIF A;  1EYB A;  3ATG A;  3KD4 A;  5FZ6 A;  5C4W A;  3T08 A;  3HEI A;  2VZ1 A;  5IT6 A;  2G9Z A;  4GJZ A;  4AQ2 A;  5I0D A;  4MGK E;  2PHX A;  4MG2 A;  3N35 A;  3WQ0 A;  3W59 A;  4E8D A;  5E8A A;  1AR7 1;  4PJY A;  2GMM A;  1WCS A;  2ILM A;  3A22 A;  3PL0 A;  4D7S A;  1F31 A;  4AHX A;  1ND3 A;  5JMO A;  4XDO A;  1J84 A;  1W9S A;  2DVG A;  1UOB A;  3SC7 X;  3VBF B;  5HCB A;  2ARC A;  1UZV A;  5FUN A;  2P1B A;  3BOP A;  4COZ A;  5M0T A;  5LBF A;  3WCS A;  3JB4 C;  2CWS A;  2WLQ A;  1NA1 A;  4AVV A;  1H30 A;  2LTN A;  5FZ1 A;  3JD7 2;  1TQ5 A;  3D3A A;  4M0N A;  3T4V A;  2HWC 1;  5T5J A;  1AJK A;  1NQD A;  4B7K A;  4QQL A;  1XNK A;  1NCQ B;  2WNU A;  4GH4 B;  3KF3 A;  1F4A A;  2R7E B;  4HBN A;  4LK7 A;  3BN6 A;  4HFS A;  1HV1 A;  1DCS A;  3LFI A;  1A3K A;  5DUV A;  5FOJ B;  5FZM A;  5A7N A;  1F5J A;  1GYK A;  3AYD A;  3JUU A;  4AI0 A;  4CCO A;  1NY7 1;  2QFE A;  4CE8 A;  3GGL A;  1LOC A;  1TNR A;  2JG9 C;  4IE4 A;  1CD3 G;  1VMJ A;  2UYB A;  4A44 A;  4BB3 A;  4DNY A;  1K42 A;  4CEY A;  1CAU A;  1DF0 A;  4Y1Z A;  4LHS A;  1RUF 2;  3VZO A;  3WDY A;  5C5T A;  1DG6 A;  4RGG A;  3KHB A;  4OFG A;  2AZ5 A;  4WM7 C;  1H8T A;  1UY4 A;  4KQ7 A;  4PIX A;  3POI A;  3OEB A;  2QQU A;  4R52 A;  4EZ4 A;  3USU A;  4UOJ A;  3RZK A;  2XWJ B;  3HAG A;  1AZD A;  4CUC A;  2CDP A;  4FCA A;  1PVC 1;  3UKN A;  4Q4X 2;  3UJQ A;  3VKL A;  2MEV 1;  1JW6 A;  1IQD C;  1NLS A;  4ZU5 A;  1TME 1;  4WM7 B;  1W0O A;  1NXM A;  4JDN A;  1ZRR A;  1FMD 2;  1W6N B;  2Y34 A;  1ND3 B;  5L73 A;  5F1R A;  5LWB A;  4G4F A;  5DQ0 A;  3EJK A;  1C8M 3;  2K9Z A;  3ENR A;  4LOS A;  2ZS6 B;  2PEL A;  3T09 A;  1AL2 3;  3P5B A;  2LM3 A;  2AEZ A;  5FZC A;  3MW3 A;  5CEH A;  3PIG A;  1CIY A;  1RUJ 2;  4MHU A;  3WP5 A;  3VL8 A;  5KHJ A;  3WDX A;  4GWN A;  2EXI A;  2GC0 A;  4Z8B A;  4O9E A;  3AXD A;  2IUW A;  1BQP A;  1RUG 1;  1ZRF A;  4HVQ A;  1UL9 A;  1LOF A;  4NRM A;  3BKZ A;  3VGI A;  4GH4 C;  1D0G A;  4GUL A;  2OA2 A;  3B9C A;  4O7X A;  5F3I A;  1HXS 3;  5G05 L;  3OUI A;  4AQS A;  4IEV A;  5IUQ A;  4Q0Q A;  4N9H A;  3ACL A;  5FIX A;  4WZF A;  1W05 A;  3ZIW A;  4Q4X 1;  2FCU A;  3NST A;  2E26 A;  3QLQ A;  5EHD A;  1GU3 A;  3AL5 A;  2PLV 2;  1VMF A;  3GAL A;  3M3Q A;  2X05 A;  3PLQ A;  4OVE A;  1V6J A;  2BU9 A;  4HL0 A;  3ZFG A;  5FYH A;  3INA A;  1WGP A;  3R05 A;  4JKM A;  5FZK A;  2NQY A;  3ZYG A;  4JC1 A;  3GDB A;  5A7S A;  1FV3 A;  5D1I A;  2PYT A;  5ACA 1;  5IVC A;  4YW7 A;  1UN1 A;  1DU3 D;  3VDD B;  3HBK A;  4CDU A;  1SCR A;  4H7L A;  1MZ5 A;  1Q8S A;  2IXH A;  2D40 A;  2VY0 A;  4RL7 A;  3THP A;  2BNM A;  5CKM A;  1AXK A;  2VMI A;  3AZV A;  3BI3 A;  4B4R A;  1AL2 2;  2BGO A;  2PA7 A;  4LBM A;  3OBR A;  2WZ8 A;  1Y43 B;  2O0O A;  4M3C B;  3VBH C;  4QB2 A;  4XAB A;  1VIW B;  3F95 A;  2A6Y A;  4OI2 A;  4FQ4 A;  3POY A;  1UU5 A;  3VBR B;  3O1O A;  1N47 A;  1V9U 3;  4AHZ A;  2PLV 1;  4IET A;  3U10 A;  5FO7 B;  3L9J T;  1TE1 B;  4E8C A;  5C4W B;  4F8A A;  4HON A;  3M3C A;  1OOP A;  2W94 A;  4E2Q A;  1WWY A;  1QWR A;  2YG0 A;  4KL1 A;  3PUR A;  1KGY A;  4CXY A;  1H8V A;  5FMO L;  2VH9 A;  1ZM1 A;  2CV6 A;  3RS6 A;  5HXV A;  4Q29 A;  4XJ8 A;  3I2D A;  3NJX A;  4Q4W 2;  1VAL A;  2RM2 2;  4WM8 A;  5FZ3 A;  3I3D A;  3AJZ A;  3D0S A;  5CBL A;  2ES3 A;  1C1L A;  4XJ9 A;  5AC9 2;  4KI5 M;  2HWF 2;  5JOY A;  4X8N A;  2J22 A;  5A6Y A;  1ZZ8 A;  5D8A A;  3ZFE A;  3THC A;  2VQT A;  5JXH A;  4XHB A;  1VLN A;  2HJI A;  4LIU A;  2JEC A;  3Q8E A;  1LOG A;  1XSR A;  3RMY A;  4BQ3 A;  1HRI 3;  2VCC A;  4Y5T A;  3MEP A;  2P5B A;  3E6D A;  3VHN A;  5A6Z A;  4FPJ A;  2JE9 A;  1DGW A;  3ZMN A;  4H55 A;  2AH2 A;  4KWJ A;  1MS8 A;  1XYN A;  2ZZQ A;  4CDW B;  4N8M A;  5GZD A;  5L7O A;  3I3B A;  4DB5 A;  5FPV A;  2ZAA A;  1H2N A;  1G9F A;  3CIH A;  5C3Q A;  1GZW B;  1Z78 A;  2UYA A;  4GAL A;  1CON A;  1SCS A;  4UFK A;  1CJD A;  4AWD A;  5FZ8 A;  1TVG A;  2WSU A;  2WYF A;  3RZG A;  2HWF 1;  3KWV A;  4UF0 B;  3PUS A;  4KNC A;  3AP6 A;  2E31 A;  4JTO A;  1FOD 2;  3MIE A;  2R32 A;  3N7L A;  2Y64 A;  5DXD A;  3ZM8 A;  1WLT A;  1UU4 A;  5CFD B;  1WW6 A;  4MYE A;  2ZHM A;  1JU4 A;  1QNW A;  2ZGU A;  4QX8 A;  4QXH A;  4GD4 A;  3OPT A;  3DPR A;  3SCG A;  2VME A;  1B35 B;  4XFF A;  3I2G A;  3NKG A;  4OZO A;  5FY7 A;  4ZS3 A;  3W5M A;  1PX4 A;  4FP2 A;  4MGQ A;  4MUV A;  3ZSE A;  2YYO A;  2DUP A;  2VMH A;  5FZE A;  4DUX A;  4E9K A;  5DMY A;  4HKO A;  3T0D A;  2PHF A;  4AZZ A;  1JZ5 A;  5C3S A;  1SG3 A;  1WA4 A;  2DTW A;  2RVA A;  5A7Q A;  4NID A;  3AFK A;  3EB7 A;  1GWK A;  1JS9 A;  4P02 B;  4C90 A;  3SEE A;  5L9R A;  2W08 A;  1YFX A;  2RV9 A;  4ARY A;  1AL0 G;  2HWF 3;  2FDJ A;  4AEJ A;  2VQ0 A;  3I97 A;  2MHF A;  1OFS A;  3JQX A;  4XMA A;  5IWF A;  4NPR A;  1ACC A;  3RNS A;  2I74 A;  1F15 A;  1W6Q B;  1COV 1;  3D0J A;  4XJW A;  1N3Q A;  1OPO A;  3CQO A;  3SIT A;  2ZGS A;  1BBT 3;  3V64 A;  1QQP 2;  1Q8P A;  3ZX7 A;  2X8K A;  2EAA A;  5BNO A;  1LJ7 A;  4GKX A;  2QQP A;  1ND2 B;  5IJR A;  1PO1 1;  4ZU4 A;  4ZHN A;  3OEA A;  2XBO 1;  2EIG A;  1YJK A;  3KV6 A;  2WWU A;  1DQ1 A;  1NCR A;  2UWB A;  4QKN A;  1AR6 1;  2J1S A;  1RUD 2;  2W0X A;  3RJ2 X;  2OQ6 A;  3ILR A;  4FQZ A;  4NIH A;  3K48 A;  4DRR A;  4CCM A;  2AEN A;  1SLT A;  4LBQ A;  4CCN A;  4UFL A;  2HWD 1;  2DFC A;  3VBU A;  3UGF A;  1VBB 2;  3ZSJ A;  5FKB A;  2B9U A;  3R4D B;  3U14 A;  4W65 A;  3JU9 A;  2WL1 A;  1PO2 1;  3JBG 2;  2VOX A;  5C8C B;  1BYH A;  3AJY A;  3OYW A;  2IVJ A;  4MZU A;  1CIW A;  1COV 2;  1PMJ X;  4YRD A;  5FO8 B;  4WVM B;  5F9T A;  1PO1 3;  1BVV A;  1E5R A;  2P3Y A;  2RMU 1;  2XLG A;  4UAP A;  1AYM 1;  3AKQ A;  4M0H A;  4N53 A;  3LPG A;  4O65 A;  1V6L A;  1ZA4 A;  5GKA C;  3U75 A;  2QUO A;  1LOD A;  2WYS A;  3UYJ A;  4A3X A;  2R1B A;  1FPN 3;  1GZC A;  4BWO A;  3RFR A;  2Q0A A;  2RDS A;  1OD3 A;  4XYX A;  1MAC A;  3P6B A;  1RUD 1;  2PHR A;  5GM0 A;  3OPW A;  4LBJ A;  2VXR A;  1QQP 3;  4IE7 A;  4CP1 A;  1JYX A;  1BHG A;  1W3V A;  2I2S A;  2ZML A;  2E6V A;  1ZBA 3;  4V2V A;  2YDE A;  3S30 A;  2XKP A;  3VBS C;  1OC1 A;  1PVX A;  4Z07 A;  1CAX B;  3I8T A;  1XNT A;  2HWE 1;  1E5I A;  5FO9 B;  4K40 A;  1LOF C;  2AR6 A;  2D97 A;  5J96 B;  1LNS A;  1QMJ A;  2HWB 1;  1UYY A;  3O14 A;  1GOF A;  3C7O A;  2VD7 A;  3HQX A;  2RJL A;  1M06 G;  1M4W A;  2QVS B;  1ENR A;  3MIC A;  3JBG 1;  4IEY A;  1VBC 3;  5FZ4 A;  1QJX 2;  2B45 X;  5FP4 A;  1WW4 A;  3AP9 A;  4MET A;  2ET7 A;  2F17 A;  1NA1 B;  1AYM 3;  3RDI A;  1YFY A;  4IQP A;  2XHN A;  4HSL A;  2X10 A;  2BTV C;  1B35 C;  1LEN A;  1XC6 A;  3LSD A;  3MDP A;  4G9S B;  4LO4 B;  4TSV A;  4UWD A;  5FZF A;  1FNY A;  3I2I A;  4UYB A;  1WUV A;  5FMC A;  3OF1 A;  5GAL A;  1R09 1;  4CCL A;  4AVB A;  1IPK A;  4DXR A;  3BU0 A;  2FDG A;  2W95 A;  2JDU A;  3APB A;  4NWW A;  2QQM A;  4QXC A;  3T2Q A;  1KQR A;  2VOV A;  3BU7 A;  4P5H A;  4W6W A;  1PZ8 A;  1OVS A;  1UXX X;  1YWK A;  2JX9 A;  1CAW A;  4EV0 A;  3TAY A;  1RMU 1;  1DQ5 A;  2WZP P;  1ASJ 2;  4DFS A;  1NZI A;  3O1T A;  3S57 A;  1UCX A;  2RS5 3;  5BNN A;  2IWG B;  1JN2 P;  1N3O A;  1UOF A;  3RVH A;  5KHG A;  1VAV A;  2HWB 2;  3NRU A;  4IGQ A;  4AOC A;  2VCB A;  4QT6 A;  5F2W A;  4MSV A;  2XOM A;  5KXD A;  4MGY E;  1BEV 2;  5IAX A;  2WA4 A;  3MUZ 1;  2QQO A;  1OUX A;  3AX4 A;  5A1L A;  4P9L A;  4AED C;  1R09 3;  1VPH A;  2F4L A;  3PDQ A;  5FTT C;  3WDT A;  3V0B B;  3I2H A;  3U0Z A;  3RZM A;  5FZO B;  1H2K A;  1ULP A;  2W1S A;  5EYY A;  3SEP A;  3WNO A;  3WV6 A;  2X5I B;  4Q4Y 1;  4XQ4 A;  1XPW A;  5HV0 A;  1YFU A;  1NKG A;  3RYK A;  1AX1 A;  1HJG A;  2GH2 A;  2BWC A;  4Y4Y A;  2UY9 A;  4ET7 A;  1CGP A;  5B4X A;  1FYU A;  4IV3 B;  1BEV 3;  2WAO A;  4QPG C;  1QJY 2;  1C5H A;  1HB4 A;  3MF6 A;  4ASM B;  3NNM A;  4XAA A;  3IPV B;  3W58 A;  4PLM A;  1VBC 2;  2VBD A;  3ZFE C;  3NKT A;  5BPX A;  1HDK A;  1W6M A;  1AXZ A;  5CVR A;  4CP9 A;  1VRB A;  4FFH A;  3NQH A;  1DIW A;  5ISL A;  3RYP A;  2PTM A;  1NQJ A;  3BYW A;  4YAR A;  5IK5 A;  1WCU A;  5C4W C;  1MVE A;  2OQ7 A;  5FP7 A;  2WS9 1;  3ZO0 B;  5FOB B;  2X5I A;  1YNA A;  2BFU S;  2BNO A;  2N7G A;  3EYP A;  4JKL A;  3WDV A;  4JDO A;  2ET1 A;  5FZ0 A;  1PO2 3;  4CEW A;  4QGN A;  5L7O C;  4Q4Y 3;  1GP4 A;  3J8F 2;  1MS3 A;  2BBA A;  4E27 A;  1F9K A;  1AYN 2;  3ZFG B;  1EUT A;  4BOW A;  1DP0 A;  5FYM A;  5CAD A;  3KCY A;  4KBB A;  5CAZ A;  2CU5 A;  1ULF A;  5A80 A;  3WLU A;  4UFJ A;  3WF4 A;  3ZVX A;  5JAX A;  2OUH A;  1X9T A;  1QJY 1;  3VDD C;  1HV0 A;  1IPJ A;  1AJO A;  5K0U A;  2A70 A;  2PFW A;  3LFM A;  4PCR A;  3OJB A;  1SDD B;  1XBF A;  4R9D A;  2XL9 A;  4FPO B;  2W46 A;  3MIH A;  1VMH A;  3KT7 A;  4YGB A;  4BDV B;  4WM8 B;  1QOO A;  3ECQ A;  2P2K A;  4FPE A;  2UY8 A;  2ZGK A;  3SCF A;  3I3M A;  2WNU C;  1HB2 A;  1YFW A;  3T2O A;  4DPN A;  4ZZ8 A;  4CSW A;  4ATE A;  5F8P A;  2E33 A;  4JQR A;  4PIY A;  4IEX A;  2LUW A;  4K20 A;  3WCR A;  1OOP B;  4Q1P A;  1Y9G A;  5GZC A;  1RUE 3;  2WZR 2;  3MPB A;  2XH6 A;  3VBO C;  2JD4 A;  3DYM A;  5C3P A;  4BK5 A;  4TLG A;  4GWM A;  5LRS A;  1O5L A;  5HCH A;  1ZZ7 A;  3LGR A;  3RWN A;  2BBV A;  2GC3 A;  2JDZ A;  2VU9 A;  4QPW A;  4CEY C;  4LO6 B;  5BNP B;  4JRA A;  4QQH A;  1AYN 1;  1RIN A;  4BQ4 A;  1VAK A;  2O8Q A;  5FZL A;  2ADE A;  3NNL A;  1EAH 3;  3MV1 1;  2XVG A;  5FXX A;  3V0A B;  3VZL A;  5LEJ A;  4NHX A;  5K0U B;  5DAV A;  5H9R A;  5FCC A;  2YRO A;  3I2J A;  5GZF A;  4WVZ A;  3N9P A;  5IVB A;  1KJL A;  2R04 3;  4OYU A;  1HB1 A;  2QNK A;  2ORZ A;  3B7M A;  1UQX A;  4AFC A;  1AR9 3;  2A73 B;  4FOQ A;  4PHZ A;  4LUL A;  4Y1X A;  1XE8 A;  4O61 A;  1IG0 A;  2AAC A;  3VHP A;  5FPU A;  4R9C A;  1F4H A;  2W92 A;  4N7I A;  4Y1Y A;  3NNG A;  4XQD A;  5LEK A;  1VBA 3;  1QH6 A;  2CL2 A;  2JG8 B;  1VAM A;  5BYN A;  4QPI C;  4BYY A;  1JXN A;  1CAV B;  1SLA A;  3PVO A;  2BFU L;  3GZE A;  4KG8 A;  4MXW B;  4IL7 A;  5A33 A;  3TYJ A;  4TZD A;  5A7W A;  2WUH A;  5L9B A;  1VB4 A;  3IT8 A;  1APN A;  1GQH A;  2ZTN A;  4QX0 A;  3TRS B;  4O9G A;  2DUO A;  5CFC B;  4MX3 A;  1QJZ A;  5FJK A;  4ASK A;  5CA6 A;  1ZBE 2;  5FY4 A;  3JXS A;  1AR8 3;  4AQT A;  3WG4 A;  1DQ2 A;  2XUE A;  3QOP A;  3DL3 A;  3LCP A;  5CFC C;  3U11 A;  3B00 A;  4FPF A;  3MF9 A;  5IK7 A;  1O3S A;  5DAP A;  1KFU L;  4LBQ B;  5IAV A;  3BOW A;  3KS7 A;  1AR7 3;  4LHN A;  4XAE A;  1RUO A;  4FTB A;  2Y60 A;  4P9I A;  3QAC A;  1NCQ C;  2CGN A;  4CP0 A;  1UWW A;  3OSD A;  1H9W A;  2GZW A;  1QJF A;  4FBF A;  4QX3 A;  1JOB A;  1GNZ A;  1O4Y A;  3LB9 A;  3DXT A;  4BXS V;  1AR9 2;  2X53 S;  2Y0O A;  2DVA A;  3GZT B;  2VGD A;  3KM5 A;  4HG6 B;  4P00 B;  3ZN4 A;  3CJI B;  4SLI A;  4LKE A;  4R8H A;  1UZ0 A;  2XLA A;  2VOK A;  1FMD 1;  1W04 A;  4EN6 B;  1BK1 A;  1YQ8 A;  4AGR A;  3I3Q A;  2ZEZ A;  1ZBE 1;  4Y26 A;  2VMD A;  3O0V A;  4XE9 A;  5EP9 A;  4DIQ A;  1C5I A;  4XFC A;  5BNQ A;  2YBP A;  4FFI A;  5GLT A;  3ZYP A;  4KWL A;  2PAE A;  2VQA A;  1LCL A;  1RVF 2;  3PHM A;  4UFM A;  5DUX A;  3TNQ A;  3ZPY A;  5A1A A;  5JXJ A;  1J3R A;  2D44 A;  3D6E A;  3OCP A;  5JWP A;  1PVC 3;  1S2B A;  3A7Q A;  4Q5O A;  2BGC A;  3WNL A;  1RUG 2;  2NM1 A;  5F32 A;  3KV5 A;  1LHW A;  1W8U A;  3GXU A;  3POW A;  3ASI A;  5FYU A;  2JE7 A;  4CDX C;  2WNV A;  2B5H A;  1NZC A;  2WSV A;  1WMX A;  1JZ2 A;  2HWC 2;  3DKW A;  3KGL A;  1XYP A;  3KB5 A;  4B7E A;  1H1I A;  1A34 A;  1MZE A;  2BGP A;  4AVA A;  1W8W A;  1MS1 A;  4Q1R A;  5EFU A;  5ABJ C;  3C2U A;  3VZM A;  1UIJ A;  5BNN C;  5FV3 A;  5HPO A;  1BJQ A;  5DAW A;  1O4Z A;  1RUE 1;  2JDN A;  2BVV A;  1RUC 2;  3M3O A;  3ZXF A;  4C91 A;  1RUF 3;  2X09 A;  4QMA A;  4QKD A;  1NYW A;  2DF7 A;  3MYX A;  3UT0 A;  1PZ7 A;  5ACA 2;  4XTM A;  1GNY A;  3BGA A;  1VRH 1;  1Q56 A;  3ZYI B;  2V72 A;  1YC6 1;  3ABZ A;  4L8Q A;  3C7G A;  2QZ3 A;  2YBK A;  4DUW A;  4QD2 A;  3ZMO A;  3RSJ A;  4D69 A;  2ZGP A;  5LZ6 A;  5JOX A;  1RUJ 3;  4CU7 A;  5L7O B;  2D3R A;  5CG8 A;  4LO5 B;  3T30 A;  2G19 A;  2CY6 A;  2EVX A;  4N53 B;  2GAL A;  5C3R A;  2LRP A;  3ILN A;  3WHT A;  2QQN A;  4FPL A;  1UZW A;  4DEV A;  2C24 A;  1PVC 2;  4JRL A;  5A3M A;  4NHK A;  1JZ3 A;  4IEU A;  1OF4 A;  5FZG A;  3ZFF B;  4AG4 A;  4EE2 A;  3OBZ A;  5T5L A;  3LDK A;  1LGB A;  3E5U A;  1HRV 2;  1QKQ A;  3NAP A;  4H2A A;  3J7N A;  1V00 A;  1POQ A;  4JGZ C;  4MO3 M;  4ES8 A;  2W1U A;  5JMC A;  5CG9 A;  4Y5S A;  1OLM E;  1RHI 2;  3AP4 A;  2ZAC A;  5FUI A;  3SMH A;  4Q4X 3;  1YI7 A;  2QDN A;  4QQ2 A;  3NW4 A;  5C6C A;  4XDQ A;  1O91 A;  5F2S A;  4AGV A;  1RUJ 1;  5FY0 A;  1CPN A;  2WO1 A;  2X5I C;  3WG3 A;  3M3E A;  3TEZ A;  1R08 1;  1RXF A;  4FAH A;  3DPR C;  4CEW C;  1XQN A;  4S2H A;  4HLT A;  1CQ9 A;  4RGA A;  3AVR A;  4NO4 A;  5AC9 1;  5A3U A;  1CN1 A;  2O1Q A;  5GLV A;  1NCR B;  1OH4 A;  4P9X A;  4RSU A;  4K21 A;  3UES A;  1X50 A;  4URA A;  5BNO B;  3B02 A;  4X6R B;  5C8C C;  4Z1V A;  1T2X A;  2WZE A;  1I1E A;  1O3R A;  3K3N A;  4ORF A;  4I09 A;  4U2A A;  1PNG A;  3HVD A;  2ENR A;  4PLO A;  3WP4 A;  2PN5 A;  3FLP A;  4CCC A;  4MHR A;  4NIG A;  3ELN A;  4FP3 A;  4CXW A;  4YVS B;  2HH9 A;  2XWB B;  1Z7S 1;  2A3X A;  3OUH A;  2AYH A;  4HMZ A;  1CAV A;  4LQR A;  2ZEY A;  4Q4V 3;  4XBN A;  1S2E A;  1YCI A;  1ALY A;  2GC1 A;  1H1M A;  4EZH A;  1L3J A;  1LHV A;  1OFN A;  1SFN A;  1KS5 A;  4Y3O A;  5J98 B;  2DUQ A;  3M1H A;  2W5F A;  2VZR A;  1R08 2;  3BCW A;  4AL9 A;  4XAC A;  4COV A;  4GMP 3;  1C8M 2;  1U12 A;  4UT5 A;  1PIV 3;  4YLZ A;  4FI9 A;  1PM4 A;  1WCQ A;  3WVJ A;  1ND2 C;  2VTX J;  3KV4 A;  4EN8 B;  5JLV A;  3PUA A;  4CEW B;  3PME A;  1FOD 1;  4X8P A;  4XUN A;  3S7E A;  2W91 A;  3IM0 A;  5JSO A;  4J1W A;  1QU0 A;  2XBO 3;  2ZEW A;  5EYX A;  1HXS 1;  1ULG A;  2R1D A;  3NMB A;  3HQU A;  4JX0 A;  4RR3 B;  2QCS B;  5A70 A;  5JOZ A;  2DBI A;  1O59 A;  3VBU C;  1OSG A;  2QQK A;  4A45 A;  3JCI A;  2XGX A;  4MGT A;  5GZG A;  4D7T A;  4IEO A;  1WW7 A;  3N7K A;  4L92 A;  4LOR A;  4BJ0 A;  1W99 A;  4QKF A;  4C0H A;  4PF1 A;  2A5Z A;  1NXD 1;  4XFH A;  4IV3 A;  4CU9 A;  4F83 A;  4GMP 1;  1YLL A;  4KU8 A;  4B4Q A;  1W8T A;  4CUG A;  4KWK A;  4N7U A;  4XF9 A;  5FAX A;  4N53 C;  4PQ9 A;  3FUQ A;  4HN0 A;  3OD0 A;  3ZXK A;  4GXL A;  5FY5 A;  1QGL A;  2E63 A;  1SBF A;  3B9I A;  5GLZ A;  1WCK A;  1LAJ A;  3WT3 A;  5I0S A;  4IDZ A;  1N1V A;  1UAI A;  2RMU 3;  1W6N A;  3PUI A;  3VKN A;  1WA6 X;  2Y6J A;  1OQ1 A;  3BB6 A;  4GA9 A;  4IXL A;  2ATF A;  4QHZ A;  2DVF A;  3ZPO A;  2DTY A;  3E6C C;  2O14 A;  1HRI 2;  1SZB A;  2WN2 A;  1A8D A;  5EQU A;  4B29 A;  5FXV A;  3ZFF A;  3UNP A;  4YVS C;  1JHN A;  2JDA A;  2VNG A;  3MIG A;  1NLR A;  2EIB A;  2P3I A;  2VVD A;  3LEK A;  5BNN B;  3RPQ A;  5FFO C;  1JI6 A;  2EID A;  5IVF A;  1YEW A;  4JTN A;  3WF2 A;  4L9B A;  1UU6 A;  4RHV 2;  4QWN A;  4XPV A;  2A6Z A;  4YGE A;  3VHR A;  5DZG A;  4NAO A;  1BBT 1;  1R1A 3;  4BQ2 A;  3H3U A;  4IV1 A;  2EA7 A;  4GB3 3;  3MGU A;  2J7M A;  3UGH A;  4CDX B;  1A8M A;  4RA0 A;  4AHY A;  3DYO A;  2ZKN A;  4MOA A;  2QQW A;  4B1L A;  1CX1 A;  3L2Y A;  3TOJ A;  1CES A;  3AYE A;  2NMN A;  5H9Q A;  4R9B A;  1UF2 C;  2DUR A;  4XUP A;  1UY0 A;  2XJS A;  4ONU A;  1DLL A;  4XDP A;  3ZYB A;  3POE A;  2JIJ A;  3PVE A;  1POV 1;  4BH9 A;  3AMH A;  2C6S A;  1HRI 1;  2J1T A;  3TN9 2;  2RG4 A;  2Y26 A;  3AKP A;  1PK6 A;  2HBT A;  4JQT A;  1I3H A;  1QF3 A;  4ISQ A;  5FDB A;  4NRP A;  4NHY A;  2WNV B;  1WMF A;  1H2M A;  2VW0 A;  1W6P A;  3RI8 A;  3V0B A;  4L2N A;  5FQ0 B;  2ZHL A;  1OA4 A;  1BBT 2;  4N43 C;  4RS5 B;  2P6C A;  2WBK A;  2Y6H A;  4JCK A;  2CTV A;  2VMG A;  4YZ4 A;  2Y8K A;  5T52 A;  4H14 A;  4D7Y A;  1ODN A;  2FCT A;  1AXY A;  3A4U A;  1JYT A;  5BNP A;  4I30 A;  4A41 A;  5LRR A;  3M2M A;  5JZG B;  2EIE A;  5KC5 A;  2GAU A;  4BLI A;  1G8W A;  4BM8 A;  4YM3 A;  4HVR A;  3C3V A;  1QQP 1;  4I0W B;  4ARX A;  4D94 A;  2YBS A;  3AC0 A;  3GBG A;  1H0B A;  1PO1 2;  2BRT A;  2ZOE B;  3OYW B;  1KS4 A;  3CDZ B;  3POF A;  1X82 A;  1AR6 2;  4AXO A;  1XNA A;  5I91 A;  1QEX A;  4FFF A;  5DAB A;  1XYO A;  3JBG 3;  3GZU C;  5BV6 A;  1WLD A;  4C0B A;  5EWS A;  3B01 A;  4PT6 A;  2P37 A;  2HEY F;  3PVN A;  1S0F A;  1DZQ A;  5B4N A;  1WMD A;  2WN3 A;  5CYY A;  4CDW C;  5A7P A;  2BOI A;  3MW2 A;  4MH0 E;  3FWE A;  5FPX A;  1XOY A;  2WT2 A;  4FPG A;  4DUV A;  2PMW B;  1V6O A;  3GM8 A;  3QD6 A;  2PQQ A;  4S2F A;  1SLL A;  1QNY A;  1IGO A;  1GP5 A;  4RHV 3;  5C9A B;  4RD7 A;  3ILF A;  1QJU 3;  5DAX A;  3OTF A;  4E2S A;  1MEC 1;  1IQA A;  1D4M 3;  3OB8 A;  3T4H B;  4K1Z A;  5FP8 A;  2ZJC A;  1AYM 2;  1AX0 A;  3MHZ A;  4QDS A;  3RZZ A;  3TN9 3;  4Y33 A;  3GYD A;  4LKD A;  5JPM B;  4F7Z A;  3RJR A;  4AI9 A;  4CCK A;  1WZX A;  1UYP A;  2PAK A;  2QQV A;  4BXF A;  4PDW B;  4Q4Y 2;  5E88 A;  2WT0 A;  3RQ0 A;  5L9V A;  4PQQ A;  3T0A A;  4OUE A;  5HCF A;  4FAG A;  1OKO A;  1BZW A;  3NV1 A;  3U1X A;  3NO8 A;  3O0X A;  1GZT A;  4YW2 A;  1I9R A;  5JOW A;  1DBN A;  4YG3 A;  3LOB A;  1U5Z A;  3HN1 A;  4AYU A;  4AFM A;  3CU7 A;  3RZL A;  3BIE A;  2BPA 2;  2AEY A;  5IVY A;  2B39 A;  5F39 A;  4YWA A;  4NAM A;  4J1X A;  3VBO A;  1X8M A;  2ZXQ A;  5FBZ A;  4Y20 A;  1GV9 A;  1HQL A;  1OUR A;  1ZZ9 A;  2XJV A;  1D4M 1;  4ITC A;  2JG8 A;  4FPK A;  4PF5 A;  1Q43 A;  4BME A;  1DGR A;  1WKY A;  5FYI A;  2WS9 2;  3O7O A;  2BUK A;  1UYZ A;  1IS4 A;  3AKS A;  4XTP A;  5KWR A;  5A3W A;  3OPZ A;  2WJS A;  2GMP A;  1VBE 2;  1IKQ A;  2W1W A;  1W0N A;  3S5A A;  1DZT A;  4Y5Z 0;  1W8F A;  2Q1F A;  1RUN A;  1FPN 1;  1VBD 1;  2EAL A;  2JG9 B;  3G7D A;  3POS A;  4AVC A;  1EAH 1;  3HMY A;  3OY8 B;  1W9Y A;  3LF7 A;  2WWS A;  1LTE A;  2O8O A;  2R06 1;  3RRD A;  4K8F A;  5EJ3 A;  4D6S A;  3I4I A;  5DUU A;  1XNC A;  3I59 A;  4UFH A;  5FYT A;  1PX3 A;  2H0B A;  3I2F A;  4QPI A;  5F5C A;  4DOU A;  2XKO A;  4AK3 A;  2PHW A;  3X29 B;  4V2W A;  5GLW A;  2VOW A;  1FXZ A;  2HEV F;  1BEV 1;  3FLT A;  3HOB A;  5A1F A;  2D5F A;  1RJ7 A;  4D3W A;  3KVB A;  1FV2 A;  1W06 A;  1C3H A;  1Y7B A;  1TMF 3;  2J1U A;  2W47 A;  2WZR 1;  3I7D A;  2VL4 A;  2W3J A;  1QJY 3;  4PDW C;  1UMZ A;  4AGG A;  3VBF C;  4IV3 C;  4QU2 A;  2TNF A;  4QQP A;  1UD1 A;  1PZ9 A;  1J3Q A;  4P9Y A;  3H42 B;  4PI2 A;  1RUH 1;  3IZO A;  2ZCW A;  2R0H A;  3HBZ A;  3WOG A;  1JYI A;  1XJA A;  5DG1 A;  3VKO A;  5JIU A;  4Y20 B;  2GSY A;  4BU2 A;  2C26 A;  2R49 A;  3AMM A;  4GWJ A;  4HVO A;  4JDM A;  4BQW A;  1HKD A;  3K51 A;  4HXC A;  5JI7 A;  4GKY A;  4WZC A;  5C9A C;  3DF0 A;  2LRO A;  1OOP C;  5LA0 A;  3RZH A;  3QH6 A;  4EYU A;  3N7M A;  3R4U A;  5KXB A;  1T6B X;  2ZGO A;  4YW3 A;  2RS3 2;  2XR4 A;  4P5Y A;  2Q8C A;  5FLH A;  5B2G B;  2YGL A;  2ZX1 A;  1UMI A;  1JUH A;  2ZAH A;  1D0H A;  4WM8 C;  4QGM A;  4B1M A;  2XDV A;  1RL3 A;  1U5Y A;  3EO6 A;  4AI1 A;  4IE6 A;  2Y6L A;  4GWI A;  1SQ4 A;  4TWT A;  4CPB D;  2OPK A;  4IES A;  5C8W A;  2A7A A;  2H6B A;  3NV2 A;  1MQT A;  5J48 A;  1E5S A;  1FMD 3;  2WAA A;  3VHO A;  1K3I A;  2VTX A;  2YFZ A;  2A1X A;  3KV9 A;  4BIF A;  5DG2 A;  3B93 A;  5FYV A;  2RS3 3;  2V5D A;  3VKF C;  1QIQ A;  1UY2 A;  4L97 A;  3VL9 A;  1GIC A;  1WW5 A;  4ZU7 A;  1REF A;  1UIK A;  3V56 A;  1MS9 A;  5JZG C;  3AYC A;  2GND A;  3M4F A;  5E1R A;  1CVN A;  4SBV A;  3CZJ A;  4AFA A;  5J3U A;  1ULE A;  2WWJ A;  1US2 A;  1QDC A;  2B42 B;  2Z5W A;  4N43 B;  3EBR A;  1WD4 A;  5F3G A;  5ABJ A;  5FLJ A;  2UWA A;  1F5F A;  5DDJ 2;  1PK6 C;  1DQ4 A;  1AX2 A;  2A3Y A;  3FBM A;  2BYV E;  1CAW B;  1V70 A;  4QM9 A;  1AR8 1;  3JZV A;  4LLO A;  2BQP A;  4ZPI A;  5C7G A;  1AR9 1;  3H3L A;  1C8N A;  1OF3 A;  4KGG A;  2Q8D A;  2FCV A;  3VBS B;  3B69 A;  1QOT A;  5LY1 A;  3HIF A;  2Y6G A;  2HWC 3;  2E51 A;  2YXS A;  1MS5 A;  4RR3 C;  1VBA 1;  1OMI A;  1OPM A;  2TBV A;  1LB2 A;  3W9A A;  1B09 A;  1LUL A;  5I8Y A;  2VOT A;  1GNH A;  1AUY A; 
#chains in the Genus database with same CATH homology
 3VD4 A;  3WNN A;  4TXW A;  3A22 A;  2XQX A;  3K4D A;  3HNM A;  5JMO A;  1J84 A;  2QQJ A;  1W9S A;  1UYX A;  3LE0 A;  1JZ6 A;  5JXG A;  1H6Y A;  2QQI A;  1JYN A;  2ZEX A;  1UWW A;  3DEC A;  4QX3 A;  3D3A A;  2JE8 A;  4BXS V;  4XUT A;  4HG6 B;  2KD7 A;  4P00 B;  4OMC A;  2VM9 A;  1JYW A;  1F4A A;  2R7E B;  1UZ0 A;  3MV0 1;  3BN6 A;  2ZEZ A;  2DCJ A;  2VMD A;  1TG7 A;  4A4A A;  1MPX A;  2VC9 A;  3VDB A;  3GGL A;  4A44 A;  5JXJ A;  1K42 A;  5A1A A;  2JD9 A;  4RYD A;  2VZT A;  4LHS A;  3OGR A;  3OBA A;  3A7Q A;  3WNL A;  2QBX A;  1UY4 A;  3GXU A;  3OEB A;  1RYY A;  4UOJ A;  3VD5 A;  4CUC A;  1JZ2 A;  3IAP A;  2CDP A;  1HN1 A;  1IQD C;  2BGP A;  5F7U A;  4LKS A;  2VJX A;  5HPO A;  1EUU A;  3OGS A;  5DQ0 A;  2X09 A;  3T09 A;  1GNY A;  1K45 A;  3BGA A;  2V72 A;  3ABZ A;  1CIY A;  3C7G A;  4DUW A;  4QX1 A;  1PMH X;  3IDA A;  5C70 A;  4CU7 A;  4CUA A;  4XUQ A;  1NX9 A;  2LS6 A;  5G05 L;  3ACF A;  2VZV A;  1NUK A;  2QQN A;  4DEV A;  1O8P A;  1L7Q A;  3VD9 A;  1JZ3 A;  2E26 A;  1OF4 A;  1GU3 A;  4AG4 A;  2X05 A;  1NAE A;  4MO3 M;  3K4Z A;  2W1U A;  4JKM A;  3SKJ E;  5FUI A;  3GDB A;  2VMC A;  2Z4F A;  2J1A A;  2WO1 A;  4A42 A;  2VR4 A;  4P08 A;  3I2K A;  5J1X A;  3WSO A;  1OH4 A;  2BGO A;  5LA2 A;  2WZ8 A;  3UES A;  2BER A;  3J7H A;  4QB2 A;  3WNK A;  3FL7 A;  3MBW A;  5DN2 A;  2OKX A;  1T2X A;  2WZE A;  2XON A;  4CU6 A;  1W9T A;  5CZK A;  4E8C A;  5IFT A;  5JR2 A;  2W94 A;  3ACI A;  3DYP A;  2YG0 A;  3WQB A;  1SHW B;  1UXZ A;  4DXT A;  4LQR A;  1KGY A;  2ZEY A;  3NJX A;  3I3D A;  2W5F A;  2VZR A;  5EJ1 B;  3T2P A;  4KI5 M;  3VD3 A;  3C7E A;  4FI9 A;  1WCQ A;  1W9W A;  4YPJ A;  2BZD A;  5JUV A;  2J22 A;  2J1V A;  2VZQ A;  3THC A;  4XUN A;  2VQT A;  2W91 A;  5JXH A;  3HN3 A;  2ZEW A;  3K46 A;  5IYY A;  3P1I A;  4JX0 A;  2VCC A;  3MO4 A;  3I3E A;  1O59 A;  1UY3 A;  2QQK A;  4A45 A;  3K75 B;  1JHJ A;  4BJ0 A;  1W99 A;  3F2Z A;  4XZU G;  3I3B A;  1R64 A;  4LPL A;  3CIH A;  5DPN A;  4PF1 A;  4GZ9 A;  2RJ2 A;  4CU9 A;  1US3 A;  3HJR A;  1TVG A;  3U37 A;  4Z2A A;  1GQP A;  2WO2 A;  2E31 A;  3PUI A;  2W1Q A;  4QB6 A;  2Y6J A;  3K4A A;  2Y64 A;  3ZM8 A;  3HNY M;  1JU4 A;  1JZ4 A;  2VME A;  2WQ8 A;  2WN2 A;  3I2G A;  1D7P M;  4OZO A;  4QDQ A;  3W5M A;  1PX4 A;  3FN9 A;  4MGQ A;  3UNP A;  2JDA A;  2EIC A;  2EIB A;  2LW8 A;  4DUX A;  3LEK A;  5DMY A;  1JI6 A;  2EID A;  3T0D A;  4L0P A;  1JZ5 A;  3WF2 A;  4KWU A;  1SG3 A;  3CMG A;  2RVA A;  1W8N A;  3NJV A;  3EB7 A;  4P02 B;  3SEE A;  3A21 A;  2RV9 A;  4ARY A;  2J7M A;  3I97 A;  1CX1 A;  3DYO A;  1O8S A;  3FHA A;  4MOA A;  1CZT A;  1KEX A;  2VO5 A;  5HXM A;  4XUP A;  2VZP A;  3ACG A;  3CQO A;  1UY0 A;  1UMH A;  1DYO A;  5IJR A;  3OEA A;  2WAB A;  5IFP A;  2J1T A;  2J1S A;  3OGV A;  4OMD A;  4QX2 A;  2VZS A;  5LA1 A;  2YC4 A;  4ZXE A;  3WNM A;  1JZ7 A;  2WBK A;  2Y6H A;  2Y8K A;  3HNB M;  3OG2 A;  2E32 A;  1CZS A;  4A41 A;  1PMJ X;  2EIE A;  2VZ3 A;  4JHZ A;  4W50 A;  4ARX A;  3C7H A;  4UAP A;  3AC0 A;  3LPG A;  2VTF A;  1I5P A;  1GOH A;  4QAW A;  2WYS A;  1UX7 A;  4M4P A;  1OD3 A;  3CDZ B;  1XNA A;  3P6B A;  4QB1 A;  1JYX A;  2HYX A;  3FHQ A;  2VCA A;  2VZO A;  3WF0 A;  1J83 A;  1BHG A;  3PUH A;  3T0B A;  4PT6 A;  2C4X A;  4DEQ A;  3VDA A;  5B4N A;  3HPN A;  1XNT A;  2WN3 A;  5CYY A;  3WEZ A;  1L7R A;  4XUR A;  1H6X A;  1LNS A;  2ID4 A;  1UYY A;  1GOF A;  3C7O A;  4DUV A;  4RN5 A;  3GM8 A;  4BK4 A;  3MUY 1;  2WO3 A;  3LEI A;  2XHN A;  3OB8 A;  2X10 A;  3IAQ A;  1JZ8 A;  1XC6 A;  5EIY B;  3LQC A;  4QDS A;  3I2I A;  1GMM A;  3LPF A;  4DXR A;  2W95 A;  3WNP A;  1JYV A;  4JKK A;  2QQM A;  3T2Q A;  4PQQ A;  2J1E A;  3T0A A;  1UXX X;  4OUE A;  4M4R A;  3SKV A;  4D8M A;  5LCW L;  2VQU A;  2J1R A;  2JKX A;  4W8J A;  1UY1 A;  2HLE A;  3NRU A;  2VCB A;  2WDB A;  2ZXQ A;  4IUG A;  2XOM A;  2YC2 A;  3UET A;  3VD7 A;  1WKY A;  3MUZ 1;  2QQO A;  1UYZ A;  5IHR A;  3THD A;  4CVU A;  1P8J A;  3I2H A;  1ULP A;  2W1W A;  1W8O A;  2W1S A;  1W0N A;  2CDO A;  3SEP A;  3E1F 1;  3WNO A;  1ULO A;  1XPW A;  3C7F A;  1NKG A;  1CZV A;  4ET7 A;  5B4X A;  4ZZ5 A;  2WAO A;  4A6O A;  2W9X A;  1PX3 A;  3I2F A;  3LEG A;  2V4V A;  4UI9 L;  3NQH A;  4MAD A;  3HOB A;  3A23 A;  4W4Z A;  2ORX A;  4JKL A;  5C71 A;  3EYP A;  1GOG A;  2J1U A;  2W47 A;  2VL4 A;  2W3J A;  4TTG A;  4MGS A;  2BBA A;  3W5N A;  1EUT A;  1DP0 A;  3III A;  4XVH A;  3WF4 A;  1K12 A;  2C26 A;  4GWJ A;  2B4K A;  3CKH A;  3WF1 A;  4XUO A;  1SDD B;  3CZU A;  5LA0 A;  2W46 A;  1DLC A;  4BDV B;  3ECQ A;  4P5Y A;  2PQS A;  3T2O A;  4QDR A;  4ZZ8 A;  3K77 A;  1UMI A;  2VZU A;  2E33 A;  2Y6L A;  4GWI A;  2YFU A;  4CU8 A;  3C8X A;  3DYM A;  4AAX A;  4BK5 A;  1OT5 A;  3ETP A;  2WAA A;  4QPW A;  1K3I A;  4A3Z A;  2W87 A;  2B9V A;  3WF3 A;  2YFZ A;  4KMQ A;  2Y6K A;  2V5D A;  3MV1 1;  2VMF A;  1UY2 A;  4ZY9 A;  2YB7 A;  2C9K A;  1JU3 A;  3I2J A;  3ACH A;  3CZJ A;  4OYU A;  2DCK A;  2ORZ A;  3VDC A;  5JXI A;  1US2 A;  1GUI A;  4D0Q A;  4DXS A;  2L9L A;  4CUB A;  1F4H A;  2W92 A;  3NNG A;  2DDU A;  5G04 L;  5EJZ B;  1YQ2 A;  3IB3 A;  5C7G A;  1OF3 A;  2WUH A;  2Y6G A;  4QX0 A;  3T08 A;  2QQL A;  3HEI A;  2VZ1 A;  5I0D A;  3JXS A;  2VOT A;  4E8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...