3LEOA

Structure of human leukotriene c4 synthase mutant r31q in complex with glutathione
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
150
structure length
150
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARQAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Arginine 104 is a key catalytic residue in leukotriene C4 synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 58
structure length 150
sequence length 150
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3leoA00
4YK5A 5BQHA 4AL0A 5K0IA 5BQIA 2UUIA 3B29A 5HV9A 4NTFA 4YL3A 4NTAA 2PNOA 4BPMA 4JRZA 5BQGA 4JC7A 2Q7RA 4AL1A 2H8AA 3HKKA 4J7TA 4YL1A 4WABA 4YL0A 4NTBA 2UUHA 3LEOA 4J7YA 3PCVA 4JCZA 3DWWA
chains in the Genus database with same CATH superfamily
1ZYRF 2VCCA 4MTGA 2VCBA 2HSQA 3JZ0A 1CPRA 2NUTA 3TJ5A 3WG7C 2NUTB 4NQFA 2NG1A 1Z3IX 1QSPA 4DBRA 1SF8A 4MVSA 2PF4E 3W2VA 2BC5A 3QVYA 2X0CA 3MX3A 4G7HF 2R7TA 4EBKA 4O7GA 3M4CA 4BJ5C 4CDVA 5GPGB 1CPQA 1A7VA 2A69F 2YRFA 1JR8A 3Q7LA 4M63A 1RCPA 4DVYP 5L0FA 3W8HA 1T01A 2R7WA 3FAJA 4EKWA 1NG1A 3EG9A 4MW8A 3F46A 1AUEA 4MVRA 1J8YF 1LE4A 3EQLF 3V5XA 3AGTA 3L0IA 5AGFA 2MHRA 4PJJA 4KNWA 3ECSA 3WAQA 2D4UA 4U5GA 2VC9A 3DAFA 1L3PA 3B29A 3E70C 2CCYA 1D0ZA 1FMVA 3V5YA 5KYYB 5AC5A 3CAXA 3M4BA 5COGA 3KYJA 2G62A 3NYLA 5D92A 1OW8A 4ZLCA 2CYDA 4L6RA 1Z7Qc 2NPUA 2WZGA 3SZRA 5E3AA 3GORA 2NSFA 2OEVA 3VAYA 1T6UA 1OR2A 3W2WA 5B3IA 2HJMA 4MVOA 5A69A 3ZDLA 5B1AC 2I8BA 2Y3HA 2DGJA 3E9VA 3ZQVA 1HE1A 4LACB 3SYNA 2QNLA 4CBEA 4J32B 2XL8A 2A0UA 3N0TA 1SR2A 1VB5A 1ZU4A 3DD7A 3OA1A 4K7BA 4XLNF 3IEEA 2HS5A 5T1DB 4XQ1A 2FGYA 3O10A 4C3EA 3HTKC 1W2WA 3U9JA 1YARO 3A11A 4IAOA 1J8MF 4U9DA 3VM6A 2J0WA 1WATA 4K1OA 1QLEC 4XPXA 4BEJA 4DXWA 5KYUA 1D0XA 4RBNA 3AG3C 3IHUA 3RVZA 4I3MA 2YL1A 4RDAA 1KU2A 4Z9HA 4EHPA 2HV7A 3H2UA 1OCOC 4E0HA 2IXMA 4R32A 4FWVA 3PHF2 4JJGA 5COMA 1NZEA 4D4XA 1YVIA 4LLCA 2HMZA 1OR3A 2XLVA 1E86A 2R03A 3ABKC 3ZG1A 1A7DA 3S9OA 4DBQA 1E83A 3T6BA 5JVEA 4WGYA 2A6HF 2BE5F 3DKAA 1RMVA 1JRAA 5KYXB 3L34A 3C62A 3ZWIA 1H9GA 2WVNA 3UR3C 2R7OA 4QI0A 4AX2A 1VTMP 4W8PA 2LP4A 5L3QA 1Y6DA 2Y39A 3AG2C 4YT5A 3TQOA 2WVQA 1OXBA 2PFDA 3F47A 4U5FE 3EFOB 3DI5A 1BBHA 4PK4A 2OJED 1YZAA 3LJBA 4JRZA 2Q00A 2L6HA 4LLEA 5DVWA 3ITFA 2A6EF 2Y3GA 3DJUB 4P6IC 2ZXPA 3DM5A 3ZSUA 3GWNA 3LNMB 3HJCA 4E0IA 4U5CE 1JOGA 2W4MA 1ZHXA 2XRHA 4JTCB 3GEEA 4WABA 4O6NA 5JSLA 2R7SA 1LI7A 3DMDA 4O79A 4A2NB 2VH3A 1C17M 3M79A 3LEOA 4LDKA 4FAPB 1LM3B 5KYWA 1QKRA 1MMNA 2OJQA 4FX5A 4MW3A 5KYWB 1OKKA 3RIPA 2IXNA 2QE9A 3BEHA 3RQFA 1NU9C 3RVYA 3UGOA 1XZPA 3CZ6A 4CS9A 4E18A 1MMGA 1V55C 4B6IA 4EBJA 3T9OA 1FAPB 2XL6A 4Q5SF 2CW0F 1H6GA 1OCRC 2AWCA 4BPMA 4YT4A 1QPUA 2R7XA 1T5OA 1EQ1A 3BRJA 4BG0A 4HFKB 1FR0A 3RH3A 5T3TA 3KYIA 2KSFA 2HKVA 1CGME 3B71A 5DLJA 4CS8C 4JEBA 3SXMA 1T6IA 1WWPA 1OXKA 2EINC 2EPLX 2Y3DA 2YZSA 3KL4A 3O39A 2W9YA 4J7YA 5B1BC 3US6A 3U5SA 3NYJA 4XEFA 3FOOA 1I5NA 2VASA 4PJNA 2P7VA 2OOCA 4IWBA 1G4US 2P61A 2Y3BA 3TULA 1S05A 3VYWA 5L0IA 1E84A 3W8IA 1WN0A 4YL3A 1PD0A 4JW1A 3U8VA 1APCA 2A1DD 2JPUA 3EHMA 4PR9A 1NBBA 2LFDA 1C03A 5KYNA 3ZTZA 4EUKB 5JLIA 2P6VA 3X1OA 3ZC4A 4HFFB 2C03A 1M57C 2OQMA 3Q6MA 3QW0A 1Z63A 1SZIA 2XS8A 2YLDA 3JCUQ 4Q7CA 1E85A 2HFIA 4IARA 1FFTC 3HLZA 3EG9B 4KBLA 2B0JA 3AJMA 4JZAA 2IXOA 3JSZA 2P1AA 1S7ZA 2UUHA 3UGPA 3QMKA 5L0JA 4CSAC 3Q7GA 2L9JA 2WZFA 3NMIA 2LD6A 2DYRC 3JRTA 5A6BD 5BQIA 1OCZC 3HNKA 4CJGA 4XEVA 3U9MA 4HE8D 5EGYA 5DS6A 3EH1A 2KYHA 4IJJA 2Y69C 1ZZPA 2ZXRA 2YL0A 3S27A 4ANJA 5COFA 2JX0A 3FVYA 3JSEO 4P9TA 4DRIB 5E2QA 2CNWD 2O9XA 5CI8A 1Y4CA 4ULWA 2LIGA 1LPEA 3GWLA 4QI2A 1A7EA 4AL1A 3LS0A 4J7TA 2IBFA 2X51A 2GFHA 4NCQA 3V5ZA 1RKEA 3B0PA 4E7SA 2YQYA 1NSGB 1RKEB 1VYIA 2ICWG 2R7UA 5DS4A 1Q0MA 1EI7A 1A0BA 1Q0GA 3GM3A 1LI5A 3M15A 2J0XA 2LSEA 2XS1A 4RD9A 5FZTA 2Q7RA 3RFYA 5B3SC 1SMYF 1YJGA 3C8GA 3DE9A 3EGDA 4IAQA 4NY3A 4PJLA 4AL0A 3J06A 3C8GB 3EGDB 5EK0A 1VYKA 2L7AA 3DM9B 1ZVZA 2UUIA 3DZAA 3LLKA 4NTFA 1BR2A 3OEOA 2VB6A 3T4RA 1F1MA 2MYSA 4H54A 2KC3A 4G78A 3CSKA 2KGOA 3DAGA 4JE9A 3TOMA 2OCCC 4BJ5A 4YN0B 4D4NA 2H7OA 1ZW2A 2J7PD 3G4ZA 5L0CA 4EIYA 5KYUB 4JTDB 4N6HA 4KNVA 4Z9IA 1MNDA 1HW1A 3NMKA 3SXZA 1HMDA 4FESA 2HZ8A 2C04A 3POVA 4H4KC 2ZPAA 3K1HA 1NLXA 4DRHB 4OIOF 1E2XA 3VRCA 3UMIA 3RKOF 4W8KA 2XSEA 4G0HA 1RXQA 2EILC 1ZU5A 4YK5A 5L3VA 4GYTA 4MVMA 4G7ZF 2KK1A 3K6BA 3K1IC 3B9QA 2L6FA 5JP7A 4YT2A 1LE2A 2TMVP 1ZHYA 1TKNA 3GANA 4CIPA 4JIOA 1G5ZA 3JYYA 3KKBA 3IQCA 1PD1A 4PACA 2B0HA 4U5DE 3RQGA 1XZQA 3KH2A 4CS7A 3R2PA 3U2LA 3ZTMA 5F5HA 2Q9AA 4BJ6C 4PFPA 3JYHA 1LIHA 3ABLC 2R02A 2YLGA 3S0XA 3RW0A 2V26A 3FHDA 4LDRA 1RJ9A 5JT4A 1OQCA 3O6XA 1TWAA 3QTHA 1YA9A 4IGGA 4NTBA 1I4YA 3C63A 3TJ6A 2AVKA 1R4TA 2OKUA 3S84A 4IB4A 3C7JA 1DOWA 3EHNA 2J46A 3FOPA 4JEAA 1ORSC 1LS4A 2AWYA 1VK5A 3M1CB 2LCHA 3U0CA 3PDMP 1WOLA 1ZHZA 3AOUA 2YL3A 3ZIBA 4E7ZA 2LFFA 4YWQA 5JUAA 2PX3A 3NDBB 2KJGA 5A6AA 3LEVA 3SEOA 2R9RB 1D1AA 1V54C 3JRMO 3N24A 4NTAA 1M2OA 2H7BA 2P0NA 5AC4A 1L7CA 2PP4A 3RQEA 1TWCA 1V74B 1MMAA 2Z15A 4QDLA 3SXYA 4JC7A 2I15A 1YDIA 1KTMA 1ST6A 1R5ID 1ZW3A 2A68F 2QUPA 4BJTA 5E3CA 1M56C 4U5EE 3T6JA 4AK9A 1QZXA 4OIRF 1AEPA 4AE4B 3GM2A 2YVKA 4XEKA 3EGXA 4N6CA 4YL0A 3S29A 3SP1A 1YLMA 3WHNA 3EGXB 3QW1A 4DJ9A 4JCZA 5T3WA 2L6GA 1GQAA 2E87A 3I5PA 3B0VC 1EKYA 3MYIA 1HW2A 4PJMA 2EIKC 5K0IA 2XLWA 3AG1C 4YT8A 1PCXA 2VCAA 5EHHA 4Q4ZF 1TQGA 2XLEA 3R7CA 3U2MA 2PNOA 2XLOA 4CIHA 4UDVA 2J9BA 2XL4A 2L81A 3S90A 1B68A 3SNHA 4EBBA 1D1CA 2KW3C 5CI9A 3DE8A 3K33A 1KNYA 3ZQYA 1LS1A 2IOQA 2LQGA 1ZHWA 2WZLA 4XTKA 4O6MA 2GDCA 5TJ5E 3LS1A 1BZ4A 4XWJA 3LLIA 3W4YA 2J45A 2J9VA 3C18A 3LESA 4ZLDA 3LNRA 2HJ3A 3JTLO 4U9EA 2ZD9A 3IPMO 1NFNA 3AQCA 3DWWA 3NYMA 1MQVA 1TFKB 2EPMX 2IM8A 2YL7A 4F4BA 5HSWA 3NKEA 1Q0KA 2H7VC 1LKXA 3ASOC 4XPYA 3CQZA 3ZVRA 4C3DA 1MNEA 4MVQA 1FNTc 5A6KA 3EZIA 1VLTA 2GA0A 1AVOB 2EPKX 1O3UA 4N06A 4C7OA 3OWTA 3TD7A 4JVSA 4JCHA 4GQHA 5BQGA 3EJNA 4C7OB 3HNIA 3O55A 4CS8A 3NMJA 3X2QC 1XWJA 2EIMC 1UFBA 1NU7D 3NRHA 3G50A 3HKKA 4LDQA 2V3CC 3K7DA 2EPNA 2EIJC 3HNJA 2D5RB 5A6JA 2OG2A 5CIVA 2LK4A 4C3BA 3MYFA 3PCVA 1K40A 5IY5C 4MVZA 1ORJA 2FAPB 1LVKA 2Q3TA 4O6YA 2EPOA 2AU5A 1HY5A 3UNGC 5BQHA 3EH2A 2DYSC 3V7OA 4CDAA 5BUOA 3GEHA 5FCLA 1OKKD 3EZHA 1H9TA 3N2ZB 3L1MA 1BDJB 3RF3A 5KYYA 3GEIA 3JT1A 1VLSA 2OU6A 4WGZA 4MTFA 4DVZA 1BR1A 1JPNA 1WGWA 2AP3A 3IQTA 1D1BA 3AG4C 4XPWA 4EWCA 4NC3A 1FFHA 3NKDA 1ORYA 2QLAA 5F5FA 2WB7A 4DOZA 4G7OF 1TWHA 1JAFA 4JURI 1BR4A 3H2VA 3U8PA 2H8AA 2NUPA 2YLIA 1EA8A 3AQBA 3DJNB 3MLGA 4JJFA 4OINF 2NUPB 4CX9A 1JPJA 2IYLD 2W45A 2XM4A 5L0GA 1DOVA 1OW6A 1MMDA 2KQ9A 3KPHA 4CSAA 3RYLA 4OD4A 1TWGA 4IRUA 4DRJB 1U0BB 1WASA 3U3BA 3EPVA 3MBGA 3U3FA 2IXPA 2Q9BA 2WVOA 3NG1A 4AE4A 5D91A 1U89A 1CGOA 1QVXA 2FFHA 2RSEB 2M64A 2YHSA 1O87A 3DXJF 4HEAJ 2GAQA 4I1OB 2HV6A 3LUTB 3FMSA 4BJ1A 4CS9C 5HV9A 1IZMA 2F22A 2QY9A 4KC9A 3L8JA 4LERA 5JS5A 1TFOB 3T6GB 3QVZA 4U5BE 1G8XA 1Q0FA 1T6QA 3I4UA 4MVUA 4X0RA 4OIQF 2BL2A 1VOMA 1I4ZA 3PMRA 1Z6AA 3ABMC 5DQZA 4P9FA 1QQ3A 4OIPF 1UG7A 1NFOA 1CGNA 1ZHTA 3IQ5A 3A9CA 3KMIA 5E33A 2R7RA 4U5HA 3GODA 1RJ9B 2KNHA 5KYXA 2J8WA 2ZXOA 4ONSA 3FXHA 2XM0A 3ATPA 5A6BA 2A0BA 2GWWA 4ER9A 4PFOA 2PX0A 5DS5A 4KI2A 3UMHA 1K04A 3LAYA 2R05A 2OEXA 1GS9A 3FAPB 1H7IA 3AGUA 1YZCA 3S28A 3EFOA 1V4AA 3C8ZA 3VF0A 2XLDA 2CNWA 2HSBA 2RD9A 1U6HA 2R25A 2J9UA 4ULVA 1G4WR 1GGQA 3TK0A 1YAUO 4J30B 4WJ0A 4MQ9F 1K05A 3L8IA 1IW7F 4E17A 2PBEA 3IQ6A 4MS2A 3UMKA 4CDYA 1FMWA 2DI3A 1PV3A 2Q4FA 2Q9CA 4OD5A 2G3KA 1OW7A 2WL8A 3Q6NA 1C02A 2MWQA 4I44A 2J9WA 2W4BA 5L0HA 2ETSA 1TR2A 1Z5ZA 1YA7O 3CEXA 1FTSA 3GM1A 4JKVA 3H65A 1M6TA 3K1IA 1JMWA 2HUJA 2YWAA 2R7QA 3SXKA 1WTYA 2G3VA 2YEVA 5L0DA 2CDQA 2CGEA 2M4EA 2XLHA 4BEMJ 5JRAA 2R7VA 2HMQA 2J7PA 2YKZA 3C8GD 5F28E 2DB4A 4GEHA 3MFNA 2ZXWC 1OCCC 1VMAA 1D0YA 3B0UX 1N1CA 1Q0DA 2JD3A 1M2VA 1Z23A 4JTAB 4MNDA 2NSGA 4YJWA 4BJ6A 5DQTA 1M2VB 3FDQA 4CJOA 4A4AA 3WODF 3QZCA 1GM5A 3TOLA 1O5HA 2ASRA 1HMOA 2XLMA 1T9KA 1YYXA 3G4XA 4YL1A 4XLPF 2XXAA 1YYJA 3ASNC 4N4WA 2XXAB 3K66A 4K0DA 4Z9JA 3HNLA 4I1MA 2QTVA 1HE9A 256BA 1A41A 1SYQA 4MTOA 1RKCA 3I5QA
chains in the Genus database with same CATH topology
4YK5A 5BQHA 4AL0A 5K0IA 5BQIA 2UUIA 3B29A 5HV9A 4NTFA 4YL3A 4NTAA 2PNOA 4BPMA 4JRZA 5BQGA 4JC7A 2Q7RA 4AL1A 2H8AA 3HKKA 4J7TA 4YL1A 4WABA 4YL0A 4NTBA 2UUHA 3LEOA 4J7YA 3PCVA 4JCZA 3DWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YK5 A;  5BQH A;  4AL0 A;  5K0I A;  5BQI A;  2UUI A;  3B29 A;  5HV9 A;  4NTF A;  4YL3 A;  4NTA A;  2PNO A;  4BPM A;  4JRZ A;  5BQG A;  4JC7 A;  2Q7R A;  4AL1 A;  2H8A A;  3HKK A;  4J7T A;  4YL1 A;  4WAB A;  4YL0 A;  4NTB A;  2UUH A;  3LEO A;  4J7Y A;  3PCV A;  4JCZ A;  3DWW A; 
#chains in the Genus database with same CATH topology
 1ZYR F;  2VCC A;  4MTG A;  2VCB A;  2HSQ A;  3JZ0 A;  1CPR A;  2NUT A;  3TJ5 A;  3WG7 C;  2NUT B;  4NQF A;  2NG1 A;  1Z3I X;  1QSP A;  4DBR A;  1SF8 A;  4MVS A;  2PF4 E;  3W2V A;  2BC5 A;  3QVY A;  2X0C A;  3MX3 A;  4G7H F;  2R7T A;  4EBK A;  4O7G A;  3M4C A;  4BJ5 C;  4CDV A;  5GPG B;  1CPQ A;  1A7V A;  2A69 F;  2YRF A;  1JR8 A;  3Q7L A;  4M63 A;  1RCP A;  4DVY P;  5L0F A;  3W8H A;  1T01 A;  2R7W A;  3FAJ A;  4EKW A;  1NG1 A;  3EG9 A;  4MW8 A;  3F46 A;  1AUE A;  4MVR A;  1J8Y F;  1LE4 A;  3EQL F;  3V5X A;  3AGT A;  3L0I A;  5AGF A;  2MHR A;  4PJJ A;  4KNW A;  3ECS A;  3WAQ A;  2D4U A;  4U5G A;  2VC9 A;  3DAF A;  1L3P A;  3B29 A;  3E70 C;  2CCY A;  1D0Z A;  1FMV A;  3V5Y A;  5KYY B;  5AC5 A;  3CAX A;  3M4B A;  5COG A;  3KYJ A;  2G62 A;  3NYL A;  5D92 A;  1OW8 A;  4ZLC A;  2CYD A;  4L6R A;  1Z7Q c;  2NPU A;  2WZG A;  3SZR A;  5E3A A;  3GOR A;  2NSF A;  2OEV A;  3VAY A;  1T6U A;  1OR2 A;  3W2W A;  5B3I A;  2HJM A;  4MVO A;  5A69 A;  3ZDL A;  5B1A C;  2I8B A;  2Y3H A;  2DGJ A;  3E9V A;  3ZQV A;  1HE1 A;  4LAC B;  3SYN A;  2QNL A;  4CBE A;  4J32 B;  2XL8 A;  2A0U A;  3N0T A;  1SR2 A;  1VB5 A;  1ZU4 A;  3DD7 A;  3OA1 A;  4K7B A;  4XLN F;  3IEE A;  2HS5 A;  5T1D B;  4XQ1 A;  2FGY A;  3O10 A;  4C3E A;  3HTK C;  1W2W A;  3U9J A;  1YAR O;  3A11 A;  4IAO A;  1J8M F;  4U9D A;  3VM6 A;  2J0W A;  1WAT A;  4K1O A;  1QLE C;  4XPX A;  4BEJ A;  4DXW A;  5KYU A;  1D0X A;  4RBN A;  3AG3 C;  3IHU A;  3RVZ A;  4I3M A;  2YL1 A;  4RDA A;  1KU2 A;  4Z9H A;  4EHP A;  2HV7 A;  3H2U A;  1OCO C;  4E0H A;  2IXM A;  4R32 A;  4FWV A;  3PHF 2;  4JJG A;  5COM A;  1NZE A;  4D4X A;  1YVI A;  4LLC A;  2HMZ A;  1OR3 A;  2XLV A;  1E86 A;  2R03 A;  3ABK C;  3ZG1 A;  1A7D A;  3S9O A;  4DBQ A;  1E83 A;  3T6B A;  5JVE A;  4WGY A;  2A6H F;  2BE5 F;  3DKA A;  1RMV A;  1JRA A;  5KYX B;  3L34 A;  3C62 A;  3ZWI A;  1H9G A;  2WVN A;  3UR3 C;  2R7O A;  4QI0 A;  4AX2 A;  1VTM P;  4W8P A;  2LP4 A;  5L3Q A;  1Y6D A;  2Y39 A;  3AG2 C;  4YT5 A;  3TQO A;  2WVQ A;  1OXB A;  2PFD A;  3F47 A;  4U5F E;  3EFO B;  3DI5 A;  1BBH A;  4PK4 A;  2OJE D;  1YZA A;  3LJB A;  4JRZ A;  2Q00 A;  2L6H A;  4LLE A;  5DVW A;  3ITF A;  2A6E F;  2Y3G A;  3DJU B;  4P6I C;  2ZXP A;  3DM5 A;  3ZSU A;  3GWN A;  3LNM B;  3HJC A;  4E0I A;  4U5C E;  1JOG A;  2W4M A;  1ZHX A;  2XRH A;  4JTC B;  3GEE A;  4WAB A;  4O6N A;  5JSL A;  2R7S A;  1LI7 A;  3DMD A;  4O79 A;  4A2N B;  2VH3 A;  1C17 M;  3M79 A;  3LEO A;  4LDK A;  4FAP B;  1LM3 B;  5KYW A;  1QKR A;  1MMN A;  2OJQ A;  4FX5 A;  4MW3 A;  5KYW B;  1OKK A;  3RIP A;  2IXN A;  2QE9 A;  3BEH A;  3RQF A;  1NU9 C;  3RVY A;  3UGO A;  1XZP A;  3CZ6 A;  4CS9 A;  4E18 A;  1MMG A;  1V55 C;  4B6I A;  4EBJ A;  3T9O A;  1FAP B;  2XL6 A;  4Q5S F;  2CW0 F;  1H6G A;  1OCR C;  2AWC A;  4BPM A;  4YT4 A;  1QPU A;  2R7X A;  1T5O A;  1EQ1 A;  3BRJ A;  4BG0 A;  4HFK B;  1FR0 A;  3RH3 A;  5T3T A;  3KYI A;  2KSF A;  2HKV A;  1CGM E;  3B71 A;  5DLJ A;  4CS8 C;  4JEB A;  3SXM A;  1T6I A;  1WWP A;  1OXK A;  2EIN C;  2EPL X;  2Y3D A;  2YZS A;  3KL4 A;  3O39 A;  2W9Y A;  4J7Y A;  5B1B C;  3US6 A;  3U5S A;  3NYJ A;  4XEF A;  3FOO A;  1I5N A;  2VAS A;  4PJN A;  2P7V A;  2OOC A;  4IWB A;  1G4U S;  2P61 A;  2Y3B A;  3TUL A;  1S05 A;  3VYW A;  5L0I A;  1E84 A;  3W8I A;  1WN0 A;  4YL3 A;  1PD0 A;  4JW1 A;  3U8V A;  1APC A;  2A1D D;  2JPU A;  3EHM A;  4PR9 A;  1NBB A;  2LFD A;  1C03 A;  5KYN A;  3ZTZ A;  4EUK B;  5JLI A;  2P6V A;  3X1O A;  3ZC4 A;  4HFF B;  2C03 A;  1M57 C;  2OQM A;  3Q6M A;  3QW0 A;  1Z63 A;  1SZI A;  2XS8 A;  2YLD A;  3JCU Q;  4Q7C A;  1E85 A;  2HFI A;  4IAR A;  1FFT C;  3HLZ A;  3EG9 B;  4KBL A;  2B0J A;  3AJM A;  4JZA A;  2IXO A;  3JSZ A;  2P1A A;  1S7Z A;  2UUH A;  3UGP A;  3QMK A;  5L0J A;  4CSA C;  3Q7G A;  2L9J A;  2WZF A;  3NMI A;  2LD6 A;  2DYR C;  3JRT A;  5A6B D;  5BQI A;  1OCZ C;  3HNK A;  4CJG A;  4XEV A;  3U9M A;  4HE8 D;  5EGY A;  5DS6 A;  3EH1 A;  2KYH A;  4IJJ A;  2Y69 C;  1ZZP A;  2ZXR A;  2YL0 A;  3S27 A;  4ANJ A;  5COF A;  2JX0 A;  3FVY A;  3JSE O;  4P9T A;  4DRI B;  5E2Q A;  2CNW D;  2O9X A;  5CI8 A;  1Y4C A;  4ULW A;  2LIG A;  1LPE A;  3GWL A;  4QI2 A;  1A7E A;  4AL1 A;  3LS0 A;  4J7T A;  2IBF A;  2X51 A;  2GFH A;  4NCQ A;  3V5Z A;  1RKE A;  3B0P A;  4E7S A;  2YQY A;  1NSG B;  1RKE B;  1VYI A;  2ICW G;  2R7U A;  5DS4 A;  1Q0M A;  1EI7 A;  1A0B A;  1Q0G A;  3GM3 A;  1LI5 A;  3M15 A;  2J0X A;  2LSE A;  2XS1 A;  4RD9 A;  5FZT A;  2Q7R A;  3RFY A;  5B3S C;  1SMY F;  1YJG A;  3C8G A;  3DE9 A;  3EGD A;  4IAQ A;  4NY3 A;  4PJL A;  4AL0 A;  3J06 A;  3C8G B;  3EGD B;  5EK0 A;  1VYK A;  2L7A A;  3DM9 B;  1ZVZ A;  2UUI A;  3DZA A;  3LLK A;  4NTF A;  1BR2 A;  3OEO A;  2VB6 A;  3T4R A;  1F1M A;  2MYS A;  4H54 A;  2KC3 A;  4G78 A;  3CSK A;  2KGO A;  3DAG A;  4JE9 A;  3TOM A;  2OCC C;  4BJ5 A;  4YN0 B;  4D4N A;  2H7O A;  1ZW2 A;  2J7P D;  3G4Z A;  5L0C A;  4EIY A;  5KYU B;  4JTD B;  4N6H A;  4KNV A;  4Z9I A;  1MND A;  1HW1 A;  3NMK A;  3SXZ A;  1HMD A;  4FES A;  2HZ8 A;  2C04 A;  3POV A;  4H4K C;  2ZPA A;  3K1H A;  1NLX A;  4DRH B;  4OIO F;  1E2X A;  3VRC A;  3UMI A;  3RKO F;  4W8K A;  2XSE A;  4G0H A;  1RXQ A;  2EIL C;  1ZU5 A;  4YK5 A;  5L3V A;  4GYT A;  4MVM A;  4G7Z F;  2KK1 A;  3K6B A;  3K1I C;  3B9Q A;  2L6F A;  5JP7 A;  4YT2 A;  1LE2 A;  2TMV P;  1ZHY A;  1TKN A;  3GAN A;  4CIP A;  4JIO A;  1G5Z A;  3JYY A;  3KKB A;  3IQC A;  1PD1 A;  4PAC A;  2B0H A;  4U5D E;  3RQG A;  1XZQ A;  3KH2 A;  4CS7 A;  3R2P A;  3U2L A;  3ZTM A;  5F5H A;  2Q9A A;  4BJ6 C;  4PFP A;  3JYH A;  1LIH A;  3ABL C;  2R02 A;  2YLG A;  3S0X A;  3RW0 A;  2V26 A;  3FHD A;  4LDR A;  1RJ9 A;  5JT4 A;  1OQC A;  3O6X A;  1TWA A;  3QTH A;  1YA9 A;  4IGG A;  4NTB A;  1I4Y A;  3C63 A;  3TJ6 A;  2AVK A;  1R4T A;  2OKU A;  3S84 A;  4IB4 A;  3C7J A;  1DOW A;  3EHN A;  2J46 A;  3FOP A;  4JEA A;  1ORS C;  1LS4 A;  2AWY A;  1VK5 A;  3M1C B;  2LCH A;  3U0C A;  3PDM P;  1WOL A;  1ZHZ A;  3AOU A;  2YL3 A;  3ZIB A;  4E7Z A;  2LFF A;  4YWQ A;  5JUA A;  2PX3 A;  3NDB B;  2KJG A;  5A6A A;  3LEV A;  3SEO A;  2R9R B;  1D1A A;  1V54 C;  3JRM O;  3N24 A;  4NTA A;  1M2O A;  2H7B A;  2P0N A;  5AC4 A;  1L7C A;  2PP4 A;  3RQE A;  1TWC A;  1V74 B;  1MMA A;  2Z15 A;  4QDL A;  3SXY A;  4JC7 A;  2I15 A;  1YDI A;  1KTM A;  1ST6 A;  1R5I D;  1ZW3 A;  2A68 F;  2QUP A;  4BJT A;  5E3C A;  1M56 C;  4U5E E;  3T6J A;  4AK9 A;  1QZX A;  4OIR F;  1AEP A;  4AE4 B;  3GM2 A;  2YVK A;  4XEK A;  3EGX A;  4N6C A;  4YL0 A;  3S29 A;  3SP1 A;  1YLM A;  3WHN A;  3EGX B;  3QW1 A;  4DJ9 A;  4JCZ A;  5T3W A;  2L6G A;  1GQA A;  2E87 A;  3I5P A;  3B0V C;  1EKY A;  3MYI A;  1HW2 A;  4PJM A;  2EIK C;  5K0I A;  2XLW A;  3AG1 C;  4YT8 A;  1PCX A;  2VCA A;  5EHH A;  4Q4Z F;  1TQG A;  2XLE A;  3R7C A;  3U2M A;  2PNO A;  2XLO A;  4CIH A;  4UDV A;  2J9B A;  2XL4 A;  2L81 A;  3S90 A;  1B68 A;  3SNH A;  4EBB A;  1D1C A;  2KW3 C;  5CI9 A;  3DE8 A;  3K33 A;  1KNY A;  3ZQY A;  1LS1 A;  2IOQ A;  2LQG A;  1ZHW A;  2WZL A;  4XTK A;  4O6M A;  2GDC A;  5TJ5 E;  3LS1 A;  1BZ4 A;  4XWJ A;  3LLI A;  3W4Y A;  2J45 A;  2J9V A;  3C18 A;  3LES A;  4ZLD A;  3LNR A;  2HJ3 A;  3JTL O;  4U9E A;  2ZD9 A;  3IPM O;  1NFN A;  3AQC A;  3DWW A;  3NYM A;  1MQV A;  1TFK B;  2EPM X;  2IM8 A;  2YL7 A;  4F4B A;  5HSW A;  3NKE A;  1Q0K A;  2H7V C;  1LKX A;  3ASO C;  4XPY A;  3CQZ A;  3ZVR A;  4C3D A;  1MNE A;  4MVQ A;  1FNT c;  5A6K A;  3EZI A;  1VLT A;  2GA0 A;  1AVO B;  2EPK X;  1O3U A;  4N06 A;  4C7O A;  3OWT A;  3TD7 A;  4JVS A;  4JCH A;  4GQH A;  5BQG A;  3EJN A;  4C7O B;  3HNI A;  3O55 A;  4CS8 A;  3NMJ A;  3X2Q C;  1XWJ A;  2EIM C;  1UFB A;  1NU7 D;  3NRH A;  3G50 A;  3HKK A;  4LDQ A;  2V3C C;  3K7D A;  2EPN A;  2EIJ C;  3HNJ A;  2D5R B;  5A6J A;  2OG2 A;  5CIV A;  2LK4 A;  4C3B A;  3MYF A;  3PCV A;  1K40 A;  5IY5 C;  4MVZ A;  1ORJ A;  2FAP B;  1LVK A;  2Q3T A;  4O6Y A;  2EPO A;  2AU5 A;  1HY5 A;  3UNG C;  5BQH A;  3EH2 A;  2DYS C;  3V7O A;  4CDA A;  5BUO A;  3GEH A;  5FCL A;  1OKK D;  3EZH A;  1H9T A;  3N2Z B;  3L1M A;  1BDJ B;  3RF3 A;  5KYY A;  3GEI A;  3JT1 A;  1VLS A;  2OU6 A;  4WGZ A;  4MTF A;  4DVZ A;  1BR1 A;  1JPN A;  1WGW A;  2AP3 A;  3IQT A;  1D1B A;  3AG4 C;  4XPW A;  4EWC A;  4NC3 A;  1FFH A;  3NKD A;  1ORY A;  2QLA A;  5F5F A;  2WB7 A;  4DOZ A;  4G7O F;  1TWH A;  1JAF A;  4JUR I;  1BR4 A;  3H2V A;  3U8P A;  2H8A A;  2NUP A;  2YLI A;  1EA8 A;  3AQB A;  3DJN B;  3MLG A;  4JJF A;  4OIN F;  2NUP B;  4CX9 A;  1JPJ A;  2IYL D;  2W45 A;  2XM4 A;  5L0G A;  1DOV A;  1OW6 A;  1MMD A;  2KQ9 A;  3KPH A;  4CSA A;  3RYL A;  4OD4 A;  1TWG A;  4IRU A;  4DRJ B;  1U0B B;  1WAS A;  3U3B A;  3EPV A;  3MBG A;  3U3F A;  2IXP A;  2Q9B A;  2WVO A;  3NG1 A;  4AE4 A;  5D91 A;  1U89 A;  1CGO A;  1QVX A;  2FFH A;  2RSE B;  2M64 A;  2YHS A;  1O87 A;  3DXJ F;  4HEA J;  2GAQ A;  4I1O B;  2HV6 A;  3LUT B;  3FMS A;  4BJ1 A;  4CS9 C;  5HV9 A;  1IZM A;  2F22 A;  2QY9 A;  4KC9 A;  3L8J A;  4LER A;  5JS5 A;  1TFO B;  3T6G B;  3QVZ A;  4U5B E;  1G8X A;  1Q0F A;  1T6Q A;  3I4U A;  4MVU A;  4X0R A;  4OIQ F;  2BL2 A;  1VOM A;  1I4Z A;  3PMR A;  1Z6A A;  3ABM C;  5DQZ A;  4P9F A;  1QQ3 A;  4OIP F;  1UG7 A;  1NFO A;  1CGN A;  1ZHT A;  3IQ5 A;  3A9C A;  3KMI A;  5E33 A;  2R7R A;  4U5H A;  3GOD A;  1RJ9 B;  2KNH A;  5KYX A;  2J8W A;  2ZXO A;  4ONS A;  3FXH A;  2XM0 A;  3ATP A;  5A6B A;  2A0B A;  2GWW A;  4ER9 A;  4PFO A;  2PX0 A;  5DS5 A;  4KI2 A;  3UMH A;  1K04 A;  3LAY A;  2R05 A;  2OEX A;  1GS9 A;  3FAP B;  1H7I A;  3AGU A;  1YZC A;  3S28 A;  3EFO A;  1V4A A;  3C8Z A;  3VF0 A;  2XLD A;  2CNW A;  2HSB A;  2RD9 A;  1U6H A;  2R25 A;  2J9U A;  4ULV A;  1G4W R;  1GGQ A;  3TK0 A;  1YAU O;  4J30 B;  4WJ0 A;  4MQ9 F;  1K05 A;  3L8I A;  1IW7 F;  4E17 A;  2PBE A;  3IQ6 A;  4MS2 A;  3UMK A;  4CDY A;  1FMW A;  2DI3 A;  1PV3 A;  2Q4F A;  2Q9C A;  4OD5 A;  2G3K A;  1OW7 A;  2WL8 A;  3Q6N A;  1C02 A;  2MWQ A;  4I44 A;  2J9W A;  2W4B A;  5L0H A;  2ETS A;  1TR2 A;  1Z5Z A;  1YA7 O;  3CEX A;  1FTS A;  3GM1 A;  4JKV A;  3H65 A;  1M6T A;  3K1I A;  1JMW A;  2HUJ A;  2YWA A;  2R7Q A;  3SXK A;  1WTY A;  2G3V A;  2YEV A;  5L0D A;  2CDQ A;  2CGE A;  2M4E A;  2XLH A;  4BEM J;  5JRA A;  2R7V A;  2HMQ A;  2J7P A;  2YKZ A;  3C8G D;  5F28 E;  2DB4 A;  4GEH A;  3MFN A;  2ZXW C;  1OCC C;  1VMA A;  1D0Y A;  3B0U X;  1N1C A;  1Q0D A;  2JD3 A;  1M2V A;  1Z23 A;  4JTA B;  4MND A;  2NSG A;  4YJW A;  4BJ6 A;  5DQT A;  1M2V B;  3FDQ A;  4CJO A;  4A4A A;  3WOD F;  3QZC A;  1GM5 A;  3TOL A;  1O5H A;  2ASR A;  1HMO A;  2XLM A;  1T9K A;  1YYX A;  3G4X A;  4YL1 A;  4XLP F;  2XXA A;  1YYJ A;  3ASN C;  4N4W A;  2XXA B;  3K66 A;  4K0D A;  4Z9J A;  3HNL A;  4I1M A;  2QTV A;  1HE9 A;  256B A;  1A41 A;  1SYQ A;  4MTO A;  1RKC A;  3I5Q A; 
#chains in the Genus database with same CATH homology
 4YK5 A;  5BQH A;  4AL0 A;  5K0I A;  5BQI A;  2UUI A;  3B29 A;  5HV9 A;  4NTF A;  4YL3 A;  4NTA A;  2PNO A;  4BPM A;  4JRZ A;  5BQG A;  4JC7 A;  2Q7R A;  4AL1 A;  2H8A A;  3HKK A;  4J7T A;  4YL1 A;  4WAB A;  4YL0 A;  4NTB A;  2UUH A;  3LEO A;  4J7Y A;  3PCV A;  4JCZ A;  3DWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...