3LELB

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelB00
2LY8A 4KHAB 5CPIA 5AV6D 3REHC 4KGCD 4J8UD 1P3GA 5B31G 4WZSB 3MGPB 4X23D 3W99B 1AOID 3REJB 5FUGA 1H3OB 4H9PB 3AFAD 5B32C 5GSUB 3W98A 3TU4B 3LELA 1KX4C 3X1VA 4J8VD 5B1MD 4H9QB 1P3IA 3WA9C 5DNMB 3W96C 2BYKA 4XUJC 1F66D 3AZHA 3C1CB 5B1LD 1R4VA 3AV2B 3AZLD 3WAAB 3AZIC 5AY8C 3MGRD 3AZND 1P3KD 3UTAC 3A6ND 5B24B 3REKB 3NQJA 2IO5C 4Z5TD 1ZLAB 3AZMA 5BNXA 4WNNA 3W99D 4H9SC 3MNNB 3REJD 4H9NB 4EO5C 5AVBB 5CPKA 1P3OB 3KUYB 5B31B 4AWLC 5GSUD 1BH9A 2BYMB 3B6GC 3TU4D 1KX5A 3LZ0A 1U35A 5AVCB 3AZEB 3AZFA 4QLCC 4H9OB 5BT1D 5DNNA 2AROB 1P34C 3C1CD 1KU5A 3WKJB 1HTAA 3AV2D 3WAAD 1P3PB 1B6WA 1WWSA 1KX4A 4G91C 5AV8B 3UT9B 3WTPA 3WA9A 4DRAA 5B24D 3REKD 3KXBB 3C1BC 3W96A 1S32C 4DRBA 5B2JC 3O62C 1ZLAD 4JJNC 3LZ1C 3MNND 1KX3C 4Z66A 4YS3B 5AVBD 4ZUXC 3W97B 3AZIA 3KUYD 5B31D 3KSYA 5CP6A 4WU9C 2HIOB 5KDMB 5AVCD 1M1AB 5BNVA 1HQ3B 4H9SA 3LJAC 2AROD 5F99B 4M6BA 3WKJD 5B2IA 4YM6C 3AZKC 4XZQC 5AV8D 3UT9D 5BO0B 1M18C 2NQBC 3KXBD 3V9RB 4QLCA 1P3AC 3REIC 1P34A 3B0DC 3AZKB 4YS3D 5GT3D 2NZDC 5AV9D 5GT0C 3X1UB 3W97D 3KWQB 5CPIB 4WU8C 4R8PD 3X1SB 1P3LA 1P3GB 2HIOD 3C1BA 3AZJA 3X1VC 1M1AD 4J8WC 2JSSA 5B2JA 3O62A 5FUGB 2CV5C 1M19D 4JJNA 4J8XA 1HQ3D 3LZ1A 5C3IC 3W98B 5F99D 5B0YB 4ZUXA 3LELB 3NQUA 1P3IB 2BYKB 3B0BA 3AZHB 5E5AB 3B6FD 3LJAA 3RELA 3AZMC 3AFAC 1WWIA 2PYOB 3X1UD 5CPKC 3KWQD 3NQJB 5CPID 1TZYA 3X1SD 1P3GD 1P3BA 2NQBA 3LZ0C 3UTBB 1U35C 5AV5D 1P3AA 1F66C 3REIA 2L5AA 1ID3C 3AZFC 1EQZA 4KUDC 5DNNC 3W98D 5B0YD 3X1TA 2NZDA 5GT0A 1KX5B 1P3FA 1P3KC 3AZGC 2YFWB 3REHB 4WU8A 1P3ID 3VH5W 3WTPC 3AZHD 4Z5TC 4J8WA 5E5AD 2CV5A 1M18A 4NE3A 5B32B 5GXQA 5CHLB 3MVDA 1BFMA 1KX4B 4Z66C 2PYOD 3WA9B 5CP6C 3W96B 4KGCA 4XUJB 2F8NB 1BH8B 3UTBD 1TAFA 2FJ7C 1AOIA 3AZIB 2RVQD 3MGPD 3AFAA 4WV4B 5AY8B 3UTAB 1KX5D 2IO5B 3VH5A 3REHD 5B2IC 4H9RA 5B40C 1F66A 5DNMD 1ID3A 4EO5B 5B1LA 4CAYA 2HUEC 5B32D 4AWLB 4G92C 4KUDA 3B6GB 5CPJC 1P3KA 5BS7A 3A6NA 3AZGA 4CSRA 3WA9D 2CWEA 3AV1C 4QLCB 4XUJD 2F8ND 4Z5TA 1P34B 1P3LC 3AZJC 3W99A 3REJA 3AZID 4J8XC 4H9PA 5AY8D 3UTAD 4G91B 5GSUA 3AN2C 1P3OD 3C1BB 2F8NK 1S32B 5B2JB 3O62B 4JJNB 5JRGC 3LZ1B 3MGSC 5B33C 2FJ7A 1KX3B 3AZED 3B0CT 4ZUXB 4NE5A 3AV2A 5GT3C 3RELC 5AV9C 4WU9B 3VH6T 3WAAA 3B6GD 3R45B 1ULYA 4R8PC 1P3PD 5B24A 3REKA 4LD9C 1TZYC 4QLCD 3LJAB 3MGQC 5B40A 1P34D 1P3BC 1M19C 3MNNA 4H9NA 4YM6B 1EQZC 3WTPE 3KUYA 5CPJA 4XZQB 3X1TC 1M18B 2NQBB 1P3FC 3C1BD 3AV1A 1S32D 5AVCA 1P3AB 3REIB 5B2JD 3O62D 3B0DB 3B6FC 4JJND 4H9OA 1KX3D 5B0ZC 2AROA 4E45A 2NZDB 3AYWC 5GT0B 4ZUXD 1P3FB 4WU9D 3AN2A 5GXQC 4WU8B 3MVDC 1P3MC 3UT9A 2YFVA 3X1VB 4J8WB 4ZBJC 3KXBA 2CV5B 5AV6C 5JRGA 3LJAD 5B33A 3MGSA 5AV5C 4KGCC 5C3IB 4J8UC 4X23C 1AOIC 5GT3A 5AV9A 3W97A 4YM6D 3AZKD 4XZQD 1M18D 4R8PA 4LD9A 5KDMA 5G49A 1TAFB 3MGQA 4J8VC 5B1MC 3REID 1M19A 3AZMB 5BNXB 1HQ3A 4WNNB 1Q9CA 3AFAB 4NFTA 2NZDD 1F1EA 5CPKB 5B1LC 4UUZA 3AZLC 4WU8D 1BH9B 4H9RB 3LELD 3MGRC 1N1JA 5BS7C 3LZ0B 4HGAC 3A6NC 3AZNC 3X1VD 1U35B 4J8WD 1F66B 1ID3B 2CV5D 3B6FA 3V9RA 3AZFB 4KUDB 5DNNB 5B0ZA 3AYWA 3W99C 1B67A 1P3KB 3REJC 3AZGB 4CSRB 1P3MA 3KWQA 5GSUC 3WTPB 3X1SA 4Z5TB 3TU4C 3VH6A 5AV6A 5AV5A 5DNMC 4J8UA 3AZMD 5JA4A 4X23A 5BT1C 4Z66B 5B0YA 3C1CC 5CPKD 5CP6B 3WAAC 3AV2C 1JFIA 3LZ0D 2FJ7B 1U35D 4J8VA 5B1MA 5B24C 3REKC 1ID3D 5E5AA 5BNVB 3AZFD 4KUDD 5DNND 1ZLAC 3MNNC 2PYOA 3AZGD 5B2IB 3AZLA 5AVBC 1P3OC 3KUYC 5B31C 3MGRA 3AZNA 1KX4D 3WTPD 5B40B 4KHAA 4E44A 3UTBA 3W96D 5AVCC 2HUEB 3AZEC 4G92B 3MGPA 5CPJB 4Z66D 2AROC 1A7WA 1H3OA 3WKJC 5CP6D 3AV1B 2YFWA 3REHA 1P3PC 1P3LB 3TU4A 3AZJB 5AV8C 3UT9C 2FJ7D 4H9QA 5DNMA 3KXBC 4J8XB 5B32A 3AN2B 3C1CA 3NQUB 5B2ID 2YFVB 4YS3C 3W97C 5JRGB 5B33B 4XUJA 3MGSB 1BH8A 5B40D 2F8NA 2HIOC 1M1AC 5GT3B 3RELB 5AV9B 1ZLAA 1HQ3C 5AY8A 5CPJD 3UTAA 5F99C 4R8PB 5AVBA 1P3OA 4LD9B 3AV1D 5B31A 1TZYB 5G49B 3MGQB 4NE6A 1P3LD 2BYMA 1P3BB 1M19B 3AZJD 3AZEA 4J8XD 3LZ1D 1EQZB 4UUZB 3AN2D 4Z2MH 3X1TB 3B6GA 3WKJA 1N1JB 3X1UC 1P3PA 3KWQC 5CPIC 3B6FB 5JRGD 5AV8A 5B33D 3MGSD 5B0ZB 3X1SC 1P3GC 3VH5T 3AYWB 2F8NH 3RELD 5GXQB 3MVDB 1P3MB 3W98C 4YS3A 5B0YC 4LD9D 4ZBJB 3LELC 1TZYD 5AV6B 1S32A 3MGQD 4KGCB 5AV5B 3B0CW 1P3IC 1P3BD 4J8UB 2NQBD 2HIOA 5JA4B 4X23B 1P3AD 1M1AA 3AZHC 3VH6W 1KX3A 1AOIB 5E5AC 1EQZD 4Z2MG 4WU9A 3X1TD 5F99A 5GT0D 1JFIB 5B32G 1P3FD 3R45A 2PYOC 4J8VB 5B1MB 5BO0A 5B0ZD 3AYWD 3UTBC 5B1LB 2F8NG 4CAYB 1P3MD 5GXQD 3MVDD 3AZLB 4YM6A 2RVQC 3MGPC 3AZKA 3MGRB 3AZNB 4XZQA 4HGAB 3A6NB 3X1UA 1KX5C
chains in the Genus database with same CATH superfamily
2LY8A 4KHAB 5CPIA 5AV6D 3REHC 4KGCD 4J8UD 1P3GA 5B31G 4WZSB 3MGPB 4X23D 3W99B 1AOID 3REJB 5FUGA 1H3OB 4H9PB 3AFAD 5B32C 5GSUB 3W98A 2Y2LA 3TU4B 3LELA 1KX4C 3X1VA 2Y2QA 4J8VD 5B1MD 4H9QB 1P3IA 3WA9C 5DNMB 2Y2HA 3W96C 2BYKA 4XUJC 1F66D 3AZHA 3C1CB 5B1LD 1R4VA 3AV2B 3AZLD 3WAAB 3AZIC 5AY8C 1Z2CB 3MGRD 3AZND 3UTAC 3A6ND 1P3KD 2Y2NA 5B24B 3REKB 3NQJA 2IO5C 4Z5TD 1ZLAB 3AZMA 5BNXA 4WNNA 3W99D 4H9SC 3MNNB 3REJD 4H9NB 4EO5C 5AVBB 5CPKA 1P3OB 3KUYB 5B31B 4AWLC 5GSUD 1BH9A 2BYMB 3B6GC 3TU4D 1KX5A 3LZ0A 1U35A 5AVCB 2XD5A 3AZEB 3AZFA 4QLCC 4H9OB 5BT1D 5DNNA 2AROB 1P34C 2Y2MA 3C1CD 1KU5A 2UWXA 3WKJB 1HTAA 3AV2D 3WAAD 1P3PB 1B6WA 1WWSA 1KX4A 4G91C 5AV8B 3UT9B 3WTPA 3WA9A 4DRAA 5B24D 3REKD 3KXBB 3C1BC 3W96A 1S32C 1PZRA 2JCHA 4DRBA 5B2JC 3O62C 1ZLAD 4JJNC 3LZ1C 3MNND 1KX3C 4Z66A 4YS3B 5AVBD 4ZUXC 3W97B 3AZIA 3KUYD 5B31D 3KSYA 5CP6A 4WU9C 2HIOB 2ZY4A 5KDMB 1W2EA 5AVCD 1M1AB 5BNVA 2J8PA 1HQ3B 4H9SA 3LJAC 2AROD 2Y2GA 5F99B 4M6BA 3WKJD 5B2IA 4YM6C 3AZKC 4XZQC 5AV8D 3UT9D 5BO0B 1M18C 2NQBC 3KXBD 3V9RB 4QLCA 1P3AC 3REIC 1P34A 3B0DC 3AZKB 4YS3D 5GT3D 2NZDC 5AV9D 5GT0C 3X1UB 3W97D 3KWQB 5CPIB 4WU8C 4R8PD 3X1SB 1P3LA 1P3GB 2HIOD 3C1BA 3AZJA 3X1VC 3EG5B 1M1AD 4J8WC 2JSSA 5B2JA 3O62A 5FUGB 2CV5C 1M19D 4JJNA 4J8XA 1HQ3D 3LZ1A 5C3IC 3W98B 5F99D 5B0YB 4ZUXA 3LELB 2Y2IA 3NQUA 1P3IB 2BYKB 3B0BA 3AZHB 5E5AB 3B6FD 3LJAA 3RELA 3AZMC 3AFAC 1WWIA 2PYOB 2G5HC 3H0MC 3X1UD 5CPKC 3KWQD 3NQJB 5CPID 1TZYA 3X1SD 1P3GD 1P3BA 2NQBA 3LZ0C 3UTBB 1U35C 1T3UA 5AV5D 1P3AA 1F66C 3EPJA 3REIA 2L5AA 1ID3C 3AZFC 1EQZA 4KUDC 5DNNC 3W98D 5B0YD 3X1TA 2NZDA 5GT0A 1KX5B 1P3FA 1P3KC 3AZGC 2YFWB 3REHB 4WU8A 1P3ID 3VH5W 3WTPC 3AZHD 4Z5TC 4J8WA 5E5AD 2CV5A 3EPHA 3A1IA 1M18A 4NE3A 5B32B 5GXQA 5CHLB 3MVDA 1BFMA 1KX4B 4Z66C 2PYOD 3WA9B 5CP6C 3W96B 4KGCA 4XUJB 2F8NB 1BH8B 3UTBD 1TAFA 2FJ7C 1AOIA 2ZM5A 3AZIB 2RVQD 3MGPD 3AFAA 4WV4B 5AY8B 3UTAB 1KX5D 2IO5B 3VH5A 3REHD 5B2IC 4WJ3C 2BG1A 4H9RA 2RIQA 5B40C 1F66A 5DNMD 1ID3A 4EO5B 5B1LA 2FFFB 4CAYA 2HUEC 5B32D 4AWLB 4G92C 4KUDA 3B6GB 5CPJC 1P3KA 5BS7A 3A6NA 3AZGA 4CSRA 3WA9D 2CWEA 3KFUG 2JE5A 3AV1C 4QLCB 4XUJD 2F8ND 4Z5TA 1P34B 1P3LC 3AZJC 3W99A 3REJA 3AZID 4J8XC 4H9PA 5AY8D 3UTAD 4G91B 5GSUA 3AN2C 1P3OD 3C1BB 2F8NK 1S32B 5B2JB 3O62B 4JJNB 5JRGC 3LZ1B 3MGSC 5B33C 2FJ7A 1KX3B 3AZED 3B0CT 4ZUXB 4NE5A 3AV2A 5GT3C 3RELC 5AV9C 4WU9B 3VH6T 3WAAA 3B6GD 3R45B 1ULYA 4R8PC 1P3PD 5B24A 3REKA 4LD9C 1TZYC 4QLCD 3LJAB 3MGQC 5B40A 1P34D 1P3BC 1M19C 3MNNA 4H9NA 4YM6B 1EQZC 3WTPE 3KUYA 5CPJA 4XZQB 3X1TC 1M18B 2NQBB 1P3FC 3C1BD 3AV1A 1S32D 5AVCA 1P3AB 3REIB 5B2JD 3O62D 3B0DB 3B6FC 4JJND 3A1KA 3EPKA 2Y2KA 4H9OA 5B0ZC 2AROA 1KX3D 4E45A 2NZDB 3AYWC 5GT0B 4ZUXD 2ZY3A 1P3FB 4WU9D 3AN2A 5GXQC 4WU8B 3MVDC 1P3MC 3UT9A 2YFVA 3X1VB 4J8WB 4ZBJC 3KXBA 2CV5B 5AV6C 2Y2PA 5JRGA 5B33A 3LJAD 5AV5C 3MGSA 4KGCC 5C3IB 4J8UC 4X23C 1AOIC 5GT3A 5AV9A 2ZY2A 3W97A 4YM6D 3AZKD 4XZQD 1M18D 2F2AC 4R8PA 4LD9A 5KDMA 5G49A 1TAFB 3MGQA 4J8VC 5B1MC 3REID 1M19A 2G5IC 3AZMB 5BNXB 1HQ3A 4WNNB 1Q9CA 3AFAB 4NFTA 2NZDD 1F1EA 5CPKB 5B1LC 4UUZA 3AZLC 4WU8D 1BH9B 4H9RB 3LELD 3MGRC 1N1JA 5BS7C 3LZ0B 3H0RC 4HGAC 3A6NC 3AZNC 3X1VD 1U35B 4J8WD 1F66B 1ID3B 2CV5D 3B6FA 3V9RA 3AZFB 4KUDB 5DNNB 5B0ZA 3AYWA 3W99C 1B67A 1P3KB 3REJC 3AZGB 4CSRB 1P3MA 3KWQA 5GSUC 3WTPB 3X1SA 4Z5TB 3TU4C 3VH6A 5AV6A 5AV5A 5DNMC 4J8UA 3AZMD 5JA4A 4X23A 5BT1C 4Z66B 2ZY5A 5B0YA 3C1CC 5CPKD 4DQYB 5CP6B 3WAAC 3AV2C 1JFIA 3LZ0D 2FJ7B 1U35D 4J8VA 5B1MA 5B24C 3REKC 1ID3D 5E5AA 5BNVB 3AZFD 4KUDD 5DNND 1ZLAC 3MNNC 2PYOA 3AZGD 5B2IB 3AZLA 5AVBC 1P3OC 3KUYC 5B31C 3MGRA 3AZNA 1KX4D 3WTPD 5B40B 4KHAA 2VQRA 4E44A 3UTBA 3W96D 5AVCC 2HUEB 3AZEC 4G92B 3MGPA 3EPLA 5CPJB 4Z66D 2AROC 1A7WA 1H3OA 3WKJC 5CP6D 3AV1B 2YFWA 3REHA 1P3PC 1P3LB 3TU4A 3AZJB 5AV8C 3UT9C 3P5JB 2FJ7D 4H9QA 5DNMA 3KXBC 4J8XB 5B32A 3AN2B 2Y2JA 3C1CA 3NQUB 5B2ID 2W8SA 2YFVB 4YS3C 3W97C 2Y2OA 5JRGB 5B33B 4XUJA 2DF4C 1BH8A 5B40D 3MGSB 2F8NA 2HIOC 1M1AC 5GT3B 3RELB 5AV9B 1ZLAA 1HQ3C 5AY8A 5CPJD 3F6TA 3AL0C 2DQNC 3UTAA 5F99C 4R8PB 5AVBA 1P3OA 4LD9B 3AV1D 5B31A 1TZYB 5G49B 3MGQB 4NE6A 1P3LD 2BYMA 1P3BB 1M19B 3AZJD 3AZEA 4J8XD 3LZ1D 1EQZB 4UUZB 3AN2D 4Z2MH 3X1TB 3B6GA 3WKJA 1N1JB 3FDDA 3X1UC 1P3PA 3KWQC 5CPIC 3B6FB 5JRGD 5AV8A 5B33D 3MGSD 5B0ZB 3X1SC 1P3GC 3VH5T 3AYWB 2F8NH 3RELD 5GXQB 3MVDB 1P3MB 3W98C 4YS3A 5B0YC 3H0LC 4LD9D 4ZBJB 3LELC 1TZYD 5AV6B 2XD1A 3MGQD 1S32A 4KGCB 5AV5B 3B0CW 1P3IC 1P3BD 4J8UB 2NQBD 2HIOA 5JA4B 4X23B 1P3AD 1M1AA 3AZHC 3VH6W 1KX3A 1AOIB 5E5AC 4UPKA 4Z2MG 1EQZD 4WU9A 3X1TD 5F99A 5GT0D 1JFIB 5B32G 1P3FD 3IP4C 3R45A 2PYOC 4J8VB 5B1MB 5BO0A 5B0ZD 3AYWD 3UTBC 5B1LB 2F8NG 4CAYB 1P3MD 5GXQD 3MVDD 3AZLB 4YM6A 2RVQC 3MGPC 3AZKA 3MGRB 3AZNB 4XZQA 4HGAB 3A6NB 3X1UA 1KX5C
chains in the Genus database with same CATH topology
2LY8A 4KHAB 5CPIA 5AV6D 3REHC 4KGCD 4J8UD 1P3GA 5B31G 4WZSB 3MGPB 4X23D 3W99B 1AOID 3REJB 5FUGA 1H3OB 4H9PB 3AFAD 5B32C 5GSUB 3W98A 2Y2LA 3TU4B 3LELA 1KX4C 3X1VA 2Y2QA 4J8VD 5B1MD 4H9QB 1P3IA 3WA9C 5DNMB 2Y2HA 3W96C 2BYKA 4XUJC 1F66D 3AZHA 3C1CB 5B1LD 1R4VA 3AV2B 3AZLD 3WAAB 3AZIC 5AY8C 1Z2CB 3MGRD 3AZND 3UTAC 3A6ND 1P3KD 2Y2NA 5B24B 3REKB 3NQJA 2IO5C 4Z5TD 1ZLAB 3AZMA 5BNXA 4WNNA 3W99D 4H9SC 3MNNB 3REJD 4H9NB 4EO5C 5AVBB 5CPKA 1P3OB 3KUYB 5B31B 4AWLC 5GSUD 1BH9A 2BYMB 3B6GC 3TU4D 1KX5A 3LZ0A 1U35A 5AVCB 2XD5A 3AZEB 3AZFA 4QLCC 4H9OB 5BT1D 5DNNA 2AROB 1P34C 2Y2MA 3C1CD 1KU5A 2UWXA 3WKJB 1HTAA 3AV2D 3WAAD 1P3PB 1B6WA 1WWSA 1KX4A 4G91C 5AV8B 3UT9B 3WTPA 3WA9A 4DRAA 5B24D 3REKD 3KXBB 3C1BC 3W96A 1S32C 1PZRA 2JCHA 4DRBA 5B2JC 3O62C 1ZLAD 4JJNC 3LZ1C 3MNND 1KX3C 4Z66A 4YS3B 5AVBD 4ZUXC 3W97B 3AZIA 3KUYD 5B31D 3KSYA 5CP6A 4WU9C 2HIOB 2ZY4A 5KDMB 1W2EA 5AVCD 1M1AB 5BNVA 2J8PA 1HQ3B 4H9SA 3LJAC 2AROD 2Y2GA 5F99B 4M6BA 3WKJD 5B2IA 4YM6C 3AZKC 4XZQC 5AV8D 3UT9D 5BO0B 1M18C 2NQBC 3KXBD 3V9RB 4QLCA 1P3AC 3REIC 1P34A 3B0DC 3AZKB 4YS3D 5GT3D 2NZDC 5AV9D 5GT0C 3X1UB 3W97D 3KWQB 5CPIB 4WU8C 4R8PD 3X1SB 1P3LA 1P3GB 2HIOD 3C1BA 3AZJA 3X1VC 3EG5B 1M1AD 4J8WC 2JSSA 5B2JA 3O62A 5FUGB 2CV5C 1M19D 4JJNA 4J8XA 1HQ3D 3LZ1A 5C3IC 3W98B 5F99D 5B0YB 4ZUXA 3LELB 2Y2IA 3NQUA 1P3IB 2BYKB 3B0BA 3AZHB 5E5AB 3B6FD 3LJAA 3RELA 3AZMC 3AFAC 1WWIA 2PYOB 2G5HC 3H0MC 3X1UD 5CPKC 3KWQD 3NQJB 5CPID 1TZYA 3X1SD 1P3GD 1P3BA 2NQBA 3LZ0C 3UTBB 1U35C 1T3UA 5AV5D 1P3AA 1F66C 3EPJA 3REIA 2L5AA 1ID3C 3AZFC 1EQZA 4KUDC 5DNNC 3W98D 5B0YD 3X1TA 2NZDA 5GT0A 1KX5B 1P3FA 1P3KC 3AZGC 2YFWB 3REHB 4WU8A 1P3ID 3VH5W 3WTPC 3AZHD 4Z5TC 4J8WA 5E5AD 2CV5A 3EPHA 3A1IA 1M18A 4NE3A 5B32B 5GXQA 5CHLB 3MVDA 1BFMA 1KX4B 4Z66C 2PYOD 3WA9B 5CP6C 3W96B 4KGCA 4XUJB 2F8NB 1BH8B 3UTBD 1TAFA 2FJ7C 1AOIA 2ZM5A 3AZIB 2RVQD 3MGPD 3AFAA 4WV4B 5AY8B 3UTAB 1KX5D 2IO5B 3VH5A 3REHD 5B2IC 4WJ3C 2BG1A 4H9RA 2RIQA 5B40C 1F66A 5DNMD 1ID3A 4EO5B 5B1LA 2FFFB 4CAYA 2HUEC 5B32D 4AWLB 4G92C 4KUDA 3B6GB 5CPJC 1P3KA 5BS7A 3A6NA 3AZGA 4CSRA 3WA9D 2CWEA 3KFUG 2JE5A 3AV1C 4QLCB 4XUJD 2F8ND 4Z5TA 1P34B 1P3LC 3AZJC 3W99A 3REJA 3AZID 4J8XC 4H9PA 5AY8D 3UTAD 4G91B 5GSUA 3AN2C 1P3OD 3C1BB 2F8NK 1S32B 5B2JB 3O62B 4JJNB 5JRGC 3LZ1B 3MGSC 5B33C 2FJ7A 1KX3B 3AZED 3B0CT 4ZUXB 4NE5A 3AV2A 5GT3C 3RELC 5AV9C 4WU9B 3VH6T 3WAAA 3B6GD 3R45B 1ULYA 4R8PC 1P3PD 5B24A 3REKA 4LD9C 1TZYC 4QLCD 3LJAB 3MGQC 5B40A 1P34D 1P3BC 1M19C 3MNNA 4H9NA 4YM6B 1EQZC 3WTPE 3KUYA 5CPJA 4XZQB 3X1TC 1M18B 2NQBB 1P3FC 3C1BD 3AV1A 1S32D 5AVCA 1P3AB 3REIB 5B2JD 3O62D 3B0DB 3B6FC 4JJND 3A1KA 3EPKA 2Y2KA 4H9OA 5B0ZC 2AROA 1KX3D 4E45A 2NZDB 3AYWC 5GT0B 4ZUXD 2ZY3A 1P3FB 4WU9D 3AN2A 5GXQC 4WU8B 3MVDC 1P3MC 3UT9A 2YFVA 3X1VB 4J8WB 4ZBJC 3KXBA 2CV5B 5AV6C 2Y2PA 5JRGA 5B33A 3LJAD 5AV5C 3MGSA 4KGCC 5C3IB 4J8UC 4X23C 1AOIC 5GT3A 5AV9A 2ZY2A 3W97A 4YM6D 3AZKD 4XZQD 1M18D 2F2AC 4R8PA 4LD9A 5KDMA 5G49A 1TAFB 3MGQA 4J8VC 5B1MC 3REID 1M19A 2G5IC 3AZMB 5BNXB 1HQ3A 4WNNB 1Q9CA 3AFAB 4NFTA 2NZDD 1F1EA 5CPKB 5B1LC 4UUZA 3AZLC 4WU8D 1BH9B 4H9RB 3LELD 3MGRC 1N1JA 5BS7C 3LZ0B 3H0RC 4HGAC 3A6NC 3AZNC 3X1VD 1U35B 4J8WD 1F66B 1ID3B 2CV5D 3B6FA 3V9RA 3AZFB 4KUDB 5DNNB 5B0ZA 3AYWA 3W99C 1B67A 1P3KB 3REJC 3AZGB 4CSRB 1P3MA 3KWQA 5GSUC 3WTPB 3X1SA 4Z5TB 3TU4C 3VH6A 5AV6A 5AV5A 5DNMC 4J8UA 3AZMD 5JA4A 4X23A 5BT1C 4Z66B 2ZY5A 5B0YA 3C1CC 5CPKD 4DQYB 5CP6B 3WAAC 3AV2C 1JFIA 3LZ0D 2FJ7B 1U35D 4J8VA 5B1MA 5B24C 3REKC 1ID3D 5E5AA 5BNVB 3AZFD 4KUDD 5DNND 1ZLAC 3MNNC 2PYOA 3AZGD 5B2IB 3AZLA 5AVBC 1P3OC 3KUYC 5B31C 3MGRA 3AZNA 1KX4D 3WTPD 5B40B 4KHAA 2VQRA 4E44A 3UTBA 3W96D 5AVCC 2HUEB 3AZEC 4G92B 3MGPA 3EPLA 5CPJB 4Z66D 2AROC 1A7WA 1H3OA 3WKJC 5CP6D 3AV1B 2YFWA 3REHA 1P3PC 1P3LB 3TU4A 3AZJB 5AV8C 3UT9C 3P5JB 2FJ7D 4H9QA 5DNMA 3KXBC 4J8XB 5B32A 3AN2B 2Y2JA 3C1CA 3NQUB 5B2ID 2W8SA 2YFVB 4YS3C 3W97C 2Y2OA 5JRGB 5B33B 4XUJA 2DF4C 1BH8A 5B40D 3MGSB 2F8NA 2HIOC 1M1AC 5GT3B 3RELB 5AV9B 1ZLAA 1HQ3C 5AY8A 5CPJD 3F6TA 3AL0C 2DQNC 3UTAA 5F99C 4R8PB 5AVBA 1P3OA 4LD9B 3AV1D 5B31A 1TZYB 5G49B 3MGQB 4NE6A 1P3LD 2BYMA 1P3BB 1M19B 3AZJD 3AZEA 4J8XD 3LZ1D 1EQZB 4UUZB 3AN2D 4Z2MH 3X1TB 3B6GA 3WKJA 1N1JB 3FDDA 3X1UC 1P3PA 3KWQC 5CPIC 3B6FB 5JRGD 5AV8A 5B33D 3MGSD 5B0ZB 3X1SC 1P3GC 3VH5T 3AYWB 2F8NH 3RELD 5GXQB 3MVDB 1P3MB 3W98C 4YS3A 5B0YC 3H0LC 4LD9D 4ZBJB 3LELC 1TZYD 5AV6B 2XD1A 3MGQD 1S32A 4KGCB 5AV5B 3B0CW 1P3IC 1P3BD 4J8UB 2NQBD 2HIOA 5JA4B 4X23B 1P3AD 1M1AA 3AZHC 3VH6W 1KX3A 1AOIB 5E5AC 4UPKA 4Z2MG 1EQZD 4WU9A 3X1TD 5F99A 5GT0D 1JFIB 5B32G 1P3FD 3IP4C 3R45A 2PYOC 4J8VB 5B1MB 5BO0A 5B0ZD 3AYWD 3UTBC 5B1LB 2F8NG 4CAYB 1P3MD 5GXQD 3MVDD 3AZLB 4YM6A 2RVQC 3MGPC 3AZKA 3MGRB 3AZNB 4XZQA 4HGAB 3A6NB 3X1UA 1KX5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY8 A;  4KHA B;  5CPI A;  5AV6 D;  3REH C;  4KGC D;  4J8U D;  1P3G A;  5B31 G;  4WZS B;  3MGP B;  4X23 D;  3W99 B;  1AOI D;  3REJ B;  5FUG A;  1H3O B;  4H9P B;  3AFA D;  5B32 C;  5GSU B;  3W98 A;  3TU4 B;  3LEL A;  1KX4 C;  3X1V A;  4J8V D;  5B1M D;  4H9Q B;  1P3I A;  3WA9 C;  5DNM B;  3W96 C;  2BYK A;  4XUJ C;  1F66 D;  3AZH A;  3C1C B;  5B1L D;  1R4V A;  3AV2 B;  3AZL D;  3WAA B;  3AZI C;  5AY8 C;  3MGR D;  3AZN D;  1P3K D;  3UTA C;  3A6N D;  5B24 B;  3REK B;  3NQJ A;  2IO5 C;  4Z5T D;  1ZLA B;  3AZM A;  5BNX A;  4WNN A;  3W99 D;  4H9S C;  3MNN B;  3REJ D;  4H9N B;  4EO5 C;  5AVB B;  5CPK A;  1P3O B;  3KUY B;  5B31 B;  4AWL C;  5GSU D;  1BH9 A;  2BYM B;  3B6G C;  3TU4 D;  1KX5 A;  3LZ0 A;  1U35 A;  5AVC B;  3AZE B;  3AZF A;  4QLC C;  4H9O B;  5BT1 D;  5DNN A;  2ARO B;  1P34 C;  3C1C D;  1KU5 A;  3WKJ B;  1HTA A;  3AV2 D;  3WAA D;  1P3P B;  1B6W A;  1WWS A;  1KX4 A;  4G91 C;  5AV8 B;  3UT9 B;  3WTP A;  3WA9 A;  4DRA A;  5B24 D;  3REK D;  3KXB B;  3C1B C;  3W96 A;  1S32 C;  4DRB A;  5B2J C;  3O62 C;  1ZLA D;  4JJN C;  3LZ1 C;  3MNN D;  1KX3 C;  4Z66 A;  4YS3 B;  5AVB D;  4ZUX C;  3W97 B;  3AZI A;  3KUY D;  5B31 D;  3KSY A;  5CP6 A;  4WU9 C;  2HIO B;  5KDM B;  5AVC D;  1M1A B;  5BNV A;  1HQ3 B;  4H9S A;  3LJA C;  2ARO D;  5F99 B;  4M6B A;  3WKJ D;  5B2I A;  4YM6 C;  3AZK C;  4XZQ C;  5AV8 D;  3UT9 D;  5BO0 B;  1M18 C;  2NQB C;  3KXB D;  3V9R B;  4QLC A;  1P3A C;  3REI C;  1P34 A;  3B0D C;  3AZK B;  4YS3 D;  5GT3 D;  2NZD C;  5AV9 D;  5GT0 C;  3X1U B;  3W97 D;  3KWQ B;  5CPI B;  4WU8 C;  4R8P D;  3X1S B;  1P3L A;  1P3G B;  2HIO D;  3C1B A;  3AZJ A;  3X1V C;  1M1A D;  4J8W C;  2JSS A;  5B2J A;  3O62 A;  5FUG B;  2CV5 C;  1M19 D;  4JJN A;  4J8X A;  1HQ3 D;  3LZ1 A;  5C3I C;  3W98 B;  5F99 D;  5B0Y B;  4ZUX A;  3LEL B;  3NQU A;  1P3I B;  2BYK B;  3B0B A;  3AZH B;  5E5A B;  3B6F D;  3LJA A;  3REL A;  3AZM C;  3AFA C;  1WWI A;  2PYO B;  3X1U D;  5CPK C;  3KWQ D;  3NQJ B;  5CPI D;  1TZY A;  3X1S D;  1P3G D;  1P3B A;  2NQB A;  3LZ0 C;  3UTB B;  1U35 C;  5AV5 D;  1P3A A;  1F66 C;  3REI A;  2L5A A;  1ID3 C;  3AZF C;  1EQZ A;  4KUD C;  5DNN C;  3W98 D;  5B0Y D;  3X1T A;  2NZD A;  5GT0 A;  1KX5 B;  1P3F A;  1P3K C;  3AZG C;  2YFW B;  3REH B;  4WU8 A;  1P3I D;  3VH5 W;  3WTP C;  3AZH D;  4Z5T C;  4J8W A;  5E5A D;  2CV5 A;  1M18 A;  4NE3 A;  5B32 B;  5GXQ A;  5CHL B;  3MVD A;  1BFM A;  1KX4 B;  4Z66 C;  2PYO D;  3WA9 B;  5CP6 C;  3W96 B;  4KGC A;  4XUJ B;  2F8N B;  1BH8 B;  3UTB D;  1TAF A;  2FJ7 C;  1AOI A;  3AZI B;  2RVQ D;  3MGP D;  3AFA A;  4WV4 B;  5AY8 B;  3UTA B;  1KX5 D;  2IO5 B;  3VH5 A;  3REH D;  5B2I C;  4H9R A;  5B40 C;  1F66 A;  5DNM D;  1ID3 A;  4EO5 B;  5B1L A;  4CAY A;  2HUE C;  5B32 D;  4AWL B;  4G92 C;  4KUD A;  3B6G B;  5CPJ C;  1P3K A;  5BS7 A;  3A6N A;  3AZG A;  4CSR A;  3WA9 D;  2CWE A;  3AV1 C;  4QLC B;  4XUJ D;  2F8N D;  4Z5T A;  1P34 B;  1P3L C;  3AZJ C;  3W99 A;  3REJ A;  3AZI D;  4J8X C;  4H9P A;  5AY8 D;  3UTA D;  4G91 B;  5GSU A;  3AN2 C;  1P3O D;  3C1B B;  2F8N K;  1S32 B;  5B2J B;  3O62 B;  4JJN B;  5JRG C;  3LZ1 B;  3MGS C;  5B33 C;  2FJ7 A;  1KX3 B;  3AZE D;  3B0C T;  4ZUX B;  4NE5 A;  3AV2 A;  5GT3 C;  3REL C;  5AV9 C;  4WU9 B;  3VH6 T;  3WAA A;  3B6G D;  3R45 B;  1ULY A;  4R8P C;  1P3P D;  5B24 A;  3REK A;  4LD9 C;  1TZY C;  4QLC D;  3LJA B;  3MGQ C;  5B40 A;  1P34 D;  1P3B C;  1M19 C;  3MNN A;  4H9N A;  4YM6 B;  1EQZ C;  3WTP E;  3KUY A;  5CPJ A;  4XZQ B;  3X1T C;  1M18 B;  2NQB B;  1P3F C;  3C1B D;  3AV1 A;  1S32 D;  5AVC A;  1P3A B;  3REI B;  5B2J D;  3O62 D;  3B0D B;  3B6F C;  4JJN D;  4H9O A;  1KX3 D;  5B0Z C;  2ARO A;  4E45 A;  2NZD B;  3AYW C;  5GT0 B;  4ZUX D;  1P3F B;  4WU9 D;  3AN2 A;  5GXQ C;  4WU8 B;  3MVD C;  1P3M C;  3UT9 A;  2YFV A;  3X1V B;  4J8W B;  4ZBJ C;  3KXB A;  2CV5 B;  5AV6 C;  5JRG A;  3LJA D;  5B33 A;  3MGS A;  5AV5 C;  4KGC C;  5C3I B;  4J8U C;  4X23 C;  1AOI C;  5GT3 A;  5AV9 A;  3W97 A;  4YM6 D;  3AZK D;  4XZQ D;  1M18 D;  4R8P A;  4LD9 A;  5KDM A;  5G49 A;  1TAF B;  3MGQ A;  4J8V C;  5B1M C;  3REI D;  1M19 A;  3AZM B;  5BNX B;  1HQ3 A;  4WNN B;  1Q9C A;  3AFA B;  4NFT A;  2NZD D;  1F1E A;  5CPK B;  5B1L C;  4UUZ A;  3AZL C;  4WU8 D;  1BH9 B;  4H9R B;  3LEL D;  3MGR C;  1N1J A;  5BS7 C;  3LZ0 B;  4HGA C;  3A6N C;  3AZN C;  3X1V D;  1U35 B;  4J8W D;  1F66 B;  1ID3 B;  2CV5 D;  3B6F A;  3V9R A;  3AZF B;  4KUD B;  5DNN B;  5B0Z A;  3AYW A;  3W99 C;  1B67 A;  1P3K B;  3REJ C;  3AZG B;  4CSR B;  1P3M A;  3KWQ A;  5GSU C;  3WTP B;  3X1S A;  4Z5T B;  3TU4 C;  3VH6 A;  5AV6 A;  5AV5 A;  5DNM C;  4J8U A;  3AZM D;  5JA4 A;  4X23 A;  5BT1 C;  4Z66 B;  5B0Y A;  3C1C C;  5CPK D;  5CP6 B;  3WAA C;  3AV2 C;  1JFI A;  3LZ0 D;  2FJ7 B;  1U35 D;  4J8V A;  5B1M A;  5B24 C;  3REK C;  1ID3 D;  5E5A A;  5BNV B;  3AZF D;  4KUD D;  5DNN D;  1ZLA C;  3MNN C;  2PYO A;  3AZG D;  5B2I B;  3AZL A;  5AVB C;  1P3O C;  3KUY C;  5B31 C;  3MGR A;  3AZN A;  1KX4 D;  3WTP D;  5B40 B;  4KHA A;  4E44 A;  3UTB A;  3W96 D;  5AVC C;  2HUE B;  3AZE C;  4G92 B;  3MGP A;  5CPJ B;  4Z66 D;  2ARO C;  1A7W A;  1H3O A;  3WKJ C;  5CP6 D;  3AV1 B;  2YFW A;  3REH A;  1P3P C;  1P3L B;  3TU4 A;  3AZJ B;  5AV8 C;  3UT9 C;  2FJ7 D;  4H9Q A;  5DNM A;  3KXB C;  4J8X B;  5B32 A;  3AN2 B;  3C1C A;  3NQU B;  5B2I D;  2YFV B;  4YS3 C;  3W97 C;  5JRG B;  5B33 B;  4XUJ A;  3MGS B;  1BH8 A;  5B40 D;  2F8N A;  2HIO C;  1M1A C;  5GT3 B;  3REL B;  5AV9 B;  1ZLA A;  1HQ3 C;  5AY8 A;  5CPJ D;  3UTA A;  5F99 C;  4R8P B;  5AVB A;  1P3O A;  4LD9 B;  3AV1 D;  5B31 A;  1TZY B;  5G49 B;  3MGQ B;  4NE6 A;  1P3L D;  2BYM A;  1P3B B;  1M19 B;  3AZJ D;  3AZE A;  4J8X D;  3LZ1 D;  1EQZ B;  4UUZ B;  3AN2 D;  4Z2M H;  3X1T B;  3B6G A;  3WKJ A;  1N1J B;  3X1U C;  1P3P A;  3KWQ C;  5CPI C;  3B6F B;  5JRG D;  5AV8 A;  5B33 D;  3MGS D;  5B0Z B;  3X1S C;  1P3G C;  3VH5 T;  3AYW B;  2F8N H;  3REL D;  5GXQ B;  3MVD B;  1P3M B;  3W98 C;  4YS3 A;  5B0Y C;  4LD9 D;  4ZBJ B;  3LEL C;  1TZY D;  5AV6 B;  1S32 A;  3MGQ D;  4KGC B;  5AV5 B;  3B0C W;  1P3I C;  1P3B D;  4J8U B;  2NQB D;  2HIO A;  5JA4 B;  4X23 B;  1P3A D;  1M1A A;  3AZH C;  3VH6 W;  1KX3 A;  1AOI B;  5E5A C;  1EQZ D;  4Z2M G;  4WU9 A;  3X1T D;  5F99 A;  5GT0 D;  1JFI B;  5B32 G;  1P3F D;  3R45 A;  2PYO C;  4J8V B;  5B1M B;  5BO0 A;  5B0Z D;  3AYW D;  3UTB C;  5B1L B;  2F8N G;  4CAY B;  1P3M D;  5GXQ D;  3MVD D;  3AZL B;  4YM6 A;  2RVQ C;  3MGP C;  3AZK A;  3MGR B;  3AZN B;  4XZQ A;  4HGA B;  3A6N B;  3X1U A;  1KX5 C; 
#chains in the Genus database with same CATH topology
 2LY8 A;  4KHA B;  5CPI A;  5AV6 D;  3REH C;  4KGC D;  4J8U D;  1P3G A;  5B31 G;  4WZS B;  3MGP B;  4X23 D;  3W99 B;  1AOI D;  3REJ B;  5FUG A;  1H3O B;  4H9P B;  3AFA D;  5B32 C;  5GSU B;  3W98 A;  2Y2L A;  3TU4 B;  3LEL A;  1KX4 C;  3X1V A;  2Y2Q A;  4J8V D;  5B1M D;  4H9Q B;  1P3I A;  3WA9 C;  5DNM B;  2Y2H A;  3W96 C;  2BYK A;  4XUJ C;  1F66 D;  3AZH A;  3C1C B;  5B1L D;  1R4V A;  3AV2 B;  3AZL D;  3WAA B;  3AZI C;  5AY8 C;  1Z2C B;  3MGR D;  3AZN D;  3UTA C;  3A6N D;  1P3K D;  2Y2N A;  5B24 B;  3REK B;  3NQJ A;  2IO5 C;  4Z5T D;  1ZLA B;  3AZM A;  5BNX A;  4WNN A;  3W99 D;  4H9S C;  3MNN B;  3REJ D;  4H9N B;  4EO5 C;  5AVB B;  5CPK A;  1P3O B;  3KUY B;  5B31 B;  4AWL C;  5GSU D;  1BH9 A;  2BYM B;  3B6G C;  3TU4 D;  1KX5 A;  3LZ0 A;  1U35 A;  5AVC B;  2XD5 A;  3AZE B;  3AZF A;  4QLC C;  4H9O B;  5BT1 D;  5DNN A;  2ARO B;  1P34 C;  2Y2M A;  3C1C D;  1KU5 A;  2UWX A;  3WKJ B;  1HTA A;  3AV2 D;  3WAA D;  1P3P B;  1B6W A;  1WWS A;  1KX4 A;  4G91 C;  5AV8 B;  3UT9 B;  3WTP A;  3WA9 A;  4DRA A;  5B24 D;  3REK D;  3KXB B;  3C1B C;  3W96 A;  1S32 C;  1PZR A;  2JCH A;  4DRB A;  5B2J C;  3O62 C;  1ZLA D;  4JJN C;  3LZ1 C;  3MNN D;  1KX3 C;  4Z66 A;  4YS3 B;  5AVB D;  4ZUX C;  3W97 B;  3AZI A;  3KUY D;  5B31 D;  3KSY A;  5CP6 A;  4WU9 C;  2HIO B;  2ZY4 A;  5KDM B;  1W2E A;  5AVC D;  1M1A B;  5BNV A;  2J8P A;  1HQ3 B;  4H9S A;  3LJA C;  2ARO D;  2Y2G A;  5F99 B;  4M6B A;  3WKJ D;  5B2I A;  4YM6 C;  3AZK C;  4XZQ C;  5AV8 D;  3UT9 D;  5BO0 B;  1M18 C;  2NQB C;  3KXB D;  3V9R B;  4QLC A;  1P3A C;  3REI C;  1P34 A;  3B0D C;  3AZK B;  4YS3 D;  5GT3 D;  2NZD C;  5AV9 D;  5GT0 C;  3X1U B;  3W97 D;  3KWQ B;  5CPI B;  4WU8 C;  4R8P D;  3X1S B;  1P3L A;  1P3G B;  2HIO D;  3C1B A;  3AZJ A;  3X1V C;  3EG5 B;  1M1A D;  4J8W C;  2JSS A;  5B2J A;  3O62 A;  5FUG B;  2CV5 C;  1M19 D;  4JJN A;  4J8X A;  1HQ3 D;  3LZ1 A;  5C3I C;  3W98 B;  5F99 D;  5B0Y B;  4ZUX A;  3LEL B;  2Y2I A;  3NQU A;  1P3I B;  2BYK B;  3B0B A;  3AZH B;  5E5A B;  3B6F D;  3LJA A;  3REL A;  3AZM C;  3AFA C;  1WWI A;  2PYO B;  2G5H C;  3H0M C;  3X1U D;  5CPK C;  3KWQ D;  3NQJ B;  5CPI D;  1TZY A;  3X1S D;  1P3G D;  1P3B A;  2NQB A;  3LZ0 C;  3UTB B;  1U35 C;  1T3U A;  5AV5 D;  1P3A A;  1F66 C;  3EPJ A;  3REI A;  2L5A A;  1ID3 C;  3AZF C;  1EQZ A;  4KUD C;  5DNN C;  3W98 D;  5B0Y D;  3X1T A;  2NZD A;  5GT0 A;  1KX5 B;  1P3F A;  1P3K C;  3AZG C;  2YFW B;  3REH B;  4WU8 A;  1P3I D;  3VH5 W;  3WTP C;  3AZH D;  4Z5T C;  4J8W A;  5E5A D;  2CV5 A;  3EPH A;  3A1I A;  1M18 A;  4NE3 A;  5B32 B;  5GXQ A;  5CHL B;  3MVD A;  1BFM A;  1KX4 B;  4Z66 C;  2PYO D;  3WA9 B;  5CP6 C;  3W96 B;  4KGC A;  4XUJ B;  2F8N B;  1BH8 B;  3UTB D;  1TAF A;  2FJ7 C;  1AOI A;  2ZM5 A;  3AZI B;  2RVQ D;  3MGP D;  3AFA A;  4WV4 B;  5AY8 B;  3UTA B;  1KX5 D;  2IO5 B;  3VH5 A;  3REH D;  5B2I C;  4WJ3 C;  2BG1 A;  4H9R A;  2RIQ A;  5B40 C;  1F66 A;  5DNM D;  1ID3 A;  4EO5 B;  5B1L A;  2FFF B;  4CAY A;  2HUE C;  5B32 D;  4AWL B;  4G92 C;  4KUD A;  3B6G B;  5CPJ C;  1P3K A;  5BS7 A;  3A6N A;  3AZG A;  4CSR A;  3WA9 D;  2CWE A;  3KFU G;  2JE5 A;  3AV1 C;  4QLC B;  4XUJ D;  2F8N D;  4Z5T A;  1P34 B;  1P3L C;  3AZJ C;  3W99 A;  3REJ A;  3AZI D;  4J8X C;  4H9P A;  5AY8 D;  3UTA D;  4G91 B;  5GSU A;  3AN2 C;  1P3O D;  3C1B B;  2F8N K;  1S32 B;  5B2J B;  3O62 B;  4JJN B;  5JRG C;  3LZ1 B;  3MGS C;  5B33 C;  2FJ7 A;  1KX3 B;  3AZE D;  3B0C T;  4ZUX B;  4NE5 A;  3AV2 A;  5GT3 C;  3REL C;  5AV9 C;  4WU9 B;  3VH6 T;  3WAA A;  3B6G D;  3R45 B;  1ULY A;  4R8P C;  1P3P D;  5B24 A;  3REK A;  4LD9 C;  1TZY C;  4QLC D;  3LJA B;  3MGQ C;  5B40 A;  1P34 D;  1P3B C;  1M19 C;  3MNN A;  4H9N A;  4YM6 B;  1EQZ C;  3WTP E;  3KUY A;  5CPJ A;  4XZQ B;  3X1T C;  1M18 B;  2NQB B;  1P3F C;  3C1B D;  3AV1 A;  1S32 D;  5AVC A;  1P3A B;  3REI B;  5B2J D;  3O62 D;  3B0D B;  3B6F C;  4JJN D;  3A1K A;  3EPK A;  2Y2K A;  4H9O A;  5B0Z C;  2ARO A;  1KX3 D;  4E45 A;  2NZD B;  3AYW C;  5GT0 B;  4ZUX D;  2ZY3 A;  1P3F B;  4WU9 D;  3AN2 A;  5GXQ C;  4WU8 B;  3MVD C;  1P3M C;  3UT9 A;  2YFV A;  3X1V B;  4J8W B;  4ZBJ C;  3KXB A;  2CV5 B;  5AV6 C;  2Y2P A;  5JRG A;  5B33 A;  3LJA D;  5AV5 C;  3MGS A;  4KGC C;  5C3I B;  4J8U C;  4X23 C;  1AOI C;  5GT3 A;  5AV9 A;  2ZY2 A;  3W97 A;  4YM6 D;  3AZK D;  4XZQ D;  1M18 D;  2F2A C;  4R8P A;  4LD9 A;  5KDM A;  5G49 A;  1TAF B;  3MGQ A;  4J8V C;  5B1M C;  3REI D;  1M19 A;  2G5I C;  3AZM B;  5BNX B;  1HQ3 A;  4WNN B;  1Q9C A;  3AFA B;  4NFT A;  2NZD D;  1F1E A;  5CPK B;  5B1L C;  4UUZ A;  3AZL C;  4WU8 D;  1BH9 B;  4H9R B;  3LEL D;  3MGR C;  1N1J A;  5BS7 C;  3LZ0 B;  3H0R C;  4HGA C;  3A6N C;  3AZN C;  3X1V D;  1U35 B;  4J8W D;  1F66 B;  1ID3 B;  2CV5 D;  3B6F A;  3V9R A;  3AZF B;  4KUD B;  5DNN B;  5B0Z A;  3AYW A;  3W99 C;  1B67 A;  1P3K B;  3REJ C;  3AZG B;  4CSR B;  1P3M A;  3KWQ A;  5GSU C;  3WTP B;  3X1S A;  4Z5T B;  3TU4 C;  3VH6 A;  5AV6 A;  5AV5 A;  5DNM C;  4J8U A;  3AZM D;  5JA4 A;  4X23 A;  5BT1 C;  4Z66 B;  2ZY5 A;  5B0Y A;  3C1C C;  5CPK D;  4DQY B;  5CP6 B;  3WAA C;  3AV2 C;  1JFI A;  3LZ0 D;  2FJ7 B;  1U35 D;  4J8V A;  5B1M A;  5B24 C;  3REK C;  1ID3 D;  5E5A A;  5BNV B;  3AZF D;  4KUD D;  5DNN D;  1ZLA C;  3MNN C;  2PYO A;  3AZG D;  5B2I B;  3AZL A;  5AVB C;  1P3O C;  3KUY C;  5B31 C;  3MGR A;  3AZN A;  1KX4 D;  3WTP D;  5B40 B;  4KHA A;  2VQR A;  4E44 A;  3UTB A;  3W96 D;  5AVC C;  2HUE B;  3AZE C;  4G92 B;  3MGP A;  3EPL A;  5CPJ B;  4Z66 D;  2ARO C;  1A7W A;  1H3O A;  3WKJ C;  5CP6 D;  3AV1 B;  2YFW A;  3REH A;  1P3P C;  1P3L B;  3TU4 A;  3AZJ B;  5AV8 C;  3UT9 C;  3P5J B;  2FJ7 D;  4H9Q A;  5DNM A;  3KXB C;  4J8X B;  5B32 A;  3AN2 B;  2Y2J A;  3C1C A;  3NQU B;  5B2I D;  2W8S A;  2YFV B;  4YS3 C;  3W97 C;  2Y2O A;  5JRG B;  5B33 B;  4XUJ A;  2DF4 C;  1BH8 A;  5B40 D;  3MGS B;  2F8N A;  2HIO C;  1M1A C;  5GT3 B;  3REL B;  5AV9 B;  1ZLA A;  1HQ3 C;  5AY8 A;  5CPJ D;  3F6T A;  3AL0 C;  2DQN C;  3UTA A;  5F99 C;  4R8P B;  5AVB A;  1P3O A;  4LD9 B;  3AV1 D;  5B31 A;  1TZY B;  5G49 B;  3MGQ B;  4NE6 A;  1P3L D;  2BYM A;  1P3B B;  1M19 B;  3AZJ D;  3AZE A;  4J8X D;  3LZ1 D;  1EQZ B;  4UUZ B;  3AN2 D;  4Z2M H;  3X1T B;  3B6G A;  3WKJ A;  1N1J B;  3FDD A;  3X1U C;  1P3P A;  3KWQ C;  5CPI C;  3B6F B;  5JRG D;  5AV8 A;  5B33 D;  3MGS D;  5B0Z B;  3X1S C;  1P3G C;  3VH5 T;  3AYW B;  2F8N H;  3REL D;  5GXQ B;  3MVD B;  1P3M B;  3W98 C;  4YS3 A;  5B0Y C;  3H0L C;  4LD9 D;  4ZBJ B;  3LEL C;  1TZY D;  5AV6 B;  2XD1 A;  3MGQ D;  1S32 A;  4KGC B;  5AV5 B;  3B0C W;  1P3I C;  1P3B D;  4J8U B;  2NQB D;  2HIO A;  5JA4 B;  4X23 B;  1P3A D;  1M1A A;  3AZH C;  3VH6 W;  1KX3 A;  1AOI B;  5E5A C;  4UPK A;  4Z2M G;  1EQZ D;  4WU9 A;  3X1T D;  5F99 A;  5GT0 D;  1JFI B;  5B32 G;  1P3F D;  3IP4 C;  3R45 A;  2PYO C;  4J8V B;  5B1M B;  5BO0 A;  5B0Z D;  3AYW D;  3UTB C;  5B1L B;  2F8N G;  4CAY B;  1P3M D;  5GXQ D;  3MVD D;  3AZL B;  4YM6 A;  2RVQ C;  3MGP C;  3AZK A;  3MGR B;  3AZN B;  4XZQ A;  4HGA B;  3A6N B;  3X1U A;  1KX5 C; 
#chains in the Genus database with same CATH homology
 2LY8 A;  4KHA B;  5CPI A;  5AV6 D;  3REH C;  4KGC D;  4J8U D;  1P3G A;  5B31 G;  4WZS B;  3MGP B;  4X23 D;  3W99 B;  1AOI D;  3REJ B;  5FUG A;  1H3O B;  4H9P B;  3AFA D;  5B32 C;  5GSU B;  3W98 A;  2Y2L A;  3TU4 B;  3LEL A;  1KX4 C;  3X1V A;  2Y2Q A;  4J8V D;  5B1M D;  4H9Q B;  1P3I A;  3WA9 C;  5DNM B;  2Y2H A;  3W96 C;  2BYK A;  4XUJ C;  1F66 D;  3AZH A;  3C1C B;  5B1L D;  1R4V A;  3AV2 B;  3AZL D;  3WAA B;  3AZI C;  5AY8 C;  1Z2C B;  3MGR D;  3AZN D;  3UTA C;  3A6N D;  1P3K D;  2Y2N A;  5B24 B;  3REK B;  3NQJ A;  2IO5 C;  4Z5T D;  1ZLA B;  3AZM A;  5BNX A;  4WNN A;  3W99 D;  4H9S C;  3MNN B;  3REJ D;  4H9N B;  4EO5 C;  5AVB B;  5CPK A;  1P3O B;  3KUY B;  5B31 B;  4AWL C;  5GSU D;  1BH9 A;  2BYM B;  3B6G C;  3TU4 D;  1KX5 A;  3LZ0 A;  1U35 A;  5AVC B;  2XD5 A;  3AZE B;  3AZF A;  4QLC C;  4H9O B;  5BT1 D;  5DNN A;  2ARO B;  1P34 C;  2Y2M A;  3C1C D;  1KU5 A;  2UWX A;  3WKJ B;  1HTA A;  3AV2 D;  3WAA D;  1P3P B;  1B6W A;  1WWS A;  1KX4 A;  4G91 C;  5AV8 B;  3UT9 B;  3WTP A;  3WA9 A;  4DRA A;  5B24 D;  3REK D;  3KXB B;  3C1B C;  3W96 A;  1S32 C;  1PZR A;  2JCH A;  4DRB A;  5B2J C;  3O62 C;  1ZLA D;  4JJN C;  3LZ1 C;  3MNN D;  1KX3 C;  4Z66 A;  4YS3 B;  5AVB D;  4ZUX C;  3W97 B;  3AZI A;  3KUY D;  5B31 D;  3KSY A;  5CP6 A;  4WU9 C;  2HIO B;  2ZY4 A;  5KDM B;  1W2E A;  5AVC D;  1M1A B;  5BNV A;  2J8P A;  1HQ3 B;  4H9S A;  3LJA C;  2ARO D;  2Y2G A;  5F99 B;  4M6B A;  3WKJ D;  5B2I A;  4YM6 C;  3AZK C;  4XZQ C;  5AV8 D;  3UT9 D;  5BO0 B;  1M18 C;  2NQB C;  3KXB D;  3V9R B;  4QLC A;  1P3A C;  3REI C;  1P34 A;  3B0D C;  3AZK B;  4YS3 D;  5GT3 D;  2NZD C;  5AV9 D;  5GT0 C;  3X1U B;  3W97 D;  3KWQ B;  5CPI B;  4WU8 C;  4R8P D;  3X1S B;  1P3L A;  1P3G B;  2HIO D;  3C1B A;  3AZJ A;  3X1V C;  3EG5 B;  1M1A D;  4J8W C;  2JSS A;  5B2J A;  3O62 A;  5FUG B;  2CV5 C;  1M19 D;  4JJN A;  4J8X A;  1HQ3 D;  3LZ1 A;  5C3I C;  3W98 B;  5F99 D;  5B0Y B;  4ZUX A;  3LEL B;  2Y2I A;  3NQU A;  1P3I B;  2BYK B;  3B0B A;  3AZH B;  5E5A B;  3B6F D;  3LJA A;  3REL A;  3AZM C;  3AFA C;  1WWI A;  2PYO B;  2G5H C;  3H0M C;  3X1U D;  5CPK C;  3KWQ D;  3NQJ B;  5CPI D;  1TZY A;  3X1S D;  1P3G D;  1P3B A;  2NQB A;  3LZ0 C;  3UTB B;  1U35 C;  1T3U A;  5AV5 D;  1P3A A;  1F66 C;  3EPJ A;  3REI A;  2L5A A;  1ID3 C;  3AZF C;  1EQZ A;  4KUD C;  5DNN C;  3W98 D;  5B0Y D;  3X1T A;  2NZD A;  5GT0 A;  1KX5 B;  1P3F A;  1P3K C;  3AZG C;  2YFW B;  3REH B;  4WU8 A;  1P3I D;  3VH5 W;  3WTP C;  3AZH D;  4Z5T C;  4J8W A;  5E5A D;  2CV5 A;  3EPH A;  3A1I A;  1M18 A;  4NE3 A;  5B32 B;  5GXQ A;  5CHL B;  3MVD A;  1BFM A;  1KX4 B;  4Z66 C;  2PYO D;  3WA9 B;  5CP6 C;  3W96 B;  4KGC A;  4XUJ B;  2F8N B;  1BH8 B;  3UTB D;  1TAF A;  2FJ7 C;  1AOI A;  2ZM5 A;  3AZI B;  2RVQ D;  3MGP D;  3AFA A;  4WV4 B;  5AY8 B;  3UTA B;  1KX5 D;  2IO5 B;  3VH5 A;  3REH D;  5B2I C;  4WJ3 C;  2BG1 A;  4H9R A;  2RIQ A;  5B40 C;  1F66 A;  5DNM D;  1ID3 A;  4EO5 B;  5B1L A;  2FFF B;  4CAY A;  2HUE C;  5B32 D;  4AWL B;  4G92 C;  4KUD A;  3B6G B;  5CPJ C;  1P3K A;  5BS7 A;  3A6N A;  3AZG A;  4CSR A;  3WA9 D;  2CWE A;  3KFU G;  2JE5 A;  3AV1 C;  4QLC B;  4XUJ D;  2F8N D;  4Z5T A;  1P34 B;  1P3L C;  3AZJ C;  3W99 A;  3REJ A;  3AZI D;  4J8X C;  4H9P A;  5AY8 D;  3UTA D;  4G91 B;  5GSU A;  3AN2 C;  1P3O D;  3C1B B;  2F8N K;  1S32 B;  5B2J B;  3O62 B;  4JJN B;  5JRG C;  3LZ1 B;  3MGS C;  5B33 C;  2FJ7 A;  1KX3 B;  3AZE D;  3B0C T;  4ZUX B;  4NE5 A;  3AV2 A;  5GT3 C;  3REL C;  5AV9 C;  4WU9 B;  3VH6 T;  3WAA A;  3B6G D;  3R45 B;  1ULY A;  4R8P C;  1P3P D;  5B24 A;  3REK A;  4LD9 C;  1TZY C;  4QLC D;  3LJA B;  3MGQ C;  5B40 A;  1P34 D;  1P3B C;  1M19 C;  3MNN A;  4H9N A;  4YM6 B;  1EQZ C;  3WTP E;  3KUY A;  5CPJ A;  4XZQ B;  3X1T C;  1M18 B;  2NQB B;  1P3F C;  3C1B D;  3AV1 A;  1S32 D;  5AVC A;  1P3A B;  3REI B;  5B2J D;  3O62 D;  3B0D B;  3B6F C;  4JJN D;  3A1K A;  3EPK A;  2Y2K A;  4H9O A;  5B0Z C;  2ARO A;  1KX3 D;  4E45 A;  2NZD B;  3AYW C;  5GT0 B;  4ZUX D;  2ZY3 A;  1P3F B;  4WU9 D;  3AN2 A;  5GXQ C;  4WU8 B;  3MVD C;  1P3M C;  3UT9 A;  2YFV A;  3X1V B;  4J8W B;  4ZBJ C;  3KXB A;  2CV5 B;  5AV6 C;  2Y2P A;  5JRG A;  5B33 A;  3LJA D;  5AV5 C;  3MGS A;  4KGC C;  5C3I B;  4J8U C;  4X23 C;  1AOI C;  5GT3 A;  5AV9 A;  2ZY2 A;  3W97 A;  4YM6 D;  3AZK D;  4XZQ D;  1M18 D;  2F2A C;  4R8P A;  4LD9 A;  5KDM A;  5G49 A;  1TAF B;  3MGQ A;  4J8V C;  5B1M C;  3REI D;  1M19 A;  2G5I C;  3AZM B;  5BNX B;  1HQ3 A;  4WNN B;  1Q9C A;  3AFA B;  4NFT A;  2NZD D;  1F1E A;  5CPK B;  5B1L C;  4UUZ A;  3AZL C;  4WU8 D;  1BH9 B;  4H9R B;  3LEL D;  3MGR C;  1N1J A;  5BS7 C;  3LZ0 B;  3H0R C;  4HGA C;  3A6N C;  3AZN C;  3X1V D;  1U35 B;  4J8W D;  1F66 B;  1ID3 B;  2CV5 D;  3B6F A;  3V9R A;  3AZF B;  4KUD B;  5DNN B;  5B0Z A;  3AYW A;  3W99 C;  1B67 A;  1P3K B;  3REJ C;  3AZG B;  4CSR B;  1P3M A;  3KWQ A;  5GSU C;  3WTP B;  3X1S A;  4Z5T B;  3TU4 C;  3VH6 A;  5AV6 A;  5AV5 A;  5DNM C;  4J8U A;  3AZM D;  5JA4 A;  4X23 A;  5BT1 C;  4Z66 B;  2ZY5 A;  5B0Y A;  3C1C C;  5CPK D;  4DQY B;  5CP6 B;  3WAA C;  3AV2 C;  1JFI A;  3LZ0 D;  2FJ7 B;  1U35 D;  4J8V A;  5B1M A;  5B24 C;  3REK C;  1ID3 D;  5E5A A;  5BNV B;  3AZF D;  4KUD D;  5DNN D;  1ZLA C;  3MNN C;  2PYO A;  3AZG D;  5B2I B;  3AZL A;  5AVB C;  1P3O C;  3KUY C;  5B31 C;  3MGR A;  3AZN A;  1KX4 D;  3WTP D;  5B40 B;  4KHA A;  2VQR A;  4E44 A;  3UTB A;  3W96 D;  5AVC C;  2HUE B;  3AZE C;  4G92 B;  3MGP A;  3EPL A;  5CPJ B;  4Z66 D;  2ARO C;  1A7W A;  1H3O A;  3WKJ C;  5CP6 D;  3AV1 B;  2YFW A;  3REH A;  1P3P C;  1P3L B;  3TU4 A;  3AZJ B;  5AV8 C;  3UT9 C;  3P5J B;  2FJ7 D;  4H9Q A;  5DNM A;  3KXB C;  4J8X B;  5B32 A;  3AN2 B;  2Y2J A;  3C1C A;  3NQU B;  5B2I D;  2W8S A;  2YFV B;  4YS3 C;  3W97 C;  2Y2O A;  5JRG B;  5B33 B;  4XUJ A;  2DF4 C;  1BH8 A;  5B40 D;  3MGS B;  2F8N A;  2HIO C;  1M1A C;  5GT3 B;  3REL B;  5AV9 B;  1ZLA A;  1HQ3 C;  5AY8 A;  5CPJ D;  3F6T A;  3AL0 C;  2DQN C;  3UTA A;  5F99 C;  4R8P B;  5AVB A;  1P3O A;  4LD9 B;  3AV1 D;  5B31 A;  1TZY B;  5G49 B;  3MGQ B;  4NE6 A;  1P3L D;  2BYM A;  1P3B B;  1M19 B;  3AZJ D;  3AZE A;  4J8X D;  3LZ1 D;  1EQZ B;  4UUZ B;  3AN2 D;  4Z2M H;  3X1T B;  3B6G A;  3WKJ A;  1N1J B;  3FDD A;  3X1U C;  1P3P A;  3KWQ C;  5CPI C;  3B6F B;  5JRG D;  5AV8 A;  5B33 D;  3MGS D;  5B0Z B;  3X1S C;  1P3G C;  3VH5 T;  3AYW B;  2F8N H;  3REL D;  5GXQ B;  3MVD B;  1P3M B;  3W98 C;  4YS3 A;  5B0Y C;  3H0L C;  4LD9 D;  4ZBJ B;  3LEL C;  1TZY D;  5AV6 B;  2XD1 A;  3MGQ D;  1S32 A;  4KGC B;  5AV5 B;  3B0C W;  1P3I C;  1P3B D;  4J8U B;  2NQB D;  2HIO A;  5JA4 B;  4X23 B;  1P3A D;  1M1A A;  3AZH C;  3VH6 W;  1KX3 A;  1AOI B;  5E5A C;  4UPK A;  4Z2M G;  1EQZ D;  4WU9 A;  3X1T D;  5F99 A;  5GT0 D;  1JFI B;  5B32 G;  1P3F D;  3IP4 C;  3R45 A;  2PYO C;  4J8V B;  5B1M B;  5BO0 A;  5B0Z D;  3AYW D;  3UTB C;  5B1L B;  2F8N G;  4CAY B;  1P3M D;  5GXQ D;  3MVD D;  3AZL B;  4YM6 A;  2RVQ C;  3MGP C;  3AZK A;  3MGR B;  3AZN B;  4XZQ A;  4HGA B;  3A6N B;  3X1U A;  1KX5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...