3LEKA

Lectin domain of lectinolysin complexed with lewis b antigen
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
VETENIARGKQASQSSTAYGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the lectin regulatory domain of the cholesterol-dependent cytolysin lectinolysin reveals the basis for its lewis antigen specificity.
pubmed doi rcsb
source organism Streptococcus mitis
molecule tags Blood clotting
molecule keywords Platelet aggregation factor Sm-hPAF
total genus 39
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3lekA00
2V72A 2QBXA 3A7QA 2YB7A 3HEIA 2W3JA 1CZTA 4L0PA 4GZ9A 4CU8A 3C7FA 4XUPA 4OMCA 3K75B 2WO1A 1PMHX 5CZKA 3WF1A 4DUVA 1P8JA 3OEAA 2YG0A 5IYYA 5C70A 3K46A 5IFTA 2VQUA 1W9SA 1JZ6A 3A23A 2VO5A 1JYXA 3CDZB 3NNGA 4E8CA 5F7UA 4MGQA 4QDRA 4QPWA 4CUAA 2QQNA 4XZUG 2QQOA 1MPXA 1W99A 3NRUA 5EJZB 4D8MA 3C8XA 3IB3A 5JXIA 2YFUA 3ACHA 1US3A 2ID4A 2X10A 1UY3A 4RYDA 3C7HA 4JHZA 5LA1A 3IDAA 4A44A 2DDUA 4PT6A 1JZ2A 2LS6A 3WNKA 3EYPA 3FL7A 3AC0A 4ZZ5A 2XQXA 3OGRA 2W9XA 4BDVB 3CIHA 2VOTA 1UMIA 5DN2A 2QQJA 1UYYA 3OGSA 3IIIA 3UNPA 2ZEXA 4DXTA 3D3AA 3WNNA 5DQ0A 1UY2A 4LPLA 2QQIA 1JZ4A 3DYPA 2WABA 2E33A 3MUY1 3ETPA 3DYOA 4QDSA 5G04L 1HN1A 2J1VA 2W1QA 1D7PM 1XC6A 3WNOA 2JDAA 2J1UA 4P02B 4XUTA 1XNTA 4OUEA 3WF2A 4CU6A 5JXHA 3SKJE 1CIYA 4QB2A 1UY4A 2VZQA 1US2A 3BGAA 4CU9A 2EICA 3F2ZA 3MO4A 2VCAA 4A4AA 2WN3A 3C7EA 3LEIA 3WF0A 2C26A 2WYSA 1K45A 2VMCA 3VD4A 1GU3A 3LPGA 4KI5M 2VZPA 4TTGA 4JKMA 3P6BA 1PX3A 2XOMA 4JX0A 5JMOA 1OF4A 1L7RA 4A3ZA 5LCWL 1W9WA 1CZSA 1XNAA 2RVAA 3K4DA 4ARXA 5HPOA 4OZOA 4DUXA 1O59A 2WZ8A 3ABZA 1GNYA 3LEKA 2BZDA 4UAPA 3T0DA 3W5MA 2VCBA 1JHJA 1OT5A 3SEEA 4LKSA 1NAEA 3CZJA 3T0BA 5LA0A 1UXZA 5B4NA 3VD7A 3I97A 3WNLA 2WO2A 3I2KA 2Y6LA 4UI9L 3SEPA 3VD5A 3K77A 2EIBA 1JU4A 2E31A 2WQ8A 4DXRA 3I2GA 4A45A 2Y6KA 5C71A 4QX3A 3OG2A 4W8JA 3PUIA 1JYNA 1I5PA 4LHSA 4QB6A 3OGVA 3GXUA 5G05L 3JXSA 2VR4A 3WEZA 2B4KA 5A1AA 3GDBA 2VQTA 2VZVA 5I0DA 4PQQA 2QQMA 3ECQA 1OH4A 4CU7A 2WAAA 2J1AA 4FI9A 1UWWA 3FHAA 1JI6A 5LA2A 3T2PA 4P00B 4M4PA 4D0QA 4TXWA 1PMJX 3MUZ1 5J1XA 2Y6GA 4P5YA 3K4ZA 1O8SA 2VZ3A 1XPWA 4CUCA 1ULPA 4QAWA 3I2JA 5JUVA 4A41A 1GQPA 1K12A 2HYXA 3CZUA 1UMHA 1UZ0A 2BGPA 1GOFA 2RV9A 2HLEA 3MBWA 4ET7A 4A6OA 2X05A 4E8DA 1BHGA 3I2IA 2CDOA 4QX1A 1T2XA 3THCA 2RJ2A 3HJRA 1YQ2A 2LW8A 4GWIA 1J84A 4DXSA 1EUTA 4KMQA 3T2OA 2WO3A 1JZ8A 1K3IA 3CQOA 2EIDA 3HOBA 3ACIA 5IFPA 2J1RA 3MV01 1UXXX 1W8OA 2V4VA 3GM8A 3UETA 3MV11 2VCCA 2B9VA 4W50A 2OKXA 3E1F1 1NUKA 1J83A 2Y8KA 1JZ3A 1JZ7A 4OMDA 3ACFA 2ZEZA 3T2QA 1O8PA 2VMDA 3DECA 1DLCA 1JU3A 1GMMA 1NX9A 3W5NA 1CX1A 2J1TA 3LEGA 4XUQA 4AAXA 5DMYA 2WUHA 5IJRA 2C9KA 5FUIA 3I3BA 1WKYA 3UESA 3LQCA 2YC4A 4Z2AA 3SKVA 2WDBA 2VZUA 2J1SA 1PX4A 5EIYB 3WNMA 2KD7A 4OYUA 2YFZA 2CDPA 1LNSA 1WCQA 2C4XA 3HPNA 3I2HA 4DEVA 2DCJA 2QQLA 5B4XA 1UX7A 2E26A 3EB7A 4XURA 3WQBA 5C7GA 3T0AA 2L9LA 4MO3M 4UOJA 1JYWA 4KWUA 2W5FA 3NJVA 3U37A 3I3EA 1H6YA 3IAQA 1UYXA 2VZOA 1GUIA 2JD9A 3VD9A 3OEBA 4MADA 4MOAA 3WF3A 1JZ5A 4ZXEA 1SHWB 2X09A 1UYZA 3HNMA 3OB8A 2Z4FA 3VDAA 2W1UA 4JKLA 5JXJA 2DCKA 1R64A 4MGSA 2W92A 3OBAA 2JKXA 1SDDB 5IHRA 4RN5A 4QX2A 2EIEA 4XVHA 2YC2A 3ZM8A 3WF4A 2XHNA 2W95A 4XUNA 5DPNA 1KEXA 3LE0A 1RYYA 4W4ZA 3FHQA 3WNPA 4QDQA 4YPJA 3PUHA 3K4AA 1UY1A 3LPFA 4BK5A 1L7QA 2W1SA 2PQSA 2VJXA 2XONA 4DEQA 5EJ1B 3C7OA 4PF1A 1DYOA 1W8NA 1DP0A 3VDBA 2WZEA 4CVUA 1SG3A 2VZSA 1F4HA 4ZZ8A 2ZEWA 2E32A 2VZRA 2VMEA 2WN2A 3A21A 4BXSV 1JYVA 1TG7A 1KGYA 4ZY9A 3T09A 4ARYA 3I2FA 3HNBM 3T08A 1H6XA 2WAOA 2W1WA 2J7MA 2ZXQA 5HXMA 2VM9A 4QB1A 1W9TA 3WSOA 2J22A 1ULOA 4QX0A 3CKHA 4BJ0A 1OF3A 1W0NA 2VTFA 3I3DA 1K42A 3A22A 4JKKA 2BERA 2BGOA 2Y64A 3THDA 4AG4A 2BBAA 5CYYA 1TVGA 2R7EB 3BN6A 1EUUA 2ORZA 4HG6B 4IUGA 3GGLA 3HNYM 2QQKA 3FN9A 1F4AA 2ZEYA 4DUWA 2VMFA 3CMGA 3NQHA 4BK4A 3IAPA 1UY0A 4CUBA 2VZ1A 4A42A 3ACGA 1IQDC 2VC9A 3HN3A 2J1EA 2W91A 2Y6JA 2W87A 2WBKA 5JR2A 1GOGA 3NJXA 1GOHA 3C7GA 5JXGA 4XUOA 4M4RA 2W47A 2VL4A 2W46A 4P08A 1OD3A 3VDCA 2ORXA 2W94A 2JE8A 2VZTA 4LQRA 1NKGA 3J7HA 2Y6HA 3VD3A 3DYMA 2V5DA 3P1IA 1CZVA 4GWJA
chains in the Genus database with same CATH superfamily
4R9DA 4COWA 2QBXA 3P3NA 2UY8A 1UN1A 1XE0A 1SPPA 3BALA 1O3SA 3HEIA 3ZXAC 1ZBA2 4DZGA 1GWLA 1OA4A 4AEMA 2R072 4L0PA 4XF4A 2Y38A 5C33A 1QJU1 1EAH1 3AMMA 3OD4A 1XYOA 5FZ4A 4CCDA 5BNPB 5GLVA 1IS3A 4GJZA 4DUVA 5CZKA 3ILNA 4RS5B 2CY6A 2YG0A 4KNCA 2A3XA 3KT4A 1XSRA 2Q4SA 4LK7A 4FPKA 4MGYE 5BXXA 2WQZC 3A23A 3B94A 1H8TB 3VBHC 3NNGA 1Y43B 4AZZA 1O4YA 4TLGA 1LGCA 4LR4A 1IHMA 5KHHA 2BUKA 1C5IA 4K21A 1BK0A 4M3CE 5D8AC 4JDNA 3AYCA 4KU8A 4IERA 4WZCA 4I30A 2UWCA 4PLMA 3TAYA 4CPBA 4D8MA 1Y9MA 3VBFB 4CCLA 3HQUA 4GB31 2G4IA 3PMSA 5E16A 1FOD2 3FMGA 1UY3A 2BW8A 2BQPA 1REEA 2FCTA 1V6KA 3C7HA 2HH9A 1HXS2 1QJX1 4LULA 5GALA 3CO2A 1CAUA 1CESA 2A5ZA 4LE4A 5BNPA 1AX1A 4CXWA 4HK9A 2GMEA 2CL2A 1CAWA 3DKQA 5LBEA 3TRSB 4K9SA 1S0DA 4UF0A 1MACA 2ZMKA 4EN6B 2LALA 4PQ9A 1NG0A 2WQ4A 1UMIA 4OULA 5DN2A 2R1DA 3I4IA 1UCXA 1F31A 3PUQA 4F83A 2FCVA 2VG9A 1VP6A 5A1FA 4H55A 1UOGA 1DQ4A 2YGLA 1YQ6A 4RA0A 4XFCA 3VHPA 1RUJ1 1BVVA 2H0BA 1UY2A 1YQCA 2ZOEB 4LPLA 4QQPA 5F8PA 4I0WB 2WABA 4RHV1 2UYAA 4HN0A 1I3HA 5FPBA 4DPNA 1HIXA 4GJYA 4IEZA 1QJX3 5FZ9A 3AFKA 3JQXA 1VALA 4Y4RA 4JGZC 3ES4A 4QD2A 1AYN2 4A3XA 2JKBA 4QDSA 2ZMLA 5ACA1 2JECA 2W1QA 1PO13 3FBYA 3U07A 5F3CA 4FPHA 1AX2A 1G86A 4IEUA 2WT2A 4NWWA 4OHZA 4BQ2A 1HXS3 2E9QA 3NJYA 4N9IA 4IEWA 3DN7A 4Q4W1 2VMIA 4UFLA 1C8M2 1F5JA 1XNTA 4OUEA 1ZBA3 1J1LA 2DVAA 2B42B 3THTA 2VW1A 3AYEA 1GBGA 2HBUA 5ANNA 1BEV2 2CSGA 2WIIB 4P9YA 3TOJA 1G7YA 1UY4A 5FYIA 5CG8A 3RYKA 5I8SA 4N43C 4B4QA 2WRAA 2DYCA 2C9AA 4UXAA 5LASA 4ASMB 4XF3A 1OHFA 4JAAA 2XBO2 3QBQA 1AYM3 4Q0VA 5SV5A 3T3YA 1LTEA 2ZX3A 2OZ6A 1BKZA 3KVAA 3AMNA 1MEC3 1QJU2 2QKDA 2AENA 2VCAA 3MO4A 1H4HA 4N7IA 1W3VA 2HEVF 1W8FA 1X7NA 3S57A 2JDHA 1KJLA 2FMDA 3FZ3A 3OBRA 3W20A 4LBOA 4TLFA 2ZA9A 4B1LA 1GZWB 1A8DA 3O1MA 4KI5M 4LKDA 4M01A 3ZFGC 2VZPA 4XCAA 4QGMA 4LBQA 2DTWA 4E2SA 4TTGA 1YC61 1VRH1 1T6BX 3KV5A 1H4GA 1PX3A 3PTYA 5DAQA 5T54A 3T4HB 5JMOA 2X5IC 5KR7A 4A3ZA 1D4VB 1W9WA 1LENA 4YZ1A 3O5SA 3RNSA 4LHNA 3SXWA 2D6KA 1QWRA 5BV6A 2P5BA 4ASLA 4KH9A 2Q8DA 3VBRB 1U5ZA 1ZZ7A 3K4DA 2A6XA 2C0ZA 5HPOA 1TMF1 4DFSA 4DUXA 1NCQA 3MFCA 3NV1A 3MW2A 5IAVA 2IUWA 4G9SB 1H2LA 4GMP3 4AEDA 4ATFA 1BLZA 1DGRA 1MR5A 5F3IA 1NE6A 3W5MA 2RDRA 5DUWA 1LGNA 2ZGLA 3CZJA 1K5MB 3JB8A 2YBPA 1PHMA 4JDMA 2HWD3 3JZVA 1S0JA 4AF9A 3AKTA 1AYM2 5BYNA 5H9PA 3I54A 2PLV3 1RUH3 1HB4A 3VL9A 2DU0A 4FPOB 3UK9A 3M3EA 1A78A 5LBFA 2QCSB 4KG0A 4META 4E9KA 1AL23 3VD5A 1KFUL 3K77A 4XOGA 2WS93 1RUF1 2V09A 1BYHA 1MQTB 4ZS2A 4AK3A 4A45A 3BYWA 3MW4A 5C71A 5FQ0B 3VZLA 4W8JA 3PUIA 1OOPC 1JUIA 3LDKA 3QACA 3U0ZA 4QB6A 3OF1A 5FMOL 4LXLA 4MUVA 5G05L 1IG3A 4LITA 4C1WA 5FYTA 1OQ1A 5FZ0A 5FBJA 5IW0A 4NIHA 2WZR2 5F5AA 5FXVA 1VRH2 2VZVA 4I0AA 5IVVA 5FY4A 4RFRB 4V2WA 1XU2A 2DBNA 3P5BA 2HWD1 2Z79A 1D4M3 1H2NA 3AP9A 3C3VA 1NY71 4ZXKA 1BEV3 1MZ6A 3AVSA 5JR7B 4FTEA 4NVPA 1XQNA 4BQWA 1OKOA 1V70A 2CNAA 2YU2A 3LDBA 3LB9A 4NJ4A 4AGVA 4LO8A 2RR11 1OPOA 5A3TA 4HETA 1UPIA 4YZ4A 3KZ4C 4M4PA 4YVWC 4D0QA 4XTMA 1H9WA 1Q8PA 1WBFA 5JI7A 4EN7B 5KXEA 1V9U2 3KMHA 1CX4A 3MGUA 2XJRA 3PL0A 4P5YA 5D8AB 3AKPA 4CDUA 2VZ3A 1QEXA 4FFGA 1HLCA 1AX0A 1SCRA 2VBBA 2WWUA 2JIGA 2DBIA 5JIAA 1G9CA 2XWBB 1PIV2 2OVUA 1VBD3 4QAWA 2WR9A 3I2JA 4YLZA 2VGDA 4Y1ZA 1WLDA 2BP6A 5J98B 1XXNA 4UBGA 2F6BA 4C8DA 1QHDA 2ZABA 5JOXA 2IFWA 4FQ4A 4UYBA 1WZXA 2Z42A 4AHXA 2HYXA 1FMD2 1FOD3 5CVRA 3V0AA 1YLLA 1UMHA 4QXHA 4CDXB 3WDTA 5K0UB 2NM1A 3VKLA 3D5OA 4QKDA 3ENRA 4TWTA 4GIQA 1AR83 4X8PA 2VBPA 1YJKA 1BHGA 1PVC2 2QUOA 3MPPG 2CDOA 4QX1A 1PZ8A 1YO8A 3M3IA 4P9IA 1YYNA 4OZXA 4PHZA 3THCA 4B4PA 2RJ2A 4BQYA 3HJRA 3OCPA 4XBLA 3V0AB 5FPUA 4GWIA 4RHV2 4GAZA 1MS4A 2ZKNA 5EYXA 1GQHA 1X9TA 5FP8A 3T2OA 3Q8EA 4XJ9A 1MS8A 3SCGA 5I0RA 2WO3A 1N3OA 4XFBA 3GHMA 5DUVA 4YGCA 3POIA 2WYFA 3ZYRA 5EPAA 1WA4A 1OD5A 3RZKA 1W8OA 2X53S 4CDWA 3N9LA 2OZJA 3VBUB 4BB3A 3VBRC 1E5RA 3ST7A 1SDWA 4IEXA 5JOWA 2TNFA 2Y8KA 4XJZA 1JZ7A 1CQ9A 4LNVA 3QH7A 2OQ7A 1AR61 2ZHLA 5FY8A 3UGFA 3F95A 1WD3A 3ETQA 5LW9A 1NX9A 4IEYA 3W5NA 4NRPA 5L7OC 2IFRA 4QPGC 5LY1A 3AKSA 3LEGA 2JICA 3NWKA 2XJUA 4NHXA 5FYVA 3VL8A 2R6QA 4AAXA 4EWEA 5HCAA 2QTWB 4DY5A 4YNIA 1HRV3 1ENRA 3RJ2X 5LK7B 1V9U1 3NV3A 1SBEA 3H8UA 3HT2A 3UESA 1C1FA 4YZ3A 4MSVA 4K40A 1CAVA 3I3QA 5LA9A 3SKVA 1ZBA1 2PHDA 2Y33A 4JGYC 2D5FA 4AQ2A 4Z2AA 4YM1A 4QX5A 4PIYA 1EPZA 5FXXA 4B4RA 2BFUL 4XEZA 1IS4A 1IQAA 1RC6A 3WNMA 5EIYB 3LIHA 4KG8A 5GJ6A 4OHWA 4YG0A 5J48A 2C4XA 5HI0A 5FPXA 5B4XA 2K9ZA 2BV4A 4QPGA 2XJQA 2E26A 5ABJC 2DVDA 2VW0A 4MG2A 1VBD2 4NRMA 5J96B 3UGHA 3NMBA 1BXHA 4IW3A 5FJHA 4OI0A 4YW7A 1PNFA 1FX5A 2BEOA 4MO3M 3T4VA 4UOJA 1OPMA 3ZSMA 1ZM1A 3BODA 4QHBA 5FZ1A 3U37A 2PXJA 2DVFA 1Z7S1 3G7DA 5FLHA 3B5LB 5FXWA 5FMDA 3WQ7A 3HQXA 1H6YA 1SFNA 4BA6A 1VMFA 1FV2A 1YHFA 2JEMA 3VZKA 2R061 1LULA 1V6NA 1GZ9A 5IVYA 4MADA 1LCLA 1W2NA 4ES9A 1FI2A 3CHXA 2RS31 1V6IA 1H1AA 2DU1A 1GNZA 4HPKA 5K8SA 1RJ8A 3TYJA 1E5IA 2EXJA 5CFCA 2ILMA 1SACA 3WDYA 1VAVA 2JDYA 3AP4A 5FK7A 3HQRA 1MEC2 1QJU3 5A1LA 1LOGA 1MQTA 1NXMA 1U0AA 3UT0A 5L9BA 5AFEA 1UOFA 3VHOA 3WCRA 5LATA 5A32A 4UFHA 1QH7A 3ZN6B 2XVLA 1SQ4A 2JDUA 2XPJA 1RUI2 2KR2A 5IHRA 2YU1A 1NCRB 2PN5A 1ENQA 1RUH2 1W8WA 1W6QB 1QGLA 3SQOA 3R0RA 3POFA 1KS4A 2VU9A 1SLBA 3HMYA 2WFF2 4RQPC 1ZNPA 1AHSA 1FNYA 1W9YA 4XTPA 4CCEA 3ZDSA 4IEVA 1L7QA 1RUNA 2W1SA 2VJXA 5C8CB 2PAMA 1H8TA 3C7OA 5IUQA 4OI2A 5CFDB 4YM2A 3VKMA 1C4RA 3PIGA 3WW3A 5HCBA 1W6MA 2DURA 3M3CA 1DYOA 3UYJA 3ZYBA 3GJBA 1ONAA 1LOFC 2A6YA 4PI0A 2WZEA 3HWJA 3PUSA 5FYHA 4MYEA 1SG3A 5IVEA 3CLPA 4NOTA 1F4HA 2TBVA 3UKNA 4ZZ8A 1SPPB 1HB2A 5KC6A 3ZSKA 3VBFA 2WN2A 1HQLA 4Q4V1 3S7EA 3D0JA 4F7ZA 5AC93 4LBQB 3O0VA 1W6MB 4ZY9A 1GFF2 3T09A 2E53A 3UKTA 4CDUC 2AEYA 4AI8A 1SFYA 4ARYA 4GB33 3T08A 3KV4A 5EYYA 2ZGUA 4BOWA 1ASJ3 1ND2C 1PM7A 2B46X 3FUQA 4JTNA 2E51A 4N53C 2A6WA 2W1WA 2IZWA 1FPN1 4AAPA 2ZZQA 4QM8A 4Q4W2 3EMRA 2VM9A 4QWNA 5LRRA 4QB1A 3RI8A 1ZRDA 4YW3A 5FZDA 4O7XA 5A7WA 2XH6A 3WSOA 4YGDA 1UO9A 3CKHA 1OF3A 2VTFA 4JKKA 3MPBA 2OXBA 2ZACA 2BWCA 3TWIA 3R4SA 1OFNA 5A6XA 1AL21 5ACA2 1KS5A 3WDWA 4JVAA 1KXGA 4XJAA 1QJY2 4AG4A 2BBAA 1EUUA 2ORZA 4IUGA 4LLFA 3FFQA 2WT0A 3CJXA 1N3PA 2PHTA 4Q4V3 1AR82 4EE2A 1DQ5A 2OW4A 1UYPA 2AYHA 4W65A 4DINB 2CAVA 1AR93 1UOBA 1C28A 5D1IA 3VHNA 4FT8A 4LA2A 3ZLIA 2CYFA 3NQHA 5JLVA 4BK4A 2FCUA 4CUBA 1OBNA 4MGZE 4E27A 1LHUA 1IQDC 4LO5B 4YGEA 4ZU5A 3HN3A 4Q0QA 3M70A 1T6GC 1RUC1 1GOGA 4XJ8A 3DKWA 5M0TA 1KJRA 5JAXA 1XNCA 3GBFA 5JXGA 3IIAA 5FZOB 2WJSA 1H0BA 4YWAA 1OOPB 1S1AA 5ANQA 1OXCA 2PAEA 1AYN3 4XDQA 2W46A 3M3OA 4P14A 5F2WA 2W94A 4DMIA 1NE4A 5IATA 5F32A 2D7FA 2G9GA 1RUE1 3U1XA 4XIKA 2BOJA 2WC2A 4QPGB 5HV4A 2P3YA 5DG1A 2VQAA 2FZ2A 3N9OA 4FSJA 4PI2A 4DNYA 4XAEA 5FZ6A 1UKGA 4AFCA 1HRI1 3B02A 5C9AA 1PGW2 3ZDVA 4GULA 1W8ZA 2ZX2A 3A7QA 1LOEA 1SZBA 5FYBA 2DFCA 1NLSA 4FPLA 4XQ4A 1WCSA 1ZZ8A 4ZKTB 1CZTA 3OYWA 5FMCA 5JDBA 4XUPA 4YSFA 4OMCA 4BIOA 2R073 2JXAA 2WO1A 3GZTB 2RM23 1MEC1 1PIV1 1GANA 3EJKA 3OEAA 3WF1A 4LKFA 5C70A 3K46A 3GBWA 5IFTA 5FLIA 3AP6A 4CZSA 1LKNA 1QJEA 2VO5A 3LAGA 4R9AA 1O6UA 3ZXLA 4Q4Y3 4KGQA 3PIJA 1W0OA 4CUAA 4W6WA 3B01A 4XZUG 1GP4A 1UNBA 3I2OA 1WUVA 2RR12 2AUYA 1W99A 2IC1A 4FOVA 4S2FA 1DF0A 1QJY1 3NRUA 1W6OB 5EJZB 2GZWA 3P3PA 5JXIA 5FP4A 2YFUA 4IV1A 4L9BA 4HOOA 4KBZA 1GWKA 3FC0A 4MLOA 2WINB 1US3A 4QM9A 2ID4A 1O7FA 5CEHA 1ZZ6A 1HQWA 1D0HA 2HEYF 4RYDA 1BK1A 3MICA 4JHZA 5LA1A 1QJY3 2Y0OA 5BNPC 2PHUA 3CEWA 4PT6A 1JZ2A 4WM7C 2CWSA 5IVJA 3D82A 4Z1VA 1K5MC 4UW5A 4ZZ5A 2GMMA 3OGRA 5FYZA 1LHWA 5JZGB 2ENRA 4BDVB 3AZWA 4N43B 1ZRRA 2VOTA 4IV1C 3AL6A 4LUMA 5IK8A 5DXDA 1HRV2 3AMHA 1UYYA 1GNHA 4R9BA 2XR4A 3UNPA 4XW3A 4CEWA 4BH9A 4D7YA 5DZEA 3DPRA 2QQIA 1JZ4A 5JWPA 4BMEA 1Z78A 4AQSA 1QMJA 3FX3A 3SNMA 5FWJA 1O91A 1TZOA 4XFGA 3MUY1 5D21A 3ASIA 1RINA 1MZEA 3ETPA 4Q2FA 3DYOA 1CAVB 3LD8A 2GP3A 5CIRA 1MZ5A 5I93A 1GR3A 3LA7A 3WHUA 3MDPA 3TN93 5ERLA 5IK7A 1UZYA 3FBMA 4YW6A 3DGTA 4JRAA 5IWFA 1HV0A 1PGL2 2RJLA 4LK6A 4FPGA 4M0HA 2A3WA 4XFAA 5BNOC 5CKNA 3LZZA 2JDAA 4YVSC 2J1UA 2WNUC 2GH8A 4P02B 4XUTA 2RMU1 5FYUA 3RS6A 3WF2A 1ULEA 2D3SA 4FQZA 4M3CA 3ZFFC 2NYYA 2X5IB 2ADDA 4D7SA 3SKJE 1JW6A 3ZFEA 1NXD1 2N7GA 3D4KA 4CDXA 5BY5A 3HBKA 1XSQA 3ILRA 3BI3A 5C3QA 4NROA 1AR72 1LOCA 3OSDA 3S0MA 1NLQA 1WBLA 4ZS3A 3LCPA 1YJLA 4Q4Y2 4N53B 5A7WB 5L36A 4XZPA 3SC7X 5HBAA 1V0AA 3F2ZA 4Y4YA 3W21A 3BB6A 4IGPA 4A4AA 3RRDA 1DLLA 4HPKB 3FJSA 3FLRA 2C26A 3ZXJA 2W0XA 1K45A 4AFAA 1Y7BA 1O4ZA 2D6PA 3BVCA 3ZMNA 2CWMA 5FY7A 3WY6A 2PHWA 3KF3A 2A71A 3FWEA 1EP0A 4OUSA 5GKAC 2DCZA 2XOMA 1W6PB 1OF4A 1YWKA 2GN3A 5DUUA 3GF6A 3WLUA 3MLLA 5GM0A 5FP9A 4CSWA 2G9FA 1COV2 1X50A 3DXTA 5FR3A 3KT1A 5T55A 4Q4V2 5IK4A 4LKEA 4DY3A 1O59A 1OUXA 4MGIE 2YMZA 3QD6A 1DQ1A 5BUVA 1GNYA 4B3NA 4DOUA 2YY1A 1QDCA 3LEKA 1G6NA 3H8XA 2ZKLA 1RVF2 2VCBA 2CTVA 2G19A 4FFFA 1O3TA 2CGPA 1OT5A 2Q5TA 3ZSJA 1W03A 3T0BA 3CL1A 4MXWA 4BQ3A 4MH0E 2XBO3 5H9QA 1JODA 5IVCA 4FCAA 1RUE2 3BTZA 4L92A 3D8CA 5KHIA 3OY8B 1R091 4UBHA 1ASJ2 5FZMA 3C2UA 1LECA 1W6PA 5L7OB 2Q8OA 1JU4A 2WQ8A 4Y33A 4DXRA 5C8WA 3I2GA 3MZHA 2VAUA 1V6MA 3PDQA 2Y6KA 4ASKA 2ARAA 5HV0A 3OG2A 1JYNA 4ZU7A 2NPIA 1UU5A 4NN0A 1TE1B 3GXUA 5F3GA 4L11A 3BPZA 4MHRA 5DAWA 5ACA3 4Z92B 3AMPA 3WEZA 2YBSA 3ZXKA 4FAGA 3PJQA 1IOAA 4M3CF 1GWMA 3U14A 1QOSA 3N7LA 3NAPC 4TN7A 5KWRA 4PQQA 3RFRA 4X8NA 2JDKA 2QQMA 5CAZA 3ECQA 4AVAA 3J8F1 1AYM1 1OH4A 2I74A 4OI4A 1UZVA 3ZR5A 4CU7A 1AF9A 4AL9A 1AXZA 5JSOA 3N4MA 2Q30A 5J36A 2GU9A 3LSEA 3O7OA 3OBZA 1REFA 3BTXA 1OA2A 4MVTA 4XDPA 5LBBA 4D94A 1MQTC 2PHFA 1AL22 2Y6GA 1VR3A 1CONA 5FZKA 3ZX7A 2GSYA 4NHKA 3URFA 1K5MA 3X29B 1ENSA 1H8TC 4XF9A 2XL7A 5A33A 1XPWA 3S30A 4JTOA 3WINE 1ULPA 4H14A 4E2GA 3POWA 3A0NA 3GZEA 3H7YA 2XB6C 4V1PA 4WM8A 4JDOA 3WP6A 1WCKA 2YPDA 1D2SA 1S2KA 2WZR3 3MYXA 1GQPA 5GLTA 1V6OA 1RUOA 1FNZA 3UJOA 3VKFC 3IMNA 1KFXL 2CV6A 2WT1A 4NR1A 1JOJA 3UGGA 2BGPA 4CDQB 4LMFA 2H6CA 2RV9A 3OPWA 2HLEA 4XC9A 5JIUA 3JU9A 4CEWB 2X05A 1RMU2 2ZTNA 2CGNA 3HT1A 1T2XA 1X8MA 3I49A 2DF7A 1OOPA 1YQ2A 3OUIA 4EN0A 1OQEA 1NCRC 3M8LA 4DXSA 2C24A 5FZ8A 3KS7A 4KMQA 2XLFA 3MEPA 4Q5OA 3DPRC 2GALA 2WNVB 5FMBA 4GMP1 4CE8A 1ZREA 1K3IA 4UW3A 5A80A 1IPSA 3ACIA 1RHI3 2J1RA 5IFPA 1I1EA 4FVVA 3O0XA 1DYPA 4KWJA 2PA7A 2WNUA 1Q8VA 4QPIB 4AVCA 1VBE1 4GWNA 4H7MA 2VCCA 1R1A2 2B9VA 3DUIA 4BQ1A 5J37A 1CAWB 1LEMA 3H3LA 1WD4A 2IXIA 2MEV1 3MIDA 1UZZA 2ZBJA 2K2SA 1GSLA 3AZVA 1ZX5A 5CADA 3HAGA 2WFF3 2ZEZA 3VZNA 4MZUA 4BZ4A 4YZ5A 4ATEA 5FO7B 2VMDA 3DECA 5FYSA 1JU3A 5LK5A 2CU5A 3OYWB 2R16A 3WOGA 1IGOA 1VBC1 1C5HA 4M00A 3K2OA 5FZGA 5BNQA 1XBFA 4XUQA 3BU0A 5D2AA 2R1BA 4BLJA 4E4ZA 1O3QA 4OFGA 4LBQD 2WUHA 3KCCA 4ISRA 1ND3B 3O1VA 1VB4A 4IQPA 1YQ5A 1UF2C 5FPVA 5FUIA 5E6HA 1CD3G 1WKYA 5T5PA 2MPFA 1VBC3 3LQCA 3POEA 2R062 1SLCA 4JGYA 2H0VA 1QNWA 1HJGA 1RL3A 2XUEA 4G4FA 2YUEA 2ZCWA 1VAKA 1RUG1 2R043 4Y26A 2WDBA 2VUAA 2VVDA 1Q8QA 2DVGA 4IGOA 3VBUA 5A3UA 1BEV1 2J1SA 4CP9A 3IPVB 1PO21 2KD7A 4BXFA 4XFFA 4OYUA 2YFZA 3BOPA 2CDPA 4Q27A 3VZOA 1LNSA 1WCQA 3HPNA 3VZJA 3I2HA 2QQLA 3IM0A 1UX7A 2XMLA 4YZ2A 4YM0A 4YGBA 3EB7A 1C8M1 4PBPA 2X29A 3M2MA 3O14A 3U75A 3WQBA 3R6SA 4AHWA 3BIWE 5F5CA 2E6VA 3ZO0B 1Q56A 4N43A 4BQ4A 2HWE2 1VPHA 2W5FA 2UWBA 1XU1A 4E4SA 1OLME 3I3EA 5C9AC 2B9UA 1COV3 3EXUA 3S5AA 4NIAA 1UAIA 2FHRA 4I01A 4EQVA 1AXKA 3ZSLA 3JD72 1ZA4A 4HN1A 4YVSA 4A7YA 5IVFA 5JPNB 2XVKA 2TEPA 5FP3A 2LM3A 3GZAA 1OKQA 4QX8A 4SLIA 3AVRA 4Y22B 5GLZA 3BPSA 4QQOA 5L73A 5C8CC 3HVDA 2FDKA 4UFIA 3HNMA 4YW2A 1SCSA 1XE7A 2PHLA 2QFEA 5F9TA 3FE5A 2P3KA 5FP7A 4H7LA 4IV3A 2DCKA 4K6BA 5C3PA 5APAA 4Z2WA 1TQ5A 1XYNA 1AR62 1VBB1 2ZAHA 2MHFA 4XABA 4B29A 3MI8A 5A3PA 3OBAA 2QQWA 4YFWA 1VE0A 3B93A 2EIEA 1A8MA 2EXIA 2P6CA 1NLRA 3SISA 2JE7A 4HKLA 5BNOB 2BVVA 1CVNA 3WF4A 2YXSA 3RDIA 2O1QA 2W95A 2WNUB 3AJYA 5H9SA 1D2QA 1OLQA 3LE0A 5A7SA 4OI1A 4W4ZA 1WWYA 3MFAA 4P9XA 1KRIA 4LOSA 3DL3A 3PUHA 3Q8CA 2OYZA 4AE2A 4BK5A 3PU8A 1G9AA 3ZXFA 1E5HA 5T5JA 1DIWA 4R4ZA 5L19A 5FPZA 2RM21 4S2HA 3VBFC 2FZ1A 3O1PA 3DXUA 1PGL1 4PF1A 4QHZA 1W8NA 2D6OX 5GZEA 2A75A 3CJIA 3VDBA 3PJYA 3DF0A 3WDUA 4R9CA 2VXJA 2YGMA 3MIFA 4G3YC 2VZSA 3SH5A 1EPWA 1ZBE3 5LY2A 2D6NA 2VMEA 3A21A 5CU1A 3OPTA 2Q8EA 2SLIA 1KGYA 1W2OA 3J7NA 2V5YA 3N9NA 1W39A 2RE9A 4XF1A 4LO7A 4C0BA 1RXFA 3WVJA 4NIDA 3I2FA 3HNBM 3WX5A 1KITA 1LHVA 1X36A 1RMU1 4P9GA 4YVWB 4A6SA 1VAMA 3N7KA 1BCXA 1UPSA 3B9IA 3CF6E 3E6DA 1VBA2 4WM7B 1Z0HA 5CNAA 1F15A 3RMYA 3WUDA 1HXS1 1LRHA 1W9TA 2J22A 4AOCA 2WFPA 1W0NA 1R1ZA 1ULFA 3I3DA 5CBLA 3A22A 2BERA 3LOIA 3ZKUA 1ENXA 1NCRA 3RWNA 3THDA 4KQ7A 4GH4C 5CYYA 2R7EB 4AI2A 1QQP2 2ET1A 3ZYHA 4AVTA 3Q9OA 1O4TA 1FYUA 1TME1 2QQKA 2WNOA 4IV3B 5KHJA 4Y20A 4DUWA 2UY9A 3H0OA 4Y1VA 3AMQA 4CDXC 3CMGA 5FFOC 3IBMA 5CISA 3KHCA 1H2MA 3N7JA 1WW7A 1DU3D 1RMU3 2JDZA 5JMCA 3FFZA 1OFSA 2A6ZA 2VC9A 3POYA 2J1EA 2W87A 1GZWA 5AVPA 5FRAA 5C6CA 1RUD2 5DZFA 1TNRA 4XHBA 1XNKA 4RD7A 4RS5C 3VUOA 3NJXA 3VBHB 4ZU4A 4Z07A 2Z2SB 2W47A 3RI9A 1CJPA 1VBA3 1GYKA 1LOAA 3KWVA 1HJFA 4P08A 4IXLA 2B45X 5LBCA 3VBSB 5ABJA 4C91A 5KXCA 2VZTA 1NKGA 3J7HA 1NZCA 3CJIB 3KLSA 5CG9A 1HW5A 4CCNA 1UQXA 1KD7A 5DAPA 3CBNA 4QXCA 4YRDA 2QNKA 3TEYA 4GWJA 2G1MA 3ELNA 2V72A 1Y9QA 1RUJ2 1TNFA 4NPRA 3FLPA 4UFKA 5FY0A 1QY4A 2YB7A 3MLJA 2QZ2A 1UU4A 2W3JA 2ARXA 2RS53 2YYOA 4NHYA 5AC91 3JBG2 4CU8A 3H1YA 3THPA 2FDFA 2FDJA 4J1XA 4LBJA 3K75B 2OIIA 1PMHX 3JUUA 3NNLA 1P8JA 1SBDA 2NQYA 5IYYA 3VKOA 1QXJA 1W9SA 2QQUA 2D5HA 2VQUA 3MF6A 4Q29A 4Y5SA 2RM22 5EV7A 2W2IA 1JZ6A 3GNEA 4CTEA 2RS51 4Y1XA 2IXKA 1W2AX 2HWC2 4DO0A 1XNDA 5FZAA 3ACLA 3Q8FA 1A3KA 2FDHA 4QPWA 5FOBB 1JXNA 1ALYA 2QQNA 2VXRA 4XHXA 1EV13 2ZX0A 2C1FA 1MPXA 3NW4A 4CUGA 1FOD1 1Q8OA 3NKTA 3MIGA 1DZRA 2A70A 1HV1A 3VN4A 1F35A 3ACHA 3KCXA 3AL5A 1M06G 4XJWA 3NV2A 4RR3B 1AR81 4YVSB 5I8YA 5K4LA 4Q8LA 2D6MA 3GZUC 4Q8KA 5CA6A 1ULDA 1AUYA 3UV9A 5LEKA 1ZZCA 1Q8SA 3N9QA 5C5UA 3PVBB 3PUAA 3R05A 3TNPB 2MEV3 4Y20B 1PNGA 1XYPA 4QPYA 4BIFA 1H1MA 5DDJ1 3T1LA 3FL7A 1HKDA 1WA6X 2VE1A 3J4UH 2XQXA 3JD73 4AGRA 5A3MA 4UW4A 2GNMA 2VQ0A 4RGGA 4BYYA 2BDRA 2YBKA 3CIHA 4JQRA 2YZ4A 1DQ6A 4KWKA 3O1UA 2VMHA 4XPVA 1EAH2 4INDA 5T3NA 5IT6A 2QQJA 2HWF3 3H3ZA 1U5YA 1K5JA 2WA4A 3OGSA 5E8AA 4PDWA 3ITQA 3WD5A 4HFSA 5J7MA 2XJVA 4QT6A 4DXTA 3J8F2 4GH4A 2VVEA 3WP3A 2D98A 2HWC3 4WVMB 5BPXA 1S0IA 4DXZA 4FAHA 1PK6B 4H3WA 5T5LA 2Z5WA 3DYPA 2HWE1 1KDKA 2QQVA 3KF5A 4NUBA 5F5QA 3H42B 2XG3A 1VIWB 2XKOA 1MS1A 4YFZA 1HN1A 3VV1A 3M1HA 1D7PM 3KM5A 1XC6A 3WNOA 1URXA 3O1SA 2XLAA 4K20A 4FOWA 4JC1A 1UD1A 3N7MA 5FOJB 3LOBA 3PHMA 3B00A 5EQUA 1GICA 2ZGTA 3ZFFA 4AXOA 2Z69A 2O14A 3AJZA 1OLRA 4I0BA 1PVC3 5K0UA 1VMHA 2IXJA 4QB2A 3QH6A 2GC0A 2EXKA 1W3XA 2JG9B 1DGWA 4XQWA 4OVEA 3ATGA 2GNBA 1RUI1 3N3HA 1OC1A 2V4AA 2EXHA 3QLQA 1EY2A 5JSRA 2A6VA 2E7QA 3AZZA 1I6XA 1V00A 3D0SA 4GXLA 4LJHA 3VBSC 5FIXA 3GYDA 4BHPA 1A34A 3ILFA 2AZ5A 3RZLA 3IN9A 1UW8A 1W6NB 3N35A 1RXGA 4I02A 3V0BA 2WWJA 3C7EA 3I8TA 4AYUA 1Z7S3 3LEIA 4TZDA 3TN92 3K51A 4NWVA 4GB32 4BWOA 1DG6A 4CYDA 1GU3A 3LPGA 1UKRA 4NRQA 1J3PA 4HMZA 2RS13 3KSCA 3I3MA 1MS9A 3N9MA 1N1SA 1WCDJ 2JG8C 3KB5A 3MIEA 1JHNA 4LIUA 1S4CA 3B3QE 3P6BA 2NZ9A 4JX0A 2WZPP 5FY1A 4PIXA 1GZTA 4XETA 5FY9A 3H1WA 1ODMA 3RG0A 2RVAA 3U4XA 4I3GA 4URAA 4MXWB 5I0SA 3GALA 3RZHA 1C57A 4Q1RA 3U78A 2PQQA 2OX0A 2WZ8A 3BIEA 2OT7A 3ABZA 1E57A 4IEOA 2EVXA 3OY8A 1RUD1 3JQWA 1JN2P 1X9PA 2BZDA 2MNGA 4TSVA 3T0DA 4F8AA 3GCWA 4RGKA 1BMV2 1JHJA 2XXZA 3RWKX 4LKSA 4FP3A 1OUSA 2AEZA 4D3WA 3NKGA 5IVBA 1UXZA 3ZSEA 3O1OA 1KQRA 5FYCA 3APBA 3NL1A 4Q4X3 1W6QA 3I97A 3SHRA 3VD7A 1G9BA 1J3QA 3WNLA 1R083 4NO4A 5FAXA 2Y6LA 3SCHA 1CJDA 2E31A 3RSJA 1MZFA 1SLIA 5FZCA 1NCQC 2XKPA 4IE5A 3O1RA 4XBNA 1DYKA 3LDRA 3B9CA 5A7OA 3EBRA 4N8MA 4LHSA 1QU0A 5FUPA 1VBE3 2NP0A 4XJUA 3JXSA 5LB6A 1DGLA 2XVGA 4CCCA 1VBA1 1QJZA 1N1VA 2VR4A 3OPZA 1W28A 1F8VA 2VNOA 2B4KA 2OA2A 2VQTA 2P6HA 1WCUA 2R041 2XWJB 2JX9A 3OTFA 5FZIA 1RUH1 1FT9A 3OJBA 3ZR6A 2WAAA 4XE9A 2J1AA 4AHYA 1UMZA 1UWWA 4FI9A 3FHAA 1JI6A 2GC3A 3AB0A 4P00B 4AW7A 4TXWA 3MUZ1 5L9VA 5J1XA 5KHKA 4O61A 4C90A 2W68A 1O8SA 5F6KA 5LRSA 4LHLA 2E7AA 1RUE3 2RR13 4QXKA 1LR5A 2ZGSA 3PVNA 5FY5A 5FZ3A 4NPLA 3ZPYA 4CXXA 1B35B 4LBLA 1BBT2 3V56A 4GH4B 1XE8A 1DQ0A 2WLQA 1W90A 3MHZA 4AVBA 2LUWA 1FAYA 2D97A 2ZHMA 2Q8CA 1C1LA 4NMIA 5FYMA 2PHRA 2FDIA 1PO12 1EV11 4A41A 5GZGA 4AQTA 4CCJA 4YYOA 1JMUB 2DUPA 4D69A 1OQDA 4XF0A 1UZ0A 4Q0PA 5A3NA 1IZ3A 2OS2A 1FMD1 2I2SA 4P9JA 3SMHA 4XYXA 1GOFA 3VLBB 5DAVA 1S0FA 3H9AA 2F17A 5FREA 1POQA 2G9ZA 4QKFA 2DUOA 4B1MA 5I8TA 3HBZA 2ES3A 2VCMA 3JCIA 4X6RB 4FTSA 5C3RA 1APNA 4AFBA 1CN1A 4E4DX 2ZPXA 3VDDC 1XJAA 2W08A 2XHKA 2YV8A 4AVSA 1J84A 1X33A 1XRUA 2ZZJA 5CFDC 1LU2A 4LBKA 4IV1B 5L7OA 1EAH3 4NAMA 3UJQA 4EV0A 2HWF2 3MF9A 3H1MA 2NMOA 1JZ8A 3CQOA 5CB7A 4OQ8A 3HOBA 1NT0A 2A73B 1W2UA 2JB4A 2P3JA 1UXXX 3AKRA 3WP4A 4COUA 2V4VA 1LB2A 3GM8A 1FXZA 3WT3A 5I91A 3AZXA 4CDQC 4WVMA 5KBFA 1H2KA 1OH3A 4HONA 1FMD3 3E1F1 2SBAA 2ZGPA 5D8AA 2OKXA 4CDUB 4KL1A 1JZ3A 4OMDA 1PMIA 1W6OA 3ACFA 4Y3OA 1NZIA 1WMFA 1QNYA 4AEDB 2GC1A 3PURA 4WVVA 5AVAA 3T2QA 1O8PA 1U12A 1DLCA 2CGOA 1GLHA 3KGLA 1CX1A 3E5XA 3W58A 1GP6A 1OURA 1X8EA 5DMYA 3AK0A 2XJTA 4ES8A 4FTBA 4ZPIA 2TUNA 1F9KA 4QU1A 2E63A 5IJRA 5C3OA 2BBVA 4HKOA 4CP1A 2C9KA 4CDQA 4IEPA 3IWZA 2WSVA 2FMYA 4PCRA 4CEWC 3TBDA 3O1TA 2BOIA 3ZFFB 4LEJA 2RJKA 5FTTC 5BNNA 4OUMA 2AC1A 1PZ9A 1RHI2 2BRTA 2R063 3LSDA 4U2AA 4YG3A 2VZUA 2VMGA 3PU3A 3RPQA 3ZFGA 4IE4A 1ACCA 5FQ0A 1IPKA 2D6LX 2ZHKA 4CDWB 2R042 3VBUC 1AR73 3VBOB 1B35A 2BWAA 3PMEA 4OLLA 3POJA 5TSWA 3ZXGA 2R32A 4XURA 4BCUA 1UX6A 3IMMA 3JBG1 5A32B 1ST8A 4JRLA 1XB9A 3T0AA 2JD4A 4CEYC 5C7GA 1LHOA 1HRI3 3AXEA 4HSJA 1IG0A 1JS9A 3OGGA 3NJVA 3NV4A 3U4SA 3WDVA 5CFCC 2XDVA 1S0CA 4AQ6A 1FV3A 3ZXDA 3A4UA 1R1A1 2VOXA 2VZOA 4L2NA 5FMOS 1ZRCA 1IS6A 1GUIA 2CHHA 1QIQA 3RMXA 3INAA 5JOYA 3VD9A 3J7MA 5IK5A 2WNEA 4A2UA 2A7AA 1HB1A 4XMAA 4HANA 2EAAA 2OPWA 1O5LA 3ZVXA 2QZ3A 2VBDA 5T50A 4MOAA 2GC2A 3WF3A 1NQDA 4FOQA 3N9PA 5JZGC 1SHWB 2DV9A 1TME2 1UYZA 3I7DA 3POGA 3AX4A 4IE6A 3VDAA 4JKLA 1AVBA 2RS32 2GH2A 4P9LA 2ADEA 4CCOA 1R64A 4JGZA 2ERFA 4RGAA 3FHIB 4MGSA 4LLOA 2W92A 4JZRA 4HSLA 1I5ZA 3G6JB 1SDDB 2JG9A 2KA3A 2PMWB 4I09A 4BLIA 2Y0IA 4QX2A 3E6CC 2FD8A 3D6EA 3UL2A 4BE3A 4XVHA 2YC2A 4FBFA 3ZM8A 3S6PA 5ISLA 1ZA7A 3BTYA 1QH6A 1LODA 1MS5A 5DPNA 2ARBA 1JYIA 3FHQA 3V64A 1QQP1 4YPJA 4Z8BA 1VBD1 3K4AA 4JCKA 2WSUA 3ZFEB 1CR7A 2PQSA 1JYCA 1X82A 1JH5A 1HN0A 1W8TA 4BU2A 1I9RA 2EALA 5E1RA 3WQ1A 2HJIA 2EA7A 1YUDA 4QMAA 3GCXA 1H9PA 2ETEA 4CRQA 4O9EA 4LBNA 3ZFEC 1ZZBA 4EYUA 3USUB 3WZ1A 4N7UA 5KHGA 4K1YA 4K7JA 3FUOA 3BOWA 1PGW1 2E32A 2GAUA 2VZRA 3WW2A 3ZN4A 4DS0A 1ZBE2 3VBOA 1AR91 3WV6A 1OLMA 1GQGA 1G9FA 2C6SA 1LU1A 3NO8A 1H6XA 1H30A 3ZFGB 4L97A 3USUA 4IDZA 1AZDA 1YFUA 2WAOA 4HVOA 4AI9A 1BJQA 4XXAA 2J7MA 3NSTA 1SLLA 2ZXQA 4SBVA 2JDPA 2A3YA 2F4LA 1WLCA 5HXMA 3AZYA 5HCFA 4I2OA 4ISQA 3RJRA 4QX0A 1LOFA 2AR6A 3LF7A 4BJ0A 2B39A 4CCMA 4LORA 5DDJ3 1K42A 1GV9A 5K7PA 1A6CA 5FZ7A 2BGOA 2VD7A 1HX6A 4QGNA 2VOWA 1W04A 3ON7A 4ITCA 2WS91 1RUF3 1SBFA 3BN6A 2R30A 4A7ZA 5E88A 5FZBA 3GGLA 4HK8A 1STMA 3ME2A 1ZYBA 4N9HA 2VNGA 1ND2A 3ZIWA 5HCHA 4CP2A 2ZEYA 1PK6C 1O3RA 1KDMA 2DWRA 1UU6A 1PO23 1AR92 5EWSA 3ZYJB 1ULCA 1UY0A 4K8RB 2VZ1A 1GKBA 3E6BA 3JD71 2GDFA 3ACGA 4JGZB 3GBGA 3S7IA 4QHOA 2C5DA 5F3EA 2IXCA 5J3UA 2W91A 3KD4A 2WBKA 1CWPA 1D4M1 1PVC1 4RQPB 3IDCB 5FZLA 4WM8B 5GZFA 5BNOA 5JI9A 2RG4A 2HWF1 2VNVA 4XBQA 3WG1A 2HBTA 1N1TA 3H8RA 3VGIA 1BBT3 3WCSA 1YFYA 1DBNA 3MLKA 5F5IA 2Q1FA 3KHBA 2JE9A 2Q0AA 4I3PA 1FATA 4M4RA 5T5OA 2VL4A 3PVOA 2WNVC 2HWB3 1COV1 4IGQA 3LFIA 1DGRN 3CU7A 4QKNA 1FPN2 1OD3A 2ZGQA 4EZHA 4OHYA 2O0OA 4GQ7A 4S2DA 4UWDA 4FXKB 5DAXA 4LQRA 5E89A 4YVWA 3T2TA 2QE3A 4C0HA 1OVSA 1Y3TA 1YCIA 3ZKYA 4GKYA 3DYMA 4EJRA 2WLPA 1J3RA 3DV8A 4QQ2A 5C4WB 2VY0A 2ATFA 3SITA 1U5XA 2VNRA 2BNOA 4NAOA 2XGXA 2B7YA 1DZQA 1RUF2 3HIFA 4GALA 5FYYA 5FO9B 3VKNA 1UIJA 2D3RA 4MGKE 4IESA 4FPJA 2VULA 4GZ9A 3C7FA 1DQ2A 1D4M2 4D6QA 1W8UA 3OGJA 2RS52 3L2HA 5EP9A 3RYPA 2RHPA 3NNJA 5EHDA 1BBT1 1L3JA 3VBHA 3WDXA 3KV6A 1ND3C 3WHTA 4Y5Z0 1Q5OA 3USSA 1JYXA 2D93A 3CDZB 5I0TA 4E8CA 3OOXA 4WM7A 1NY72 1VBC2 4XDOA 4Y5TA 3K48A 5F7UA 5GZCA 1V9U3 2I07B 1RUD3 4MGQA 4QDRA 4E2QA 3VBSA 5ABJB 1PIV3 2QQOA 2WZR1 3ROUA 1POV1 1RB8G 3TEWA 2WS92 2XQRA 1WMXA 2BGCA 5F1RA 3C8XA 2DFBA 3IB3A 4YW5A 1WW6A 4W6YA 5K0UC 3TB0A 1SLAA 1DFQA 4BMBA 2X10A 4QPIA 3ZN6A 2AREA 2GN7A 4FPCA 2D44A 1DCSA 4RS5A 4WBBA 3U10A 2EAKA 3IDAA 3SCFA 2BU9A 2DVBA 4A44A 4Q26A 2DDUA 1DHKB 1S0GA 2LS6A 4R52A 3WNKA 3JBG3 3EYPA 1UZWA 2D3PA 1YEWA 1SMVA 3T30A 1NA1A 1VRH3 4U36A 3GHNA 3WW4A 4AHZA 4CP0A 3AC0A 3IDEA 4QX7A 2D43A 2MEV2 2W9XA 1WLTA 4WVZA 2YROA 1REDA 2QVSB 1OA3A 3ORJA 3ZPOA 3GJAA 3WG4A 2EF6A 4HVQA 2RDNA 1XOYA 2YDEA 1CPMA 2Y34A 3RYRA 5KXBA 1TMF3 2X5IA 2VPVA 4L99A 1NOVA 1WW5A 4XXPA 3PVEA 1YFXA 3IIIA 1SEFA 2HKXA 2LRPA 2ZEXA 4QU2A 1HRV1 3D3AA 4ONUA 3WNNA 5DQ0A 1S2EA 5FKCA 3WW1A 5JCTA 2JG9C 4XMIA 1VLNA 4KWLA 4COZA 2KM2A 2E33A 1NA1C 2GNTA 1BMV1 4EROA 2QQPA 1RGSA 2V73A 3LGRA 1LHNA 1VRBA 1CAXB 2B5HA 2UYBA 4XQDA 5G04L 3AFGA 2J1VA 3H3UA 4KBBA 4B8EA 4RL7A 3R4DB 2PAKA 5A3WA 5FXZA 1LEDA 4QPIC 3RZJA 5JSPA 3WP5A 5F6LB 3AKQA 5DABA 2E7TA 1D0GA 1UIKA 2K0GA 3WQ0A 1MS0A 5A7QA 4LA3A 5FPLA 1IKPA 2VECA 5B2GB 4QGLA 4JGYB 3TEZA 3BKZA 3K3NA 4CU6A 5JXHA 4YARA 1G8WA 4C1XA 2ARCA 1CIYA 4IE7A 4MGTA 2WA3A 4TYSA 4EN8B 1C3HA 4RSUA 2J42A 2VZQA 4N90A 3TNQA 3ZYGA 4CDWC 3I59B 1RHI1 1US2A 2JDNA 4NIIA 4X6QB 5C5TA 1DGWX 5FBZA 2IXHA 3S5QA 1JOBA 3NNFA 4H2AA 2WKKA 2XJSA 3BGAA 4XAAA 3ZYIB 1CIWA 1Y4WA 4S2GA 4UT5A 4YW1A 5GZDA 4CU9A 2RS33 4NIGA 2EICA 3BU7A 3RZGA 4AFMA 5A6QA 1VMJA 2WN3A 3OUJA 3ZYPA 4COVA 4AEJA 4RR3A 2NLRA 3WF0A 1QOTA 3SLIA 3KCYA 4LUKA 2WYSA 3E5UA 4DQAA 2VMCA 3PLQA 3VD4A 4XILA 4RQPA 4FO9A 4Y1YA 1DDLA 1PK6A 4DIQA 3SH4A 1LGBA 2D40A 4PDWC 4K8FA 4KGGA 1B09A 1ASJ1 4JKMA 5FCCA 1R092 1VJ2A 3TEXA 2FQPA 4WVWA 1QJFA 1L7RA 2VUDA 4OHXA 1W2TA 1N3QA 3RGBA 5LCWL 1AYN1 2FDGA 1CZSA 3RZZA 2DUQA 3HD8B 3E97A 4E4HA 2Y26A 1WGPA 5A7NA 1XNAA 1ZBE1 4ARXA 4OZOA 1LESA 4R8HA 1NYWA 1QQP3 5C4WA 3WXPA 4K3UA 1ZVFA 2XBO1 1YI9A 1RUC2 2Y6FA 2BVBA 1N47A 1VBB3 2QDNA 1WLWA 2ZGKA 2GP5A 3M3QA 3MIHA 2R0HA 2HYKA 3ES1A 4UAPA 4BISA 3B7MA 5FZHA 1CPNA 4FPEA 3SEEA 1NAEA 2LROA 1YI7A 5A33B 3ZMOA 1PVXA 3KV9A 3NVCA 5LA0A 5B4NA 2ZMNA 1L7LA 4QQLA 1WMDA 1O5UA 4AEKA 2ZGNA 2VVFA 5BNNB 1G9DA 4UFJA 1J58A 3OD0A 2WL1A 5EXOA 2WO2A 3I2KA 4FFIA 1CAXA 2P1BA 2XJPA 3LA2A 1MVEA 4UI9L 3RQ0A 3WNXA 3SEPA 5A7PA 1W8HA 2EIBA 5H9RA 4IETA 1GP5A 5F2SA 2ZS6B 3SH3A 5JPMB 3AP5A 5C4WC 2CAUA 3BUCA 3L2YA 2HWE3 4Q0SA 2JB8A 4QX3A 1R093 1RJ7A 1POV3 1I5PA 3VDDA 1FPN3 5DDJ2 3ALQA 3LKJA 3OGVA 4YG6A 1S2BA 5KC5A 4CPBD 4LHKA 4R4XA 2P17A 4PLNA 4LO4B 5A1AA 1IKQA 5SV8A 3GDBA 5I0DA 1POV0 1V6LA 3IKWA 4Z82A 5LWBA 3J7LA 2GNDA 2VUJA 3L9JT 1RVF3 4A7KA 1PO22 1RUJ3 4WV8A 3I59A 4BM8A 5C9AB 3PTRB 2EIGA 1LOBA 1W6NA 1NA1B 1WW4A 3NNMA 4RHV3 5FZFA 1JYTA 3T2PA 5LA2A 1W06A 5FPAA 3EHKA 2RMU2 3HR9A 4CEYB 4QKBA 1PMJX 4JHTA 3J8F3 4ZONA 2PHXA 1NQJA 3AM2A 3K4ZA 4Q4X2 3W59A 1JTZX 5T52A 3W9AA 1RUI3 4D6SA 1R082 3DPRB 4HL0A 2ZGMA 4CUCA 2JJ6A 4Q4W3 3IDBB 1YXWA 4AEDC 1EV12 4B7KA 4B7EA 5LZ6A 1JBCA 4EWDA 1GZCA 4V2VA 2H6BA 4BPZA 3H7JA 4XCBA 1E5SA 4FP2A 5JUVA 1YRZA 4NE9A 1K12A 1YFWA 2BNMA 1XNBA 1VBE2 3CZUA 3VHRA 2A1XA 2RS11 3AYDA 4JV4A 3ZXEA 2ZJCA 4O9GA 4RR3C 2BPA2 3MBWA 4ET7A 4A6OA 1QF3A 2JWPA 2VH9A 5EFUA 4E8DA 3I2IA 4IL7A 1YQ8A 4IV3C 3VB9A 3QOPA 1TMF2 2PLV1 2B8MA 2LW8A 4Y24A 2UWAA 4P9WA 2RDSA 3K3OA 1R081 2O8OA 4UF0B 5JZGA 3RZMA 1B35C 1EUTA 2ET7A 3B69A 2KXLA 3H50A 1LAJA 4MHUA 2DCTA 4CA9A 2RDQA 2R071 3CNAA 1ZRFA 2EIDA 4OQ9A 4N53A 4Q0UA 1BZWA 4RFT0 5A70A 3OUHA 3MV01 5JOZA 1QKQA 2WWSA 3DEMA 4CP9B 3UETA 3MV11 2DTYA 2W39A 4W50A 4DB5A 1NUKA 2ZGOA 1J83A 3AYAA 4AWDA 3V0BB 1Q3EA 1UL9A 2UU8A 2XLGA 2PELA 3LFMA 2DCYA 1GMMA 4NHMA 3CJIC 4YM3A 4FOYA 4URTA 3VDDB 2J1TA 2ZX1A 3WUCA 3H8OA 1EYBA 4GA9A 4XFHA 2OUJA 3MIBA 1OI6A 3JB4C 4MV2A 1J1TA 5CFCB 1HDKA 5EZWA 3I3BA 2GMPA 3KGZA 4W6XA 5A3OA 3NAPA 2O8QA 5GLUA 4MXVA 4K1ZA 2YC4A 4HKWA 4MX3A 1U5IA 1BVP1 1S55A 4EWAA 4AGGA 5L9RA 4HXCA 1PX4A 4HZFA 2JENA 3J9SA 5C3SA 1QXPA 1ZRIA 1PO11 2VOVA 4DEVA 1VB2A 2DCJA 3UKVA 2ZHNA 3LIGA 1QXRA 3IZOA 2WNVA 2BJSA 2AH2A 2I45A 2L9LA 4PIZA 1JYWA 4KWUA 1OMIA 3RVHA 3N36A 4LTAA 4ORFA 1SFPA 2W52A 4YW4A 3ZOIA 1HRI2 4GD4A 4AFDA 2RS12 1F5FA 1JUHA 1C8M3 1AL0G 4DRVA 1J59A 4PBOA 3IAQA 3I2DA 1UYXA 4M3CB 2JG8B 1LJ7A 5HXVA 3TN91 2JD9A 1W0PA 4O65A 3WG3A 3M7AA 4AVVA 1AJKA 1YIPA 3KVBA 4PF5A 4WM8C 4EZ4A 3OEBA 4BQXA 1RUC3 3POBA 4HBNA 3VBRA 3WR0A 1OSGA 3ZN5A 4ZHNA 3VBOC 1M4WA 2ZAAA 1N1YA 5CFDA 1JZ5A 1F2NA 4ZXEA 5LEJA 3ZIXA 2X09A 4LE3A 1RVF1 1W05A 2Z4FA 3BCWA 3OB8A 2W1UA 5FWEA 3EQEA 5FO8B 5JXJA 1ND2B 4BQ5A 1HB3A 1VBB2 3KT7A 3J26N 2LTNA 1RIRA 1QJX2 4AI0A 1S0EA 1HQNA 5AC92 4NHLA 2BTVC 2P3IA 2JKXA 4OCTA 1UOJA 5CKQA 2BNNA 1AR63 3MW3A 5F39A 4NPMA 4RN5A 3LEMA 4F3JA 1QDOA 2PFWA 4IE0A 5A6ZA 4AI3A 2Q1ZB 1ULGA 2HWB2 3OBTA 4P5HA 3IPVA 2NMNA 2XHNA 5A6YA 1WMEA 4XUNA 5K9YA 1KEXA 2YPJA 2ZX4A 1RYYA 4QQHA 2QJVA 2VW2A 3WNPA 4HLTA 4CCKA 4QDQA 3BTAA 2HWB1 2Y60A 3NJZA 1UY1A 3LPFA 4PJYA 3NAPB 4L8QA 4AR2A 5J09A 2XONA 4DEQA 2VUCA 3POSA 5EJ1B 2AACA 1C8NA 5GLWA 4Y22A 5FKBA 4DRRA 2F4PA 5F37A 1PGSA 4JQTA 5C8CA 1DP0A 2IWGB 3EO6A 2X8KA 4Q4Y1 2WO7A 2NN8A 4CVUA 2P4EA 2UURA 2HWC1 1AR71 1ZZ9A 2BYVE 2K46A 2OQ6A 4EN9B 3QCWA 2ZEWA 4LO6B 1TME3 4BXSV 4GWMA 4OHVA 5FZOA 1TG7A 3O0WA 1JYVA 4WZFA 1Y9GA 3VZMA 1RTVA 2JIJA 5A3LA 4PLOA 1QOOA 5AFBA 4LT5A 4PDWB 3KQ4B 5IAXA 2PYTA 2HWD2 3Q8AA 4AI1A 3PNAA 5DZGA 1RUG2 2XL9A 3LWCA 4J1WA 2BFUS 2AGSA 1JOPA 2XUMA 3IT8A 2YC0A 4CEYA 3WG2A 4QXBA 2YHJA 1CGPA 4J6GA 1IS5A 3M4FA 1R1A3 1ULOA 1YNAA 4Q1PA 1ND3A 4COYA 3AP7A 1SLTA 4XIOA 2IVJA 3R4UA 2Y64A 1ODNA 1PM4A 5FV3A 1BQPA 1TVGA 2IVIB 4HG6B 1RITA 2Q1MA 4UW6A 2IXLA 5KXDA 4Y1UA 3HNYM 5DG2A 2WFF1 4HVRA 4LBMA 1AJOA 3FN9A 1S0BA 2JG8A 1F4AA 3HN1A 2OPKA 2VMFA 4Q4X1 3FLTA 3KQRA 4GKXA 5DUXA 5FLJA 4XACA 5JVVA 2P34A 1MVQA 3IAPA 1CAUB 1H8VA 2RMU3 4UFMA 4A42A 5BNNC 2VTXJ 2PLV2 4FXGB 4FPFA 3ZYFA 5FUNA 2ZGRA 1W9FA 2Y6JA 1YIFA 4CXYA 1Q43A 2FBEA 5FK8A 1AXYA 3AXDA 1MS3A 5JR2A 2P37A 1V6JA 1GOHA 3C7GA 4KU7A 3E5QA 2QDRA 1OVPA 1Z7S2 4IEQA 3O12A 1RUG3 4XFIA 4XUOA 4D6RA 2VOKA 4LOTA 4GMP0 3A0KA 3DCQA 5FDBA 2OUHA 1H1IA 1DZTA 2R0FA 5FZEA 2ORXA 4FFHA 4FPYA 5I0UA 3LA3A 2JE8A 2P2KA 3VDCA 4M0NA 2VTXA 2JDMA 2PTMA 4J25A 4D7TA 2Y6HA 5FJKA 3T1MA 3V65A 4LIVA 3Q8BA 1IPJA 1PZ7A 3VD3A 1NCQB 2HEWF 2V5DA 5CKMA 1TEIA 3P1IA 1CZVA 4HT1T 2R49A 5EJ3A 3U11A
chains in the Genus database with same CATH topology
2V72A 2QBXA 3A7QA 2YB7A 3HEIA 2W3JA 1CZTA 4L0PA 4GZ9A 4CU8A 3C7FA 4XUPA 4OMCA 3K75B 2WO1A 1PMHX 5CZKA 3WF1A 4DUVA 1P8JA 3OEAA 2YG0A 5IYYA 5C70A 3K46A 5IFTA 2VQUA 1W9SA 1JZ6A 3A23A 2VO5A 1JYXA 3CDZB 3NNGA 4E8CA 5F7UA 4MGQA 4QDRA 4QPWA 4CUAA 2QQNA 4XZUG 2QQOA 1MPXA 1W99A 3NRUA 5EJZB 4D8MA 3C8XA 3IB3A 5JXIA 2YFUA 3ACHA 1US3A 2ID4A 2X10A 1UY3A 4RYDA 3C7HA 4JHZA 5LA1A 3IDAA 4A44A 2DDUA 4PT6A 1JZ2A 2LS6A 3WNKA 3EYPA 3FL7A 3AC0A 4ZZ5A 2XQXA 3OGRA 2W9XA 4BDVB 3CIHA 2VOTA 1UMIA 5DN2A 2QQJA 1UYYA 3OGSA 3IIIA 3UNPA 2ZEXA 4DXTA 3D3AA 3WNNA 5DQ0A 1UY2A 4LPLA 2QQIA 1JZ4A 3DYPA 2WABA 2E33A 3MUY1 3ETPA 3DYOA 4QDSA 5G04L 1HN1A 2J1VA 2W1QA 1D7PM 1XC6A 3WNOA 2JDAA 2J1UA 4P02B 4XUTA 1XNTA 4OUEA 3WF2A 4CU6A 5JXHA 3SKJE 1CIYA 4QB2A 1UY4A 2VZQA 1US2A 3BGAA 4CU9A 2EICA 3F2ZA 3MO4A 2VCAA 4A4AA 2WN3A 3C7EA 3LEIA 3WF0A 2C26A 2WYSA 1K45A 2VMCA 3VD4A 1GU3A 3LPGA 4KI5M 2VZPA 4TTGA 4JKMA 3P6BA 1PX3A 2XOMA 4JX0A 5JMOA 1OF4A 1L7RA 4A3ZA 5LCWL 1W9WA 1CZSA 1XNAA 2RVAA 3K4DA 4ARXA 5HPOA 4OZOA 4DUXA 1O59A 2WZ8A 3ABZA 1GNYA 3LEKA 2BZDA 4UAPA 3T0DA 3W5MA 2VCBA 1JHJA 1OT5A 3SEEA 4LKSA 1NAEA 3CZJA 3T0BA 5LA0A 1UXZA 5B4NA 3VD7A 3I97A 3WNLA 2WO2A 3I2KA 2Y6LA 4UI9L 3SEPA 3VD5A 3K77A 2EIBA 1JU4A 2E31A 2WQ8A 4DXRA 3I2GA 4A45A 2Y6KA 5C71A 4QX3A 3OG2A 4W8JA 3PUIA 1JYNA 1I5PA 4LHSA 4QB6A 3OGVA 3GXUA 5G05L 3JXSA 2VR4A 3WEZA 2B4KA 5A1AA 3GDBA 2VQTA 2VZVA 5I0DA 4PQQA 2QQMA 3ECQA 1OH4A 4CU7A 2WAAA 2J1AA 4FI9A 1UWWA 3FHAA 1JI6A 5LA2A 3T2PA 4P00B 4M4PA 4D0QA 4TXWA 1PMJX 3MUZ1 5J1XA 2Y6GA 4P5YA 3K4ZA 1O8SA 2VZ3A 1XPWA 4CUCA 1ULPA 4QAWA 3I2JA 5JUVA 4A41A 1GQPA 1K12A 2HYXA 3CZUA 1UMHA 1UZ0A 2BGPA 1GOFA 2RV9A 2HLEA 3MBWA 4ET7A 4A6OA 2X05A 4E8DA 1BHGA 3I2IA 2CDOA 4QX1A 1T2XA 3THCA 2RJ2A 3HJRA 1YQ2A 2LW8A 4GWIA 1J84A 4DXSA 1EUTA 4KMQA 3T2OA 2WO3A 1JZ8A 1K3IA 3CQOA 2EIDA 3HOBA 3ACIA 5IFPA 2J1RA 3MV01 1UXXX 1W8OA 2V4VA 3GM8A 3UETA 3MV11 2VCCA 2B9VA 4W50A 2OKXA 3E1F1 1NUKA 1J83A 2Y8KA 1JZ3A 1JZ7A 4OMDA 3ACFA 2ZEZA 3T2QA 1O8PA 2VMDA 3DECA 1DLCA 1JU3A 1GMMA 1NX9A 3W5NA 1CX1A 2J1TA 3LEGA 4XUQA 4AAXA 5DMYA 2WUHA 5IJRA 2C9KA 5FUIA 3I3BA 1WKYA 3UESA 3LQCA 2YC4A 4Z2AA 3SKVA 2WDBA 2VZUA 2J1SA 1PX4A 5EIYB 3WNMA 2KD7A 4OYUA 2YFZA 2CDPA 1LNSA 1WCQA 2C4XA 3HPNA 3I2HA 4DEVA 2DCJA 2QQLA 5B4XA 1UX7A 2E26A 3EB7A 4XURA 3WQBA 5C7GA 3T0AA 2L9LA 4MO3M 4UOJA 1JYWA 4KWUA 2W5FA 3NJVA 3U37A 3I3EA 1H6YA 3IAQA 1UYXA 2VZOA 1GUIA 2JD9A 3VD9A 3OEBA 4MADA 4MOAA 3WF3A 1JZ5A 4ZXEA 1SHWB 2X09A 1UYZA 3HNMA 3OB8A 2Z4FA 3VDAA 2W1UA 4JKLA 5JXJA 2DCKA 1R64A 4MGSA 2W92A 3OBAA 2JKXA 1SDDB 5IHRA 4RN5A 4QX2A 2EIEA 4XVHA 2YC2A 3ZM8A 3WF4A 2XHNA 2W95A 4XUNA 5DPNA 1KEXA 3LE0A 1RYYA 4W4ZA 3FHQA 3WNPA 4QDQA 4YPJA 3PUHA 3K4AA 1UY1A 3LPFA 4BK5A 1L7QA 2W1SA 2PQSA 2VJXA 2XONA 4DEQA 5EJ1B 3C7OA 4PF1A 1DYOA 1W8NA 1DP0A 3VDBA 2WZEA 4CVUA 1SG3A 2VZSA 1F4HA 4ZZ8A 2ZEWA 2E32A 2VZRA 2VMEA 2WN2A 3A21A 4BXSV 1JYVA 1TG7A 1KGYA 4ZY9A 3T09A 4ARYA 3I2FA 3HNBM 3T08A 1H6XA 2WAOA 2W1WA 2J7MA 2ZXQA 5HXMA 2VM9A 4QB1A 1W9TA 3WSOA 2J22A 1ULOA 4QX0A 3CKHA 4BJ0A 1OF3A 1W0NA 2VTFA 3I3DA 1K42A 3A22A 4JKKA 2BERA 2BGOA 2Y64A 3THDA 4AG4A 2BBAA 5CYYA 1TVGA 2R7EB 3BN6A 1EUUA 2ORZA 4HG6B 4IUGA 3GGLA 3HNYM 2QQKA 3FN9A 1F4AA 2ZEYA 4DUWA 2VMFA 3CMGA 3NQHA 4BK4A 3IAPA 1UY0A 4CUBA 2VZ1A 4A42A 3ACGA 1IQDC 2VC9A 3HN3A 2J1EA 2W91A 2Y6JA 2W87A 2WBKA 5JR2A 1GOGA 3NJXA 1GOHA 3C7GA 5JXGA 4XUOA 4M4RA 2W47A 2VL4A 2W46A 4P08A 1OD3A 3VDCA 2ORXA 2W94A 2JE8A 2VZTA 4LQRA 1NKGA 3J7HA 2Y6HA 3VD3A 3DYMA 2V5DA 3P1IA 1CZVA 4GWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V72 A;  2QBX A;  3A7Q A;  2YB7 A;  3HEI A;  2W3J A;  1CZT A;  4L0P A;  4GZ9 A;  4CU8 A;  3C7F A;  4XUP A;  4OMC A;  3K75 B;  2WO1 A;  1PMH X;  5CZK A;  3WF1 A;  4DUV A;  1P8J A;  3OEA A;  2YG0 A;  5IYY A;  5C70 A;  3K46 A;  5IFT A;  2VQU A;  1W9S A;  1JZ6 A;  3A23 A;  2VO5 A;  1JYX A;  3CDZ B;  3NNG A;  4E8C A;  5F7U A;  4MGQ A;  4QDR A;  4QPW A;  4CUA A;  2QQN A;  4XZU G;  2QQO A;  1MPX A;  1W99 A;  3NRU A;  5EJZ B;  4D8M A;  3C8X A;  3IB3 A;  5JXI A;  2YFU A;  3ACH A;  1US3 A;  2ID4 A;  2X10 A;  1UY3 A;  4RYD A;  3C7H A;  4JHZ A;  5LA1 A;  3IDA A;  4A44 A;  2DDU A;  4PT6 A;  1JZ2 A;  2LS6 A;  3WNK A;  3EYP A;  3FL7 A;  3AC0 A;  4ZZ5 A;  2XQX A;  3OGR A;  2W9X A;  4BDV B;  3CIH A;  2VOT A;  1UMI A;  5DN2 A;  2QQJ A;  1UYY A;  3OGS A;  3III A;  3UNP A;  2ZEX A;  4DXT A;  3D3A A;  3WNN A;  5DQ0 A;  1UY2 A;  4LPL A;  2QQI A;  1JZ4 A;  3DYP A;  2WAB A;  2E33 A;  3MUY 1;  3ETP A;  3DYO A;  4QDS A;  5G04 L;  1HN1 A;  2J1V A;  2W1Q A;  1D7P M;  1XC6 A;  3WNO A;  2JDA A;  2J1U A;  4P02 B;  4XUT A;  1XNT A;  4OUE A;  3WF2 A;  4CU6 A;  5JXH A;  3SKJ E;  1CIY A;  4QB2 A;  1UY4 A;  2VZQ A;  1US2 A;  3BGA A;  4CU9 A;  2EIC A;  3F2Z A;  3MO4 A;  2VCA A;  4A4A A;  2WN3 A;  3C7E A;  3LEI A;  3WF0 A;  2C26 A;  2WYS A;  1K45 A;  2VMC A;  3VD4 A;  1GU3 A;  3LPG A;  4KI5 M;  2VZP A;  4TTG A;  4JKM A;  3P6B A;  1PX3 A;  2XOM A;  4JX0 A;  5JMO A;  1OF4 A;  1L7R A;  4A3Z A;  5LCW L;  1W9W A;  1CZS A;  1XNA A;  2RVA A;  3K4D A;  4ARX A;  5HPO A;  4OZO A;  4DUX A;  1O59 A;  2WZ8 A;  3ABZ A;  1GNY A;  3LEK A;  2BZD A;  4UAP A;  3T0D A;  3W5M A;  2VCB A;  1JHJ A;  1OT5 A;  3SEE A;  4LKS A;  1NAE A;  3CZJ A;  3T0B A;  5LA0 A;  1UXZ A;  5B4N A;  3VD7 A;  3I97 A;  3WNL A;  2WO2 A;  3I2K A;  2Y6L A;  4UI9 L;  3SEP A;  3VD5 A;  3K77 A;  2EIB A;  1JU4 A;  2E31 A;  2WQ8 A;  4DXR A;  3I2G A;  4A45 A;  2Y6K A;  5C71 A;  4QX3 A;  3OG2 A;  4W8J A;  3PUI A;  1JYN A;  1I5P A;  4LHS A;  4QB6 A;  3OGV A;  3GXU A;  5G05 L;  3JXS A;  2VR4 A;  3WEZ A;  2B4K A;  5A1A A;  3GDB A;  2VQT A;  2VZV A;  5I0D A;  4PQQ A;  2QQM A;  3ECQ A;  1OH4 A;  4CU7 A;  2WAA A;  2J1A A;  4FI9 A;  1UWW A;  3FHA A;  1JI6 A;  5LA2 A;  3T2P A;  4P00 B;  4M4P A;  4D0Q A;  4TXW A;  1PMJ X;  3MUZ 1;  5J1X A;  2Y6G A;  4P5Y A;  3K4Z A;  1O8S A;  2VZ3 A;  1XPW A;  4CUC A;  1ULP A;  4QAW A;  3I2J A;  5JUV A;  4A41 A;  1GQP A;  1K12 A;  2HYX A;  3CZU A;  1UMH A;  1UZ0 A;  2BGP A;  1GOF A;  2RV9 A;  2HLE A;  3MBW A;  4ET7 A;  4A6O A;  2X05 A;  4E8D A;  1BHG A;  3I2I A;  2CDO A;  4QX1 A;  1T2X A;  3THC A;  2RJ2 A;  3HJR A;  1YQ2 A;  2LW8 A;  4GWI A;  1J84 A;  4DXS A;  1EUT A;  4KMQ A;  3T2O A;  2WO3 A;  1JZ8 A;  1K3I A;  3CQO A;  2EID A;  3HOB A;  3ACI A;  5IFP A;  2J1R A;  3MV0 1;  1UXX X;  1W8O A;  2V4V A;  3GM8 A;  3UET A;  3MV1 1;  2VCC A;  2B9V A;  4W50 A;  2OKX A;  3E1F 1;  1NUK A;  1J83 A;  2Y8K A;  1JZ3 A;  1JZ7 A;  4OMD A;  3ACF A;  2ZEZ A;  3T2Q A;  1O8P A;  2VMD A;  3DEC A;  1DLC A;  1JU3 A;  1GMM A;  1NX9 A;  3W5N A;  1CX1 A;  2J1T A;  3LEG A;  4XUQ A;  4AAX A;  5DMY A;  2WUH A;  5IJR A;  2C9K A;  5FUI A;  3I3B A;  1WKY A;  3UES A;  3LQC A;  2YC4 A;  4Z2A A;  3SKV A;  2WDB A;  2VZU A;  2J1S A;  1PX4 A;  5EIY B;  3WNM A;  2KD7 A;  4OYU A;  2YFZ A;  2CDP A;  1LNS A;  1WCQ A;  2C4X A;  3HPN A;  3I2H A;  4DEV A;  2DCJ A;  2QQL A;  5B4X A;  1UX7 A;  2E26 A;  3EB7 A;  4XUR A;  3WQB A;  5C7G A;  3T0A A;  2L9L A;  4MO3 M;  4UOJ A;  1JYW A;  4KWU A;  2W5F A;  3NJV A;  3U37 A;  3I3E A;  1H6Y A;  3IAQ A;  1UYX A;  2VZO A;  1GUI A;  2JD9 A;  3VD9 A;  3OEB A;  4MAD A;  4MOA A;  3WF3 A;  1JZ5 A;  4ZXE A;  1SHW B;  2X09 A;  1UYZ A;  3HNM A;  3OB8 A;  2Z4F A;  3VDA A;  2W1U A;  4JKL A;  5JXJ A;  2DCK A;  1R64 A;  4MGS A;  2W92 A;  3OBA A;  2JKX A;  1SDD B;  5IHR A;  4RN5 A;  4QX2 A;  2EIE A;  4XVH A;  2YC2 A;  3ZM8 A;  3WF4 A;  2XHN A;  2W95 A;  4XUN A;  5DPN A;  1KEX A;  3LE0 A;  1RYY A;  4W4Z A;  3FHQ A;  3WNP A;  4QDQ A;  4YPJ A;  3PUH A;  3K4A A;  1UY1 A;  3LPF A;  4BK5 A;  1L7Q A;  2W1S A;  2PQS A;  2VJX A;  2XON A;  4DEQ A;  5EJ1 B;  3C7O A;  4PF1 A;  1DYO A;  1W8N A;  1DP0 A;  3VDB A;  2WZE A;  4CVU A;  1SG3 A;  2VZS A;  1F4H A;  4ZZ8 A;  2ZEW A;  2E32 A;  2VZR A;  2VME A;  2WN2 A;  3A21 A;  4BXS V;  1JYV A;  1TG7 A;  1KGY A;  4ZY9 A;  3T09 A;  4ARY A;  3I2F A;  3HNB M;  3T08 A;  1H6X A;  2WAO A;  2W1W A;  2J7M A;  2ZXQ A;  5HXM A;  2VM9 A;  4QB1 A;  1W9T A;  3WSO A;  2J22 A;  1ULO A;  4QX0 A;  3CKH A;  4BJ0 A;  1OF3 A;  1W0N A;  2VTF A;  3I3D A;  1K42 A;  3A22 A;  4JKK A;  2BER A;  2BGO A;  2Y64 A;  3THD A;  4AG4 A;  2BBA A;  5CYY A;  1TVG A;  2R7E B;  3BN6 A;  1EUU A;  2ORZ A;  4HG6 B;  4IUG A;  3GGL A;  3HNY M;  2QQK A;  3FN9 A;  1F4A A;  2ZEY A;  4DUW A;  2VMF A;  3CMG A;  3NQH A;  4BK4 A;  3IAP A;  1UY0 A;  4CUB A;  2VZ1 A;  4A42 A;  3ACG A;  1IQD C;  2VC9 A;  3HN3 A;  2J1E A;  2W91 A;  2Y6J A;  2W87 A;  2WBK A;  5JR2 A;  1GOG A;  3NJX A;  1GOH A;  3C7G A;  5JXG A;  4XUO A;  4M4R A;  2W47 A;  2VL4 A;  2W46 A;  4P08 A;  1OD3 A;  3VDC A;  2ORX A;  2W94 A;  2JE8 A;  2VZT A;  4LQR A;  1NKG A;  3J7H A;  2Y6H A;  3VD3 A;  3DYM A;  2V5D A;  3P1I A;  1CZV A;  4GWJ A; 
#chains in the Genus database with same CATH topology
 4R9D A;  4COW A;  2QBX A;  3P3N A;  2UY8 A;  1UN1 A;  1XE0 A;  1SPP A;  3BAL A;  1O3S A;  3HEI A;  3ZXA C;  1ZBA 2;  4DZG A;  1GWL A;  1OA4 A;  4AEM A;  2R07 2;  4L0P A;  4XF4 A;  2Y38 A;  5C33 A;  1QJU 1;  1EAH 1;  3AMM A;  3OD4 A;  1XYO A;  5FZ4 A;  4CCD A;  5BNP B;  5GLV A;  1IS3 A;  4GJZ A;  4DUV A;  5CZK A;  3ILN A;  4RS5 B;  2CY6 A;  2YG0 A;  4KNC A;  2A3X A;  3KT4 A;  1XSR A;  2Q4S A;  4LK7 A;  4FPK A;  4MGY E;  5BXX A;  2WQZ C;  3A23 A;  3B94 A;  1H8T B;  3VBH C;  3NNG A;  1Y43 B;  4AZZ A;  1O4Y A;  4TLG A;  1LGC A;  4LR4 A;  1IHM A;  5KHH A;  2BUK A;  1C5I A;  4K21 A;  1BK0 A;  4M3C E;  5D8A C;  4JDN A;  3AYC A;  4KU8 A;  4IER A;  4WZC A;  4I30 A;  2UWC A;  4PLM A;  3TAY A;  4CPB A;  4D8M A;  1Y9M A;  3VBF B;  4CCL A;  3HQU A;  4GB3 1;  2G4I A;  3PMS A;  5E16 A;  1FOD 2;  3FMG A;  1UY3 A;  2BW8 A;  2BQP A;  1REE A;  2FCT A;  1V6K A;  3C7H A;  2HH9 A;  1HXS 2;  1QJX 1;  4LUL A;  5GAL A;  3CO2 A;  1CAU A;  1CES A;  2A5Z A;  4LE4 A;  5BNP A;  1AX1 A;  4CXW A;  4HK9 A;  2GME A;  2CL2 A;  1CAW A;  3DKQ A;  5LBE A;  3TRS B;  4K9S A;  1S0D A;  4UF0 A;  1MAC A;  2ZMK A;  4EN6 B;  2LAL A;  4PQ9 A;  1NG0 A;  2WQ4 A;  1UMI A;  4OUL A;  5DN2 A;  2R1D A;  3I4I A;  1UCX A;  1F31 A;  3PUQ A;  4F83 A;  2FCV A;  2VG9 A;  1VP6 A;  5A1F A;  4H55 A;  1UOG A;  1DQ4 A;  2YGL A;  1YQ6 A;  4RA0 A;  4XFC A;  3VHP A;  1RUJ 1;  1BVV A;  2H0B A;  1UY2 A;  1YQC A;  2ZOE B;  4LPL A;  4QQP A;  5F8P A;  4I0W B;  2WAB A;  4RHV 1;  2UYA A;  4HN0 A;  1I3H A;  5FPB A;  4DPN A;  1HIX A;  4GJY A;  4IEZ A;  1QJX 3;  5FZ9 A;  3AFK A;  3JQX A;  1VAL A;  4Y4R A;  4JGZ C;  3ES4 A;  4QD2 A;  1AYN 2;  4A3X A;  2JKB A;  4QDS A;  2ZML A;  5ACA 1;  2JEC A;  2W1Q A;  1PO1 3;  3FBY A;  3U07 A;  5F3C A;  4FPH A;  1AX2 A;  1G86 A;  4IEU A;  2WT2 A;  4NWW A;  4OHZ A;  4BQ2 A;  1HXS 3;  2E9Q A;  3NJY A;  4N9I A;  4IEW A;  3DN7 A;  4Q4W 1;  2VMI A;  4UFL A;  1C8M 2;  1F5J A;  1XNT A;  4OUE A;  1ZBA 3;  1J1L A;  2DVA A;  2B42 B;  3THT A;  2VW1 A;  3AYE A;  1GBG A;  2HBU A;  5ANN A;  1BEV 2;  2CSG A;  2WII B;  4P9Y A;  3TOJ A;  1G7Y A;  1UY4 A;  5FYI A;  5CG8 A;  3RYK A;  5I8S A;  4N43 C;  4B4Q A;  2WRA A;  2DYC A;  2C9A A;  4UXA A;  5LAS A;  4ASM B;  4XF3 A;  1OHF A;  4JAA A;  2XBO 2;  3QBQ A;  1AYM 3;  4Q0V A;  5SV5 A;  3T3Y A;  1LTE A;  2ZX3 A;  2OZ6 A;  1BKZ A;  3KVA A;  3AMN A;  1MEC 3;  1QJU 2;  2QKD A;  2AEN A;  2VCA A;  3MO4 A;  1H4H A;  4N7I A;  1W3V A;  2HEV F;  1W8F A;  1X7N A;  3S57 A;  2JDH A;  1KJL A;  2FMD A;  3FZ3 A;  3OBR A;  3W20 A;  4LBO A;  4TLF A;  2ZA9 A;  4B1L A;  1GZW B;  1A8D A;  3O1M A;  4KI5 M;  4LKD A;  4M01 A;  3ZFG C;  2VZP A;  4XCA A;  4QGM A;  4LBQ A;  2DTW A;  4E2S A;  4TTG A;  1YC6 1;  1VRH 1;  1T6B X;  3KV5 A;  1H4G A;  1PX3 A;  3PTY A;  5DAQ A;  5T54 A;  3T4H B;  5JMO A;  2X5I C;  5KR7 A;  4A3Z A;  1D4V B;  1W9W A;  1LEN A;  4YZ1 A;  3O5S A;  3RNS A;  4LHN A;  3SXW A;  2D6K A;  1QWR A;  5BV6 A;  2P5B A;  4ASL A;  4KH9 A;  2Q8D A;  3VBR B;  1U5Z A;  1ZZ7 A;  3K4D A;  2A6X A;  2C0Z A;  5HPO A;  1TMF 1;  4DFS A;  4DUX A;  1NCQ A;  3MFC A;  3NV1 A;  3MW2 A;  5IAV A;  2IUW A;  4G9S B;  1H2L A;  4GMP 3;  4AED A;  4ATF A;  1BLZ A;  1DGR A;  1MR5 A;  5F3I A;  1NE6 A;  3W5M A;  2RDR A;  5DUW A;  1LGN A;  2ZGL A;  3CZJ A;  1K5M B;  3JB8 A;  2YBP A;  1PHM A;  4JDM A;  2HWD 3;  3JZV A;  1S0J A;  4AF9 A;  3AKT A;  1AYM 2;  5BYN A;  5H9P A;  3I54 A;  2PLV 3;  1RUH 3;  1HB4 A;  3VL9 A;  2DU0 A;  4FPO B;  3UK9 A;  3M3E A;  1A78 A;  5LBF A;  2QCS B;  4KG0 A;  4MET A;  4E9K A;  1AL2 3;  3VD5 A;  1KFU L;  3K77 A;  4XOG A;  2WS9 3;  1RUF 1;  2V09 A;  1BYH A;  1MQT B;  4ZS2 A;  4AK3 A;  4A45 A;  3BYW A;  3MW4 A;  5C71 A;  5FQ0 B;  3VZL A;  4W8J A;  3PUI A;  1OOP C;  1JUI A;  3LDK A;  3QAC A;  3U0Z A;  4QB6 A;  3OF1 A;  5FMO L;  4LXL A;  4MUV A;  5G05 L;  1IG3 A;  4LIT A;  4C1W A;  5FYT A;  1OQ1 A;  5FZ0 A;  5FBJ A;  5IW0 A;  4NIH A;  2WZR 2;  5F5A A;  5FXV A;  1VRH 2;  2VZV A;  4I0A A;  5IVV A;  5FY4 A;  4RFR B;  4V2W A;  1XU2 A;  2DBN A;  3P5B A;  2HWD 1;  2Z79 A;  1D4M 3;  1H2N A;  3AP9 A;  3C3V A;  1NY7 1;  4ZXK A;  1BEV 3;  1MZ6 A;  3AVS A;  5JR7 B;  4FTE A;  4NVP A;  1XQN A;  4BQW A;  1OKO A;  1V70 A;  2CNA A;  2YU2 A;  3LDB A;  3LB9 A;  4NJ4 A;  4AGV A;  4LO8 A;  2RR1 1;  1OPO A;  5A3T A;  4HET A;  1UPI A;  4YZ4 A;  3KZ4 C;  4M4P A;  4YVW C;  4D0Q A;  4XTM A;  1H9W A;  1Q8P A;  1WBF A;  5JI7 A;  4EN7 B;  5KXE A;  1V9U 2;  3KMH A;  1CX4 A;  3MGU A;  2XJR A;  3PL0 A;  4P5Y A;  5D8A B;  3AKP A;  4CDU A;  2VZ3 A;  1QEX A;  4FFG A;  1HLC A;  1AX0 A;  1SCR A;  2VBB A;  2WWU A;  2JIG A;  2DBI A;  5JIA A;  1G9C A;  2XWB B;  1PIV 2;  2OVU A;  1VBD 3;  4QAW A;  2WR9 A;  3I2J A;  4YLZ A;  2VGD A;  4Y1Z A;  1WLD A;  2BP6 A;  5J98 B;  1XXN A;  4UBG A;  2F6B A;  4C8D A;  1QHD A;  2ZAB A;  5JOX A;  2IFW A;  4FQ4 A;  4UYB A;  1WZX A;  2Z42 A;  4AHX A;  2HYX A;  1FMD 2;  1FOD 3;  5CVR A;  3V0A A;  1YLL A;  1UMH A;  4QXH A;  4CDX B;  3WDT A;  5K0U B;  2NM1 A;  3VKL A;  3D5O A;  4QKD A;  3ENR A;  4TWT A;  4GIQ A;  1AR8 3;  4X8P A;  2VBP A;  1YJK A;  1BHG A;  1PVC 2;  2QUO A;  3MPP G;  2CDO A;  4QX1 A;  1PZ8 A;  1YO8 A;  3M3I A;  4P9I A;  1YYN A;  4OZX A;  4PHZ A;  3THC A;  4B4P A;  2RJ2 A;  4BQY A;  3HJR A;  3OCP A;  4XBL A;  3V0A B;  5FPU A;  4GWI A;  4RHV 2;  4GAZ A;  1MS4 A;  2ZKN A;  5EYX A;  1GQH A;  1X9T A;  5FP8 A;  3T2O A;  3Q8E A;  4XJ9 A;  1MS8 A;  3SCG A;  5I0R A;  2WO3 A;  1N3O A;  4XFB A;  3GHM A;  5DUV A;  4YGC A;  3POI A;  2WYF A;  3ZYR A;  5EPA A;  1WA4 A;  1OD5 A;  3RZK A;  1W8O A;  2X53 S;  4CDW A;  3N9L A;  2OZJ A;  3VBU B;  4BB3 A;  3VBR C;  1E5R A;  3ST7 A;  1SDW A;  4IEX A;  5JOW A;  2TNF A;  2Y8K A;  4XJZ A;  1JZ7 A;  1CQ9 A;  4LNV A;  3QH7 A;  2OQ7 A;  1AR6 1;  2ZHL A;  5FY8 A;  3UGF A;  3F95 A;  1WD3 A;  3ETQ A;  5LW9 A;  1NX9 A;  4IEY A;  3W5N A;  4NRP A;  5L7O C;  2IFR A;  4QPG C;  5LY1 A;  3AKS A;  3LEG A;  2JIC A;  3NWK A;  2XJU A;  4NHX A;  5FYV A;  3VL8 A;  2R6Q A;  4AAX A;  4EWE A;  5HCA A;  2QTW B;  4DY5 A;  4YNI A;  1HRV 3;  1ENR A;  3RJ2 X;  5LK7 B;  1V9U 1;  3NV3 A;  1SBE A;  3H8U A;  3HT2 A;  3UES A;  1C1F A;  4YZ3 A;  4MSV A;  4K40 A;  1CAV A;  3I3Q A;  5LA9 A;  3SKV A;  1ZBA 1;  2PHD A;  2Y33 A;  4JGY C;  2D5F A;  4AQ2 A;  4Z2A A;  4YM1 A;  4QX5 A;  4PIY A;  1EPZ A;  5FXX A;  4B4R A;  2BFU L;  4XEZ A;  1IS4 A;  1IQA A;  1RC6 A;  3WNM A;  5EIY B;  3LIH A;  4KG8 A;  5GJ6 A;  4OHW A;  4YG0 A;  5J48 A;  2C4X A;  5HI0 A;  5FPX A;  5B4X A;  2K9Z A;  2BV4 A;  4QPG A;  2XJQ A;  2E26 A;  5ABJ C;  2DVD A;  2VW0 A;  4MG2 A;  1VBD 2;  4NRM A;  5J96 B;  3UGH A;  3NMB A;  1BXH A;  4IW3 A;  5FJH A;  4OI0 A;  4YW7 A;  1PNF A;  1FX5 A;  2BEO A;  4MO3 M;  3T4V A;  4UOJ A;  1OPM A;  3ZSM A;  1ZM1 A;  3BOD A;  4QHB A;  5FZ1 A;  3U37 A;  2PXJ A;  2DVF A;  1Z7S 1;  3G7D A;  5FLH A;  3B5L B;  5FXW A;  5FMD A;  3WQ7 A;  3HQX A;  1H6Y A;  1SFN A;  4BA6 A;  1VMF A;  1FV2 A;  1YHF A;  2JEM A;  3VZK A;  2R06 1;  1LUL A;  1V6N A;  1GZ9 A;  5IVY A;  4MAD A;  1LCL A;  1W2N A;  4ES9 A;  1FI2 A;  3CHX A;  2RS3 1;  1V6I A;  1H1A A;  2DU1 A;  1GNZ A;  4HPK A;  5K8S A;  1RJ8 A;  3TYJ A;  1E5I A;  2EXJ A;  5CFC A;  2ILM A;  1SAC A;  3WDY A;  1VAV A;  2JDY A;  3AP4 A;  5FK7 A;  3HQR A;  1MEC 2;  1QJU 3;  5A1L A;  1LOG A;  1MQT A;  1NXM A;  1U0A A;  3UT0 A;  5L9B A;  5AFE A;  1UOF A;  3VHO A;  3WCR A;  5LAT A;  5A32 A;  4UFH A;  1QH7 A;  3ZN6 B;  2XVL A;  1SQ4 A;  2JDU A;  2XPJ A;  1RUI 2;  2KR2 A;  5IHR A;  2YU1 A;  1NCR B;  2PN5 A;  1ENQ A;  1RUH 2;  1W8W A;  1W6Q B;  1QGL A;  3SQO A;  3R0R A;  3POF A;  1KS4 A;  2VU9 A;  1SLB A;  3HMY A;  2WFF 2;  4RQP C;  1ZNP A;  1AHS A;  1FNY A;  1W9Y A;  4XTP A;  4CCE A;  3ZDS A;  4IEV A;  1L7Q A;  1RUN A;  2W1S A;  2VJX A;  5C8C B;  2PAM A;  1H8T A;  3C7O A;  5IUQ A;  4OI2 A;  5CFD B;  4YM2 A;  3VKM A;  1C4R A;  3PIG A;  3WW3 A;  5HCB A;  1W6M A;  2DUR A;  3M3C A;  1DYO A;  3UYJ A;  3ZYB A;  3GJB A;  1ONA A;  1LOF C;  2A6Y A;  4PI0 A;  2WZE A;  3HWJ A;  3PUS A;  5FYH A;  4MYE A;  1SG3 A;  5IVE A;  3CLP A;  4NOT A;  1F4H A;  2TBV A;  3UKN A;  4ZZ8 A;  1SPP B;  1HB2 A;  5KC6 A;  3ZSK A;  3VBF A;  2WN2 A;  1HQL A;  4Q4V 1;  3S7E A;  3D0J A;  4F7Z A;  5AC9 3;  4LBQ B;  3O0V A;  1W6M B;  4ZY9 A;  1GFF 2;  3T09 A;  2E53 A;  3UKT A;  4CDU C;  2AEY A;  4AI8 A;  1SFY A;  4ARY A;  4GB3 3;  3T08 A;  3KV4 A;  5EYY A;  2ZGU A;  4BOW A;  1ASJ 3;  1ND2 C;  1PM7 A;  2B46 X;  3FUQ A;  4JTN A;  2E51 A;  4N53 C;  2A6W A;  2W1W A;  2IZW A;  1FPN 1;  4AAP A;  2ZZQ A;  4QM8 A;  4Q4W 2;  3EMR A;  2VM9 A;  4QWN A;  5LRR A;  4QB1 A;  3RI8 A;  1ZRD A;  4YW3 A;  5FZD A;  4O7X A;  5A7W A;  2XH6 A;  3WSO A;  4YGD A;  1UO9 A;  3CKH A;  1OF3 A;  2VTF A;  4JKK A;  3MPB A;  2OXB A;  2ZAC A;  2BWC A;  3TWI A;  3R4S A;  1OFN A;  5A6X A;  1AL2 1;  5ACA 2;  1KS5 A;  3WDW A;  4JVA A;  1KXG A;  4XJA A;  1QJY 2;  4AG4 A;  2BBA A;  1EUU A;  2ORZ A;  4IUG A;  4LLF A;  3FFQ A;  2WT0 A;  3CJX A;  1N3P A;  2PHT A;  4Q4V 3;  1AR8 2;  4EE2 A;  1DQ5 A;  2OW4 A;  1UYP A;  2AYH A;  4W65 A;  4DIN B;  2CAV A;  1AR9 3;  1UOB A;  1C28 A;  5D1I A;  3VHN A;  4FT8 A;  4LA2 A;  3ZLI A;  2CYF A;  3NQH A;  5JLV A;  4BK4 A;  2FCU A;  4CUB A;  1OBN A;  4MGZ E;  4E27 A;  1LHU A;  1IQD C;  4LO5 B;  4YGE A;  4ZU5 A;  3HN3 A;  4Q0Q A;  3M70 A;  1T6G C;  1RUC 1;  1GOG A;  4XJ8 A;  3DKW A;  5M0T A;  1KJR A;  5JAX A;  1XNC A;  3GBF A;  5JXG A;  3IIA A;  5FZO B;  2WJS A;  1H0B A;  4YWA A;  1OOP B;  1S1A A;  5ANQ A;  1OXC A;  2PAE A;  1AYN 3;  4XDQ A;  2W46 A;  3M3O A;  4P14 A;  5F2W A;  2W94 A;  4DMI A;  1NE4 A;  5IAT A;  5F32 A;  2D7F A;  2G9G A;  1RUE 1;  3U1X A;  4XIK A;  2BOJ A;  2WC2 A;  4QPG B;  5HV4 A;  2P3Y A;  5DG1 A;  2VQA A;  2FZ2 A;  3N9O A;  4FSJ A;  4PI2 A;  4DNY A;  4XAE A;  5FZ6 A;  1UKG A;  4AFC A;  1HRI 1;  3B02 A;  5C9A A;  1PGW 2;  3ZDV A;  4GUL A;  1W8Z A;  2ZX2 A;  3A7Q A;  1LOE A;  1SZB A;  5FYB A;  2DFC A;  1NLS A;  4FPL A;  4XQ4 A;  1WCS A;  1ZZ8 A;  4ZKT B;  1CZT A;  3OYW A;  5FMC A;  5JDB A;  4XUP A;  4YSF A;  4OMC A;  4BIO A;  2R07 3;  2JXA A;  2WO1 A;  3GZT B;  2RM2 3;  1MEC 1;  1PIV 1;  1GAN A;  3EJK A;  3OEA A;  3WF1 A;  4LKF A;  5C70 A;  3K46 A;  3GBW A;  5IFT A;  5FLI A;  3AP6 A;  4CZS A;  1LKN A;  1QJE A;  2VO5 A;  3LAG A;  4R9A A;  1O6U A;  3ZXL A;  4Q4Y 3;  4KGQ A;  3PIJ A;  1W0O A;  4CUA A;  4W6W A;  3B01 A;  4XZU G;  1GP4 A;  1UNB A;  3I2O A;  1WUV A;  2RR1 2;  2AUY A;  1W99 A;  2IC1 A;  4FOV A;  4S2F A;  1DF0 A;  1QJY 1;  3NRU A;  1W6O B;  5EJZ B;  2GZW A;  3P3P A;  5JXI A;  5FP4 A;  2YFU A;  4IV1 A;  4L9B A;  4HOO A;  4KBZ A;  1GWK A;  3FC0 A;  4MLO A;  2WIN B;  1US3 A;  4QM9 A;  2ID4 A;  1O7F A;  5CEH A;  1ZZ6 A;  1HQW A;  1D0H A;  2HEY F;  4RYD A;  1BK1 A;  3MIC A;  4JHZ A;  5LA1 A;  1QJY 3;  2Y0O A;  5BNP C;  2PHU A;  3CEW A;  4PT6 A;  1JZ2 A;  4WM7 C;  2CWS A;  5IVJ A;  3D82 A;  4Z1V A;  1K5M C;  4UW5 A;  4ZZ5 A;  2GMM A;  3OGR A;  5FYZ A;  1LHW A;  5JZG B;  2ENR A;  4BDV B;  3AZW A;  4N43 B;  1ZRR A;  2VOT A;  4IV1 C;  3AL6 A;  4LUM A;  5IK8 A;  5DXD A;  1HRV 2;  3AMH A;  1UYY A;  1GNH A;  4R9B A;  2XR4 A;  3UNP A;  4XW3 A;  4CEW A;  4BH9 A;  4D7Y A;  5DZE A;  3DPR A;  2QQI A;  1JZ4 A;  5JWP A;  4BME A;  1Z78 A;  4AQS A;  1QMJ A;  3FX3 A;  3SNM A;  5FWJ A;  1O91 A;  1TZO A;  4XFG A;  3MUY 1;  5D21 A;  3ASI A;  1RIN A;  1MZE A;  3ETP A;  4Q2F A;  3DYO A;  1CAV B;  3LD8 A;  2GP3 A;  5CIR A;  1MZ5 A;  5I93 A;  1GR3 A;  3LA7 A;  3WHU A;  3MDP A;  3TN9 3;  5ERL A;  5IK7 A;  1UZY A;  3FBM A;  4YW6 A;  3DGT A;  4JRA A;  5IWF A;  1HV0 A;  1PGL 2;  2RJL A;  4LK6 A;  4FPG A;  4M0H A;  2A3W A;  4XFA A;  5BNO C;  5CKN A;  3LZZ A;  2JDA A;  4YVS C;  2J1U A;  2WNU C;  2GH8 A;  4P02 B;  4XUT A;  2RMU 1;  5FYU A;  3RS6 A;  3WF2 A;  1ULE A;  2D3S A;  4FQZ A;  4M3C A;  3ZFF C;  2NYY A;  2X5I B;  2ADD A;  4D7S A;  3SKJ E;  1JW6 A;  3ZFE A;  1NXD 1;  2N7G A;  3D4K A;  4CDX A;  5BY5 A;  3HBK A;  1XSQ A;  3ILR A;  3BI3 A;  5C3Q A;  4NRO A;  1AR7 2;  1LOC A;  3OSD A;  3S0M A;  1NLQ A;  1WBL A;  4ZS3 A;  3LCP A;  1YJL A;  4Q4Y 2;  4N53 B;  5A7W B;  5L36 A;  4XZP A;  3SC7 X;  5HBA A;  1V0A A;  3F2Z A;  4Y4Y A;  3W21 A;  3BB6 A;  4IGP A;  4A4A A;  3RRD A;  1DLL A;  4HPK B;  3FJS A;  3FLR A;  2C26 A;  3ZXJ A;  2W0X A;  1K45 A;  4AFA A;  1Y7B A;  1O4Z A;  2D6P A;  3BVC A;  3ZMN A;  2CWM A;  5FY7 A;  3WY6 A;  2PHW A;  3KF3 A;  2A71 A;  3FWE A;  1EP0 A;  4OUS A;  5GKA C;  2DCZ A;  2XOM A;  1W6P B;  1OF4 A;  1YWK A;  2GN3 A;  5DUU A;  3GF6 A;  3WLU A;  3MLL A;  5GM0 A;  5FP9 A;  4CSW A;  2G9F A;  1COV 2;  1X50 A;  3DXT A;  5FR3 A;  3KT1 A;  5T55 A;  4Q4V 2;  5IK4 A;  4LKE A;  4DY3 A;  1O59 A;  1OUX A;  4MGI E;  2YMZ A;  3QD6 A;  1DQ1 A;  5BUV A;  1GNY A;  4B3N A;  4DOU A;  2YY1 A;  1QDC A;  3LEK A;  1G6N A;  3H8X A;  2ZKL A;  1RVF 2;  2VCB A;  2CTV A;  2G19 A;  4FFF A;  1O3T A;  2CGP A;  1OT5 A;  2Q5T A;  3ZSJ A;  1W03 A;  3T0B A;  3CL1 A;  4MXW A;  4BQ3 A;  4MH0 E;  2XBO 3;  5H9Q A;  1JOD A;  5IVC A;  4FCA A;  1RUE 2;  3BTZ A;  4L92 A;  3D8C A;  5KHI A;  3OY8 B;  1R09 1;  4UBH A;  1ASJ 2;  5FZM A;  3C2U A;  1LEC A;  1W6P A;  5L7O B;  2Q8O A;  1JU4 A;  2WQ8 A;  4Y33 A;  4DXR A;  5C8W A;  3I2G A;  3MZH A;  2VAU A;  1V6M A;  3PDQ A;  2Y6K A;  4ASK A;  2ARA A;  5HV0 A;  3OG2 A;  1JYN A;  4ZU7 A;  2NPI A;  1UU5 A;  4NN0 A;  1TE1 B;  3GXU A;  5F3G A;  4L11 A;  3BPZ A;  4MHR A;  5DAW A;  5ACA 3;  4Z92 B;  3AMP A;  3WEZ A;  2YBS A;  3ZXK A;  4FAG A;  3PJQ A;  1IOA A;  4M3C F;  1GWM A;  3U14 A;  1QOS A;  3N7L A;  3NAP C;  4TN7 A;  5KWR A;  4PQQ A;  3RFR A;  4X8N A;  2JDK A;  2QQM A;  5CAZ A;  3ECQ A;  4AVA A;  3J8F 1;  1AYM 1;  1OH4 A;  2I74 A;  4OI4 A;  1UZV A;  3ZR5 A;  4CU7 A;  1AF9 A;  4AL9 A;  1AXZ A;  5JSO A;  3N4M A;  2Q30 A;  5J36 A;  2GU9 A;  3LSE A;  3O7O A;  3OBZ A;  1REF A;  3BTX A;  1OA2 A;  4MVT A;  4XDP A;  5LBB A;  4D94 A;  1MQT C;  2PHF A;  1AL2 2;  2Y6G A;  1VR3 A;  1CON A;  5FZK A;  3ZX7 A;  2GSY A;  4NHK A;  3URF A;  1K5M A;  3X29 B;  1ENS A;  1H8T C;  4XF9 A;  2XL7 A;  5A33 A;  1XPW A;  3S30 A;  4JTO A;  3WIN E;  1ULP A;  4H14 A;  4E2G A;  3POW A;  3A0N A;  3GZE A;  3H7Y A;  2XB6 C;  4V1P A;  4WM8 A;  4JDO A;  3WP6 A;  1WCK A;  2YPD A;  1D2S A;  1S2K A;  2WZR 3;  3MYX A;  1GQP A;  5GLT A;  1V6O A;  1RUO A;  1FNZ A;  3UJO A;  3VKF C;  3IMN A;  1KFX L;  2CV6 A;  2WT1 A;  4NR1 A;  1JOJ A;  3UGG A;  2BGP A;  4CDQ B;  4LMF A;  2H6C A;  2RV9 A;  3OPW A;  2HLE A;  4XC9 A;  5JIU A;  3JU9 A;  4CEW B;  2X05 A;  1RMU 2;  2ZTN A;  2CGN A;  3HT1 A;  1T2X A;  1X8M A;  3I49 A;  2DF7 A;  1OOP A;  1YQ2 A;  3OUI A;  4EN0 A;  1OQE A;  1NCR C;  3M8L A;  4DXS A;  2C24 A;  5FZ8 A;  3KS7 A;  4KMQ A;  2XLF A;  3MEP A;  4Q5O A;  3DPR C;  2GAL A;  2WNV B;  5FMB A;  4GMP 1;  4CE8 A;  1ZRE A;  1K3I A;  4UW3 A;  5A80 A;  1IPS A;  3ACI A;  1RHI 3;  2J1R A;  5IFP A;  1I1E A;  4FVV A;  3O0X A;  1DYP A;  4KWJ A;  2PA7 A;  2WNU A;  1Q8V A;  4QPI B;  4AVC A;  1VBE 1;  4GWN A;  4H7M A;  2VCC A;  1R1A 2;  2B9V A;  3DUI A;  4BQ1 A;  5J37 A;  1CAW B;  1LEM A;  3H3L A;  1WD4 A;  2IXI A;  2MEV 1;  3MID A;  1UZZ A;  2ZBJ A;  2K2S A;  1GSL A;  3AZV A;  1ZX5 A;  5CAD A;  3HAG A;  2WFF 3;  2ZEZ A;  3VZN A;  4MZU A;  4BZ4 A;  4YZ5 A;  4ATE A;  5FO7 B;  2VMD A;  3DEC A;  5FYS A;  1JU3 A;  5LK5 A;  2CU5 A;  3OYW B;  2R16 A;  3WOG A;  1IGO A;  1VBC 1;  1C5H A;  4M00 A;  3K2O A;  5FZG A;  5BNQ A;  1XBF A;  4XUQ A;  3BU0 A;  5D2A A;  2R1B A;  4BLJ A;  4E4Z A;  1O3Q A;  4OFG A;  4LBQ D;  2WUH A;  3KCC A;  4ISR A;  1ND3 B;  3O1V A;  1VB4 A;  4IQP A;  1YQ5 A;  1UF2 C;  5FPV A;  5FUI A;  5E6H A;  1CD3 G;  1WKY A;  5T5P A;  2MPF A;  1VBC 3;  3LQC A;  3POE A;  2R06 2;  1SLC A;  4JGY A;  2H0V A;  1QNW A;  1HJG A;  1RL3 A;  2XUE A;  4G4F A;  2YUE A;  2ZCW A;  1VAK A;  1RUG 1;  2R04 3;  4Y26 A;  2WDB A;  2VUA A;  2VVD A;  1Q8Q A;  2DVG A;  4IGO A;  3VBU A;  5A3U A;  1BEV 1;  2J1S A;  4CP9 A;  3IPV B;  1PO2 1;  2KD7 A;  4BXF A;  4XFF A;  4OYU A;  2YFZ A;  3BOP A;  2CDP A;  4Q27 A;  3VZO A;  1LNS A;  1WCQ A;  3HPN A;  3VZJ A;  3I2H A;  2QQL A;  3IM0 A;  1UX7 A;  2XML A;  4YZ2 A;  4YM0 A;  4YGB A;  3EB7 A;  1C8M 1;  4PBP A;  2X29 A;  3M2M A;  3O14 A;  3U75 A;  3WQB A;  3R6S A;  4AHW A;  3BIW E;  5F5C A;  2E6V A;  3ZO0 B;  1Q56 A;  4N43 A;  4BQ4 A;  2HWE 2;  1VPH A;  2W5F A;  2UWB A;  1XU1 A;  4E4S A;  1OLM E;  3I3E A;  5C9A C;  2B9U A;  1COV 3;  3EXU A;  3S5A A;  4NIA A;  1UAI A;  2FHR A;  4I01 A;  4EQV A;  1AXK A;  3ZSL A;  3JD7 2;  1ZA4 A;  4HN1 A;  4YVS A;  4A7Y A;  5IVF A;  5JPN B;  2XVK A;  2TEP A;  5FP3 A;  2LM3 A;  3GZA A;  1OKQ A;  4QX8 A;  4SLI A;  3AVR A;  4Y22 B;  5GLZ A;  3BPS A;  4QQO A;  5L73 A;  5C8C C;  3HVD A;  2FDK A;  4UFI A;  3HNM A;  4YW2 A;  1SCS A;  1XE7 A;  2PHL A;  2QFE A;  5F9T A;  3FE5 A;  2P3K A;  5FP7 A;  4H7L A;  4IV3 A;  2DCK A;  4K6B A;  5C3P A;  5APA A;  4Z2W A;  1TQ5 A;  1XYN A;  1AR6 2;  1VBB 1;  2ZAH A;  2MHF A;  4XAB A;  4B29 A;  3MI8 A;  5A3P A;  3OBA A;  2QQW A;  4YFW A;  1VE0 A;  3B93 A;  2EIE A;  1A8M A;  2EXI A;  2P6C A;  1NLR A;  3SIS A;  2JE7 A;  4HKL A;  5BNO B;  2BVV A;  1CVN A;  3WF4 A;  2YXS A;  3RDI A;  2O1Q A;  2W95 A;  2WNU B;  3AJY A;  5H9S A;  1D2Q A;  1OLQ A;  3LE0 A;  5A7S A;  4OI1 A;  4W4Z A;  1WWY A;  3MFA A;  4P9X A;  1KRI A;  4LOS A;  3DL3 A;  3PUH A;  3Q8C A;  2OYZ A;  4AE2 A;  4BK5 A;  3PU8 A;  1G9A A;  3ZXF A;  1E5H A;  5T5J A;  1DIW A;  4R4Z A;  5L19 A;  5FPZ A;  2RM2 1;  4S2H A;  3VBF C;  2FZ1 A;  3O1P A;  3DXU A;  1PGL 1;  4PF1 A;  4QHZ A;  1W8N A;  2D6O X;  5GZE A;  2A75 A;  3CJI A;  3VDB A;  3PJY A;  3DF0 A;  3WDU A;  4R9C A;  2VXJ A;  2YGM A;  3MIF A;  4G3Y C;  2VZS A;  3SH5 A;  1EPW A;  1ZBE 3;  5LY2 A;  2D6N A;  2VME A;  3A21 A;  5CU1 A;  3OPT A;  2Q8E A;  2SLI A;  1KGY A;  1W2O A;  3J7N A;  2V5Y A;  3N9N A;  1W39 A;  2RE9 A;  4XF1 A;  4LO7 A;  4C0B A;  1RXF A;  3WVJ A;  4NID A;  3I2F A;  3HNB M;  3WX5 A;  1KIT A;  1LHV A;  1X36 A;  1RMU 1;  4P9G A;  4YVW B;  4A6S A;  1VAM A;  3N7K A;  1BCX A;  1UPS A;  3B9I A;  3CF6 E;  3E6D A;  1VBA 2;  4WM7 B;  1Z0H A;  5CNA A;  1F15 A;  3RMY A;  3WUD A;  1HXS 1;  1LRH A;  1W9T A;  2J22 A;  4AOC A;  2WFP A;  1W0N A;  1R1Z A;  1ULF A;  3I3D A;  5CBL A;  3A22 A;  2BER A;  3LOI A;  3ZKU A;  1ENX A;  1NCR A;  3RWN A;  3THD A;  4KQ7 A;  4GH4 C;  5CYY A;  2R7E B;  4AI2 A;  1QQP 2;  2ET1 A;  3ZYH A;  4AVT A;  3Q9O A;  1O4T A;  1FYU A;  1TME 1;  2QQK A;  2WNO A;  4IV3 B;  5KHJ A;  4Y20 A;  4DUW A;  2UY9 A;  3H0O A;  4Y1V A;  3AMQ A;  4CDX C;  3CMG A;  5FFO C;  3IBM A;  5CIS A;  3KHC A;  1H2M A;  3N7J A;  1WW7 A;  1DU3 D;  1RMU 3;  2JDZ A;  5JMC A;  3FFZ A;  1OFS A;  2A6Z A;  2VC9 A;  3POY A;  2J1E A;  2W87 A;  1GZW A;  5AVP A;  5FRA A;  5C6C A;  1RUD 2;  5DZF A;  1TNR A;  4XHB A;  1XNK A;  4RD7 A;  4RS5 C;  3VUO A;  3NJX A;  3VBH B;  4ZU4 A;  4Z07 A;  2Z2S B;  2W47 A;  3RI9 A;  1CJP A;  1VBA 3;  1GYK A;  1LOA A;  3KWV A;  1HJF A;  4P08 A;  4IXL A;  2B45 X;  5LBC A;  3VBS B;  5ABJ A;  4C91 A;  5KXC A;  2VZT A;  1NKG A;  3J7H A;  1NZC A;  3CJI B;  3KLS A;  5CG9 A;  1HW5 A;  4CCN A;  1UQX A;  1KD7 A;  5DAP A;  3CBN A;  4QXC A;  4YRD A;  2QNK A;  3TEY A;  4GWJ A;  2G1M A;  3ELN A;  2V72 A;  1Y9Q A;  1RUJ 2;  1TNF A;  4NPR A;  3FLP A;  4UFK A;  5FY0 A;  1QY4 A;  2YB7 A;  3MLJ A;  2QZ2 A;  1UU4 A;  2W3J A;  2ARX A;  2RS5 3;  2YYO A;  4NHY A;  5AC9 1;  3JBG 2;  4CU8 A;  3H1Y A;  3THP A;  2FDF A;  2FDJ A;  4J1X A;  4LBJ A;  3K75 B;  2OII A;  1PMH X;  3JUU A;  3NNL A;  1P8J A;  1SBD A;  2NQY A;  5IYY A;  3VKO A;  1QXJ A;  1W9S A;  2QQU A;  2D5H A;  2VQU A;  3MF6 A;  4Q29 A;  4Y5S A;  2RM2 2;  5EV7 A;  2W2I A;  1JZ6 A;  3GNE A;  4CTE A;  2RS5 1;  4Y1X A;  2IXK A;  1W2A X;  2HWC 2;  4DO0 A;  1XND A;  5FZA A;  3ACL A;  3Q8F A;  1A3K A;  2FDH A;  4QPW A;  5FOB B;  1JXN A;  1ALY A;  2QQN A;  2VXR A;  4XHX A;  1EV1 3;  2ZX0 A;  2C1F A;  1MPX A;  3NW4 A;  4CUG A;  1FOD 1;  1Q8O A;  3NKT A;  3MIG A;  1DZR A;  2A70 A;  1HV1 A;  3VN4 A;  1F35 A;  3ACH A;  3KCX A;  3AL5 A;  1M06 G;  4XJW A;  3NV2 A;  4RR3 B;  1AR8 1;  4YVS B;  5I8Y A;  5K4L A;  4Q8L A;  2D6M A;  3GZU C;  4Q8K A;  5CA6 A;  1ULD A;  1AUY A;  3UV9 A;  5LEK A;  1ZZC A;  1Q8S A;  3N9Q A;  5C5U A;  3PVB B;  3PUA A;  3R05 A;  3TNP B;  2MEV 3;  4Y20 B;  1PNG A;  1XYP A;  4QPY A;  4BIF A;  1H1M A;  5DDJ 1;  3T1L A;  3FL7 A;  1HKD A;  1WA6 X;  2VE1 A;  3J4U H;  2XQX A;  3JD7 3;  4AGR A;  5A3M A;  4UW4 A;  2GNM A;  2VQ0 A;  4RGG A;  4BYY A;  2BDR A;  2YBK A;  3CIH A;  4JQR A;  2YZ4 A;  1DQ6 A;  4KWK A;  3O1U A;  2VMH A;  4XPV A;  1EAH 2;  4IND A;  5T3N A;  5IT6 A;  2QQJ A;  2HWF 3;  3H3Z A;  1U5Y A;  1K5J A;  2WA4 A;  3OGS A;  5E8A A;  4PDW A;  3ITQ A;  3WD5 A;  4HFS A;  5J7M A;  2XJV A;  4QT6 A;  4DXT A;  3J8F 2;  4GH4 A;  2VVE A;  3WP3 A;  2D98 A;  2HWC 3;  4WVM B;  5BPX A;  1S0I A;  4DXZ A;  4FAH A;  1PK6 B;  4H3W A;  5T5L A;  2Z5W A;  3DYP A;  2HWE 1;  1KDK A;  2QQV A;  3KF5 A;  4NUB A;  5F5Q A;  3H42 B;  2XG3 A;  1VIW B;  2XKO A;  1MS1 A;  4YFZ A;  1HN1 A;  3VV1 A;  3M1H A;  1D7P M;  3KM5 A;  1XC6 A;  3WNO A;  1URX A;  3O1S A;  2XLA A;  4K20 A;  4FOW A;  4JC1 A;  1UD1 A;  3N7M A;  5FOJ B;  3LOB A;  3PHM A;  3B00 A;  5EQU A;  1GIC A;  2ZGT A;  3ZFF A;  4AXO A;  2Z69 A;  2O14 A;  3AJZ A;  1OLR A;  4I0B A;  1PVC 3;  5K0U A;  1VMH A;  2IXJ A;  4QB2 A;  3QH6 A;  2GC0 A;  2EXK A;  1W3X A;  2JG9 B;  1DGW A;  4XQW A;  4OVE A;  3ATG A;  2GNB A;  1RUI 1;  3N3H A;  1OC1 A;  2V4A A;  2EXH A;  3QLQ A;  1EY2 A;  5JSR A;  2A6V A;  2E7Q A;  3AZZ A;  1I6X A;  1V00 A;  3D0S A;  4GXL A;  4LJH A;  3VBS C;  5FIX A;  3GYD A;  4BHP A;  1A34 A;  3ILF A;  2AZ5 A;  3RZL A;  3IN9 A;  1UW8 A;  1W6N B;  3N35 A;  1RXG A;  4I02 A;  3V0B A;  2WWJ A;  3C7E A;  3I8T A;  4AYU A;  1Z7S 3;  3LEI A;  4TZD A;  3TN9 2;  3K51 A;  4NWV A;  4GB3 2;  4BWO A;  1DG6 A;  4CYD A;  1GU3 A;  3LPG A;  1UKR A;  4NRQ A;  1J3P A;  4HMZ A;  2RS1 3;  3KSC A;  3I3M A;  1MS9 A;  3N9M A;  1N1S A;  1WCD J;  2JG8 C;  3KB5 A;  3MIE A;  1JHN A;  4LIU A;  1S4C A;  3B3Q E;  3P6B A;  2NZ9 A;  4JX0 A;  2WZP P;  5FY1 A;  4PIX A;  1GZT A;  4XET A;  5FY9 A;  3H1W A;  1ODM A;  3RG0 A;  2RVA A;  3U4X A;  4I3G A;  4URA A;  4MXW B;  5I0S A;  3GAL A;  3RZH A;  1C57 A;  4Q1R A;  3U78 A;  2PQQ A;  2OX0 A;  2WZ8 A;  3BIE A;  2OT7 A;  3ABZ A;  1E57 A;  4IEO A;  2EVX A;  3OY8 A;  1RUD 1;  3JQW A;  1JN2 P;  1X9P A;  2BZD A;  2MNG A;  4TSV A;  3T0D A;  4F8A A;  3GCW A;  4RGK A;  1BMV 2;  1JHJ A;  2XXZ A;  3RWK X;  4LKS A;  4FP3 A;  1OUS A;  2AEZ A;  4D3W A;  3NKG A;  5IVB A;  1UXZ A;  3ZSE A;  3O1O A;  1KQR A;  5FYC A;  3APB A;  3NL1 A;  4Q4X 3;  1W6Q A;  3I97 A;  3SHR A;  3VD7 A;  1G9B A;  1J3Q A;  3WNL A;  1R08 3;  4NO4 A;  5FAX A;  2Y6L A;  3SCH A;  1CJD A;  2E31 A;  3RSJ A;  1MZF A;  1SLI A;  5FZC A;  1NCQ C;  2XKP A;  4IE5 A;  3O1R A;  4XBN A;  1DYK A;  3LDR A;  3B9C A;  5A7O A;  3EBR A;  4N8M A;  4LHS A;  1QU0 A;  5FUP A;  1VBE 3;  2NP0 A;  4XJU A;  3JXS A;  5LB6 A;  1DGL A;  2XVG A;  4CCC A;  1VBA 1;  1QJZ A;  1N1V A;  2VR4 A;  3OPZ A;  1W28 A;  1F8V A;  2VNO A;  2B4K A;  2OA2 A;  2VQT A;  2P6H A;  1WCU A;  2R04 1;  2XWJ B;  2JX9 A;  3OTF A;  5FZI A;  1RUH 1;  1FT9 A;  3OJB A;  3ZR6 A;  2WAA A;  4XE9 A;  2J1A A;  4AHY A;  1UMZ A;  1UWW A;  4FI9 A;  3FHA A;  1JI6 A;  2GC3 A;  3AB0 A;  4P00 B;  4AW7 A;  4TXW A;  3MUZ 1;  5L9V A;  5J1X A;  5KHK A;  4O61 A;  4C90 A;  2W68 A;  1O8S A;  5F6K A;  5LRS A;  4LHL A;  2E7A A;  1RUE 3;  2RR1 3;  4QXK A;  1LR5 A;  2ZGS A;  3PVN A;  5FY5 A;  5FZ3 A;  4NPL A;  3ZPY A;  4CXX A;  1B35 B;  4LBL A;  1BBT 2;  3V56 A;  4GH4 B;  1XE8 A;  1DQ0 A;  2WLQ A;  1W90 A;  3MHZ A;  4AVB A;  2LUW A;  1FAY A;  2D97 A;  2ZHM A;  2Q8C A;  1C1L A;  4NMI A;  5FYM A;  2PHR A;  2FDI A;  1PO1 2;  1EV1 1;  4A41 A;  5GZG A;  4AQT A;  4CCJ A;  4YYO A;  1JMU B;  2DUP A;  4D69 A;  1OQD A;  4XF0 A;  1UZ0 A;  4Q0P A;  5A3N A;  1IZ3 A;  2OS2 A;  1FMD 1;  2I2S A;  4P9J A;  3SMH A;  4XYX A;  1GOF A;  3VLB B;  5DAV A;  1S0F A;  3H9A A;  2F17 A;  5FRE A;  1POQ A;  2G9Z A;  4QKF A;  2DUO A;  4B1M A;  5I8T A;  3HBZ A;  2ES3 A;  2VCM A;  3JCI A;  4X6R B;  4FTS A;  5C3R A;  1APN A;  4AFB A;  1CN1 A;  4E4D X;  2ZPX A;  3VDD C;  1XJA A;  2W08 A;  2XHK A;  2YV8 A;  4AVS A;  1J84 A;  1X33 A;  1XRU A;  2ZZJ A;  5CFD C;  1LU2 A;  4LBK A;  4IV1 B;  5L7O A;  1EAH 3;  4NAM A;  3UJQ A;  4EV0 A;  2HWF 2;  3MF9 A;  3H1M A;  2NMO A;  1JZ8 A;  3CQO A;  5CB7 A;  4OQ8 A;  3HOB A;  1NT0 A;  2A73 B;  1W2U A;  2JB4 A;  2P3J A;  1UXX X;  3AKR A;  3WP4 A;  4COU A;  2V4V A;  1LB2 A;  3GM8 A;  1FXZ A;  3WT3 A;  5I91 A;  3AZX A;  4CDQ C;  4WVM A;  5KBF A;  1H2K A;  1OH3 A;  4HON A;  1FMD 3;  3E1F 1;  2SBA A;  2ZGP A;  5D8A A;  2OKX A;  4CDU B;  4KL1 A;  1JZ3 A;  4OMD A;  1PMI A;  1W6O A;  3ACF A;  4Y3O A;  1NZI A;  1WMF A;  1QNY A;  4AED B;  2GC1 A;  3PUR A;  4WVV A;  5AVA A;  3T2Q A;  1O8P A;  1U12 A;  1DLC A;  2CGO A;  1GLH A;  3KGL A;  1CX1 A;  3E5X A;  3W58 A;  1GP6 A;  1OUR A;  1X8E A;  5DMY A;  3AK0 A;  2XJT A;  4ES8 A;  4FTB A;  4ZPI A;  2TUN A;  1F9K A;  4QU1 A;  2E63 A;  5IJR A;  5C3O A;  2BBV A;  4HKO A;  4CP1 A;  2C9K A;  4CDQ A;  4IEP A;  3IWZ A;  2WSV A;  2FMY A;  4PCR A;  4CEW C;  3TBD A;  3O1T A;  2BOI A;  3ZFF B;  4LEJ A;  2RJK A;  5FTT C;  5BNN A;  4OUM A;  2AC1 A;  1PZ9 A;  1RHI 2;  2BRT A;  2R06 3;  3LSD A;  4U2A A;  4YG3 A;  2VZU A;  2VMG A;  3PU3 A;  3RPQ A;  3ZFG A;  4IE4 A;  1ACC A;  5FQ0 A;  1IPK A;  2D6L X;  2ZHK A;  4CDW B;  2R04 2;  3VBU C;  1AR7 3;  3VBO B;  1B35 A;  2BWA A;  3PME A;  4OLL A;  3POJ A;  5TSW A;  3ZXG A;  2R32 A;  4XUR A;  4BCU A;  1UX6 A;  3IMM A;  3JBG 1;  5A32 B;  1ST8 A;  4JRL A;  1XB9 A;  3T0A A;  2JD4 A;  4CEY C;  5C7G A;  1LHO A;  1HRI 3;  3AXE A;  4HSJ A;  1IG0 A;  1JS9 A;  3OGG A;  3NJV A;  3NV4 A;  3U4S A;  3WDV A;  5CFC C;  2XDV A;  1S0C A;  4AQ6 A;  1FV3 A;  3ZXD A;  3A4U A;  1R1A 1;  2VOX A;  2VZO A;  4L2N A;  5FMO S;  1ZRC A;  1IS6 A;  1GUI A;  2CHH A;  1QIQ A;  3RMX A;  3INA A;  5JOY A;  3VD9 A;  3J7M A;  5IK5 A;  2WNE A;  4A2U A;  2A7A A;  1HB1 A;  4XMA A;  4HAN A;  2EAA A;  2OPW A;  1O5L A;  3ZVX A;  2QZ3 A;  2VBD A;  5T50 A;  4MOA A;  2GC2 A;  3WF3 A;  1NQD A;  4FOQ A;  3N9P A;  5JZG C;  1SHW B;  2DV9 A;  1TME 2;  1UYZ A;  3I7D A;  3POG A;  3AX4 A;  4IE6 A;  3VDA A;  4JKL A;  1AVB A;  2RS3 2;  2GH2 A;  4P9L A;  2ADE A;  4CCO A;  1R64 A;  4JGZ A;  2ERF A;  4RGA A;  3FHI B;  4MGS A;  4LLO A;  2W92 A;  4JZR A;  4HSL A;  1I5Z A;  3G6J B;  1SDD B;  2JG9 A;  2KA3 A;  2PMW B;  4I09 A;  4BLI A;  2Y0I A;  4QX2 A;  3E6C C;  2FD8 A;  3D6E A;  3UL2 A;  4BE3 A;  4XVH A;  2YC2 A;  4FBF A;  3ZM8 A;  3S6P A;  5ISL A;  1ZA7 A;  3BTY A;  1QH6 A;  1LOD A;  1MS5 A;  5DPN A;  2ARB A;  1JYI A;  3FHQ A;  3V64 A;  1QQP 1;  4YPJ A;  4Z8B A;  1VBD 1;  3K4A A;  4JCK A;  2WSU A;  3ZFE B;  1CR7 A;  2PQS A;  1JYC A;  1X82 A;  1JH5 A;  1HN0 A;  1W8T A;  4BU2 A;  1I9R A;  2EAL A;  5E1R A;  3WQ1 A;  2HJI A;  2EA7 A;  1YUD A;  4QMA A;  3GCX A;  1H9P A;  2ETE A;  4CRQ A;  4O9E A;  4LBN A;  3ZFE C;  1ZZB A;  4EYU A;  3USU B;  3WZ1 A;  4N7U A;  5KHG A;  4K1Y A;  4K7J A;  3FUO A;  3BOW A;  1PGW 1;  2E32 A;  2GAU A;  2VZR A;  3WW2 A;  3ZN4 A;  4DS0 A;  1ZBE 2;  3VBO A;  1AR9 1;  3WV6 A;  1OLM A;  1GQG A;  1G9F A;  2C6S A;  1LU1 A;  3NO8 A;  1H6X A;  1H30 A;  3ZFG B;  4L97 A;  3USU A;  4IDZ A;  1AZD A;  1YFU A;  2WAO A;  4HVO A;  4AI9 A;  1BJQ A;  4XXA A;  2J7M A;  3NST A;  1SLL A;  2ZXQ A;  4SBV A;  2JDP A;  2A3Y A;  2F4L A;  1WLC A;  5HXM A;  3AZY A;  5HCF A;  4I2O A;  4ISQ A;  3RJR A;  4QX0 A;  1LOF A;  2AR6 A;  3LF7 A;  4BJ0 A;  2B39 A;  4CCM A;  4LOR A;  5DDJ 3;  1K42 A;  1GV9 A;  5K7P A;  1A6C A;  5FZ7 A;  2BGO A;  2VD7 A;  1HX6 A;  4QGN A;  2VOW A;  1W04 A;  3ON7 A;  4ITC A;  2WS9 1;  1RUF 3;  1SBF A;  3BN6 A;  2R30 A;  4A7Z A;  5E88 A;  5FZB A;  3GGL A;  4HK8 A;  1STM A;  3ME2 A;  1ZYB A;  4N9H A;  2VNG A;  1ND2 A;  3ZIW A;  5HCH A;  4CP2 A;  2ZEY A;  1PK6 C;  1O3R A;  1KDM A;  2DWR A;  1UU6 A;  1PO2 3;  1AR9 2;  5EWS A;  3ZYJ B;  1ULC A;  1UY0 A;  4K8R B;  2VZ1 A;  1GKB A;  3E6B A;  3JD7 1;  2GDF A;  3ACG A;  4JGZ B;  3GBG A;  3S7I A;  4QHO A;  2C5D A;  5F3E A;  2IXC A;  5J3U A;  2W91 A;  3KD4 A;  2WBK A;  1CWP A;  1D4M 1;  1PVC 1;  4RQP B;  3IDC B;  5FZL A;  4WM8 B;  5GZF A;  5BNO A;  5JI9 A;  2RG4 A;  2HWF 1;  2VNV A;  4XBQ A;  3WG1 A;  2HBT A;  1N1T A;  3H8R A;  3VGI A;  1BBT 3;  3WCS A;  1YFY A;  1DBN A;  3MLK A;  5F5I A;  2Q1F A;  3KHB A;  2JE9 A;  2Q0A A;  4I3P A;  1FAT A;  4M4R A;  5T5O A;  2VL4 A;  3PVO A;  2WNV C;  2HWB 3;  1COV 1;  4IGQ A;  3LFI A;  1DGR N;  3CU7 A;  4QKN A;  1FPN 2;  1OD3 A;  2ZGQ A;  4EZH A;  4OHY A;  2O0O A;  4GQ7 A;  4S2D A;  4UWD A;  4FXK B;  5DAX A;  4LQR A;  5E89 A;  4YVW A;  3T2T A;  2QE3 A;  4C0H A;  1OVS A;  1Y3T A;  1YCI A;  3ZKY A;  4GKY A;  3DYM A;  4EJR A;  2WLP A;  1J3R A;  3DV8 A;  4QQ2 A;  5C4W B;  2VY0 A;  2ATF A;  3SIT A;  1U5X A;  2VNR A;  2BNO A;  4NAO A;  2XGX A;  2B7Y A;  1DZQ A;  1RUF 2;  3HIF A;  4GAL A;  5FYY A;  5FO9 B;  3VKN A;  1UIJ A;  2D3R A;  4MGK E;  4IES A;  4FPJ A;  2VUL A;  4GZ9 A;  3C7F A;  1DQ2 A;  1D4M 2;  4D6Q A;  1W8U A;  3OGJ A;  2RS5 2;  3L2H A;  5EP9 A;  3RYP A;  2RHP A;  3NNJ A;  5EHD A;  1BBT 1;  1L3J A;  3VBH A;  3WDX A;  3KV6 A;  1ND3 C;  3WHT A;  4Y5Z 0;  1Q5O A;  3USS A;  1JYX A;  2D93 A;  3CDZ B;  5I0T A;  4E8C A;  3OOX A;  4WM7 A;  1NY7 2;  1VBC 2;  4XDO A;  4Y5T A;  3K48 A;  5F7U A;  5GZC A;  1V9U 3;  2I07 B;  1RUD 3;  4MGQ A;  4QDR A;  4E2Q A;  3VBS A;  5ABJ B;  1PIV 3;  2QQO A;  2WZR 1;  3ROU A;  1POV 1;  1RB8 G;  3TEW A;  2WS9 2;  2XQR A;  1WMX A;  2BGC A;  5F1R A;  3C8X A;  2DFB A;  3IB3 A;  4YW5 A;  1WW6 A;  4W6Y A;  5K0U C;  3TB0 A;  1SLA A;  1DFQ A;  4BMB A;  2X10 A;  4QPI A;  3ZN6 A;  2ARE A;  2GN7 A;  4FPC A;  2D44 A;  1DCS A;  4RS5 A;  4WBB A;  3U10 A;  2EAK A;  3IDA A;  3SCF A;  2BU9 A;  2DVB A;  4A44 A;  4Q26 A;  2DDU A;  1DHK B;  1S0G A;  2LS6 A;  4R52 A;  3WNK A;  3JBG 3;  3EYP A;  1UZW A;  2D3P A;  1YEW A;  1SMV A;  3T30 A;  1NA1 A;  1VRH 3;  4U36 A;  3GHN A;  3WW4 A;  4AHZ A;  4CP0 A;  3AC0 A;  3IDE A;  4QX7 A;  2D43 A;  2MEV 2;  2W9X A;  1WLT A;  4WVZ A;  2YRO A;  1RED A;  2QVS B;  1OA3 A;  3ORJ A;  3ZPO A;  3GJA A;  3WG4 A;  2EF6 A;  4HVQ A;  2RDN A;  1XOY A;  2YDE A;  1CPM A;  2Y34 A;  3RYR A;  5KXB A;  1TMF 3;  2X5I A;  2VPV A;  4L99 A;  1NOV A;  1WW5 A;  4XXP A;  3PVE A;  1YFX A;  3III A;  1SEF A;  2HKX A;  2LRP A;  2ZEX A;  4QU2 A;  1HRV 1;  3D3A A;  4ONU A;  3WNN A;  5DQ0 A;  1S2E A;  5FKC A;  3WW1 A;  5JCT A;  2JG9 C;  4XMI A;  1VLN A;  4KWL A;  4COZ A;  2KM2 A;  2E33 A;  1NA1 C;  2GNT A;  1BMV 1;  4ERO A;  2QQP A;  1RGS A;  2V73 A;  3LGR A;  1LHN A;  1VRB A;  1CAX B;  2B5H A;  2UYB A;  4XQD A;  5G04 L;  3AFG A;  2J1V A;  3H3U A;  4KBB A;  4B8E A;  4RL7 A;  3R4D B;  2PAK A;  5A3W A;  5FXZ A;  1LED A;  4QPI C;  3RZJ A;  5JSP A;  3WP5 A;  5F6L B;  3AKQ A;  5DAB A;  2E7T A;  1D0G A;  1UIK A;  2K0G A;  3WQ0 A;  1MS0 A;  5A7Q A;  4LA3 A;  5FPL A;  1IKP A;  2VEC A;  5B2G B;  4QGL A;  4JGY B;  3TEZ A;  3BKZ A;  3K3N A;  4CU6 A;  5JXH A;  4YAR A;  1G8W A;  4C1X A;  2ARC A;  1CIY A;  4IE7 A;  4MGT A;  2WA3 A;  4TYS A;  4EN8 B;  1C3H A;  4RSU A;  2J42 A;  2VZQ A;  4N90 A;  3TNQ A;  3ZYG A;  4CDW C;  3I59 B;  1RHI 1;  1US2 A;  2JDN A;  4NII A;  4X6Q B;  5C5T A;  1DGW X;  5FBZ A;  2IXH A;  3S5Q A;  1JOB A;  3NNF A;  4H2A A;  2WKK A;  2XJS A;  3BGA A;  4XAA A;  3ZYI B;  1CIW A;  1Y4W A;  4S2G A;  4UT5 A;  4YW1 A;  5GZD A;  4CU9 A;  2RS3 3;  4NIG A;  2EIC A;  3BU7 A;  3RZG A;  4AFM A;  5A6Q A;  1VMJ A;  2WN3 A;  3OUJ A;  3ZYP A;  4COV A;  4AEJ A;  4RR3 A;  2NLR A;  3WF0 A;  1QOT A;  3SLI A;  3KCY A;  4LUK A;  2WYS A;  3E5U A;  4DQA A;  2VMC A;  3PLQ A;  3VD4 A;  4XIL A;  4RQP A;  4FO9 A;  4Y1Y A;  1DDL A;  1PK6 A;  4DIQ A;  3SH4 A;  1LGB A;  2D40 A;  4PDW C;  4K8F A;  4KGG A;  1B09 A;  1ASJ 1;  4JKM A;  5FCC A;  1R09 2;  1VJ2 A;  3TEX A;  2FQP A;  4WVW A;  1QJF A;  1L7R A;  2VUD A;  4OHX A;  1W2T A;  1N3Q A;  3RGB A;  5LCW L;  1AYN 1;  2FDG A;  1CZS A;  3RZZ A;  2DUQ A;  3HD8 B;  3E97 A;  4E4H A;  2Y26 A;  1WGP A;  5A7N A;  1XNA A;  1ZBE 1;  4ARX A;  4OZO A;  1LES A;  4R8H A;  1NYW A;  1QQP 3;  5C4W A;  3WXP A;  4K3U A;  1ZVF A;  2XBO 1;  1YI9 A;  1RUC 2;  2Y6F A;  2BVB A;  1N47 A;  1VBB 3;  2QDN A;  1WLW A;  2ZGK A;  2GP5 A;  3M3Q A;  3MIH A;  2R0H A;  2HYK A;  3ES1 A;  4UAP A;  4BIS A;  3B7M A;  5FZH A;  1CPN A;  4FPE A;  3SEE A;  1NAE A;  2LRO A;  1YI7 A;  5A33 B;  3ZMO A;  1PVX A;  3KV9 A;  3NVC A;  5LA0 A;  5B4N A;  2ZMN A;  1L7L A;  4QQL A;  1WMD A;  1O5U A;  4AEK A;  2ZGN A;  2VVF A;  5BNN B;  1G9D A;  4UFJ A;  1J58 A;  3OD0 A;  2WL1 A;  5EXO A;  2WO2 A;  3I2K A;  4FFI A;  1CAX A;  2P1B A;  2XJP A;  3LA2 A;  1MVE A;  4UI9 L;  3RQ0 A;  3WNX A;  3SEP A;  5A7P A;  1W8H A;  2EIB A;  5H9R A;  4IET A;  1GP5 A;  5F2S A;  2ZS6 B;  3SH3 A;  5JPM B;  3AP5 A;  5C4W C;  2CAU A;  3BUC A;  3L2Y A;  2HWE 3;  4Q0S A;  2JB8 A;  4QX3 A;  1R09 3;  1RJ7 A;  1POV 3;  1I5P A;  3VDD A;  1FPN 3;  5DDJ 2;  3ALQ A;  3LKJ A;  3OGV A;  4YG6 A;  1S2B A;  5KC5 A;  4CPB D;  4LHK A;  4R4X A;  2P17 A;  4PLN A;  4LO4 B;  5A1A A;  1IKQ A;  5SV8 A;  3GDB A;  5I0D A;  1POV 0;  1V6L A;  3IKW A;  4Z82 A;  5LWB A;  3J7L A;  2GND A;  2VUJ A;  3L9J T;  1RVF 3;  4A7K A;  1PO2 2;  1RUJ 3;  4WV8 A;  3I59 A;  4BM8 A;  5C9A B;  3PTR B;  2EIG A;  1LOB A;  1W6N A;  1NA1 B;  1WW4 A;  3NNM A;  4RHV 3;  5FZF A;  1JYT A;  3T2P A;  5LA2 A;  1W06 A;  5FPA A;  3EHK A;  2RMU 2;  3HR9 A;  4CEY B;  4QKB A;  1PMJ X;  4JHT A;  3J8F 3;  4ZON A;  2PHX A;  1NQJ A;  3AM2 A;  3K4Z A;  4Q4X 2;  3W59 A;  1JTZ X;  5T52 A;  3W9A A;  1RUI 3;  4D6S A;  1R08 2;  3DPR B;  4HL0 A;  2ZGM A;  4CUC A;  2JJ6 A;  4Q4W 3;  3IDB B;  1YXW A;  4AED C;  1EV1 2;  4B7K A;  4B7E A;  5LZ6 A;  1JBC A;  4EWD A;  1GZC A;  4V2V A;  2H6B A;  4BPZ A;  3H7J A;  4XCB A;  1E5S A;  4FP2 A;  5JUV A;  1YRZ A;  4NE9 A;  1K12 A;  1YFW A;  2BNM A;  1XNB A;  1VBE 2;  3CZU A;  3VHR A;  2A1X A;  2RS1 1;  3AYD A;  4JV4 A;  3ZXE A;  2ZJC A;  4O9G A;  4RR3 C;  2BPA 2;  3MBW A;  4ET7 A;  4A6O A;  1QF3 A;  2JWP A;  2VH9 A;  5EFU A;  4E8D A;  3I2I A;  4IL7 A;  1YQ8 A;  4IV3 C;  3VB9 A;  3QOP A;  1TMF 2;  2PLV 1;  2B8M A;  2LW8 A;  4Y24 A;  2UWA A;  4P9W A;  2RDS A;  3K3O A;  1R08 1;  2O8O A;  4UF0 B;  5JZG A;  3RZM A;  1B35 C;  1EUT A;  2ET7 A;  3B69 A;  2KXL A;  3H50 A;  1LAJ A;  4MHU A;  2DCT A;  4CA9 A;  2RDQ A;  2R07 1;  3CNA A;  1ZRF A;  2EID A;  4OQ9 A;  4N53 A;  4Q0U A;  1BZW A;  4RFT 0;  5A70 A;  3OUH A;  3MV0 1;  5JOZ A;  1QKQ A;  2WWS A;  3DEM A;  4CP9 B;  3UET A;  3MV1 1;  2DTY A;  2W39 A;  4W50 A;  4DB5 A;  1NUK A;  2ZGO A;  1J83 A;  3AYA A;  4AWD A;  3V0B B;  1Q3E A;  1UL9 A;  2UU8 A;  2XLG A;  2PEL A;  3LFM A;  2DCY A;  1GMM A;  4NHM A;  3CJI C;  4YM3 A;  4FOY A;  4URT A;  3VDD B;  2J1T A;  2ZX1 A;  3WUC A;  3H8O A;  1EYB A;  4GA9 A;  4XFH A;  2OUJ A;  3MIB A;  1OI6 A;  3JB4 C;  4MV2 A;  1J1T A;  5CFC B;  1HDK A;  5EZW A;  3I3B A;  2GMP A;  3KGZ A;  4W6X A;  5A3O A;  3NAP A;  2O8Q A;  5GLU A;  4MXV A;  4K1Z A;  2YC4 A;  4HKW A;  4MX3 A;  1U5I A;  1BVP 1;  1S55 A;  4EWA A;  4AGG A;  5L9R A;  4HXC A;  1PX4 A;  4HZF A;  2JEN A;  3J9S A;  5C3S A;  1QXP A;  1ZRI A;  1PO1 1;  2VOV A;  4DEV A;  1VB2 A;  2DCJ A;  3UKV A;  2ZHN A;  3LIG A;  1QXR A;  3IZO A;  2WNV A;  2BJS A;  2AH2 A;  2I45 A;  2L9L A;  4PIZ A;  1JYW A;  4KWU A;  1OMI A;  3RVH A;  3N36 A;  4LTA A;  4ORF A;  1SFP A;  2W52 A;  4YW4 A;  3ZOI A;  1HRI 2;  4GD4 A;  4AFD A;  2RS1 2;  1F5F A;  1JUH A;  1C8M 3;  1AL0 G;  4DRV A;  1J59 A;  4PBO A;  3IAQ A;  3I2D A;  1UYX A;  4M3C B;  2JG8 B;  1LJ7 A;  5HXV A;  3TN9 1;  2JD9 A;  1W0P A;  4O65 A;  3WG3 A;  3M7A A;  4AVV A;  1AJK A;  1YIP A;  3KVB A;  4PF5 A;  4WM8 C;  4EZ4 A;  3OEB A;  4BQX A;  1RUC 3;  3POB A;  4HBN A;  3VBR A;  3WR0 A;  1OSG A;  3ZN5 A;  4ZHN A;  3VBO C;  1M4W A;  2ZAA A;  1N1Y A;  5CFD A;  1JZ5 A;  1F2N A;  4ZXE A;  5LEJ A;  3ZIX A;  2X09 A;  4LE3 A;  1RVF 1;  1W05 A;  2Z4F A;  3BCW A;  3OB8 A;  2W1U A;  5FWE A;  3EQE A;  5FO8 B;  5JXJ A;  1ND2 B;  4BQ5 A;  1HB3 A;  1VBB 2;  3KT7 A;  3J26 N;  2LTN A;  1RIR A;  1QJX 2;  4AI0 A;  1S0E A;  1HQN A;  5AC9 2;  4NHL A;  2BTV C;  2P3I A;  2JKX A;  4OCT A;  1UOJ A;  5CKQ A;  2BNN A;  1AR6 3;  3MW3 A;  5F39 A;  4NPM A;  4RN5 A;  3LEM A;  4F3J A;  1QDO A;  2PFW A;  4IE0 A;  5A6Z A;  4AI3 A;  2Q1Z B;  1ULG A;  2HWB 2;  3OBT A;  4P5H A;  3IPV A;  2NMN A;  2XHN A;  5A6Y A;  1WME A;  4XUN A;  5K9Y A;  1KEX A;  2YPJ A;  2ZX4 A;  1RYY A;  4QQH A;  2QJV A;  2VW2 A;  3WNP A;  4HLT A;  4CCK A;  4QDQ A;  3BTA A;  2HWB 1;  2Y60 A;  3NJZ A;  1UY1 A;  3LPF A;  4PJY A;  3NAP B;  4L8Q A;  4AR2 A;  5J09 A;  2XON A;  4DEQ A;  2VUC A;  3POS A;  5EJ1 B;  2AAC A;  1C8N A;  5GLW A;  4Y22 A;  5FKB A;  4DRR A;  2F4P A;  5F37 A;  1PGS A;  4JQT A;  5C8C A;  1DP0 A;  2IWG B;  3EO6 A;  2X8K A;  4Q4Y 1;  2WO7 A;  2NN8 A;  4CVU A;  2P4E A;  2UUR A;  2HWC 1;  1AR7 1;  1ZZ9 A;  2BYV E;  2K46 A;  2OQ6 A;  4EN9 B;  3QCW A;  2ZEW A;  4LO6 B;  1TME 3;  4BXS V;  4GWM A;  4OHV A;  5FZO A;  1TG7 A;  3O0W A;  1JYV A;  4WZF A;  1Y9G A;  3VZM A;  1RTV A;  2JIJ A;  5A3L A;  4PLO A;  1QOO A;  5AFB A;  4LT5 A;  4PDW B;  3KQ4 B;  5IAX A;  2PYT A;  2HWD 2;  3Q8A A;  4AI1 A;  3PNA A;  5DZG A;  1RUG 2;  2XL9 A;  3LWC A;  4J1W A;  2BFU S;  2AGS A;  1JOP A;  2XUM A;  3IT8 A;  2YC0 A;  4CEY A;  3WG2 A;  4QXB A;  2YHJ A;  1CGP A;  4J6G A;  1IS5 A;  3M4F A;  1R1A 3;  1ULO A;  1YNA A;  4Q1P A;  1ND3 A;  4COY A;  3AP7 A;  1SLT A;  4XIO A;  2IVJ A;  3R4U A;  2Y64 A;  1ODN A;  1PM4 A;  5FV3 A;  1BQP A;  1TVG A;  2IVI B;  4HG6 B;  1RIT A;  2Q1M A;  4UW6 A;  2IXL A;  5KXD A;  4Y1U A;  3HNY M;  5DG2 A;  2WFF 1;  4HVR A;  4LBM A;  1AJO A;  3FN9 A;  1S0B A;  2JG8 A;  1F4A A;  3HN1 A;  2OPK A;  2VMF A;  4Q4X 1;  3FLT A;  3KQR A;  4GKX A;  5DUX A;  5FLJ A;  4XAC A;  5JVV A;  2P34 A;  1MVQ A;  3IAP A;  1CAU B;  1H8V A;  2RMU 3;  4UFM A;  4A42 A;  5BNN C;  2VTX J;  2PLV 2;  4FXG B;  4FPF A;  3ZYF A;  5FUN A;  2ZGR A;  1W9F A;  2Y6J A;  1YIF A;  4CXY A;  1Q43 A;  2FBE A;  5FK8 A;  1AXY A;  3AXD A;  1MS3 A;  5JR2 A;  2P37 A;  1V6J A;  1GOH A;  3C7G A;  4KU7 A;  3E5Q A;  2QDR A;  1OVP A;  1Z7S 2;  4IEQ A;  3O12 A;  1RUG 3;  4XFI A;  4XUO A;  4D6R A;  2VOK A;  4LOT A;  4GMP 0;  3A0K A;  3DCQ A;  5FDB A;  2OUH A;  1H1I A;  1DZT A;  2R0F A;  5FZE A;  2ORX A;  4FFH A;  4FPY A;  5I0U A;  3LA3 A;  2JE8 A;  2P2K A;  3VDC A;  4M0N A;  2VTX A;  2JDM A;  2PTM A;  4J25 A;  4D7T A;  2Y6H A;  5FJK A;  3T1M A;  3V65 A;  4LIV A;  3Q8B A;  1IPJ A;  1PZ7 A;  3VD3 A;  1NCQ B;  2HEW F;  2V5D A;  5CKM A;  1TEI A;  3P1I A;  1CZV A;  4HT1 T;  2R49 A;  5EJ3 A;  3U11 A; 
#chains in the Genus database with same CATH homology
 2V72 A;  2QBX A;  3A7Q A;  2YB7 A;  3HEI A;  2W3J A;  1CZT A;  4L0P A;  4GZ9 A;  4CU8 A;  3C7F A;  4XUP A;  4OMC A;  3K75 B;  2WO1 A;  1PMH X;  5CZK A;  3WF1 A;  4DUV A;  1P8J A;  3OEA A;  2YG0 A;  5IYY A;  5C70 A;  3K46 A;  5IFT A;  2VQU A;  1W9S A;  1JZ6 A;  3A23 A;  2VO5 A;  1JYX A;  3CDZ B;  3NNG A;  4E8C A;  5F7U A;  4MGQ A;  4QDR A;  4QPW A;  4CUA A;  2QQN A;  4XZU G;  2QQO A;  1MPX A;  1W99 A;  3NRU A;  5EJZ B;  4D8M A;  3C8X A;  3IB3 A;  5JXI A;  2YFU A;  3ACH A;  1US3 A;  2ID4 A;  2X10 A;  1UY3 A;  4RYD A;  3C7H A;  4JHZ A;  5LA1 A;  3IDA A;  4A44 A;  2DDU A;  4PT6 A;  1JZ2 A;  2LS6 A;  3WNK A;  3EYP A;  3FL7 A;  3AC0 A;  4ZZ5 A;  2XQX A;  3OGR A;  2W9X A;  4BDV B;  3CIH A;  2VOT A;  1UMI A;  5DN2 A;  2QQJ A;  1UYY A;  3OGS A;  3III A;  3UNP A;  2ZEX A;  4DXT A;  3D3A A;  3WNN A;  5DQ0 A;  1UY2 A;  4LPL A;  2QQI A;  1JZ4 A;  3DYP A;  2WAB A;  2E33 A;  3MUY 1;  3ETP A;  3DYO A;  4QDS A;  5G04 L;  1HN1 A;  2J1V A;  2W1Q A;  1D7P M;  1XC6 A;  3WNO A;  2JDA A;  2J1U A;  4P02 B;  4XUT A;  1XNT A;  4OUE A;  3WF2 A;  4CU6 A;  5JXH A;  3SKJ E;  1CIY A;  4QB2 A;  1UY4 A;  2VZQ A;  1US2 A;  3BGA A;  4CU9 A;  2EIC A;  3F2Z A;  3MO4 A;  2VCA A;  4A4A A;  2WN3 A;  3C7E A;  3LEI A;  3WF0 A;  2C26 A;  2WYS A;  1K45 A;  2VMC A;  3VD4 A;  1GU3 A;  3LPG A;  4KI5 M;  2VZP A;  4TTG A;  4JKM A;  3P6B A;  1PX3 A;  2XOM A;  4JX0 A;  5JMO A;  1OF4 A;  1L7R A;  4A3Z A;  5LCW L;  1W9W A;  1CZS A;  1XNA A;  2RVA A;  3K4D A;  4ARX A;  5HPO A;  4OZO A;  4DUX A;  1O59 A;  2WZ8 A;  3ABZ A;  1GNY A;  3LEK A;  2BZD A;  4UAP A;  3T0D A;  3W5M A;  2VCB A;  1JHJ A;  1OT5 A;  3SEE A;  4LKS A;  1NAE A;  3CZJ A;  3T0B A;  5LA0 A;  1UXZ A;  5B4N A;  3VD7 A;  3I97 A;  3WNL A;  2WO2 A;  3I2K A;  2Y6L A;  4UI9 L;  3SEP A;  3VD5 A;  3K77 A;  2EIB A;  1JU4 A;  2E31 A;  2WQ8 A;  4DXR A;  3I2G A;  4A45 A;  2Y6K A;  5C71 A;  4QX3 A;  3OG2 A;  4W8J A;  3PUI A;  1JYN A;  1I5P A;  4LHS A;  4QB6 A;  3OGV A;  3GXU A;  5G05 L;  3JXS A;  2VR4 A;  3WEZ A;  2B4K A;  5A1A A;  3GDB A;  2VQT A;  2VZV A;  5I0D A;  4PQQ A;  2QQM A;  3ECQ A;  1OH4 A;  4CU7 A;  2WAA A;  2J1A A;  4FI9 A;  1UWW A;  3FHA A;  1JI6 A;  5LA2 A;  3T2P A;  4P00 B;  4M4P A;  4D0Q A;  4TXW A;  1PMJ X;  3MUZ 1;  5J1X A;  2Y6G A;  4P5Y A;  3K4Z A;  1O8S A;  2VZ3 A;  1XPW A;  4CUC A;  1ULP A;  4QAW A;  3I2J A;  5JUV A;  4A41 A;  1GQP A;  1K12 A;  2HYX A;  3CZU A;  1UMH A;  1UZ0 A;  2BGP A;  1GOF A;  2RV9 A;  2HLE A;  3MBW A;  4ET7 A;  4A6O A;  2X05 A;  4E8D A;  1BHG A;  3I2I A;  2CDO A;  4QX1 A;  1T2X A;  3THC A;  2RJ2 A;  3HJR A;  1YQ2 A;  2LW8 A;  4GWI A;  1J84 A;  4DXS A;  1EUT A;  4KMQ A;  3T2O A;  2WO3 A;  1JZ8 A;  1K3I A;  3CQO A;  2EID A;  3HOB A;  3ACI A;  5IFP A;  2J1R A;  3MV0 1;  1UXX X;  1W8O A;  2V4V A;  3GM8 A;  3UET A;  3MV1 1;  2VCC A;  2B9V A;  4W50 A;  2OKX A;  3E1F 1;  1NUK A;  1J83 A;  2Y8K A;  1JZ3 A;  1JZ7 A;  4OMD A;  3ACF A;  2ZEZ A;  3T2Q A;  1O8P A;  2VMD A;  3DEC A;  1DLC A;  1JU3 A;  1GMM A;  1NX9 A;  3W5N A;  1CX1 A;  2J1T A;  3LEG A;  4XUQ A;  4AAX A;  5DMY A;  2WUH A;  5IJR A;  2C9K A;  5FUI A;  3I3B A;  1WKY A;  3UES A;  3LQC A;  2YC4 A;  4Z2A A;  3SKV A;  2WDB A;  2VZU A;  2J1S A;  1PX4 A;  5EIY B;  3WNM A;  2KD7 A;  4OYU A;  2YFZ A;  2CDP A;  1LNS A;  1WCQ A;  2C4X A;  3HPN A;  3I2H A;  4DEV A;  2DCJ A;  2QQL A;  5B4X A;  1UX7 A;  2E26 A;  3EB7 A;  4XUR A;  3WQB A;  5C7G A;  3T0A A;  2L9L A;  4MO3 M;  4UOJ A;  1JYW A;  4KWU A;  2W5F A;  3NJV A;  3U37 A;  3I3E A;  1H6Y A;  3IAQ A;  1UYX A;  2VZO A;  1GUI A;  2JD9 A;  3VD9 A;  3OEB A;  4MAD A;  4MOA A;  3WF3 A;  1JZ5 A;  4ZXE A;  1SHW B;  2X09 A;  1UYZ A;  3HNM A;  3OB8 A;  2Z4F A;  3VDA A;  2W1U A;  4JKL A;  5JXJ A;  2DCK A;  1R64 A;  4MGS A;  2W92 A;  3OBA A;  2JKX A;  1SDD B;  5IHR A;  4RN5 A;  4QX2 A;  2EIE A;  4XVH A;  2YC2 A;  3ZM8 A;  3WF4 A;  2XHN A;  2W95 A;  4XUN A;  5DPN A;  1KEX A;  3LE0 A;  1RYY A;  4W4Z A;  3FHQ A;  3WNP A;  4QDQ A;  4YPJ A;  3PUH A;  3K4A A;  1UY1 A;  3LPF A;  4BK5 A;  1L7Q A;  2W1S A;  2PQS A;  2VJX A;  2XON A;  4DEQ A;  5EJ1 B;  3C7O A;  4PF1 A;  1DYO A;  1W8N A;  1DP0 A;  3VDB A;  2WZE A;  4CVU A;  1SG3 A;  2VZS A;  1F4H A;  4ZZ8 A;  2ZEW A;  2E32 A;  2VZR A;  2VME A;  2WN2 A;  3A21 A;  4BXS V;  1JYV A;  1TG7 A;  1KGY A;  4ZY9 A;  3T09 A;  4ARY A;  3I2F A;  3HNB M;  3T08 A;  1H6X A;  2WAO A;  2W1W A;  2J7M A;  2ZXQ A;  5HXM A;  2VM9 A;  4QB1 A;  1W9T A;  3WSO A;  2J22 A;  1ULO A;  4QX0 A;  3CKH A;  4BJ0 A;  1OF3 A;  1W0N A;  2VTF A;  3I3D A;  1K42 A;  3A22 A;  4JKK A;  2BER A;  2BGO A;  2Y64 A;  3THD A;  4AG4 A;  2BBA A;  5CYY A;  1TVG A;  2R7E B;  3BN6 A;  1EUU A;  2ORZ A;  4HG6 B;  4IUG A;  3GGL A;  3HNY M;  2QQK A;  3FN9 A;  1F4A A;  2ZEY A;  4DUW A;  2VMF A;  3CMG A;  3NQH A;  4BK4 A;  3IAP A;  1UY0 A;  4CUB A;  2VZ1 A;  4A42 A;  3ACG A;  1IQD C;  2VC9 A;  3HN3 A;  2J1E A;  2W91 A;  2Y6J A;  2W87 A;  2WBK A;  5JR2 A;  1GOG A;  3NJX A;  1GOH A;  3C7G A;  5JXG A;  4XUO A;  4M4R A;  2W47 A;  2VL4 A;  2W46 A;  4P08 A;  1OD3 A;  3VDC A;  2ORX A;  2W94 A;  2JE8 A;  2VZT A;  4LQR A;  1NKG A;  3J7H A;  2Y6H A;  3VD3 A;  3DYM A;  2V5D A;  3P1I A;  1CZV A;  4GWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...