3LEOA

Structure of human leukotriene c4 synthase mutant r31q in complex with glutathione
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
150
structure length
150
Chain Sequence
b'HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARQAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
molecule tags Lyase
source organism Homo sapiens
publication title Arginine 104 is a key catalytic residue in leukotriene C4 synthase.
pubmed doi rcsb
total genus 58
structure length 150
sequence length 150
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3leoA00
3DWWA 3LEOA 4JRZA 3B29A 2Q7RA 4JC7A 4AL0A 4NTAA 4J7YA 2H8AA 4YK5A 2PNOA 4JCZA 4YL0A 4J7TA 5BQGA 4NTBA 4WABA 4YL3A 5BQIA 4BPMA 2UUHA 4AL1A 4YL1A 3HKKA 5HV9A 5K0IA 5BQHA 3PCVA 4NTFA 2UUIA
chains in the Genus database with same CATH superfamily
2H7VC 3LEVA 4N06A 3J06A 4MVRA 1G4WR 2JX0A 1TR2A 4I1MA 2J7PA 2NUTB 2WVOA 3IPMO 3M15A 1I5NA 2RSEB 3OWTA 1JPJA 3O55A 2Q7RA 1RJ9B 4BJ6A 5CI8A 1IZMA 2P1AA 3FAJA 4YT2A 2MHRA 4YT4A 1ZW2A 4MVOA 2YRFA 3PHF2 4YL0A 1FNTc 3L8IA 2LIGA 4P9FA 3ZQVA 3JRTA 4CJGA 1QSPA 1K04A 5KYWB 1FR0A 5TJ5E 2R7VA 4XLPF 3I5QA 4LDKA 2NUPA 1O87A 2YL1A 3SEOA 4YN0B 1UG7A 1HE9A 4H4KC 2AVKA 5DLJA 2W4MA 5E33A 4E0HA 3K6BA 2YLIA 3S0XA 3O10A 4U5BE 5IY5C 2HSBA 3DM5A 1YA9A 3FOOA 4IAQA 3PCVA 1NSGB 5T1DB 3U3FA 5A6JA 3S28A 4CJOA 4IB4A 3K66A 3RF3A 1WOLA 3AG2C 1MMAA 3TK0A 3X1OA 4OIRF 5L0IA 5KYXA 4OIQF 1OCOC 2YL3A 4CBEA 2Y3BA 2HZ8A 1WTYA 1QVXA 3AOUA 3G4XA 5AGFA 1G8XA 1XWJA 4J7TA 1R4TA 3DAFA 4E7SA 4PJMA 3GM3A 5COFA 4W8PA 2KW3C 1YA7O 3LLKA 5AC4A 1H9TA 1M57C 1R5ID 5COGA 2QY9A 4CS8A 1JAFA 4FX5A 2L6GA 1HMOA 2P0NA 4MVQA 2Q9CA 3Q6NA 3RVYA 3NKDA 4CS8C 4F4BA 5JRAA 4G7ZF 3NMJA 2A1DD 2GDCA 4HE8D 3U9MA 1RJ9A 5T3TA 2XL8A 2L7AA 3IQTA 3AG1C 4JTAB 3GEHA 2VCAA 3EGDA 3L1MA 3SXYA 3QW0A 2IYLD 4AE4A 4XEKA 2M64A 2R7OA 2OJED 3AQBA 2G3VA 4CSAA 1BZ4A 4DBQA 1ORYA 1PV3A 2J7PD 3RKOF 1S05A 4YWQA 1NBBA 2Y69C 2XRHA 5BQGA 3Q6MA 4FAPB 3GANA 3NMIA 1CGOA 4OINF 2Q4FA 4ZLDA 4PFOA 4CIPA 1SF8A 2HSQA 3C8ZA 4XPYA 3WODF 3FOPA 2R05A 3Q7LA 1M6TA 1RXQA 2HMZA 3E9VA 3H2VA 4PFPA 1QQ3A 3WG7C 1EQ1A 4EHPA 4JKVA 2P61A 3S27A 3WHNA 5L0GA 3W2WA 3TJ5A 4I44A 5KYYA 2ETSA 1A7VA 2A0UA 1LI5A 2PF4E 3G50A 3B9QA 2DGJA 1VMAA 2XSEA 3I5PA 4CX9A 3MYFA 1V54C 3HTKC 3HNLA 3NKEA 1TFKB 3UR3C 1MNDA 4OIPF 3BEHA 2J0WA 3QTHA 4J7YA 2XS8A 2H8AA 1OR3A 4P6IC 3ZIBA 3LS1A 3NYMA 4KC9A 2YQYA 3FMSA 1QKRA 4NTBA 5B3SC 4JIOA 2R7QA 4U5CE 1MMGA 4U9DA 3UMKA 3X2QC 3VYWA 4ER9A 2IXPA 3KH2A 4CIHA 2KYHA 1GGQA 1T6QA 1MNEA 3AGUA 2XLOA 1YJGA 2IM8A 3K1HA 4QI2A 1JMWA 3LUTB 3EJNA 1TWAA 3IHUA 1GS9A 4IJJA 2J9WA 3V5ZA 2EPKX 2OEVA 4DVYP 2GFHA 3NG1A 1H6GA 4WJ0A 2XL6A 2HUJA 1VLTA 3FVYA 5GPGB 4BJ6C 1OQCA 2EPNA 3ZVRA 2XM0A 3SP1A 4EBBA 1Z6AA 4JC7A 4H54A 4YK5A 1YZAA 3SZRA 3GM1A 3V5XA 3LAYA 1J8MF 4ULWA 1V74B 2BC5A 2C04A 2VASA 1B68A 1YYXA 4JZAA 2AWCA 2OOCA 4E7ZA 2HJ3A 3DXJF 3MYIA 2XLVA 3RW0A 5KYXB 1SYQA 1IW7F 2NSGA 3ABKC 3SXMA 2VH3A 3E70C 4XEVA 2XL4A 1FTSA 2WVNA 3A9CA 4PJLA 5BQHA 3LS0A 5DVWA 2RD9A 3ZSUA 5EGYA 1ZHTA 2WZGA 1CGME 3KKBA 3EGDB 4NTFA 2XLDA 1O5HA 4MTGA 3U0CA 5DS6A 4IAOA 3HNKA 3IQCA 2IOQA 2R9RB 1Q0GA 3ASNC 3NYLA 2XLHA 4I3MA 1CPQA 4MW3A 4DXWA 4HEAJ 4LLCA 1LVKA 4JTDB 1LS4A 4C3BA 3ATPA 1CGNA 3EZHA 2J46A 3EG9A 4M63A 3TOMA 3VAYA 5DS4A 1FMWA 1U0BB 3C62A 3ZTZA 5L0JA 1TFOB 2G3KA 5DS5A 4JJGA 4ULVA 1LPEA 2A6EF 2NG1A 1MQVA 1A0BA 4QI0A 2W4BA 2Q9BA 2I8BA 1XZPA 3U2LA 2Y3GA 1WASA 3HKKA 1LIHA 2IXNA 3S84A 1ZHYA 5HSWA 1G4US 1YDIA 5KYUB 2Z15A 3O6XA 3W2VA 2J45A 3B0UX 4PR9A 4LACB 1O3UA 1ZVZA 2A68F 3CSKA 1LI7A 4CSAC 4CDYA 2P7VA 1N1CA 5F5FA 2VCCA 3T6JA 4RDAA 2KC3A 5EK0A 3N24A 2QE9A 1I4ZA 1V4AA 2LK4A 2MWQA 3QVYA 2R7WA 5B1BC 3ZC4A 3O39A 1C17M 1RKEB 2OU6A 3F47A 1RMVA 4DVZA 1ZZPA 3DAGA 3UNGC 2YL7A 1Y4CA 3V7OA 1LKXA 2MYSA 3S29A 5KYWA 3EHNA 1ZW3A 1ORSC 2QNLA 3UMIA 2V3CC 4DJ9A 2D5RB 2WB7A 3H65A 1RKEA 3DZAA 3EGXB 2AWYA 5JS5A 4U5DE 1OXKA 1ZHWA 4MTFA 4U9EA 4Z9JA 3UGPA 4HFFB 2IXOA 1AVOB 3CQZA 3U8PA 1D1BA 3GEIA 3VM6A 1JRAA 1VYIA 3HNJA 4IGGA 4MW8A 2R7XA 2PBEA 1D1CA 2OEXA 3S9OA 1ZYRF 1NFNA 2DYSC 3DE9A 1T9KA 2ASRA 3GWNA 3IEEA 3DJUB 3LJBA 4XPXA 4MVMA 3ZWIA 5D91A 4PACA 2R03A 4BJTA 2EPOA 4JVSA 1OCZC 4C7OB 4RD9A 1MMNA 4N6HA 1HY5A 1Y6DA 2YL0A 3NRHA 2XXAB 3G4ZA 1Z5ZA 4K0DA 4AX2A 3T6BA 1XZQA 4XPWA 1NFOA 4LDQA 4KI2A 2YZSA 2O9XA 3UMHA 3LNMB 3AG3C 1KNYA 5KYYB 3DJNB 1GM5A 3ZDLA 5DQTA 5A6BD 1VB5A 3DKAA 2XLEA 4G7OF 1E83A 2CGEA 2P6VA 4PJNA 2E87A 2NUTA 2PP4A 4X0RA 4HFKB 2V26A 2YEVA 1E85A 1E84A 1A7DA 3ZG1A 4UDVA 5E2QA 2HJMA 1C02A 1FFTC 3K1IA 3QMKA 4KNVA 4JCZA 4P9TA 5E3CA 2HKVA 3T9OA 3U8VA 2R25A 3QZCA 1BR2A 4AE4B 4U5FE 3QVZA 4EBKA 1YAUO 2I15A 3L0IA 1RKCA 2R02A 1KTMA 4RBNA 2HFIA 2EINC 1D0XA 1BR1A 3JZ0A 2A0BA 4BJ5A 1LE4A 3RFYA 4XLNF 5L3QA 2EPLX 3DD7A 2NUPB 1A41A 1EI7A 1WATA 4IWBA 4JURI 3EG9B 3K7DA 4QDLA 2YHSA 3RQEA 2Q3TA 3U2MA 1YARO 3NDBB 4Z9IA 1RCPA 3TULA 2L9JA 1VK5A 4JCHA 4AL0A 3R2PA 3AQCA 1CPRA 2J9VA 3AGTA 4MNDA 4YT5A 3BRJA 3C18A 3HNIA 1OR2A 3JSEO 2XLMA 3S90A 1PD1A 4G0HA 3TOLA 4KBLA 4O79A 4CS7A 4O6MA 2DI3A 4MQ9F 3RQGA 1EA8A 3AG4C 2QUPA 3N2ZB 2KSFA 3SXKA 3POVA 3L34A 2QLAA 3OA1A 1ZHZA 2BL2A 4LLEA 4EWCA 256BA 4J32B 4K7BA 5KYUA 2ZXPA 2HS5A 4LDRA 5FCLA 4C7OA 3Q7GA 3EH1A 3EFOB 2LFFA 1SR2A 1J8YF 1ZU4A 2NPUA 2YWAA 3DWWA 5L0FA 2EILC 4GQHA 3RH3A 3RYLA 3JRMO 4C3EA 5B1AC 2G62A 4N4WA 2PFDA 3SXZA 2LD6A 1W2WA 1I4YA 4N6CA 1APCA 1OW8A 2FAPB 2BE5F 2OKUA 3LESA 1D1AA 1OW6A 1TWGA 2PX0A 3HJCA 2L6FA 2PX3A 1V55C 1M2OA 5A6BA 1OCRC 4GYTA 4CS9A 1H7IA 4MVSA 1TWCA 3FAPB 1D0YA 2KJGA 1Q0KA 4PK4A 4OIOF 3M79A 2XLWA 3ITFA 1Q0DA 2B0JA 4XTKA 1YLMA 2KGOA 1G5ZA 4Z9HA 3EQLF 4ZLCA 3FDQA 1T6UA 4G7HF 2A69F 1MMDA 2UUIA 4A2NB 1T5OA 1TKNA 4LERA 4E17A 2HV7A 4JRZA 4O6YA 2W9YA 5DQZA 2L81A 3VRCA 4NC3A 2J9UA 2B0HA 4CDAA 1E2XA 2WZFA 3CAXA 2VCBA 2WVQA 2EIMC 2C03A 1OKKD 3GORA 4MS2A 5B3IA 5L0CA 2R7SA 2VB6A 5E3AA 3LLIA 2ZPAA 4K1OA 4OD5A 3ABMC 3SYNA 2J8WA 1U89A 2HV6A 2YLGA 1AEPA 2KK1A 3FXHA 2HMQA 1OW7A 3IQ5A 4NQFA 4XQ1A 4JW1A 2R7TA 3KYJA 2ICWG 1ZHXA 2UUHA 3GWLA 1YVIA 4AK9A 2WL8A 4E0IA 1KU2A 2ZXOA 4EIYA 4DRHB 1M2VA 2QTVA 1AUEA 3TJ6A 2XS1A 4U5HA 1SZIA 3VF0A 1DOWA 4BJ5C 4JJFA 2NSFA 5F28E 2DB4A 1NZEA 1L7CA 4GEHA 4EBJA 5BUOA 3T6GB 3U3BA 1DOVA 3M4CA 3DI5A 2R7UA 4KNWA 3WAQA 3T4RA 3C8GA 3TQOA 1Z63A 5COMA 2H7OA 3MBGA 1U6HA 2M4EA 3N0TA 4IARA 4IRUA 2CCYA 2Y3DA 4CDVA 5A69A 3M4BA 3EPVA 2JPUA 2OCCC 1VYKA 5CI9A 5FZTA 3U9JA 4Q4ZF 4B6IA 1HW2A 1BBHA 4XWJA 1SMYF 1K05A 2IXMA 3GEEA 1PD0A 3K33A 4JE9A 3MFNA 4WGZA 3CZ6A 1LE2A 4BPMA 4AL1A 3CEXA 3RQFA 2LP4A 2EPMX 5K0IA 1QLEC 2EIJC 3AJMA 4FWVA 2OJQA 2ZD9A 3RIPA 1PCXA 4BJ1A 3LNRA 3GODA 2L6HA 3UGOA 3US6A 1LM3B 1Z3IX 3DM9B 4MVZA 1ORJA 5D92A 5JSLA 1UFBA 1NG1A 2EIKC 2Q9AA 3C63A 5F5HA 3ZTMA 4BEJA 1ZU5A 5JVEA 1OCCC 3EHMA 1T6IA 3K1IC 1YYJA 1YZCA 2CYDA 3GM2A 3KMIA 3QW1A 3V5YA 2R7RA 2GAQA 2PNOA 1WGWA 2ZXWC 4EKWA 1JOGA 1ST6A 3R7CA 5JT4A 1M56C 4EUKB 1BDJB 3SNHA 3B0PA 3L8JA 3A11A 4L6RA 1NU9C 5L3VA 1QPUA 3KPHA 2TMVP 2H7BA 2J0XA 1LS1A 2KQ9A 4W8KA 4J30B 3OEOA 2LQGA 2GA0A 4PJJA 3M1CB 1FAPB 1FFHA 5A6AA 4OD4A 2KNHA 4FESA 3FHDA 3NYJA 3PMRA 4YL1A 2CDQA 5HV9A 4MVUA 1Z7Qc 1JR8A 1NLXA 4JEAA 2LSEA 1VLSA 2CNWD 3H2UA 4G78A 3RVZA 5L0DA 3W8IA 2FGYA 3HLZA 1GQAA 1L3PA 1Q0MA 2YVKA 2LCHA 1EKYA 1T01A 1D0ZA 3F46A 4U5GA 3B0VC 2FFHA 1QZXA 4DBRA 1H9GA 4ONSA 4BG0A 3C8GD 4MTOA 3EFOA 3MX3A 2D4UA 2Y3HA 2YKZA 4JTCB 4XEFA 2CW0F 3JT1A 4Q5SF 1TQGA 2AP3A 3U5SA 5AC5A 1Q0FA 1Z23A 4O7GA 4ANJA 3ECSA 5BQIA 1A7EA 2LFDA 3DE8A 1WWPA 4YJWA 2A6HF 2F22A 4D4NA 3JTLO 2YLDA 4DOZA 3PDMP 4CS9C 3B71A 5L0HA 2VC9A 1HMDA 3EH2A 3C7JA 1TWHA 3JYHA 3EGXA 1FMVA 1M2VB 4NY3A 3MLGA 5T3WA 2CNWA 2Q00A 1S7ZA 2OG2A 4Q7CA 3W4YA 2WZLA 4DRJB 3LEOA 4C3DA 4I1OB 3KL4A 4BEMJ 5A6KA 3TD7A 3B29A 1OKKA 3JCUQ 3IQ6A 4DRIB 4O6NA 3I4UA 2J9BA 4NTAA 4R32A 1C03A 2XM4A 5EHHA 4U5EE 3JSZA 3ABLC 1OXBA 4NCQA 2XXAA 3ASOC 2IBFA 4WGYA 1JPNA 5JUAA 4JEBA 1NU7D 4WABA 4YL3A 1K40A 4YT8A 2JD3A 3ZQYA 3KYIA 2DYRC 2OQMA 2X0CA 3W8HA 4D4XA 5JLIA 3NMKA 5CIVA 1E86A 1VOMA 3C8GB 1BR4A 2Y39A 1F1MA 2AU5A 2W45A 3DMDA 3JYYA 5JP7A 4A4AA 5KYNA 1HW1A 2X51A 3EZIA 2ZXRA 1HE1A 2GWWA 4E18A 1VTMP 1WN0A
chains in the Genus database with same CATH topology
3DWWA 3LEOA 4JRZA 3B29A 2Q7RA 4JC7A 4AL0A 4NTAA 4J7YA 2H8AA 4YK5A 2PNOA 4JCZA 4YL0A 4J7TA 5BQGA 4NTBA 4WABA 4YL3A 5BQIA 4BPMA 2UUHA 4AL1A 4YL1A 3HKKA 5HV9A 5K0IA 5BQHA 3PCVA 4NTFA 2UUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWW A;  3LEO A;  4JRZ A;  3B29 A;  2Q7R A;  4JC7 A;  4AL0 A;  4NTA A;  4J7Y A;  2H8A A;  4YK5 A;  2PNO A;  4JCZ A;  4YL0 A;  4J7T A;  5BQG A;  4NTB A;  4WAB A;  4YL3 A;  5BQI A;  4BPM A;  2UUH A;  4AL1 A;  4YL1 A;  3HKK A;  5HV9 A;  5K0I A;  5BQH A;  3PCV A;  4NTF A;  2UUI A; 
#chains in the Genus database with same CATH topology
 2H7V C;  3LEV A;  4N06 A;  3J06 A;  4MVR A;  1G4W R;  2JX0 A;  1TR2 A;  4I1M A;  2J7P A;  2NUT B;  2WVO A;  3IPM O;  3M15 A;  1I5N A;  2RSE B;  3OWT A;  1JPJ A;  3O55 A;  2Q7R A;  1RJ9 B;  4BJ6 A;  5CI8 A;  1IZM A;  2P1A A;  3FAJ A;  4YT2 A;  2MHR A;  4YT4 A;  1ZW2 A;  4MVO A;  2YRF A;  3PHF 2;  4YL0 A;  1FNT c;  3L8I A;  2LIG A;  4P9F A;  3ZQV A;  3JRT A;  4CJG A;  1QSP A;  1K04 A;  5KYW B;  1FR0 A;  5TJ5 E;  2R7V A;  4XLP F;  3I5Q A;  4LDK A;  2NUP A;  1O87 A;  2YL1 A;  3SEO A;  4YN0 B;  1UG7 A;  1HE9 A;  4H4K C;  2AVK A;  5DLJ A;  2W4M A;  5E33 A;  4E0H A;  3K6B A;  2YLI A;  3S0X A;  3O10 A;  4U5B E;  5IY5 C;  2HSB A;  3DM5 A;  1YA9 A;  3FOO A;  4IAQ A;  3PCV A;  1NSG B;  5T1D B;  3U3F A;  5A6J A;  3S28 A;  4CJO A;  4IB4 A;  3K66 A;  3RF3 A;  1WOL A;  3AG2 C;  1MMA A;  3TK0 A;  3X1O A;  4OIR F;  5L0I A;  5KYX A;  4OIQ F;  1OCO C;  2YL3 A;  4CBE A;  2Y3B A;  2HZ8 A;  1WTY A;  1QVX A;  3AOU A;  3G4X A;  5AGF A;  1G8X A;  1XWJ A;  4J7T A;  1R4T A;  3DAF A;  4E7S A;  4PJM A;  3GM3 A;  5COF A;  4W8P A;  2KW3 C;  1YA7 O;  3LLK A;  5AC4 A;  1H9T A;  1M57 C;  1R5I D;  5COG A;  2QY9 A;  4CS8 A;  1JAF A;  4FX5 A;  2L6G A;  1HMO A;  2P0N A;  4MVQ A;  2Q9C A;  3Q6N A;  3RVY A;  3NKD A;  4CS8 C;  4F4B A;  5JRA A;  4G7Z F;  3NMJ A;  2A1D D;  2GDC A;  4HE8 D;  3U9M A;  1RJ9 A;  5T3T A;  2XL8 A;  2L7A A;  3IQT A;  3AG1 C;  4JTA B;  3GEH A;  2VCA A;  3EGD A;  3L1M A;  3SXY A;  3QW0 A;  2IYL D;  4AE4 A;  4XEK A;  2M64 A;  2R7O A;  2OJE D;  3AQB A;  2G3V A;  4CSA A;  1BZ4 A;  4DBQ A;  1ORY A;  1PV3 A;  2J7P D;  3RKO F;  1S05 A;  4YWQ A;  1NBB A;  2Y69 C;  2XRH A;  5BQG A;  3Q6M A;  4FAP B;  3GAN A;  3NMI A;  1CGO A;  4OIN F;  2Q4F A;  4ZLD A;  4PFO A;  4CIP A;  1SF8 A;  2HSQ A;  3C8Z A;  4XPY A;  3WOD F;  3FOP A;  2R05 A;  3Q7L A;  1M6T A;  1RXQ A;  2HMZ A;  3E9V A;  3H2V A;  4PFP A;  1QQ3 A;  3WG7 C;  1EQ1 A;  4EHP A;  4JKV A;  2P61 A;  3S27 A;  3WHN A;  5L0G A;  3W2W A;  3TJ5 A;  4I44 A;  5KYY A;  2ETS A;  1A7V A;  2A0U A;  1LI5 A;  2PF4 E;  3G50 A;  3B9Q A;  2DGJ A;  1VMA A;  2XSE A;  3I5P A;  4CX9 A;  3MYF A;  1V54 C;  3HTK C;  3HNL A;  3NKE A;  1TFK B;  3UR3 C;  1MND A;  4OIP F;  3BEH A;  2J0W A;  3QTH A;  4J7Y A;  2XS8 A;  2H8A A;  1OR3 A;  4P6I C;  3ZIB A;  3LS1 A;  3NYM A;  4KC9 A;  2YQY A;  3FMS A;  1QKR A;  4NTB A;  5B3S C;  4JIO A;  2R7Q A;  4U5C E;  1MMG A;  4U9D A;  3UMK A;  3X2Q C;  3VYW A;  4ER9 A;  2IXP A;  3KH2 A;  4CIH A;  2KYH A;  1GGQ A;  1T6Q A;  1MNE A;  3AGU A;  2XLO A;  1YJG A;  2IM8 A;  3K1H A;  4QI2 A;  1JMW A;  3LUT B;  3EJN A;  1TWA A;  3IHU A;  1GS9 A;  4IJJ A;  2J9W A;  3V5Z A;  2EPK X;  2OEV A;  4DVY P;  2GFH A;  3NG1 A;  1H6G A;  4WJ0 A;  2XL6 A;  2HUJ A;  1VLT A;  3FVY A;  5GPG B;  4BJ6 C;  1OQC A;  2EPN A;  3ZVR A;  2XM0 A;  3SP1 A;  4EBB A;  1Z6A A;  4JC7 A;  4H54 A;  4YK5 A;  1YZA A;  3SZR A;  3GM1 A;  3V5X A;  3LAY A;  1J8M F;  4ULW A;  1V74 B;  2BC5 A;  2C04 A;  2VAS A;  1B68 A;  1YYX A;  4JZA A;  2AWC A;  2OOC A;  4E7Z A;  2HJ3 A;  3DXJ F;  3MYI A;  2XLV A;  3RW0 A;  5KYX B;  1SYQ A;  1IW7 F;  2NSG A;  3ABK C;  3SXM A;  2VH3 A;  3E70 C;  4XEV A;  2XL4 A;  1FTS A;  2WVN A;  3A9C A;  4PJL A;  5BQH A;  3LS0 A;  5DVW A;  2RD9 A;  3ZSU A;  5EGY A;  1ZHT A;  2WZG A;  1CGM E;  3KKB A;  3EGD B;  4NTF A;  2XLD A;  1O5H A;  4MTG A;  3U0C A;  5DS6 A;  4IAO A;  3HNK A;  3IQC A;  2IOQ A;  2R9R B;  1Q0G A;  3ASN C;  3NYL A;  2XLH A;  4I3M A;  1CPQ A;  4MW3 A;  4DXW A;  4HEA J;  4LLC A;  1LVK A;  4JTD B;  1LS4 A;  4C3B A;  3ATP A;  1CGN A;  3EZH A;  2J46 A;  3EG9 A;  4M63 A;  3TOM A;  3VAY A;  5DS4 A;  1FMW A;  1U0B B;  3C62 A;  3ZTZ A;  5L0J A;  1TFO B;  2G3K A;  5DS5 A;  4JJG A;  4ULV A;  1LPE A;  2A6E F;  2NG1 A;  1MQV A;  1A0B A;  4QI0 A;  2W4B A;  2Q9B A;  2I8B A;  1XZP A;  3U2L A;  2Y3G A;  1WAS A;  3HKK A;  1LIH A;  2IXN A;  3S84 A;  1ZHY A;  5HSW A;  1G4U S;  1YDI A;  5KYU B;  2Z15 A;  3O6X A;  3W2V A;  2J45 A;  3B0U X;  4PR9 A;  4LAC B;  1O3U A;  1ZVZ A;  2A68 F;  3CSK A;  1LI7 A;  4CSA C;  4CDY A;  2P7V A;  1N1C A;  5F5F A;  2VCC A;  3T6J A;  4RDA A;  2KC3 A;  5EK0 A;  3N24 A;  2QE9 A;  1I4Z A;  1V4A A;  2LK4 A;  2MWQ A;  3QVY A;  2R7W A;  5B1B C;  3ZC4 A;  3O39 A;  1C17 M;  1RKE B;  2OU6 A;  3F47 A;  1RMV A;  4DVZ A;  1ZZP A;  3DAG A;  3UNG C;  2YL7 A;  1Y4C A;  3V7O A;  1LKX A;  2MYS A;  3S29 A;  5KYW A;  3EHN A;  1ZW3 A;  1ORS C;  2QNL A;  3UMI A;  2V3C C;  4DJ9 A;  2D5R B;  2WB7 A;  3H65 A;  1RKE A;  3DZA A;  3EGX B;  2AWY A;  5JS5 A;  4U5D E;  1OXK A;  1ZHW A;  4MTF A;  4U9E A;  4Z9J A;  3UGP A;  4HFF B;  2IXO A;  1AVO B;  3CQZ A;  3U8P A;  1D1B A;  3GEI A;  3VM6 A;  1JRA A;  1VYI A;  3HNJ A;  4IGG A;  4MW8 A;  2R7X A;  2PBE A;  1D1C A;  2OEX A;  3S9O A;  1ZYR F;  1NFN A;  2DYS C;  3DE9 A;  1T9K A;  2ASR A;  3GWN A;  3IEE A;  3DJU B;  3LJB A;  4XPX A;  4MVM A;  3ZWI A;  5D91 A;  4PAC A;  2R03 A;  4BJT A;  2EPO A;  4JVS A;  1OCZ C;  4C7O B;  4RD9 A;  1MMN A;  4N6H A;  1HY5 A;  1Y6D A;  2YL0 A;  3NRH A;  2XXA B;  3G4Z A;  1Z5Z A;  4K0D A;  4AX2 A;  3T6B A;  1XZQ A;  4XPW A;  1NFO A;  4LDQ A;  4KI2 A;  2YZS A;  2O9X A;  3UMH A;  3LNM B;  3AG3 C;  1KNY A;  5KYY B;  3DJN B;  1GM5 A;  3ZDL A;  5DQT A;  5A6B D;  1VB5 A;  3DKA A;  2XLE A;  4G7O F;  1E83 A;  2CGE A;  2P6V A;  4PJN A;  2E87 A;  2NUT A;  2PP4 A;  4X0R A;  4HFK B;  2V26 A;  2YEV A;  1E85 A;  1E84 A;  1A7D A;  3ZG1 A;  4UDV A;  5E2Q A;  2HJM A;  1C02 A;  1FFT C;  3K1I A;  3QMK A;  4KNV A;  4JCZ A;  4P9T A;  5E3C A;  2HKV A;  3T9O A;  3U8V A;  2R25 A;  3QZC A;  1BR2 A;  4AE4 B;  4U5F E;  3QVZ A;  4EBK A;  1YAU O;  2I15 A;  3L0I A;  1RKC A;  2R02 A;  1KTM A;  4RBN A;  2HFI A;  2EIN C;  1D0X A;  1BR1 A;  3JZ0 A;  2A0B A;  4BJ5 A;  1LE4 A;  3RFY A;  4XLN F;  5L3Q A;  2EPL X;  3DD7 A;  2NUP B;  1A41 A;  1EI7 A;  1WAT A;  4IWB A;  4JUR I;  3EG9 B;  3K7D A;  4QDL A;  2YHS A;  3RQE A;  2Q3T A;  3U2M A;  1YAR O;  3NDB B;  4Z9I A;  1RCP A;  3TUL A;  2L9J A;  1VK5 A;  4JCH A;  4AL0 A;  3R2P A;  3AQC A;  1CPR A;  2J9V A;  3AGT A;  4MND A;  4YT5 A;  3BRJ A;  3C18 A;  3HNI A;  1OR2 A;  3JSE O;  2XLM A;  3S90 A;  1PD1 A;  4G0H A;  3TOL A;  4KBL A;  4O79 A;  4CS7 A;  4O6M A;  2DI3 A;  4MQ9 F;  3RQG A;  1EA8 A;  3AG4 C;  2QUP A;  3N2Z B;  2KSF A;  3SXK A;  3POV A;  3L34 A;  2QLA A;  3OA1 A;  1ZHZ A;  2BL2 A;  4LLE A;  4EWC A;  256B A;  4J32 B;  4K7B A;  5KYU A;  2ZXP A;  2HS5 A;  4LDR A;  5FCL A;  4C7O A;  3Q7G A;  3EH1 A;  3EFO B;  2LFF A;  1SR2 A;  1J8Y F;  1ZU4 A;  2NPU A;  2YWA A;  3DWW A;  5L0F A;  2EIL C;  4GQH A;  3RH3 A;  3RYL A;  3JRM O;  4C3E A;  5B1A C;  2G62 A;  4N4W A;  2PFD A;  3SXZ A;  2LD6 A;  1W2W A;  1I4Y A;  4N6C A;  1APC A;  1OW8 A;  2FAP B;  2BE5 F;  2OKU A;  3LES A;  1D1A A;  1OW6 A;  1TWG A;  2PX0 A;  3HJC A;  2L6F A;  2PX3 A;  1V55 C;  1M2O A;  5A6B A;  1OCR C;  4GYT A;  4CS9 A;  1H7I A;  4MVS A;  1TWC A;  3FAP B;  1D0Y A;  2KJG A;  1Q0K A;  4PK4 A;  4OIO F;  3M79 A;  2XLW A;  3ITF A;  1Q0D A;  2B0J A;  4XTK A;  1YLM A;  2KGO A;  1G5Z A;  4Z9H A;  3EQL F;  4ZLC A;  3FDQ A;  1T6U A;  4G7H F;  2A69 F;  1MMD A;  2UUI A;  4A2N B;  1T5O A;  1TKN A;  4LER A;  4E17 A;  2HV7 A;  4JRZ A;  4O6Y A;  2W9Y A;  5DQZ A;  2L81 A;  3VRC A;  4NC3 A;  2J9U A;  2B0H A;  4CDA A;  1E2X A;  2WZF A;  3CAX A;  2VCB A;  2WVQ A;  2EIM C;  2C03 A;  1OKK D;  3GOR A;  4MS2 A;  5B3I A;  5L0C A;  2R7S A;  2VB6 A;  5E3A A;  3LLI A;  2ZPA A;  4K1O A;  4OD5 A;  3ABM C;  3SYN A;  2J8W A;  1U89 A;  2HV6 A;  2YLG A;  1AEP A;  2KK1 A;  3FXH A;  2HMQ A;  1OW7 A;  3IQ5 A;  4NQF A;  4XQ1 A;  4JW1 A;  2R7T A;  3KYJ A;  2ICW G;  1ZHX A;  2UUH A;  3GWL A;  1YVI A;  4AK9 A;  2WL8 A;  4E0I A;  1KU2 A;  2ZXO A;  4EIY A;  4DRH B;  1M2V A;  2QTV A;  1AUE A;  3TJ6 A;  2XS1 A;  4U5H A;  1SZI A;  3VF0 A;  1DOW A;  4BJ5 C;  4JJF A;  2NSF A;  5F28 E;  2DB4 A;  1NZE A;  1L7C A;  4GEH A;  4EBJ A;  5BUO A;  3T6G B;  3U3B A;  1DOV A;  3M4C A;  3DI5 A;  2R7U A;  4KNW A;  3WAQ A;  3T4R A;  3C8G A;  3TQO A;  1Z63 A;  5COM A;  2H7O A;  3MBG A;  1U6H A;  2M4E A;  3N0T A;  4IAR A;  4IRU A;  2CCY A;  2Y3D A;  4CDV A;  5A69 A;  3M4B A;  3EPV A;  2JPU A;  2OCC C;  1VYK A;  5CI9 A;  5FZT A;  3U9J A;  4Q4Z F;  4B6I A;  1HW2 A;  1BBH A;  4XWJ A;  1SMY F;  1K05 A;  2IXM A;  3GEE A;  1PD0 A;  3K33 A;  4JE9 A;  3MFN A;  4WGZ A;  3CZ6 A;  1LE2 A;  4BPM A;  4AL1 A;  3CEX A;  3RQF A;  2LP4 A;  2EPM X;  5K0I A;  1QLE C;  2EIJ C;  3AJM A;  4FWV A;  2OJQ A;  2ZD9 A;  3RIP A;  1PCX A;  4BJ1 A;  3LNR A;  3GOD A;  2L6H A;  3UGO A;  3US6 A;  1LM3 B;  1Z3I X;  3DM9 B;  4MVZ A;  1ORJ A;  5D92 A;  5JSL A;  1UFB A;  1NG1 A;  2EIK C;  2Q9A A;  3C63 A;  5F5H A;  3ZTM A;  4BEJ A;  1ZU5 A;  5JVE A;  1OCC C;  3EHM A;  1T6I A;  3K1I C;  1YYJ A;  1YZC A;  2CYD A;  3GM2 A;  3KMI A;  3QW1 A;  3V5Y A;  2R7R A;  2GAQ A;  2PNO A;  1WGW A;  2ZXW C;  4EKW A;  1JOG A;  1ST6 A;  3R7C A;  5JT4 A;  1M56 C;  4EUK B;  1BDJ B;  3SNH A;  3B0P A;  3L8J A;  3A11 A;  4L6R A;  1NU9 C;  5L3V A;  1QPU A;  3KPH A;  2TMV P;  2H7B A;  2J0X A;  1LS1 A;  2KQ9 A;  4W8K A;  4J30 B;  3OEO A;  2LQG A;  2GA0 A;  4PJJ A;  3M1C B;  1FAP B;  1FFH A;  5A6A A;  4OD4 A;  2KNH A;  4FES A;  3FHD A;  3NYJ A;  3PMR A;  4YL1 A;  2CDQ A;  5HV9 A;  4MVU A;  1Z7Q c;  1JR8 A;  1NLX A;  4JEA A;  2LSE A;  1VLS A;  2CNW D;  3H2U A;  4G78 A;  3RVZ A;  5L0D A;  3W8I A;  2FGY A;  3HLZ A;  1GQA A;  1L3P A;  1Q0M A;  2YVK A;  2LCH A;  1EKY A;  1T01 A;  1D0Z A;  3F46 A;  4U5G A;  3B0V C;  2FFH A;  1QZX A;  4DBR A;  1H9G A;  4ONS A;  4BG0 A;  3C8G D;  4MTO A;  3EFO A;  3MX3 A;  2D4U A;  2Y3H A;  2YKZ A;  4JTC B;  4XEF A;  2CW0 F;  3JT1 A;  4Q5S F;  1TQG A;  2AP3 A;  3U5S A;  5AC5 A;  1Q0F A;  1Z23 A;  4O7G A;  4ANJ A;  3ECS A;  5BQI A;  1A7E A;  2LFD A;  3DE8 A;  1WWP A;  4YJW A;  2A6H F;  2F22 A;  4D4N A;  3JTL O;  2YLD A;  4DOZ A;  3PDM P;  4CS9 C;  3B71 A;  5L0H A;  2VC9 A;  1HMD A;  3EH2 A;  3C7J A;  1TWH A;  3JYH A;  3EGX A;  1FMV A;  1M2V B;  4NY3 A;  3MLG A;  5T3W A;  2CNW A;  2Q00 A;  1S7Z A;  2OG2 A;  4Q7C A;  3W4Y A;  2WZL A;  4DRJ B;  3LEO A;  4C3D A;  4I1O B;  3KL4 A;  4BEM J;  5A6K A;  3TD7 A;  3B29 A;  1OKK A;  3JCU Q;  3IQ6 A;  4DRI B;  4O6N A;  3I4U A;  2J9B A;  4NTA A;  4R32 A;  1C03 A;  2XM4 A;  5EHH A;  4U5E E;  3JSZ A;  3ABL C;  1OXB A;  4NCQ A;  2XXA A;  3ASO C;  2IBF A;  4WGY A;  1JPN A;  5JUA A;  4JEB A;  1NU7 D;  4WAB A;  4YL3 A;  1K40 A;  4YT8 A;  2JD3 A;  3ZQY A;  3KYI A;  2DYR C;  2OQM A;  2X0C A;  3W8H A;  4D4X A;  5JLI A;  3NMK A;  5CIV A;  1E86 A;  1VOM A;  3C8G B;  1BR4 A;  2Y39 A;  1F1M A;  2AU5 A;  2W45 A;  3DMD A;  3JYY A;  5JP7 A;  4A4A A;  5KYN A;  1HW1 A;  2X51 A;  3EZI A;  2ZXR A;  1HE1 A;  2GWW A;  4E18 A;  1VTM P;  1WN0 A; 
#chains in the Genus database with same CATH homology
 3DWW A;  3LEO A;  4JRZ A;  3B29 A;  2Q7R A;  4JC7 A;  4AL0 A;  4NTA A;  4J7Y A;  2H8A A;  4YK5 A;  2PNO A;  4JCZ A;  4YL0 A;  4J7T A;  5BQG A;  4NTB A;  4WAB A;  4YL3 A;  5BQI A;  4BPM A;  2UUH A;  4AL1 A;  4YL1 A;  3HKK A;  5HV9 A;  5K0I A;  5BQH A;  3PCV A;  4NTF A;  2UUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...