3LELB

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelB00
1P3MB 5B24C 1F66A 4XUJD 5B32C 3AFAB 5G49A 3O62C 3AZKC 4XZQC 3X1UA 3VH5A 3AZFA 1EQZB 2NQBA 5AV9B 3R45A 3X1SC 4WZSB 1M19C 4Z2MH 3AZNA 1P34A 5B1MA 3REKA 1P3OB 5AV5B 4J8XB 4ZBJC 3AZMB 4G91C 4H9RA 3REIB 4ZUXB 3C1CC 5AV6A 1R4VA 5B2IB 3MNNA 5GXQB 1M1AD 3LELB 4YM6B 1AOIC 5F99C 4JJNA 4WNNA 3LZ1B 2YFVB 5JA4B 5GT3C 4X23D 1P3MD 3VH6T 3WAAB 3MGPB 5CPKC 3B6GA 3AFAD 4CSRB 1P3AA 5B0ZB 5B40A 4J8UC 5B33B 3UTAB 1EQZD 5AV9D 1F66C 2L5AA 4DRAA 2BYKB 5B0YA 3X1VB 1P3OD 4KHAA 5AV5D 3X1UC 4J8XD 3AZFC 2NQBC 3AZMD 3AYWB 3REID 1P3PA 4ZUXD 5E5AA 1M18B 5B2ID 1ID3A 5GXQD 5B1MC 3V9RB 5DNNC 4UUZA 5B31B 3LELD 4YM6D 3REJA 3B6FB 1KX3A 3LZ1D 3MGQA 4J8WB 1BH8B 5AV6C 1S32A 5BNVA 3REHB 2F8NG 3MGPD 3AZHA 3WAAD 1JFIA 3WA9A 5B0ZD 1B67A 1KX4B 5B33D 3UTAD 4JJNC 3W97B 3MGSA 3AZJB 3KUYB 3AV2A 3MGRA 5BS7A 3AZIB 4NE3A 4H9NB 1P3FA 2PYOA 1HQ3B 5CPIA 1P3GB 1P3KB 3X1VD 5B40C 2FJ7A 4CAYA 1TZYC 3UTBA 3AYWD 1N1JB 4YS3B 1M18D 3W98B 5B0YC 3KWQB 3RELB 5BT1C 5CP6B 3AN2B 5GSUB 5B31D 2CV5A 3B6FD 5B1LB 5BO0B 5B2JB 2F8NA 4J8WD 5E5AC 3C1BB 3REHD 4Z66B 2HIOB 4AWLC 5KDMB 3LJAC 3TU4A 3REJC 3KXBB 1KX4D 5AV8C 3W97D 2YFWA 3MGQC 3AZJD 3W99A 3KUYD 4XZQB 1S32C 4KGCB 3AZHC 3AZID 4Z5TC 1HQ3D 1P3GD 1P3IA 1P3KD 4H9PB 4R8PA 3VH6W 4G92C 4YS3D 5DNMB 3AV2C 4ZBJB 5BS7C 3W98D 1P3FC 2PYOC 5CPIC 3KWQD 3RELD 5CP6D 3AZGB 3AN2D 5GSUD 5AY8B 2FJ7C 1ZLAA 3NQUA 5B1LD 5B2JD 4QLCB 1KX5A 3LZ0A 1H3OB 3C1BD 4Z66D 5CPJA 2HIOD 5GT3B 3MVDA 2CV5C 4NE6A 3KXBD 5CPKB 4WU9A 2NZDB 4EO5B 3AV1B 4J8UB 4XZQD 4KGCD 3W96B 1U35B 3UT9A 3TU4C 3VH5T 4XUJA 5DNMD 5C3IC 3AZFB 1P3IC 5AVCC 3AZGD 2RVQC 5AY8D 4QLCD 5DNNB 2IO5C 1ULYA 5JRGB 1P3LC 5GT3D 4H9SA 5CPKD 1ZLAC 1KX5C 1TAFB 4J8VB 2AROC 3B0CT 2NZDD 2CWEA 3LZ0C 5GT0C 3AV1D 4J8UD 5BNXA 3W96D 5CPJC 1U35D 1A7WA 1M1AA 3MVDC 3NQJA 4WU9C 4H9QB 4HGAB 4X23A 1P3MA 3AZLB 3WTPC 4WV4B 4NFTA 2F8NH 1TZYB 3AZFD 3AFAA 1P3BC 4NE5A 3AZEB 1EQZA 5AV9A 5DNND 4XUJC 5JRGD 3X1TB 1P3OA 5AV5A 5AVBB 4J8XA 4J8VD 3REIA 3LJAB 4ZUXA 3REJB 4WU8B 2HUEB 5B2IA 5AV8B 3MGQB 3AZNC 5GXQA 4H9SC 1P34C 3REKC 5BNVB 4YM6A 3LZ1A 4Z5TB 2YFVA 5JA4A 5B31G 3B0BA 3B0DC 3AZLD 3WAAA 3MGPA 3MNNC 1TZYD 4CSRA 5B0ZA 4LD9B 5B33A 3AZED 5CPIB 5FUGB 1P3MC 3KSYA 2BYKA 3WKJB 3B6GC 3X1TD 3A6NB 3X1VA 3VH5W 1P3AC 5AVBD 4KUDB 5AV9C 3AYWA 3LJAD 3REJD 4H9OB 4WU8D 1M18A 5AV8D 3MGQD 3V9RA 5B31A 3B6FA 1BH9B 2JSSA 5AV5C 4J8XC 4Z5TD 1P3PC 4J8WA 4ZUXC 3REHA 1ID3C 5GXQC 5B24B 3B0CW 4LD9D 5B32B 4YM6C 1KX4A 3W97A 3LZ1C 1KX3C 5CPID 5AVCB 3AZJA 3KUYA 2BYMB 3O62B 3AZKB 3WKJD 1HQ3A 3A6ND 1P3KA 2IO5B 5B0ZC 3X1SB 3WA9C 5B33C 1M19B 1P3LB 4KUDD 4X23B 3MGSC 1WWSA 4YS3A 3W98A 3MGRC 2AROB 4G91B 3KWQA 3RELA 5CP6A 5GT0B 3X1VC 3C1CB 5B1LA 3AYWC 3UTBC 1M18C 3C1BA 1AOIB 5F99B 4Z66A 2HIOA 5KDMA 3WTPB 5B24D 5B31C 3B6FC 3KXBA 5B32D 1P3BB 5AVCD 4J8WC 4XZQA 3REHC 3O62D 3AZKD 4KGCA 1F66B 3X1SD 4H9PA 1M19D 1P3LD 5G49B 3KUYC 3W99C 5DNMA 1B6WA 3X1UB 2AROD 2NQBB 3R45B 5GT0D 3AZGA 3C1CD 5AY8A 4R8PC 4QLCA 3AZNB 1P34B 5B1MB 3REKB 1H3OA 4DRBA 4YS3C 1AOID 5F99D 3W98C 5GT3A 4H9RB 3KWQC 3WTPD 5AV6B 5CPKA 3MNNB 2NZDA 1P3BD 3AV1A 4J8UA 3C1BC 3W96A 4WNNB 2HIOC 4JJNB 1U35A 1F66D 3KXBC 3B6GB 1P3AB 5B40B 4KGCC 3X1UD 2NQBD 3UT9C 1BFMA 5B0YB 3AZND 1P34D 5B1MD 5DNNA 3REKD 5DNMC 4KHAB 5JRGA 1P3PB 3AZGC 5AV6D 5AY8C 5E5AB 1ID3B 3MNND 1TAFA 4QLCC 4J8VA 4AWLB 3AZMA 1Q9CA 4UUZB 1WWIA 4JJND 1KX3B 1S32B 3LELA 4H9QA 3AZHB 1JFIB 2NZDC 3B6GD 4EO5C 1P3AD 3AV1C 3AZLA 3WA9B 5B40D 4E44A 1TZYA 4M6BA 3W96C 3MGSB 1U35C 1M1AC 4G92B 3VH6A 3AV2B 4Z2MG 3MGRB 3UTAA 3AZEA 5B0YD 1P3FB 2PYOB 4X23C 5BT1D 2FJ7B 4CAYB 3AFAC 3X1TA 3UTBB 1P3PD 5E5AD 5AVBA 1ID3D 1HTAA 1EQZC 3LJAA 1F1EA 4WU8A 2CV5B 5AV8A 5JRGC 1KX3D 2F8NB 1P3OC 1S32D 3AZHD 4Z5TA 4J8VC 3AZMC 3REIC 3WA9D 3TU4B 1BH8A 5B2IC 2YFWB 3MGSD 4LD9A 3W99B 3LELC 3AV2D 5C3IB 3MGRD 4HGAC 5B32G 1P3FD 5FUGA 1P3IB 2PYOD 3AZLC 3WAAC 4R8PB 3MGPC 2FJ7D 3WKJA 3AZIA 4H9NA 3A6NA 3UTBD 1P3GA 3UTAC 3AZEC 4KUDA 1N1JA 4H9OA 2CV5D 1ZLAB 3NQUB 1KU5A 1KX5B 3X1TC 2F8ND 3LZ0B 3AN2A 1BH9A 5GSUA 5AVBC 5BO0A 5B2JA 5CPJB 3MVDB 4WU8C 2HUEC 5CHLB 3TU4D 4WU9B 5B24A 3W99D 5B32A 5AVCA 1P3ID 2BYMA 3UT9B 2RVQD 3O62A 3AZKA 4R8PD 2F8NK 3X1SA 4LD9C 4XUJB 1M19A 2LY8A 1KX4C 1P3LA 3W97C 3AZJC 4E45A 1ZLAD 3WKJC 2AROA 3AZIC 1KX5D 3A6NC 1HQ3C 5GT0A 3LZ0D 1P3GC 3C1CA 1P3KC 4KUDC 5CPJD 3MVDD 1AOIA 5F99A 4WU9D 3B0DB 3RELC 5CP6C 3WTPA 3AN2C 5BNXB 5GSUC 5B1LC 5B2JC 1P3BA 1M1AB 3UT9D 3NQJB 4Z66C 3WTPE
chains in the Genus database with same CATH superfamily
1P3MB 5B24C 1F66A 4XUJD 5B32C 3AFAB 5G49A 3O62C 3AZKC 4XZQC 2Y2GA 3X1UA 3VH5A 3AZFA 1EQZB 2NQBA 5AV9B 2Y2LA 3R45A 3X1SC 4WZSB 1M19C 4Z2MH 2G5HC 3AZNA 1P34A 5B1MA 3REKA 1P3OB 5AV5B 4J8XB 4ZBJC 3AZMB 4G91C 4H9RA 3REIB 4ZUXB 3C1CC 5AV6A 1R4VA 5B2IB 3MNNA 5GXQB 1M1AD 3LELB 4YM6B 2XD1A 1AOIC 5F99C 4JJNA 4WNNA 3LZ1B 2YFVB 5JA4B 5GT3C 4X23D 1P3MD 3VH6T 3WAAB 3MGPB 5CPKC 3B6GA 3AFAD 4CSRB 1P3AA 5B0ZB 5B40A 4J8UC 5B33B 3UTAB 1EQZD 5AV9D 1F66C 2L5AA 4DRAA 2BYKB 5B0YA 3X1VB 1P3OD 4KHAA 5AV5D 3X1UC 4J8XD 3AZFC 2NQBC 3AZMD 3AYWB 3REID 1P3PA 3A1IA 4ZUXD 5E5AA 1M18B 5B2ID 1ID3A 5GXQD 5B1MC 3V9RB 5DNNC 4UUZA 5B31B 3LELD 4YM6D 3EPKA 3REJA 3B6FB 1KX3A 3LZ1D 3MGQA 4J8WB 1BH8B 5AV6C 1S32A 5BNVA 3REHB 2F8NG 3MGPD 3AZHA 3WAAD 1JFIA 3WA9A 5B0ZD 1B67A 1KX4B 5B33D 3UTAD 4JJNC 3W97B 3MGSA 2FFFB 3AZJB 3KUYB 1PZRA 3AV2A 3MGRA 5BS7A 3AZIB 4NE3A 4H9NB 1P3FA 2PYOA 1HQ3B 5CPIA 1P3GB 1P3KB 3X1VD 5B40C 2FJ7A 4CAYA 1TZYC 2BG1A 3UTBA 3AYWD 1N1JB 4YS3B 1M18D 3IP4C 3W98B 5B0YC 3KWQB 3RELB 5BT1C 5CP6B 3AN2B 5GSUB 5B31D 2CV5A 3B6FD 5B1LB 5BO0B 5B2JB 2F8NA 4J8WD 5E5AC 3C1BB 3REHD 4Z66B 2HIOB 4AWLC 5KDMB 3LJAC 3TU4A 3REJC 3KXBB 1KX4D 3KFUG 5AV8C 3W97D 2YFWA 3MGQC 3AZJD 3W99A 3KUYD 4XZQB 1S32C 4KGCB 3AZHC 3H0LC 3AZID 4Z5TC 1HQ3D 1P3GD 1P3IA 2Y2OA 1P3KD 4H9PB 4R8PA 3VH6W 2F2AC 4G92C 4YS3D 5DNMB 3AV2C 4ZBJB 5BS7C 3W98D 1P3FC 2PYOC 5CPIC 3KWQD 3RELD 5CP6D 3AZGB 3AN2D 5GSUD 5AY8B 2FJ7C 1ZLAA 3NQUA 5B1LD 5B2JD 4QLCB 1KX5A 3LZ0A 1H3OB 3C1BD 4Z66D 5CPJA 2HIOD 5GT3B 3MVDA 2CV5C 4NE6A 3KXBD 5CPKB 4WU9A 2DQNC 2NZDB 4EO5B 3AV1B 4J8UB 4XZQD 2Y2MA 4KGCD 3W96B 1U35B 3UT9A 3TU4C 3VH5T 4XUJA 5DNMD 5C3IC 3AZFB 2Y2JA 1P3IC 5AVCC 2ZY5A 3AZGD 2RVQC 5AY8D 2W8SA 4QLCD 5DNNB 2IO5C 1ULYA 5JRGB 1P3LC 5GT3D 4H9SA 5CPKD 1ZLAC 1KX5C 1TAFB 2Y2IA 2AROC 3B0CT 4J8VB 2NZDD 2CWEA 3LZ0C 5GT0C 3AV1D 4J8UD 5BNXA 3W96D 5CPJC 1U35D 1A7WA 1M1AA 3MVDC 3NQJA 2UWXA 4WU9C 4H9QB 4HGAB 4X23A 1P3MA 3AZLB 3WTPC 4WV4B 4NFTA 2F8NH 1TZYB 4WJ3C 3AZFD 3AFAA 1P3BC 2ZY2A 4NE5A 3AZEB 1EQZA 5AV9A 5DNND 4XUJC 5JRGD 3X1TB 1P3OA 5AV5A 5AVBB 4J8XA 4J8VD 3REIA 3LJAB 4ZUXA 3REJB 4WU8B 2HUEB 5B2IA 5AV8B 3MGQB 3AZNC 5GXQA 4H9SC 1P34C 3REKC 5BNVB 3EG5B 4YM6A 3LZ1A 4Z5TB 2YFVA 5JA4A 5B31G 3B0BA 3B0DC 3AZLD 3WAAA 3MGPA 3MNNC 1TZYD 4CSRA 5B0ZA 4LD9B 5B33A 3AZED 5CPIB 5FUGB 1P3MC 2Y2NA 3KSYA 2BYKA 3WKJB 3B6GC 3X1TD 3A6NB 3X1VA 3VH5W 1P3AC 5AVBD 4KUDB 5AV9C 4UPKA 3AYWA 3LJAD 3REJD 4H9OB 4WU8D 3EPLA 1M18A 5AV8D 2ZY4A 3MGQD 3V9RA 5B31A 3B6FA 1BH9B 2JSSA 5AV5C 4J8XC 4Z5TD 1P3PC 4J8WA 4ZUXC 3REHA 1ID3C 5GXQC 5B24B 3B0CW 4LD9D 5B32B 4YM6C 1KX4A 3W97A 3LZ1C 1KX3C 5CPID 5AVCB 3AZJA 3KUYA 2BYMB 3O62B 3AZKB 3WKJD 1HQ3A 3A6ND 1P3KA 2IO5B 5B0ZC 3X1SB 3WA9C 5B33C 1M19B 1P3LB 3AL0C 4KUDD 4X23B 3MGSC 1WWSA 4YS3A 2J8PA 3W98A 3MGRC 2AROB 4G91B 3KWQA 3RELA 5CP6A 5GT0B 3X1VC 3C1CB 5B1LA 3AYWC 3UTBC 1M18C 3C1BA 1AOIB 5F99B 4Z66A 4DQYB 2HIOA 5KDMA 3WTPB 5B24D 5B31C 3B6FC 3KXBA 5B32D 1P3BB 5AVCD 4J8WC 4XZQA 3REHC 3O62D 3AZKD 4KGCA 1F66B 3X1SD 4H9PA 1M19D 1P3LD 5G49B 3EPJA 3KUYC 3W99C 5DNMA 1B6WA 3X1UB 2AROD 2NQBB 3R45B 5GT0D 3AZGA 3C1CD 5AY8A 4R8PC 4QLCA 3AZNB 1P34B 5B1MB 3REKB 1H3OA 4DRBA 4YS3C 1AOID 5F99D 3W98C 5GT3A 4H9RB 3KWQC 3WTPD 5AV6B 5CPKA 3MNNB 2NZDA 1P3BD 3AV1A 4J8UA 3H0RC 3C1BC 3W96A 4WNNB 2HIOC 2ZM5A 4JJNB 1U35A 1F66D 3KXBC 2Y2PA 3B6GB 1P3AB 5B40B 4KGCC 3X1UD 2NQBD 3UT9C 1BFMA 5B0YB 3AZND 3FDDA 1P34D 5B1MD 2Y2QA 5DNNA 3REKD 5DNMC 4KHAB 5JRGA 1P3PB 3AZGC 5AV6D 5AY8C 5E5AB 1ID3B 3MNND 1TAFA 4QLCC 4J8VA 4AWLB 3AZMA 1Q9CA 4UUZB 3F6TA 1WWIA 4JJND 1KX3B 1S32B 3LELA 4H9QA 3AZHB 1JFIB 2NZDC 2G5IC 4EO5C 3B6GD 1P3AD 3AV1C 3AZLA 3WA9B 5B40D 4E44A 1TZYA 4M6BA 3W96C 3MGSB 1U35C 1M1AC 4G92B 2JCHA 3VH6A 3AV2B 4Z2MG 3MGRB 3UTAA 3AZEA 5B0YD 1P3FB 2PYOB 4X23C 5BT1D 2FJ7B 4CAYB 3AFAC 3X1TA 3UTBB 1P3PD 5E5AD 5AVBA 1ID3D 1HTAA 1W2EA 1EQZC 3LJAA 1F1EA 4WU8A 2CV5B 5AV8A 5JRGC 1KX3D 2F8NB 2RIQA 1P3OC 1S32D 3AZHD 4Z5TA 4J8VC 3AZMC 3REIC 3WA9D 3TU4B 1BH8A 5B2IC 2YFWB 3MGSD 4LD9A 3W99B 3LELC 3AV2D 5C3IB 3MGRD 4HGAC 5B32G 1P3FD 5FUGA 1P3IB 2PYOD 3AZLC 3P5JB 3WAAC 4R8PB 3MGPC 2FJ7D 3WKJA 3AZIA 4H9NA 3A6NA 3UTBD 1P3GA 2ZY3A 3UTAC 3AZEC 4KUDA 3A1KA 1N1JA 4H9OA 2CV5D 1ZLAB 3NQUB 1KU5A 1KX5B 3X1TC 2F8ND 3LZ0B 3AN2A 1BH9A 5GSUA 5AVBC 5BO0A 2Y2KA 5B2JA 5CPJB 3MVDB 2DF4C 4WU8C 2HUEC 5CHLB 3TU4D 2XD5A 4WU9B 3EPHA 5B24A 3W99D 5B32A 5AVCA 1P3ID 2BYMA 3UT9B 2RVQD 3O62A 3AZKA 4R8PD 2F8NK 3X1SA 4LD9C 4XUJB 2Y2HA 2LY8A 1M19A 1KX4C 1P3LA 3W97C 3AZJC 4E45A 1ZLAD 3WKJC 2AROA 3AZIC 1KX5D 3A6NC 1HQ3C 5GT0A 3LZ0D 1P3GC 3C1CA 1P3KC 2VQRA 4KUDC 5CPJD 1Z2CB 3MVDD 1AOIA 5F99A 4WU9D 3H0MC 3B0DB 3RELC 5CP6C 3WTPA 3AN2C 5BNXB 5GSUC 1T3UA 2JE5A 5B1LC 5B2JC 1P3BA 1M1AB 3UT9D 3NQJB 4Z66C 3WTPE
chains in the Genus database with same CATH topology
1P3MB 5B24C 1F66A 4XUJD 5B32C 3AFAB 5G49A 3O62C 3AZKC 4XZQC 2Y2GA 3X1UA 3VH5A 3AZFA 1EQZB 2NQBA 5AV9B 2Y2LA 3R45A 3X1SC 4WZSB 1M19C 4Z2MH 2G5HC 3AZNA 1P34A 5B1MA 3REKA 1P3OB 5AV5B 4J8XB 4ZBJC 3AZMB 4G91C 4H9RA 3REIB 4ZUXB 3C1CC 5AV6A 1R4VA 5B2IB 3MNNA 5GXQB 1M1AD 3LELB 4YM6B 2XD1A 1AOIC 5F99C 4JJNA 4WNNA 3LZ1B 2YFVB 5JA4B 5GT3C 4X23D 1P3MD 3VH6T 3WAAB 3MGPB 5CPKC 3B6GA 3AFAD 4CSRB 1P3AA 5B0ZB 5B40A 4J8UC 5B33B 3UTAB 1EQZD 5AV9D 1F66C 2L5AA 4DRAA 2BYKB 5B0YA 3X1VB 1P3OD 4KHAA 5AV5D 3X1UC 4J8XD 3AZFC 2NQBC 3AZMD 3AYWB 3REID 1P3PA 3A1IA 4ZUXD 5E5AA 1M18B 5B2ID 1ID3A 5GXQD 5B1MC 3V9RB 5DNNC 4UUZA 5B31B 3LELD 4YM6D 3EPKA 3REJA 3B6FB 1KX3A 3LZ1D 3MGQA 4J8WB 1BH8B 5AV6C 1S32A 5BNVA 3REHB 2F8NG 3MGPD 3AZHA 3WAAD 1JFIA 3WA9A 5B0ZD 1B67A 1KX4B 5B33D 3UTAD 4JJNC 3W97B 3MGSA 2FFFB 3AZJB 3KUYB 1PZRA 3AV2A 3MGRA 5BS7A 3AZIB 4NE3A 4H9NB 1P3FA 2PYOA 1HQ3B 5CPIA 1P3GB 1P3KB 3X1VD 5B40C 2FJ7A 4CAYA 1TZYC 2BG1A 3UTBA 3AYWD 1N1JB 4YS3B 1M18D 3IP4C 3W98B 5B0YC 3KWQB 3RELB 5BT1C 5CP6B 3AN2B 5GSUB 5B31D 2CV5A 3B6FD 5B1LB 5BO0B 5B2JB 2F8NA 4J8WD 5E5AC 3C1BB 3REHD 4Z66B 2HIOB 4AWLC 5KDMB 3LJAC 3TU4A 3REJC 3KXBB 1KX4D 3KFUG 5AV8C 3W97D 2YFWA 3MGQC 3AZJD 3W99A 3KUYD 4XZQB 1S32C 4KGCB 3AZHC 3H0LC 3AZID 4Z5TC 1HQ3D 1P3GD 1P3IA 2Y2OA 1P3KD 4H9PB 4R8PA 3VH6W 2F2AC 4G92C 4YS3D 5DNMB 3AV2C 4ZBJB 5BS7C 3W98D 1P3FC 2PYOC 5CPIC 3KWQD 3RELD 5CP6D 3AZGB 3AN2D 5GSUD 5AY8B 2FJ7C 1ZLAA 3NQUA 5B1LD 5B2JD 4QLCB 1KX5A 3LZ0A 1H3OB 3C1BD 4Z66D 5CPJA 2HIOD 5GT3B 3MVDA 2CV5C 4NE6A 3KXBD 5CPKB 4WU9A 2DQNC 2NZDB 4EO5B 3AV1B 4J8UB 4XZQD 2Y2MA 4KGCD 3W96B 1U35B 3UT9A 3TU4C 3VH5T 4XUJA 5DNMD 5C3IC 3AZFB 2Y2JA 1P3IC 5AVCC 2ZY5A 3AZGD 2RVQC 5AY8D 2W8SA 4QLCD 5DNNB 2IO5C 1ULYA 5JRGB 1P3LC 5GT3D 4H9SA 5CPKD 1ZLAC 1KX5C 1TAFB 2Y2IA 2AROC 3B0CT 4J8VB 2NZDD 2CWEA 3LZ0C 5GT0C 3AV1D 4J8UD 5BNXA 3W96D 5CPJC 1U35D 1A7WA 1M1AA 3MVDC 3NQJA 2UWXA 4WU9C 4H9QB 4HGAB 4X23A 1P3MA 3AZLB 3WTPC 4WV4B 4NFTA 2F8NH 1TZYB 4WJ3C 3AZFD 3AFAA 1P3BC 2ZY2A 4NE5A 3AZEB 1EQZA 5AV9A 5DNND 4XUJC 5JRGD 3X1TB 1P3OA 5AV5A 5AVBB 4J8XA 4J8VD 3REIA 3LJAB 4ZUXA 3REJB 4WU8B 2HUEB 5B2IA 5AV8B 3MGQB 3AZNC 5GXQA 4H9SC 1P34C 3REKC 5BNVB 3EG5B 4YM6A 3LZ1A 4Z5TB 2YFVA 5JA4A 5B31G 3B0BA 3B0DC 3AZLD 3WAAA 3MGPA 3MNNC 1TZYD 4CSRA 5B0ZA 4LD9B 5B33A 3AZED 5CPIB 5FUGB 1P3MC 2Y2NA 3KSYA 2BYKA 3WKJB 3B6GC 3X1TD 3A6NB 3X1VA 3VH5W 1P3AC 5AVBD 4KUDB 5AV9C 4UPKA 3AYWA 3LJAD 3REJD 4H9OB 4WU8D 3EPLA 1M18A 5AV8D 2ZY4A 3MGQD 3V9RA 5B31A 3B6FA 1BH9B 2JSSA 5AV5C 4J8XC 4Z5TD 1P3PC 4J8WA 4ZUXC 3REHA 1ID3C 5GXQC 5B24B 3B0CW 4LD9D 5B32B 4YM6C 1KX4A 3W97A 3LZ1C 1KX3C 5CPID 5AVCB 3AZJA 3KUYA 2BYMB 3O62B 3AZKB 3WKJD 1HQ3A 3A6ND 1P3KA 2IO5B 5B0ZC 3X1SB 3WA9C 5B33C 1M19B 1P3LB 3AL0C 4KUDD 4X23B 3MGSC 1WWSA 4YS3A 2J8PA 3W98A 3MGRC 2AROB 4G91B 3KWQA 3RELA 5CP6A 5GT0B 3X1VC 3C1CB 5B1LA 3AYWC 3UTBC 1M18C 3C1BA 1AOIB 5F99B 4Z66A 4DQYB 2HIOA 5KDMA 3WTPB 5B24D 5B31C 3B6FC 3KXBA 5B32D 1P3BB 5AVCD 4J8WC 4XZQA 3REHC 3O62D 3AZKD 4KGCA 1F66B 3X1SD 4H9PA 1M19D 1P3LD 5G49B 3EPJA 3KUYC 3W99C 5DNMA 1B6WA 3X1UB 2AROD 2NQBB 3R45B 5GT0D 3AZGA 3C1CD 5AY8A 4R8PC 4QLCA 3AZNB 1P34B 5B1MB 3REKB 1H3OA 4DRBA 4YS3C 1AOID 5F99D 3W98C 5GT3A 4H9RB 3KWQC 3WTPD 5AV6B 5CPKA 3MNNB 2NZDA 1P3BD 3AV1A 4J8UA 3H0RC 3C1BC 3W96A 4WNNB 2HIOC 2ZM5A 4JJNB 1U35A 1F66D 3KXBC 2Y2PA 3B6GB 1P3AB 5B40B 4KGCC 3X1UD 2NQBD 3UT9C 1BFMA 5B0YB 3AZND 3FDDA 1P34D 5B1MD 2Y2QA 5DNNA 3REKD 5DNMC 4KHAB 5JRGA 1P3PB 3AZGC 5AV6D 5AY8C 5E5AB 1ID3B 3MNND 1TAFA 4QLCC 4J8VA 4AWLB 3AZMA 1Q9CA 4UUZB 3F6TA 1WWIA 4JJND 1KX3B 1S32B 3LELA 4H9QA 3AZHB 1JFIB 2NZDC 2G5IC 4EO5C 3B6GD 1P3AD 3AV1C 3AZLA 3WA9B 5B40D 4E44A 1TZYA 4M6BA 3W96C 3MGSB 1U35C 1M1AC 4G92B 2JCHA 3VH6A 3AV2B 4Z2MG 3MGRB 3UTAA 3AZEA 5B0YD 1P3FB 2PYOB 4X23C 5BT1D 2FJ7B 4CAYB 3AFAC 3X1TA 3UTBB 1P3PD 5E5AD 5AVBA 1ID3D 1HTAA 1W2EA 1EQZC 3LJAA 1F1EA 4WU8A 2CV5B 5AV8A 5JRGC 1KX3D 2F8NB 2RIQA 1P3OC 1S32D 3AZHD 4Z5TA 4J8VC 3AZMC 3REIC 3WA9D 3TU4B 1BH8A 5B2IC 2YFWB 3MGSD 4LD9A 3W99B 3LELC 3AV2D 5C3IB 3MGRD 4HGAC 5B32G 1P3FD 5FUGA 1P3IB 2PYOD 3AZLC 3P5JB 3WAAC 4R8PB 3MGPC 2FJ7D 3WKJA 3AZIA 4H9NA 3A6NA 3UTBD 1P3GA 2ZY3A 3UTAC 3AZEC 4KUDA 3A1KA 1N1JA 4H9OA 2CV5D 1ZLAB 3NQUB 1KU5A 1KX5B 3X1TC 2F8ND 3LZ0B 3AN2A 1BH9A 5GSUA 5AVBC 5BO0A 2Y2KA 5B2JA 5CPJB 3MVDB 2DF4C 4WU8C 2HUEC 5CHLB 3TU4D 2XD5A 4WU9B 3EPHA 5B24A 3W99D 5B32A 5AVCA 1P3ID 2BYMA 3UT9B 2RVQD 3O62A 3AZKA 4R8PD 2F8NK 3X1SA 4LD9C 4XUJB 2Y2HA 2LY8A 1M19A 1KX4C 1P3LA 3W97C 3AZJC 4E45A 1ZLAD 3WKJC 2AROA 3AZIC 1KX5D 3A6NC 1HQ3C 5GT0A 3LZ0D 1P3GC 3C1CA 1P3KC 2VQRA 4KUDC 5CPJD 1Z2CB 3MVDD 1AOIA 5F99A 4WU9D 3H0MC 3B0DB 3RELC 5CP6C 3WTPA 3AN2C 5BNXB 5GSUC 1T3UA 2JE5A 5B1LC 5B2JC 1P3BA 1M1AB 3UT9D 3NQJB 4Z66C 3WTPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M B;  5B24 C;  1F66 A;  4XUJ D;  5B32 C;  3AFA B;  5G49 A;  3O62 C;  3AZK C;  4XZQ C;  3X1U A;  3VH5 A;  3AZF A;  1EQZ B;  2NQB A;  5AV9 B;  3R45 A;  3X1S C;  4WZS B;  1M19 C;  4Z2M H;  3AZN A;  1P34 A;  5B1M A;  3REK A;  1P3O B;  5AV5 B;  4J8X B;  4ZBJ C;  3AZM B;  4G91 C;  4H9R A;  3REI B;  4ZUX B;  3C1C C;  5AV6 A;  1R4V A;  5B2I B;  3MNN A;  5GXQ B;  1M1A D;  3LEL B;  4YM6 B;  1AOI C;  5F99 C;  4JJN A;  4WNN A;  3LZ1 B;  2YFV B;  5JA4 B;  5GT3 C;  4X23 D;  1P3M D;  3VH6 T;  3WAA B;  3MGP B;  5CPK C;  3B6G A;  3AFA D;  4CSR B;  1P3A A;  5B0Z B;  5B40 A;  4J8U C;  5B33 B;  3UTA B;  1EQZ D;  5AV9 D;  1F66 C;  2L5A A;  4DRA A;  2BYK B;  5B0Y A;  3X1V B;  1P3O D;  4KHA A;  5AV5 D;  3X1U C;  4J8X D;  3AZF C;  2NQB C;  3AZM D;  3AYW B;  3REI D;  1P3P A;  4ZUX D;  5E5A A;  1M18 B;  5B2I D;  1ID3 A;  5GXQ D;  5B1M C;  3V9R B;  5DNN C;  4UUZ A;  5B31 B;  3LEL D;  4YM6 D;  3REJ A;  3B6F B;  1KX3 A;  3LZ1 D;  3MGQ A;  4J8W B;  1BH8 B;  5AV6 C;  1S32 A;  5BNV A;  3REH B;  2F8N G;  3MGP D;  3AZH A;  3WAA D;  1JFI A;  3WA9 A;  5B0Z D;  1B67 A;  1KX4 B;  5B33 D;  3UTA D;  4JJN C;  3W97 B;  3MGS A;  3AZJ B;  3KUY B;  3AV2 A;  3MGR A;  5BS7 A;  3AZI B;  4NE3 A;  4H9N B;  1P3F A;  2PYO A;  1HQ3 B;  5CPI A;  1P3G B;  1P3K B;  3X1V D;  5B40 C;  2FJ7 A;  4CAY A;  1TZY C;  3UTB A;  3AYW D;  1N1J B;  4YS3 B;  1M18 D;  3W98 B;  5B0Y C;  3KWQ B;  3REL B;  5BT1 C;  5CP6 B;  3AN2 B;  5GSU B;  5B31 D;  2CV5 A;  3B6F D;  5B1L B;  5BO0 B;  5B2J B;  2F8N A;  4J8W D;  5E5A C;  3C1B B;  3REH D;  4Z66 B;  2HIO B;  4AWL C;  5KDM B;  3LJA C;  3TU4 A;  3REJ C;  3KXB B;  1KX4 D;  5AV8 C;  3W97 D;  2YFW A;  3MGQ C;  3AZJ D;  3W99 A;  3KUY D;  4XZQ B;  1S32 C;  4KGC B;  3AZH C;  3AZI D;  4Z5T C;  1HQ3 D;  1P3G D;  1P3I A;  1P3K D;  4H9P B;  4R8P A;  3VH6 W;  4G92 C;  4YS3 D;  5DNM B;  3AV2 C;  4ZBJ B;  5BS7 C;  3W98 D;  1P3F C;  2PYO C;  5CPI C;  3KWQ D;  3REL D;  5CP6 D;  3AZG B;  3AN2 D;  5GSU D;  5AY8 B;  2FJ7 C;  1ZLA A;  3NQU A;  5B1L D;  5B2J D;  4QLC B;  1KX5 A;  3LZ0 A;  1H3O B;  3C1B D;  4Z66 D;  5CPJ A;  2HIO D;  5GT3 B;  3MVD A;  2CV5 C;  4NE6 A;  3KXB D;  5CPK B;  4WU9 A;  2NZD B;  4EO5 B;  3AV1 B;  4J8U B;  4XZQ D;  4KGC D;  3W96 B;  1U35 B;  3UT9 A;  3TU4 C;  3VH5 T;  4XUJ A;  5DNM D;  5C3I C;  3AZF B;  1P3I C;  5AVC C;  3AZG D;  2RVQ C;  5AY8 D;  4QLC D;  5DNN B;  2IO5 C;  1ULY A;  5JRG B;  1P3L C;  5GT3 D;  4H9S A;  5CPK D;  1ZLA C;  1KX5 C;  1TAF B;  4J8V B;  2ARO C;  3B0C T;  2NZD D;  2CWE A;  3LZ0 C;  5GT0 C;  3AV1 D;  4J8U D;  5BNX A;  3W96 D;  5CPJ C;  1U35 D;  1A7W A;  1M1A A;  3MVD C;  3NQJ A;  4WU9 C;  4H9Q B;  4HGA B;  4X23 A;  1P3M A;  3AZL B;  3WTP C;  4WV4 B;  4NFT A;  2F8N H;  1TZY B;  3AZF D;  3AFA A;  1P3B C;  4NE5 A;  3AZE B;  1EQZ A;  5AV9 A;  5DNN D;  4XUJ C;  5JRG D;  3X1T B;  1P3O A;  5AV5 A;  5AVB B;  4J8X A;  4J8V D;  3REI A;  3LJA B;  4ZUX A;  3REJ B;  4WU8 B;  2HUE B;  5B2I A;  5AV8 B;  3MGQ B;  3AZN C;  5GXQ A;  4H9S C;  1P34 C;  3REK C;  5BNV B;  4YM6 A;  3LZ1 A;  4Z5T B;  2YFV A;  5JA4 A;  5B31 G;  3B0B A;  3B0D C;  3AZL D;  3WAA A;  3MGP A;  3MNN C;  1TZY D;  4CSR A;  5B0Z A;  4LD9 B;  5B33 A;  3AZE D;  5CPI B;  5FUG B;  1P3M C;  3KSY A;  2BYK A;  3WKJ B;  3B6G C;  3X1T D;  3A6N B;  3X1V A;  3VH5 W;  1P3A C;  5AVB D;  4KUD B;  5AV9 C;  3AYW A;  3LJA D;  3REJ D;  4H9O B;  4WU8 D;  1M18 A;  5AV8 D;  3MGQ D;  3V9R A;  5B31 A;  3B6F A;  1BH9 B;  2JSS A;  5AV5 C;  4J8X C;  4Z5T D;  1P3P C;  4J8W A;  4ZUX C;  3REH A;  1ID3 C;  5GXQ C;  5B24 B;  3B0C W;  4LD9 D;  5B32 B;  4YM6 C;  1KX4 A;  3W97 A;  3LZ1 C;  1KX3 C;  5CPI D;  5AVC B;  3AZJ A;  3KUY A;  2BYM B;  3O62 B;  3AZK B;  3WKJ D;  1HQ3 A;  3A6N D;  1P3K A;  2IO5 B;  5B0Z C;  3X1S B;  3WA9 C;  5B33 C;  1M19 B;  1P3L B;  4KUD D;  4X23 B;  3MGS C;  1WWS A;  4YS3 A;  3W98 A;  3MGR C;  2ARO B;  4G91 B;  3KWQ A;  3REL A;  5CP6 A;  5GT0 B;  3X1V C;  3C1C B;  5B1L A;  3AYW C;  3UTB C;  1M18 C;  3C1B A;  1AOI B;  5F99 B;  4Z66 A;  2HIO A;  5KDM A;  3WTP B;  5B24 D;  5B31 C;  3B6F C;  3KXB A;  5B32 D;  1P3B B;  5AVC D;  4J8W C;  4XZQ A;  3REH C;  3O62 D;  3AZK D;  4KGC A;  1F66 B;  3X1S D;  4H9P A;  1M19 D;  1P3L D;  5G49 B;  3KUY C;  3W99 C;  5DNM A;  1B6W A;  3X1U B;  2ARO D;  2NQB B;  3R45 B;  5GT0 D;  3AZG A;  3C1C D;  5AY8 A;  4R8P C;  4QLC A;  3AZN B;  1P34 B;  5B1M B;  3REK B;  1H3O A;  4DRB A;  4YS3 C;  1AOI D;  5F99 D;  3W98 C;  5GT3 A;  4H9R B;  3KWQ C;  3WTP D;  5AV6 B;  5CPK A;  3MNN B;  2NZD A;  1P3B D;  3AV1 A;  4J8U A;  3C1B C;  3W96 A;  4WNN B;  2HIO C;  4JJN B;  1U35 A;  1F66 D;  3KXB C;  3B6G B;  1P3A B;  5B40 B;  4KGC C;  3X1U D;  2NQB D;  3UT9 C;  1BFM A;  5B0Y B;  3AZN D;  1P34 D;  5B1M D;  5DNN A;  3REK D;  5DNM C;  4KHA B;  5JRG A;  1P3P B;  3AZG C;  5AV6 D;  5AY8 C;  5E5A B;  1ID3 B;  3MNN D;  1TAF A;  4QLC C;  4J8V A;  4AWL B;  3AZM A;  1Q9C A;  4UUZ B;  1WWI A;  4JJN D;  1KX3 B;  1S32 B;  3LEL A;  4H9Q A;  3AZH B;  1JFI B;  2NZD C;  3B6G D;  4EO5 C;  1P3A D;  3AV1 C;  3AZL A;  3WA9 B;  5B40 D;  4E44 A;  1TZY A;  4M6B A;  3W96 C;  3MGS B;  1U35 C;  1M1A C;  4G92 B;  3VH6 A;  3AV2 B;  4Z2M G;  3MGR B;  3UTA A;  3AZE A;  5B0Y D;  1P3F B;  2PYO B;  4X23 C;  5BT1 D;  2FJ7 B;  4CAY B;  3AFA C;  3X1T A;  3UTB B;  1P3P D;  5E5A D;  5AVB A;  1ID3 D;  1HTA A;  1EQZ C;  3LJA A;  1F1E A;  4WU8 A;  2CV5 B;  5AV8 A;  5JRG C;  1KX3 D;  2F8N B;  1P3O C;  1S32 D;  3AZH D;  4Z5T A;  4J8V C;  3AZM C;  3REI C;  3WA9 D;  3TU4 B;  1BH8 A;  5B2I C;  2YFW B;  3MGS D;  4LD9 A;  3W99 B;  3LEL C;  3AV2 D;  5C3I B;  3MGR D;  4HGA C;  5B32 G;  1P3F D;  5FUG A;  1P3I B;  2PYO D;  3AZL C;  3WAA C;  4R8P B;  3MGP C;  2FJ7 D;  3WKJ A;  3AZI A;  4H9N A;  3A6N A;  3UTB D;  1P3G A;  3UTA C;  3AZE C;  4KUD A;  1N1J A;  4H9O A;  2CV5 D;  1ZLA B;  3NQU B;  1KU5 A;  1KX5 B;  3X1T C;  2F8N D;  3LZ0 B;  3AN2 A;  1BH9 A;  5GSU A;  5AVB C;  5BO0 A;  5B2J A;  5CPJ B;  3MVD B;  4WU8 C;  2HUE C;  5CHL B;  3TU4 D;  4WU9 B;  5B24 A;  3W99 D;  5B32 A;  5AVC A;  1P3I D;  2BYM A;  3UT9 B;  2RVQ D;  3O62 A;  3AZK A;  4R8P D;  2F8N K;  3X1S A;  4LD9 C;  4XUJ B;  1M19 A;  2LY8 A;  1KX4 C;  1P3L A;  3W97 C;  3AZJ C;  4E45 A;  1ZLA D;  3WKJ C;  2ARO A;  3AZI C;  1KX5 D;  3A6N C;  1HQ3 C;  5GT0 A;  3LZ0 D;  1P3G C;  3C1C A;  1P3K C;  4KUD C;  5CPJ D;  3MVD D;  1AOI A;  5F99 A;  4WU9 D;  3B0D B;  3REL C;  5CP6 C;  3WTP A;  3AN2 C;  5BNX B;  5GSU C;  5B1L C;  5B2J C;  1P3B A;  1M1A B;  3UT9 D;  3NQJ B;  4Z66 C;  3WTP E; 
#chains in the Genus database with same CATH topology
 1P3M B;  5B24 C;  1F66 A;  4XUJ D;  5B32 C;  3AFA B;  5G49 A;  3O62 C;  3AZK C;  4XZQ C;  2Y2G A;  3X1U A;  3VH5 A;  3AZF A;  1EQZ B;  2NQB A;  5AV9 B;  2Y2L A;  3R45 A;  3X1S C;  4WZS B;  1M19 C;  4Z2M H;  2G5H C;  3AZN A;  1P34 A;  5B1M A;  3REK A;  1P3O B;  5AV5 B;  4J8X B;  4ZBJ C;  3AZM B;  4G91 C;  4H9R A;  3REI B;  4ZUX B;  3C1C C;  5AV6 A;  1R4V A;  5B2I B;  3MNN A;  5GXQ B;  1M1A D;  3LEL B;  4YM6 B;  2XD1 A;  1AOI C;  5F99 C;  4JJN A;  4WNN A;  3LZ1 B;  2YFV B;  5JA4 B;  5GT3 C;  4X23 D;  1P3M D;  3VH6 T;  3WAA B;  3MGP B;  5CPK C;  3B6G A;  3AFA D;  4CSR B;  1P3A A;  5B0Z B;  5B40 A;  4J8U C;  5B33 B;  3UTA B;  1EQZ D;  5AV9 D;  1F66 C;  2L5A A;  4DRA A;  2BYK B;  5B0Y A;  3X1V B;  1P3O D;  4KHA A;  5AV5 D;  3X1U C;  4J8X D;  3AZF C;  2NQB C;  3AZM D;  3AYW B;  3REI D;  1P3P A;  3A1I A;  4ZUX D;  5E5A A;  1M18 B;  5B2I D;  1ID3 A;  5GXQ D;  5B1M C;  3V9R B;  5DNN C;  4UUZ A;  5B31 B;  3LEL D;  4YM6 D;  3EPK A;  3REJ A;  3B6F B;  1KX3 A;  3LZ1 D;  3MGQ A;  4J8W B;  1BH8 B;  5AV6 C;  1S32 A;  5BNV A;  3REH B;  2F8N G;  3MGP D;  3AZH A;  3WAA D;  1JFI A;  3WA9 A;  5B0Z D;  1B67 A;  1KX4 B;  5B33 D;  3UTA D;  4JJN C;  3W97 B;  3MGS A;  2FFF B;  3AZJ B;  3KUY B;  1PZR A;  3AV2 A;  3MGR A;  5BS7 A;  3AZI B;  4NE3 A;  4H9N B;  1P3F A;  2PYO A;  1HQ3 B;  5CPI A;  1P3G B;  1P3K B;  3X1V D;  5B40 C;  2FJ7 A;  4CAY A;  1TZY C;  2BG1 A;  3UTB A;  3AYW D;  1N1J B;  4YS3 B;  1M18 D;  3IP4 C;  3W98 B;  5B0Y C;  3KWQ B;  3REL B;  5BT1 C;  5CP6 B;  3AN2 B;  5GSU B;  5B31 D;  2CV5 A;  3B6F D;  5B1L B;  5BO0 B;  5B2J B;  2F8N A;  4J8W D;  5E5A C;  3C1B B;  3REH D;  4Z66 B;  2HIO B;  4AWL C;  5KDM B;  3LJA C;  3TU4 A;  3REJ C;  3KXB B;  1KX4 D;  3KFU G;  5AV8 C;  3W97 D;  2YFW A;  3MGQ C;  3AZJ D;  3W99 A;  3KUY D;  4XZQ B;  1S32 C;  4KGC B;  3AZH C;  3H0L C;  3AZI D;  4Z5T C;  1HQ3 D;  1P3G D;  1P3I A;  2Y2O A;  1P3K D;  4H9P B;  4R8P A;  3VH6 W;  2F2A C;  4G92 C;  4YS3 D;  5DNM B;  3AV2 C;  4ZBJ B;  5BS7 C;  3W98 D;  1P3F C;  2PYO C;  5CPI C;  3KWQ D;  3REL D;  5CP6 D;  3AZG B;  3AN2 D;  5GSU D;  5AY8 B;  2FJ7 C;  1ZLA A;  3NQU A;  5B1L D;  5B2J D;  4QLC B;  1KX5 A;  3LZ0 A;  1H3O B;  3C1B D;  4Z66 D;  5CPJ A;  2HIO D;  5GT3 B;  3MVD A;  2CV5 C;  4NE6 A;  3KXB D;  5CPK B;  4WU9 A;  2DQN C;  2NZD B;  4EO5 B;  3AV1 B;  4J8U B;  4XZQ D;  2Y2M A;  4KGC D;  3W96 B;  1U35 B;  3UT9 A;  3TU4 C;  3VH5 T;  4XUJ A;  5DNM D;  5C3I C;  3AZF B;  2Y2J A;  1P3I C;  5AVC C;  2ZY5 A;  3AZG D;  2RVQ C;  5AY8 D;  2W8S A;  4QLC D;  5DNN B;  2IO5 C;  1ULY A;  5JRG B;  1P3L C;  5GT3 D;  4H9S A;  5CPK D;  1ZLA C;  1KX5 C;  1TAF B;  2Y2I A;  2ARO C;  3B0C T;  4J8V B;  2NZD D;  2CWE A;  3LZ0 C;  5GT0 C;  3AV1 D;  4J8U D;  5BNX A;  3W96 D;  5CPJ C;  1U35 D;  1A7W A;  1M1A A;  3MVD C;  3NQJ A;  2UWX A;  4WU9 C;  4H9Q B;  4HGA B;  4X23 A;  1P3M A;  3AZL B;  3WTP C;  4WV4 B;  4NFT A;  2F8N H;  1TZY B;  4WJ3 C;  3AZF D;  3AFA A;  1P3B C;  2ZY2 A;  4NE5 A;  3AZE B;  1EQZ A;  5AV9 A;  5DNN D;  4XUJ C;  5JRG D;  3X1T B;  1P3O A;  5AV5 A;  5AVB B;  4J8X A;  4J8V D;  3REI A;  3LJA B;  4ZUX A;  3REJ B;  4WU8 B;  2HUE B;  5B2I A;  5AV8 B;  3MGQ B;  3AZN C;  5GXQ A;  4H9S C;  1P34 C;  3REK C;  5BNV B;  3EG5 B;  4YM6 A;  3LZ1 A;  4Z5T B;  2YFV A;  5JA4 A;  5B31 G;  3B0B A;  3B0D C;  3AZL D;  3WAA A;  3MGP A;  3MNN C;  1TZY D;  4CSR A;  5B0Z A;  4LD9 B;  5B33 A;  3AZE D;  5CPI B;  5FUG B;  1P3M C;  2Y2N A;  3KSY A;  2BYK A;  3WKJ B;  3B6G C;  3X1T D;  3A6N B;  3X1V A;  3VH5 W;  1P3A C;  5AVB D;  4KUD B;  5AV9 C;  4UPK A;  3AYW A;  3LJA D;  3REJ D;  4H9O B;  4WU8 D;  3EPL A;  1M18 A;  5AV8 D;  2ZY4 A;  3MGQ D;  3V9R A;  5B31 A;  3B6F A;  1BH9 B;  2JSS A;  5AV5 C;  4J8X C;  4Z5T D;  1P3P C;  4J8W A;  4ZUX C;  3REH A;  1ID3 C;  5GXQ C;  5B24 B;  3B0C W;  4LD9 D;  5B32 B;  4YM6 C;  1KX4 A;  3W97 A;  3LZ1 C;  1KX3 C;  5CPI D;  5AVC B;  3AZJ A;  3KUY A;  2BYM B;  3O62 B;  3AZK B;  3WKJ D;  1HQ3 A;  3A6N D;  1P3K A;  2IO5 B;  5B0Z C;  3X1S B;  3WA9 C;  5B33 C;  1M19 B;  1P3L B;  3AL0 C;  4KUD D;  4X23 B;  3MGS C;  1WWS A;  4YS3 A;  2J8P A;  3W98 A;  3MGR C;  2ARO B;  4G91 B;  3KWQ A;  3REL A;  5CP6 A;  5GT0 B;  3X1V C;  3C1C B;  5B1L A;  3AYW C;  3UTB C;  1M18 C;  3C1B A;  1AOI B;  5F99 B;  4Z66 A;  4DQY B;  2HIO A;  5KDM A;  3WTP B;  5B24 D;  5B31 C;  3B6F C;  3KXB A;  5B32 D;  1P3B B;  5AVC D;  4J8W C;  4XZQ A;  3REH C;  3O62 D;  3AZK D;  4KGC A;  1F66 B;  3X1S D;  4H9P A;  1M19 D;  1P3L D;  5G49 B;  3EPJ A;  3KUY C;  3W99 C;  5DNM A;  1B6W A;  3X1U B;  2ARO D;  2NQB B;  3R45 B;  5GT0 D;  3AZG A;  3C1C D;  5AY8 A;  4R8P C;  4QLC A;  3AZN B;  1P34 B;  5B1M B;  3REK B;  1H3O A;  4DRB A;  4YS3 C;  1AOI D;  5F99 D;  3W98 C;  5GT3 A;  4H9R B;  3KWQ C;  3WTP D;  5AV6 B;  5CPK A;  3MNN B;  2NZD A;  1P3B D;  3AV1 A;  4J8U A;  3H0R C;  3C1B C;  3W96 A;  4WNN B;  2HIO C;  2ZM5 A;  4JJN B;  1U35 A;  1F66 D;  3KXB C;  2Y2P A;  3B6G B;  1P3A B;  5B40 B;  4KGC C;  3X1U D;  2NQB D;  3UT9 C;  1BFM A;  5B0Y B;  3AZN D;  3FDD A;  1P34 D;  5B1M D;  2Y2Q A;  5DNN A;  3REK D;  5DNM C;  4KHA B;  5JRG A;  1P3P B;  3AZG C;  5AV6 D;  5AY8 C;  5E5A B;  1ID3 B;  3MNN D;  1TAF A;  4QLC C;  4J8V A;  4AWL B;  3AZM A;  1Q9C A;  4UUZ B;  3F6T A;  1WWI A;  4JJN D;  1KX3 B;  1S32 B;  3LEL A;  4H9Q A;  3AZH B;  1JFI B;  2NZD C;  2G5I C;  4EO5 C;  3B6G D;  1P3A D;  3AV1 C;  3AZL A;  3WA9 B;  5B40 D;  4E44 A;  1TZY A;  4M6B A;  3W96 C;  3MGS B;  1U35 C;  1M1A C;  4G92 B;  2JCH A;  3VH6 A;  3AV2 B;  4Z2M G;  3MGR B;  3UTA A;  3AZE A;  5B0Y D;  1P3F B;  2PYO B;  4X23 C;  5BT1 D;  2FJ7 B;  4CAY B;  3AFA C;  3X1T A;  3UTB B;  1P3P D;  5E5A D;  5AVB A;  1ID3 D;  1HTA A;  1W2E A;  1EQZ C;  3LJA A;  1F1E A;  4WU8 A;  2CV5 B;  5AV8 A;  5JRG C;  1KX3 D;  2F8N B;  2RIQ A;  1P3O C;  1S32 D;  3AZH D;  4Z5T A;  4J8V C;  3AZM C;  3REI C;  3WA9 D;  3TU4 B;  1BH8 A;  5B2I C;  2YFW B;  3MGS D;  4LD9 A;  3W99 B;  3LEL C;  3AV2 D;  5C3I B;  3MGR D;  4HGA C;  5B32 G;  1P3F D;  5FUG A;  1P3I B;  2PYO D;  3AZL C;  3P5J B;  3WAA C;  4R8P B;  3MGP C;  2FJ7 D;  3WKJ A;  3AZI A;  4H9N A;  3A6N A;  3UTB D;  1P3G A;  2ZY3 A;  3UTA C;  3AZE C;  4KUD A;  3A1K A;  1N1J A;  4H9O A;  2CV5 D;  1ZLA B;  3NQU B;  1KU5 A;  1KX5 B;  3X1T C;  2F8N D;  3LZ0 B;  3AN2 A;  1BH9 A;  5GSU A;  5AVB C;  5BO0 A;  2Y2K A;  5B2J A;  5CPJ B;  3MVD B;  2DF4 C;  4WU8 C;  2HUE C;  5CHL B;  3TU4 D;  2XD5 A;  4WU9 B;  3EPH A;  5B24 A;  3W99 D;  5B32 A;  5AVC A;  1P3I D;  2BYM A;  3UT9 B;  2RVQ D;  3O62 A;  3AZK A;  4R8P D;  2F8N K;  3X1S A;  4LD9 C;  4XUJ B;  2Y2H A;  2LY8 A;  1M19 A;  1KX4 C;  1P3L A;  3W97 C;  3AZJ C;  4E45 A;  1ZLA D;  3WKJ C;  2ARO A;  3AZI C;  1KX5 D;  3A6N C;  1HQ3 C;  5GT0 A;  3LZ0 D;  1P3G C;  3C1C A;  1P3K C;  2VQR A;  4KUD C;  5CPJ D;  1Z2C B;  3MVD D;  1AOI A;  5F99 A;  4WU9 D;  3H0M C;  3B0D B;  3REL C;  5CP6 C;  3WTP A;  3AN2 C;  5BNX B;  5GSU C;  1T3U A;  2JE5 A;  5B1L C;  5B2J C;  1P3B A;  1M1A B;  3UT9 D;  3NQJ B;  4Z66 C;  3WTP E; 
#chains in the Genus database with same CATH homology
 1P3M B;  5B24 C;  1F66 A;  4XUJ D;  5B32 C;  3AFA B;  5G49 A;  3O62 C;  3AZK C;  4XZQ C;  2Y2G A;  3X1U A;  3VH5 A;  3AZF A;  1EQZ B;  2NQB A;  5AV9 B;  2Y2L A;  3R45 A;  3X1S C;  4WZS B;  1M19 C;  4Z2M H;  2G5H C;  3AZN A;  1P34 A;  5B1M A;  3REK A;  1P3O B;  5AV5 B;  4J8X B;  4ZBJ C;  3AZM B;  4G91 C;  4H9R A;  3REI B;  4ZUX B;  3C1C C;  5AV6 A;  1R4V A;  5B2I B;  3MNN A;  5GXQ B;  1M1A D;  3LEL B;  4YM6 B;  2XD1 A;  1AOI C;  5F99 C;  4JJN A;  4WNN A;  3LZ1 B;  2YFV B;  5JA4 B;  5GT3 C;  4X23 D;  1P3M D;  3VH6 T;  3WAA B;  3MGP B;  5CPK C;  3B6G A;  3AFA D;  4CSR B;  1P3A A;  5B0Z B;  5B40 A;  4J8U C;  5B33 B;  3UTA B;  1EQZ D;  5AV9 D;  1F66 C;  2L5A A;  4DRA A;  2BYK B;  5B0Y A;  3X1V B;  1P3O D;  4KHA A;  5AV5 D;  3X1U C;  4J8X D;  3AZF C;  2NQB C;  3AZM D;  3AYW B;  3REI D;  1P3P A;  3A1I A;  4ZUX D;  5E5A A;  1M18 B;  5B2I D;  1ID3 A;  5GXQ D;  5B1M C;  3V9R B;  5DNN C;  4UUZ A;  5B31 B;  3LEL D;  4YM6 D;  3EPK A;  3REJ A;  3B6F B;  1KX3 A;  3LZ1 D;  3MGQ A;  4J8W B;  1BH8 B;  5AV6 C;  1S32 A;  5BNV A;  3REH B;  2F8N G;  3MGP D;  3AZH A;  3WAA D;  1JFI A;  3WA9 A;  5B0Z D;  1B67 A;  1KX4 B;  5B33 D;  3UTA D;  4JJN C;  3W97 B;  3MGS A;  2FFF B;  3AZJ B;  3KUY B;  1PZR A;  3AV2 A;  3MGR A;  5BS7 A;  3AZI B;  4NE3 A;  4H9N B;  1P3F A;  2PYO A;  1HQ3 B;  5CPI A;  1P3G B;  1P3K B;  3X1V D;  5B40 C;  2FJ7 A;  4CAY A;  1TZY C;  2BG1 A;  3UTB A;  3AYW D;  1N1J B;  4YS3 B;  1M18 D;  3IP4 C;  3W98 B;  5B0Y C;  3KWQ B;  3REL B;  5BT1 C;  5CP6 B;  3AN2 B;  5GSU B;  5B31 D;  2CV5 A;  3B6F D;  5B1L B;  5BO0 B;  5B2J B;  2F8N A;  4J8W D;  5E5A C;  3C1B B;  3REH D;  4Z66 B;  2HIO B;  4AWL C;  5KDM B;  3LJA C;  3TU4 A;  3REJ C;  3KXB B;  1KX4 D;  3KFU G;  5AV8 C;  3W97 D;  2YFW A;  3MGQ C;  3AZJ D;  3W99 A;  3KUY D;  4XZQ B;  1S32 C;  4KGC B;  3AZH C;  3H0L C;  3AZI D;  4Z5T C;  1HQ3 D;  1P3G D;  1P3I A;  2Y2O A;  1P3K D;  4H9P B;  4R8P A;  3VH6 W;  2F2A C;  4G92 C;  4YS3 D;  5DNM B;  3AV2 C;  4ZBJ B;  5BS7 C;  3W98 D;  1P3F C;  2PYO C;  5CPI C;  3KWQ D;  3REL D;  5CP6 D;  3AZG B;  3AN2 D;  5GSU D;  5AY8 B;  2FJ7 C;  1ZLA A;  3NQU A;  5B1L D;  5B2J D;  4QLC B;  1KX5 A;  3LZ0 A;  1H3O B;  3C1B D;  4Z66 D;  5CPJ A;  2HIO D;  5GT3 B;  3MVD A;  2CV5 C;  4NE6 A;  3KXB D;  5CPK B;  4WU9 A;  2DQN C;  2NZD B;  4EO5 B;  3AV1 B;  4J8U B;  4XZQ D;  2Y2M A;  4KGC D;  3W96 B;  1U35 B;  3UT9 A;  3TU4 C;  3VH5 T;  4XUJ A;  5DNM D;  5C3I C;  3AZF B;  2Y2J A;  1P3I C;  5AVC C;  2ZY5 A;  3AZG D;  2RVQ C;  5AY8 D;  2W8S A;  4QLC D;  5DNN B;  2IO5 C;  1ULY A;  5JRG B;  1P3L C;  5GT3 D;  4H9S A;  5CPK D;  1ZLA C;  1KX5 C;  1TAF B;  2Y2I A;  2ARO C;  3B0C T;  4J8V B;  2NZD D;  2CWE A;  3LZ0 C;  5GT0 C;  3AV1 D;  4J8U D;  5BNX A;  3W96 D;  5CPJ C;  1U35 D;  1A7W A;  1M1A A;  3MVD C;  3NQJ A;  2UWX A;  4WU9 C;  4H9Q B;  4HGA B;  4X23 A;  1P3M A;  3AZL B;  3WTP C;  4WV4 B;  4NFT A;  2F8N H;  1TZY B;  4WJ3 C;  3AZF D;  3AFA A;  1P3B C;  2ZY2 A;  4NE5 A;  3AZE B;  1EQZ A;  5AV9 A;  5DNN D;  4XUJ C;  5JRG D;  3X1T B;  1P3O A;  5AV5 A;  5AVB B;  4J8X A;  4J8V D;  3REI A;  3LJA B;  4ZUX A;  3REJ B;  4WU8 B;  2HUE B;  5B2I A;  5AV8 B;  3MGQ B;  3AZN C;  5GXQ A;  4H9S C;  1P34 C;  3REK C;  5BNV B;  3EG5 B;  4YM6 A;  3LZ1 A;  4Z5T B;  2YFV A;  5JA4 A;  5B31 G;  3B0B A;  3B0D C;  3AZL D;  3WAA A;  3MGP A;  3MNN C;  1TZY D;  4CSR A;  5B0Z A;  4LD9 B;  5B33 A;  3AZE D;  5CPI B;  5FUG B;  1P3M C;  2Y2N A;  3KSY A;  2BYK A;  3WKJ B;  3B6G C;  3X1T D;  3A6N B;  3X1V A;  3VH5 W;  1P3A C;  5AVB D;  4KUD B;  5AV9 C;  4UPK A;  3AYW A;  3LJA D;  3REJ D;  4H9O B;  4WU8 D;  3EPL A;  1M18 A;  5AV8 D;  2ZY4 A;  3MGQ D;  3V9R A;  5B31 A;  3B6F A;  1BH9 B;  2JSS A;  5AV5 C;  4J8X C;  4Z5T D;  1P3P C;  4J8W A;  4ZUX C;  3REH A;  1ID3 C;  5GXQ C;  5B24 B;  3B0C W;  4LD9 D;  5B32 B;  4YM6 C;  1KX4 A;  3W97 A;  3LZ1 C;  1KX3 C;  5CPI D;  5AVC B;  3AZJ A;  3KUY A;  2BYM B;  3O62 B;  3AZK B;  3WKJ D;  1HQ3 A;  3A6N D;  1P3K A;  2IO5 B;  5B0Z C;  3X1S B;  3WA9 C;  5B33 C;  1M19 B;  1P3L B;  3AL0 C;  4KUD D;  4X23 B;  3MGS C;  1WWS A;  4YS3 A;  2J8P A;  3W98 A;  3MGR C;  2ARO B;  4G91 B;  3KWQ A;  3REL A;  5CP6 A;  5GT0 B;  3X1V C;  3C1C B;  5B1L A;  3AYW C;  3UTB C;  1M18 C;  3C1B A;  1AOI B;  5F99 B;  4Z66 A;  4DQY B;  2HIO A;  5KDM A;  3WTP B;  5B24 D;  5B31 C;  3B6F C;  3KXB A;  5B32 D;  1P3B B;  5AVC D;  4J8W C;  4XZQ A;  3REH C;  3O62 D;  3AZK D;  4KGC A;  1F66 B;  3X1S D;  4H9P A;  1M19 D;  1P3L D;  5G49 B;  3EPJ A;  3KUY C;  3W99 C;  5DNM A;  1B6W A;  3X1U B;  2ARO D;  2NQB B;  3R45 B;  5GT0 D;  3AZG A;  3C1C D;  5AY8 A;  4R8P C;  4QLC A;  3AZN B;  1P34 B;  5B1M B;  3REK B;  1H3O A;  4DRB A;  4YS3 C;  1AOI D;  5F99 D;  3W98 C;  5GT3 A;  4H9R B;  3KWQ C;  3WTP D;  5AV6 B;  5CPK A;  3MNN B;  2NZD A;  1P3B D;  3AV1 A;  4J8U A;  3H0R C;  3C1B C;  3W96 A;  4WNN B;  2HIO C;  2ZM5 A;  4JJN B;  1U35 A;  1F66 D;  3KXB C;  2Y2P A;  3B6G B;  1P3A B;  5B40 B;  4KGC C;  3X1U D;  2NQB D;  3UT9 C;  1BFM A;  5B0Y B;  3AZN D;  3FDD A;  1P34 D;  5B1M D;  2Y2Q A;  5DNN A;  3REK D;  5DNM C;  4KHA B;  5JRG A;  1P3P B;  3AZG C;  5AV6 D;  5AY8 C;  5E5A B;  1ID3 B;  3MNN D;  1TAF A;  4QLC C;  4J8V A;  4AWL B;  3AZM A;  1Q9C A;  4UUZ B;  3F6T A;  1WWI A;  4JJN D;  1KX3 B;  1S32 B;  3LEL A;  4H9Q A;  3AZH B;  1JFI B;  2NZD C;  2G5I C;  4EO5 C;  3B6G D;  1P3A D;  3AV1 C;  3AZL A;  3WA9 B;  5B40 D;  4E44 A;  1TZY A;  4M6B A;  3W96 C;  3MGS B;  1U35 C;  1M1A C;  4G92 B;  2JCH A;  3VH6 A;  3AV2 B;  4Z2M G;  3MGR B;  3UTA A;  3AZE A;  5B0Y D;  1P3F B;  2PYO B;  4X23 C;  5BT1 D;  2FJ7 B;  4CAY B;  3AFA C;  3X1T A;  3UTB B;  1P3P D;  5E5A D;  5AVB A;  1ID3 D;  1HTA A;  1W2E A;  1EQZ C;  3LJA A;  1F1E A;  4WU8 A;  2CV5 B;  5AV8 A;  5JRG C;  1KX3 D;  2F8N B;  2RIQ A;  1P3O C;  1S32 D;  3AZH D;  4Z5T A;  4J8V C;  3AZM C;  3REI C;  3WA9 D;  3TU4 B;  1BH8 A;  5B2I C;  2YFW B;  3MGS D;  4LD9 A;  3W99 B;  3LEL C;  3AV2 D;  5C3I B;  3MGR D;  4HGA C;  5B32 G;  1P3F D;  5FUG A;  1P3I B;  2PYO D;  3AZL C;  3P5J B;  3WAA C;  4R8P B;  3MGP C;  2FJ7 D;  3WKJ A;  3AZI A;  4H9N A;  3A6N A;  3UTB D;  1P3G A;  2ZY3 A;  3UTA C;  3AZE C;  4KUD A;  3A1K A;  1N1J A;  4H9O A;  2CV5 D;  1ZLA B;  3NQU B;  1KU5 A;  1KX5 B;  3X1T C;  2F8N D;  3LZ0 B;  3AN2 A;  1BH9 A;  5GSU A;  5AVB C;  5BO0 A;  2Y2K A;  5B2J A;  5CPJ B;  3MVD B;  2DF4 C;  4WU8 C;  2HUE C;  5CHL B;  3TU4 D;  2XD5 A;  4WU9 B;  3EPH A;  5B24 A;  3W99 D;  5B32 A;  5AVC A;  1P3I D;  2BYM A;  3UT9 B;  2RVQ D;  3O62 A;  3AZK A;  4R8P D;  2F8N K;  3X1S A;  4LD9 C;  4XUJ B;  2Y2H A;  2LY8 A;  1M19 A;  1KX4 C;  1P3L A;  3W97 C;  3AZJ C;  4E45 A;  1ZLA D;  3WKJ C;  2ARO A;  3AZI C;  1KX5 D;  3A6N C;  1HQ3 C;  5GT0 A;  3LZ0 D;  1P3G C;  3C1C A;  1P3K C;  2VQR A;  4KUD C;  5CPJ D;  1Z2C B;  3MVD D;  1AOI A;  5F99 A;  4WU9 D;  3H0M C;  3B0D B;  3REL C;  5CP6 C;  3WTP A;  3AN2 C;  5BNX B;  5GSU C;  1T3U A;  2JE5 A;  5B1L C;  5B2J C;  1P3B A;  1M1A B;  3UT9 D;  3NQJ B;  4Z66 C;  3WTP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...