3LEOA

Structure of human leukotriene c4 synthase mutant r31q in complex with glutathione
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
150
structure length
150
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARQAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Arginine 104 is a key catalytic residue in leukotriene C4 synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 58
structure length 150
sequence length 150
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3leoA00
4AL0A 5HV9A 3PCVA 4YL3A 5BQHA 4YL0A 3HKKA 4BPMA 5BQGA 2Q7RA 4YL1A 4NTBA 4WABA 2H8AA 2UUHA 3B29A 5K0IA 4JRZA 4JCZA 2UUIA 2PNOA 4J7TA 3DWWA 5BQIA 4NTFA 3LEOA 4NTAA 4AL1A 4JC7A 4J7YA 4YK5A
chains in the Genus database with same CATH superfamily
4GEHA 2L81A 2YRFA 4E7SA 2GFHA 2CYDA 2Q9AA 5KYYB 1WWPA 3GEEA 1D1BA 2AU5A 1VOMA 3OA1A 2P61A 4JTAB 4CDYA 1GM5A 1A7EA 4MVQA 5HSWA 4PFPA 4XTKA 1PCXA 2X0CA 2DB4A 3K1IA 4QI0A 4NCQA 4CS7A 1GQAA 4DJ9A 3R7CA 1Z6AA 2KGOA 3GODA 2IYLD 5K0IA 1ZHZA 4EBBA 2O9XA 1AUEA 1OCZC 3EFOA 4N4WA 4RDAA 1H9GA 1A7DA 3H65A 4MVMA 1FTSA 3H2VA 1O5HA 3WAQA 2NSFA 3HNKA 4CBEA 4MS2A 2HKVA 2I8BA 3L1MA 4JC7A 2ASRA 4C7OA 2ZPAA 2MWQA 3V5XA 3K1IC 3IHUA 2M4EA 3GM2A 3RFYA 3SXZA 2P0NA 1Z7Qc 4CS8A 5CI8A 1TQGA 1V74B 3W2VA 3T4RA 2R02A 1SZIA 4LERA 3JCUQ 1ZHTA 2VCCA 2GDCA 3IQTA 3NMIA 2IM8A 3VM6A 1YYXA 1ZYRF 3QVYA 3W2WA 4YWQA 1BR2A 1OW6A 2LSEA 1JR8A 3UMKA 1LPEA 4IJJA 1HY5A 5KYYA 1BZ4A 2KK1A 3AG3C 2J9BA 1V54C 4YT8A 1EI7A 1OKKD 2IBFA 1QLEC 2HMZA 4XQ1A 5DQTA 4JE9A 3C8ZA 3EZHA 2HZ8A 2OCCC 1L7CA 1T5OA 2R05A 4CS8C 4MNDA 1ZW2A 2Y3BA 2L9JA 1WATA 2BL2A 5KYWA 1FMVA 4PACA 1BR4A 1Q0FA 1I4YA 2Q00A 4B6IA 5FZTA 1JPJA 2V3CC 1H6GA 4JIOA 2FAPB 1VB5A 2YLIA 4BJ6A 1KNYA 4R32A 1WTYA 4FWVA 4BG0A 4W8PA 1IZMA 1LS4A 4PJJA 5BQGA 4O6NA 4DXWA 1Q0MA 4KNWA 5KYXA 2Y39A 1TFOB 2JD3A 2XS1A 4LDKA 4PJLA 1XWJA 3KKBA 4A2NB 2YVKA 4CIHA 256BA 2EPKX 2J7PD 1OKKA 1YARO 1ZU4A 1Z23A 2I15A 2UUIA 3AGUA 5B3IA 3U0CA 2L6HA 4DRIB 1LM3B 3DI5A 5DS5A 3U3BA 4BJ6C 3A11A 3O55A 1ZVZA 3EG9A 4AL1A 2HV7A 3SNHA 1RMVA 5A6AA 2ZD9A 4LLEA 3U5SA 3VF0A 4OIPF 1VMAA 2G3VA 4K7BA 3EGDA 3O6XA 3V7OA 4U9DA 3X1OA 4OINF 3X2QC 4DVYP 4YL0A 3L34A 1O3UA 5DS4A 1JOGA 3R2PA 5CIVA 3ECSA 2PX3A 1OW8A 2YL7A 1QQ3A 3M4CA 4PK4A 3RKOF 3ZTZA 1FFHA 1VYKA 2QLAA 3MFNA 3DAFA 4ULWA 1U89A 3QMKA 2QE9A 5L0JA 1EQ1A 3ZSUA 1MNEA 4GYTA 4O7GA 2XM4A 3SXKA 4JEBA 1BBHA 2J7PA 4NC3A 5T3TA 4BEMJ 4C3BA 2HUJA 3C63A 3FMSA 1T01A 2C03A 3L8IA 3AQBA 1YAUO 4EIYA 4L6RA 4J7YA 2NUTB 1Z5ZA 4DOZA 1RKCA 4LLCA 4YK5A 3C8GD 4WGZA 2YL1A 3LEVA 4D4NA 3G4ZA 5T3WA 3SXYA 4CX9A 3RF3A 3GORA 3DJNB 4EHPA 1AEPA 5BQHA 3KL4A 2BE5F 2WZFA 2HJ3A 3EFOB 3M4BA 3HTKC 4H4KC 2JPUA 4P9TA 3SXMA 2JX0A 5L3QA 3S27A 1HE1A 3DJUB 1YYJA 4MVRA 4YL1A 1HMOA 3U8VA 5T1DB 2GA0A 3IQ6A 1J8YF 2YLGA 3ZC4A 4E0HA 4AE4A 4JCZA 4AK9A 1D0YA 3CSKA 3FAPB 5JP7A 1QPUA 1FAPB 2W9YA 4O6YA 3L8JA 5D91A 3JTLO 4J7TA 2XLOA 3EGXA 1H7IA 2A68F 4XWJA 3DAGA 1M6TA 4Q7CA 3AOUA 4MVUA 3RYLA 5TJ5E 5FCLA 3DE8A 3GWNA 1ZHWA 4Q5SF 2ETSA 2VH3A 3C18A 3C8GA 3QTHA 1G4US 2Q3TA 1RXQA 2WZGA 2DYSC 2H7VC 2H7OA 3TD7A 2R7UA 1T6IA 1MMNA 3U2LA 3M79A 2LQGA 2RD9A 3Q7GA 5A69A 1E84A 1M57C 3DM5A 3OWTA 3I4UA 3S84A 4N06A 2NUTA 2YL0A 1ST6A 4LACB 3ABMC 3JYHA 3S29A 4NTBA 4EKWA 5KYWB 2XLEA 1ORJA 2DYRC 2H8AA 4EBJA 5L0CA 3AG4C 4JKVA 1ZHXA 2OOCA 4U5BE 4GQHA 3FOOA 1NSGB 2P6VA 4YT4A 3HNIA 3JYYA 2XLHA 2XLWA 4KC9A 3W8HA 4ZLDA 2PBEA 5DQZA 5KYXB 2LFDA 3NYMA 3B0VC 4XPXA 2CGEA 4CJGA 4YT2A 2LD6A 4Z9IA 2R03A 3V5ZA 4KI2A 1TFKB 2XLDA 2LP4A 2A0UA 4I44A 4P9FA 2KSFA 3TJ6A 3U3FA 1D1CA 3GWLA 3DKAA 3EZIA 3WODF 1SMYF 2CCYA 1FNTc 3AG2C 4XLPF 1WGWA 3QVZA 2OU6A 3EG9B 1C17M 2J0WA 1NZEA 1Q0DA 1PD1A 1NG1A 3ASOC 1XZPA 2PF4E 3FDQA 2A69F 2VCBA 2WVNA 3EGDB 1PV3A 2F22A 4CSAA 1A0BA 2HS5A 4U5EE 3C62A 2L7AA 4NTFA 4U5DE 5E2QA 4MTGA 1K05A 2V26A 3IQCA 4JEAA 5B1AC 3HNJA 2EPMX 2M64A 3LUTB 4IGGA 5JLIA 2MYSA 3QW0A 2VC9A 3T6GB 4BJTA 3VYWA 2XRHA 3PCVA 3LLKA 2LCHA 1FR0A 5JSLA 5A6BD 4G7ZF 1OXKA 3S90A 2OQMA 4C3DA 1WN0A 4LDRA 1XZQA 3M15A 4JCHA 4CSAC 1VLTA 3B9QA 1RKEA 5DS6A 4IWBA 1M56C 1TWHA 4U9EA 3SP1A 1M2VA 2J45A 2R7QA 3TJ5A 4BEJA 1H9TA 5EGYA 3TQOA 2PX0A 2X51A 4W8KA 5JUAA 1B68A 4HFFB 4JVSA 4MW3A 5L0DA 3HNLA 1YJGA 2J9WA 5L0FA 4PJMA 2LIGA 3WHNA 3FOPA 3LEOA 4K1OA 1TWAA 2WZLA 1C03A 1YVIA 1YA9A 2RSEB 1ZU5A 3NDBB 1VTMP 2KQ9A 5AGFA 4AE4B 4OIQF 5A6BA 3AG1C 2AWYA 4U5HA 3FAJA 2NG1A 4XPYA 3I5PA 1YZAA 2IXNA 1G5ZA 3ZTMA 4FAPB 4D4XA 4EWCA 4Q4ZF 3LS0A 1D1AA 3HJCA 3EGXB 1LS1A 2HSBA 4HFKB 4XEFA 4DBRA 3VRCA 4DRHB 4JJGA 2J8WA 5L3VA 2YWAA 4M63A 3C8GB 4KNVA 2YEVA 2Y3HA 1UFBA 4KBLA 3DWWA 1K40A 1W2WA 2OEVA 3LNMB 1YA7O 3RQFA 3CQZA 1BDJB 3NMKA 2WL8A 1ZZPA 3EH2A 4IAQA 4CDVA 3NG1A 4AL0A 2PFDA 3FHDA 4P6IC 5BUOA 5HV9A 3T6BA 2QUPA 1MNDA 2XM0A 4XLNF 1T6QA 3POVA 1A7VA 2ZXRA 1NLXA 2H7BA 4JZAA 2P7VA 3UNGC 1U6HA 3JRTA 1QVXA 3A9CA 3RVYA 3L0IA 1LIHA 3CEXA 1R5ID 3LESA 1VYIA 4H54A 3U9JA 1S05A 3U9MA 2EIJC 3UGOA 3B0UX 2W4MA 3EHMA 2VB6A 4F4BA 1R4TA 3EPVA 4OD4A 1U0BB 2EPLX 3C7JA 3J06A 5E3CA 2G62A 3B0PA 4NY3A 1NFOA 2KJGA 3JRMO 2EIMC 2Y3GA 3JT1A 4E18A 3KYIA 3Q7LA 5KYUB 2QY9A 5E33A 2L6FA 2Z15A 4XEVA 1VLSA 2CW0F 1KU2A 2D4UA 2A6HF 3K7DA 2A1DD 2DGJA 2EPOA 3ITFA 4RD9A 4QI2A 1LKXA 4J30B 3VAYA 5L0GA 1NFNA 3K6BA 3KPHA 3EJNA 4HE8D 2XLVA 1A41A 4U5GA 3TOMA 3UGPA 4I1MA 1Y4CA 1HE9A 5DLJA 5E3AA 3ZQYA 4ER9A 2HV6A 5JS5A 3GEIA 1KTMA 1JPNA 1EA8A 1GS9A 2DI3A 2D5RB 2KNHA 3Q6MA 2XSEA 1NU7D 2R7WA 3MYFA 2ZXOA 3CZ6A 1OXBA 1Z63A 1OCRC 2VCAA 2Y3DA 2AP3A 3B71A 3FVYA 5JVEA 3ZG1A 5F5FA 1G4WR 2ZXWC 3NRHA 3O39A 4EUKB 5AC4A 2TMVP 2YKZA 1YLMA 1MMGA 3ASNC 3FXHA 2NUPA 4AX2A 1RKEB 3EQLF 3TULA 1RJ9B 4OIRF 2HMQA 3U2MA 3RQEA 1M2VB 3ZIBA 2YLDA 4ONSA 2A6EF 2ICWG 3I5QA 3K33A 4X0RA 5L0IA 4XPWA 5GPGB 5IY5C 1E83A 1QSPA 2IXMA 2VASA 4MVSA 2CNWD 1TR2A 2NPUA 5KYUA 1WASA 3IQ5A 3T6JA 3ZVRA 1F1MA 4BJ5A 3K66A 2XL4A 3SYNA 5A6JA 1OR3A 3S0XA 2R7VA 2OJED 4I3MA 2G3KA 2R7XA 3TK0A 4NQFA 3KMIA 3MBGA 3RW0A 2YZSA 1C02A 2XS8A 3TOLA 1OCOC 3JSEO 2KYHA 1O87A 1Z3IX 3NYLA 4MTFA 1CPRA 4O79A 1ZW3A 5AC5A 2EIKC 1SF8A 2XLMA 2YQYA 1ZHYA 3GM1A 4PJNA 5BQIA 3DM9B 3RH3A 2B0JA 1Y6DA 3AQCA 1Q0KA 1MMDA 2E87A 4BJ5C 2XL6A 5COMA 3M1CB 1E2XA 2BC5A 4U5FE 5B1BC 1G8XA 2EPNA 2HSQA 2W45A 3ABLC 3K1HA 1HW1A 1ORYA 1UG7A 3F47A 4N6HA 4YL3A 4G7OF 4JW1A 1CGOA 3GM3A 3N2ZB 2GAQA 2QTVA 3EHNA 3MX3A 1NU9C 3QW1A 3DXJF 1MQVA 1L3PA 4G0HA 3KYJA 4MW8A 2R25A 4O6MA 2PP4A 2CNWA 2C04A 3PDMP 1CGNA 2KC3A 2B0HA 3LAYA 3EH1A 1YDIA 5F5HA 2XXAB 4HEAJ 1RJ9A 4YT5A 4JRZA 1FFTC 5EHHA 2FGYA 3S9OA 4YN0B 1K04A 2FFHA 2PNOA 2R7SA 3NKEA 1OR2A 4CJOA 1DOVA 3BEHA 4PR9A 2R9RB 3ATPA 4JURI 3G50A 4YJWA 1E86A 3MYIA 4OIOF 3Q6NA 4FESA 3PHF2 1SR2A 4MVZA 5DVWA 4Z9JA 4C3EA 4QDLA 5KYNA 1IW7F 3US6A 4Z9HA 2J9VA 3HLZA 1CPQA 1TWGA 4ULVA 4CS9A 1PD0A 4ZLCA 2NSGA 1LI5A 3IEEA 5B3SC 4JJFA 1FMWA 1BR1A 1LI7A 2GWWA 2KW3C 2OG2A 1Q0GA 3UR3C 4UDVA 4N6CA 4G7HF 2L6GA 2J9UA 5D92A 3DZAA 2R7OA 4RBNA 1I5NA 1TKNA 4WABA 1S7ZA 1QZXA 4DVZA 4LDQA 2UUHA 3B29A 1LE4A 1T6UA 1GGQA 3LS1A 4CDAA 2QNLA 1I4ZA 1MMAA 2Q4FA 4IB4A 5JT4A 1D0ZA 4MVOA 3GEHA 3U8PA 1RCPA 2HFIA 2IXPA 4I1OB 5JRAA 4CS9C 3RIPA 4WGYA 2CDQA 3IPMO 2WB7A 1APCA 2XXAA 2R7RA 5EK0A 1QKRA 3RVZA 1NBBA 4MTOA 3CAXA 3RQGA 1AVOB 2OEXA 5A6KA 1WOLA 1YZCA 1HW2A 1JRAA 3MLGA 3LJBA 1JAFA 4OD5A 5F28E 4E17A 3JZ0A 3DMDA 1M2OA 2YL3A 3H2UA 2WVOA 2WVQA 3JSZA 3T9OA 4EBKA 1N1CA 4G78A 3DD7A 4K0DA 4WJ0A 4ANJA 1V4AA 4E7ZA 1JMWA 4CIPA 2P1AA 1J8MF 1LVKA 3LLIA 3S28A 3ZWIA 2NUPB 1TWCA 3SEOA 4IRUA 4FX5A 5CI9A 5COGA 2XL8A 3V5YA 2YHSA 1D0XA 1V55C 1E85A 4NTAA 2ZXPA 4IAOA 3BRJA 2W4BA 1OQCA 2HJMA 2EINC 2LK4A 3NKDA 3PMRA 4DRJB 2OKUA 1ORSC 2J46A 2Q9CA 3UMIA 1SYQA 4BJ1A 4IARA 3GANA 4U5CE 3DE9A 3E9VA 3F46A 3KH2A 3N24A 2OJQA 3HKKA 3ZQVA 2J0XA 4BPMA 3LNRA 3O10A 1EKYA 1OCCC 1HMDA 1LE2A 3QZCA 2Q7RA 2Q9BA 4JTCB 2Y69C 3OEOA 1OW7A 2IXOA 3AGTA 4C7OB 2R7TA 5COFA 4XEKA 1DOWA 4DBQA 2AWCA 4A4AA 3UMHA 3NMJA 4J32B 3ZDLA 3W4YA 4E0IA 1CGME 3AJMA 5L0HA 2A0BA 3E70C 3W8IA 4MQ9F 2EILC 3N0TA 3WG7C 2LFFA 1VK5A 4PFOA 4JTDB 3G4XA 2IOQA 3ABKC 2AVKA 1T9KA 2MHRA 3NYJA 3SZRA
chains in the Genus database with same CATH topology
4AL0A 5HV9A 3PCVA 4YL3A 5BQHA 4YL0A 3HKKA 4BPMA 5BQGA 2Q7RA 4YL1A 4NTBA 4WABA 2H8AA 2UUHA 3B29A 5K0IA 4JRZA 4JCZA 2UUIA 2PNOA 4J7TA 3DWWA 5BQIA 4NTFA 3LEOA 4NTAA 4AL1A 4JC7A 4J7YA 4YK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AL0 A;  5HV9 A;  3PCV A;  4YL3 A;  5BQH A;  4YL0 A;  3HKK A;  4BPM A;  5BQG A;  2Q7R A;  4YL1 A;  4NTB A;  4WAB A;  2H8A A;  2UUH A;  3B29 A;  5K0I A;  4JRZ A;  4JCZ A;  2UUI A;  2PNO A;  4J7T A;  3DWW A;  5BQI A;  4NTF A;  3LEO A;  4NTA A;  4AL1 A;  4JC7 A;  4J7Y A;  4YK5 A; 
#chains in the Genus database with same CATH topology
 4GEH A;  2L81 A;  2YRF A;  4E7S A;  2GFH A;  2CYD A;  2Q9A A;  5KYY B;  1WWP A;  3GEE A;  1D1B A;  2AU5 A;  1VOM A;  3OA1 A;  2P61 A;  4JTA B;  4CDY A;  1GM5 A;  1A7E A;  4MVQ A;  5HSW A;  4PFP A;  4XTK A;  1PCX A;  2X0C A;  2DB4 A;  3K1I A;  4QI0 A;  4NCQ A;  4CS7 A;  1GQA A;  4DJ9 A;  3R7C A;  1Z6A A;  2KGO A;  3GOD A;  2IYL D;  5K0I A;  1ZHZ A;  4EBB A;  2O9X A;  1AUE A;  1OCZ C;  3EFO A;  4N4W A;  4RDA A;  1H9G A;  1A7D A;  3H65 A;  4MVM A;  1FTS A;  3H2V A;  1O5H A;  3WAQ A;  2NSF A;  3HNK A;  4CBE A;  4MS2 A;  2HKV A;  2I8B A;  3L1M A;  4JC7 A;  2ASR A;  4C7O A;  2ZPA A;  2MWQ A;  3V5X A;  3K1I C;  3IHU A;  2M4E A;  3GM2 A;  3RFY A;  3SXZ A;  2P0N A;  1Z7Q c;  4CS8 A;  5CI8 A;  1TQG A;  1V74 B;  3W2V A;  3T4R A;  2R02 A;  1SZI A;  4LER A;  3JCU Q;  1ZHT A;  2VCC A;  2GDC A;  3IQT A;  3NMI A;  2IM8 A;  3VM6 A;  1YYX A;  1ZYR F;  3QVY A;  3W2W A;  4YWQ A;  1BR2 A;  1OW6 A;  2LSE A;  1JR8 A;  3UMK A;  1LPE A;  4IJJ A;  1HY5 A;  5KYY A;  1BZ4 A;  2KK1 A;  3AG3 C;  2J9B A;  1V54 C;  4YT8 A;  1EI7 A;  1OKK D;  2IBF A;  1QLE C;  2HMZ A;  4XQ1 A;  5DQT A;  4JE9 A;  3C8Z A;  3EZH A;  2HZ8 A;  2OCC C;  1L7C A;  1T5O A;  2R05 A;  4CS8 C;  4MND A;  1ZW2 A;  2Y3B A;  2L9J A;  1WAT A;  2BL2 A;  5KYW A;  1FMV A;  4PAC A;  1BR4 A;  1Q0F A;  1I4Y A;  2Q00 A;  4B6I A;  5FZT A;  1JPJ A;  2V3C C;  1H6G A;  4JIO A;  2FAP B;  1VB5 A;  2YLI A;  4BJ6 A;  1KNY A;  4R32 A;  1WTY A;  4FWV A;  4BG0 A;  4W8P A;  1IZM A;  1LS4 A;  4PJJ A;  5BQG A;  4O6N A;  4DXW A;  1Q0M A;  4KNW A;  5KYX A;  2Y39 A;  1TFO B;  2JD3 A;  2XS1 A;  4LDK A;  4PJL A;  1XWJ A;  3KKB A;  4A2N B;  2YVK A;  4CIH A;  256B A;  2EPK X;  2J7P D;  1OKK A;  1YAR O;  1ZU4 A;  1Z23 A;  2I15 A;  2UUI A;  3AGU A;  5B3I A;  3U0C A;  2L6H A;  4DRI B;  1LM3 B;  3DI5 A;  5DS5 A;  3U3B A;  4BJ6 C;  3A11 A;  3O55 A;  1ZVZ A;  3EG9 A;  4AL1 A;  2HV7 A;  3SNH A;  1RMV A;  5A6A A;  2ZD9 A;  4LLE A;  3U5S A;  3VF0 A;  4OIP F;  1VMA A;  2G3V A;  4K7B A;  3EGD A;  3O6X A;  3V7O A;  4U9D A;  3X1O A;  4OIN F;  3X2Q C;  4DVY P;  4YL0 A;  3L34 A;  1O3U A;  5DS4 A;  1JOG A;  3R2P A;  5CIV A;  3ECS A;  2PX3 A;  1OW8 A;  2YL7 A;  1QQ3 A;  3M4C A;  4PK4 A;  3RKO F;  3ZTZ A;  1FFH A;  1VYK A;  2QLA A;  3MFN A;  3DAF A;  4ULW A;  1U89 A;  3QMK A;  2QE9 A;  5L0J A;  1EQ1 A;  3ZSU A;  1MNE A;  4GYT A;  4O7G A;  2XM4 A;  3SXK A;  4JEB A;  1BBH A;  2J7P A;  4NC3 A;  5T3T A;  4BEM J;  4C3B A;  2HUJ A;  3C63 A;  3FMS A;  1T01 A;  2C03 A;  3L8I A;  3AQB A;  1YAU O;  4EIY A;  4L6R A;  4J7Y A;  2NUT B;  1Z5Z A;  4DOZ A;  1RKC A;  4LLC A;  4YK5 A;  3C8G D;  4WGZ A;  2YL1 A;  3LEV A;  4D4N A;  3G4Z A;  5T3W A;  3SXY A;  4CX9 A;  3RF3 A;  3GOR A;  3DJN B;  4EHP A;  1AEP A;  5BQH A;  3KL4 A;  2BE5 F;  2WZF A;  2HJ3 A;  3EFO B;  3M4B A;  3HTK C;  4H4K C;  2JPU A;  4P9T A;  3SXM A;  2JX0 A;  5L3Q A;  3S27 A;  1HE1 A;  3DJU B;  1YYJ A;  4MVR A;  4YL1 A;  1HMO A;  3U8V A;  5T1D B;  2GA0 A;  3IQ6 A;  1J8Y F;  2YLG A;  3ZC4 A;  4E0H A;  4AE4 A;  4JCZ A;  4AK9 A;  1D0Y A;  3CSK A;  3FAP B;  5JP7 A;  1QPU A;  1FAP B;  2W9Y A;  4O6Y A;  3L8J A;  5D91 A;  3JTL O;  4J7T A;  2XLO A;  3EGX A;  1H7I A;  2A68 F;  4XWJ A;  3DAG A;  1M6T A;  4Q7C A;  3AOU A;  4MVU A;  3RYL A;  5TJ5 E;  5FCL A;  3DE8 A;  3GWN A;  1ZHW A;  4Q5S F;  2ETS A;  2VH3 A;  3C18 A;  3C8G A;  3QTH A;  1G4U S;  2Q3T A;  1RXQ A;  2WZG A;  2DYS C;  2H7V C;  2H7O A;  3TD7 A;  2R7U A;  1T6I A;  1MMN A;  3U2L A;  3M79 A;  2LQG A;  2RD9 A;  3Q7G A;  5A69 A;  1E84 A;  1M57 C;  3DM5 A;  3OWT A;  3I4U A;  3S84 A;  4N06 A;  2NUT A;  2YL0 A;  1ST6 A;  4LAC B;  3ABM C;  3JYH A;  3S29 A;  4NTB A;  4EKW A;  5KYW B;  2XLE A;  1ORJ A;  2DYR C;  2H8A A;  4EBJ A;  5L0C A;  3AG4 C;  4JKV A;  1ZHX A;  2OOC A;  4U5B E;  4GQH A;  3FOO A;  1NSG B;  2P6V A;  4YT4 A;  3HNI A;  3JYY A;  2XLH A;  2XLW A;  4KC9 A;  3W8H A;  4ZLD A;  2PBE A;  5DQZ A;  5KYX B;  2LFD A;  3NYM A;  3B0V C;  4XPX A;  2CGE A;  4CJG A;  4YT2 A;  2LD6 A;  4Z9I A;  2R03 A;  3V5Z A;  4KI2 A;  1TFK B;  2XLD A;  2LP4 A;  2A0U A;  4I44 A;  4P9F A;  2KSF A;  3TJ6 A;  3U3F A;  1D1C A;  3GWL A;  3DKA A;  3EZI A;  3WOD F;  1SMY F;  2CCY A;  1FNT c;  3AG2 C;  4XLP F;  1WGW A;  3QVZ A;  2OU6 A;  3EG9 B;  1C17 M;  2J0W A;  1NZE A;  1Q0D A;  1PD1 A;  1NG1 A;  3ASO C;  1XZP A;  2PF4 E;  3FDQ A;  2A69 F;  2VCB A;  2WVN A;  3EGD B;  1PV3 A;  2F22 A;  4CSA A;  1A0B A;  2HS5 A;  4U5E E;  3C62 A;  2L7A A;  4NTF A;  4U5D E;  5E2Q A;  4MTG A;  1K05 A;  2V26 A;  3IQC A;  4JEA A;  5B1A C;  3HNJ A;  2EPM X;  2M64 A;  3LUT B;  4IGG A;  5JLI A;  2MYS A;  3QW0 A;  2VC9 A;  3T6G B;  4BJT A;  3VYW A;  2XRH A;  3PCV A;  3LLK A;  2LCH A;  1FR0 A;  5JSL A;  5A6B D;  4G7Z F;  1OXK A;  3S90 A;  2OQM A;  4C3D A;  1WN0 A;  4LDR A;  1XZQ A;  3M15 A;  4JCH A;  4CSA C;  1VLT A;  3B9Q A;  1RKE A;  5DS6 A;  4IWB A;  1M56 C;  1TWH A;  4U9E A;  3SP1 A;  1M2V A;  2J45 A;  2R7Q A;  3TJ5 A;  4BEJ A;  1H9T A;  5EGY A;  3TQO A;  2PX0 A;  2X51 A;  4W8K A;  5JUA A;  1B68 A;  4HFF B;  4JVS A;  4MW3 A;  5L0D A;  3HNL A;  1YJG A;  2J9W A;  5L0F A;  4PJM A;  2LIG A;  3WHN A;  3FOP A;  3LEO A;  4K1O A;  1TWA A;  2WZL A;  1C03 A;  1YVI A;  1YA9 A;  2RSE B;  1ZU5 A;  3NDB B;  1VTM P;  2KQ9 A;  5AGF A;  4AE4 B;  4OIQ F;  5A6B A;  3AG1 C;  2AWY A;  4U5H A;  3FAJ A;  2NG1 A;  4XPY A;  3I5P A;  1YZA A;  2IXN A;  1G5Z A;  3ZTM A;  4FAP B;  4D4X A;  4EWC A;  4Q4Z F;  3LS0 A;  1D1A A;  3HJC A;  3EGX B;  1LS1 A;  2HSB A;  4HFK B;  4XEF A;  4DBR A;  3VRC A;  4DRH B;  4JJG A;  2J8W A;  5L3V A;  2YWA A;  4M63 A;  3C8G B;  4KNV A;  2YEV A;  2Y3H A;  1UFB A;  4KBL A;  3DWW A;  1K40 A;  1W2W A;  2OEV A;  3LNM B;  1YA7 O;  3RQF A;  3CQZ A;  1BDJ B;  3NMK A;  2WL8 A;  1ZZP A;  3EH2 A;  4IAQ A;  4CDV A;  3NG1 A;  4AL0 A;  2PFD A;  3FHD A;  4P6I C;  5BUO A;  5HV9 A;  3T6B A;  2QUP A;  1MND A;  2XM0 A;  4XLN F;  1T6Q A;  3POV A;  1A7V A;  2ZXR A;  1NLX A;  2H7B A;  4JZA A;  2P7V A;  3UNG C;  1U6H A;  3JRT A;  1QVX A;  3A9C A;  3RVY A;  3L0I A;  1LIH A;  3CEX A;  1R5I D;  3LES A;  1VYI A;  4H54 A;  3U9J A;  1S05 A;  3U9M A;  2EIJ C;  3UGO A;  3B0U X;  2W4M A;  3EHM A;  2VB6 A;  4F4B A;  1R4T A;  3EPV A;  4OD4 A;  1U0B B;  2EPL X;  3C7J A;  3J06 A;  5E3C A;  2G62 A;  3B0P A;  4NY3 A;  1NFO A;  2KJG A;  3JRM O;  2EIM C;  2Y3G A;  3JT1 A;  4E18 A;  3KYI A;  3Q7L A;  5KYU B;  2QY9 A;  5E33 A;  2L6F A;  2Z15 A;  4XEV A;  1VLS A;  2CW0 F;  1KU2 A;  2D4U A;  2A6H F;  3K7D A;  2A1D D;  2DGJ A;  2EPO A;  3ITF A;  4RD9 A;  4QI2 A;  1LKX A;  4J30 B;  3VAY A;  5L0G A;  1NFN A;  3K6B A;  3KPH A;  3EJN A;  4HE8 D;  2XLV A;  1A41 A;  4U5G A;  3TOM A;  3UGP A;  4I1M A;  1Y4C A;  1HE9 A;  5DLJ A;  5E3A A;  3ZQY A;  4ER9 A;  2HV6 A;  5JS5 A;  3GEI A;  1KTM A;  1JPN A;  1EA8 A;  1GS9 A;  2DI3 A;  2D5R B;  2KNH A;  3Q6M A;  2XSE A;  1NU7 D;  2R7W A;  3MYF A;  2ZXO A;  3CZ6 A;  1OXB A;  1Z63 A;  1OCR C;  2VCA A;  2Y3D A;  2AP3 A;  3B71 A;  3FVY A;  5JVE A;  3ZG1 A;  5F5F A;  1G4W R;  2ZXW C;  3NRH A;  3O39 A;  4EUK B;  5AC4 A;  2TMV P;  2YKZ A;  1YLM A;  1MMG A;  3ASN C;  3FXH A;  2NUP A;  4AX2 A;  1RKE B;  3EQL F;  3TUL A;  1RJ9 B;  4OIR F;  2HMQ A;  3U2M A;  3RQE A;  1M2V B;  3ZIB A;  2YLD A;  4ONS A;  2A6E F;  2ICW G;  3I5Q A;  3K33 A;  4X0R A;  5L0I A;  4XPW A;  5GPG B;  5IY5 C;  1E83 A;  1QSP A;  2IXM A;  2VAS A;  4MVS A;  2CNW D;  1TR2 A;  2NPU A;  5KYU A;  1WAS A;  3IQ5 A;  3T6J A;  3ZVR A;  1F1M A;  4BJ5 A;  3K66 A;  2XL4 A;  3SYN A;  5A6J A;  1OR3 A;  3S0X A;  2R7V A;  2OJE D;  4I3M A;  2G3K A;  2R7X A;  3TK0 A;  4NQF A;  3KMI A;  3MBG A;  3RW0 A;  2YZS A;  1C02 A;  2XS8 A;  3TOL A;  1OCO C;  3JSE O;  2KYH A;  1O87 A;  1Z3I X;  3NYL A;  4MTF A;  1CPR A;  4O79 A;  1ZW3 A;  5AC5 A;  2EIK C;  1SF8 A;  2XLM A;  2YQY A;  1ZHY A;  3GM1 A;  4PJN A;  5BQI A;  3DM9 B;  3RH3 A;  2B0J A;  1Y6D A;  3AQC A;  1Q0K A;  1MMD A;  2E87 A;  4BJ5 C;  2XL6 A;  5COM A;  3M1C B;  1E2X A;  2BC5 A;  4U5F E;  5B1B C;  1G8X A;  2EPN A;  2HSQ A;  2W45 A;  3ABL C;  3K1H A;  1HW1 A;  1ORY A;  1UG7 A;  3F47 A;  4N6H A;  4YL3 A;  4G7O F;  4JW1 A;  1CGO A;  3GM3 A;  3N2Z B;  2GAQ A;  2QTV A;  3EHN A;  3MX3 A;  1NU9 C;  3QW1 A;  3DXJ F;  1MQV A;  1L3P A;  4G0H A;  3KYJ A;  4MW8 A;  2R25 A;  4O6M A;  2PP4 A;  2CNW A;  2C04 A;  3PDM P;  1CGN A;  2KC3 A;  2B0H A;  3LAY A;  3EH1 A;  1YDI A;  5F5H A;  2XXA B;  4HEA J;  1RJ9 A;  4YT5 A;  4JRZ A;  1FFT C;  5EHH A;  2FGY A;  3S9O A;  4YN0 B;  1K04 A;  2FFH A;  2PNO A;  2R7S A;  3NKE A;  1OR2 A;  4CJO A;  1DOV A;  3BEH A;  4PR9 A;  2R9R B;  3ATP A;  4JUR I;  3G50 A;  4YJW A;  1E86 A;  3MYI A;  4OIO F;  3Q6N A;  4FES A;  3PHF 2;  1SR2 A;  4MVZ A;  5DVW A;  4Z9J A;  4C3E A;  4QDL A;  5KYN A;  1IW7 F;  3US6 A;  4Z9H A;  2J9V A;  3HLZ A;  1CPQ A;  1TWG A;  4ULV A;  4CS9 A;  1PD0 A;  4ZLC A;  2NSG A;  1LI5 A;  3IEE A;  5B3S C;  4JJF A;  1FMW A;  1BR1 A;  1LI7 A;  2GWW A;  2KW3 C;  2OG2 A;  1Q0G A;  3UR3 C;  4UDV A;  4N6C A;  4G7H F;  2L6G A;  2J9U A;  5D92 A;  3DZA A;  2R7O A;  4RBN A;  1I5N A;  1TKN A;  4WAB A;  1S7Z A;  1QZX A;  4DVZ A;  4LDQ A;  2UUH A;  3B29 A;  1LE4 A;  1T6U A;  1GGQ A;  3LS1 A;  4CDA A;  2QNL A;  1I4Z A;  1MMA A;  2Q4F A;  4IB4 A;  5JT4 A;  1D0Z A;  4MVO A;  3GEH A;  3U8P A;  1RCP A;  2HFI A;  2IXP A;  4I1O B;  5JRA A;  4CS9 C;  3RIP A;  4WGY A;  2CDQ A;  3IPM O;  2WB7 A;  1APC A;  2XXA A;  2R7R A;  5EK0 A;  1QKR A;  3RVZ A;  1NBB A;  4MTO A;  3CAX A;  3RQG A;  1AVO B;  2OEX A;  5A6K A;  1WOL A;  1YZC A;  1HW2 A;  1JRA A;  3MLG A;  3LJB A;  1JAF A;  4OD5 A;  5F28 E;  4E17 A;  3JZ0 A;  3DMD A;  1M2O A;  2YL3 A;  3H2U A;  2WVO A;  2WVQ A;  3JSZ A;  3T9O A;  4EBK A;  1N1C A;  4G78 A;  3DD7 A;  4K0D A;  4WJ0 A;  4ANJ A;  1V4A A;  4E7Z A;  1JMW A;  4CIP A;  2P1A A;  1J8M F;  1LVK A;  3LLI A;  3S28 A;  3ZWI A;  2NUP B;  1TWC A;  3SEO A;  4IRU A;  4FX5 A;  5CI9 A;  5COG A;  2XL8 A;  3V5Y A;  2YHS A;  1D0X A;  1V55 C;  1E85 A;  4NTA A;  2ZXP A;  4IAO A;  3BRJ A;  2W4B A;  1OQC A;  2HJM A;  2EIN C;  2LK4 A;  3NKD A;  3PMR A;  4DRJ B;  2OKU A;  1ORS C;  2J46 A;  2Q9C A;  3UMI A;  1SYQ A;  4BJ1 A;  4IAR A;  3GAN A;  4U5C E;  3DE9 A;  3E9V A;  3F46 A;  3KH2 A;  3N24 A;  2OJQ A;  3HKK A;  3ZQV A;  2J0X A;  4BPM A;  3LNR A;  3O10 A;  1EKY A;  1OCC C;  1HMD A;  1LE2 A;  3QZC A;  2Q7R A;  2Q9B A;  4JTC B;  2Y69 C;  3OEO A;  1OW7 A;  2IXO A;  3AGT A;  4C7O B;  2R7T A;  5COF A;  4XEK A;  1DOW A;  4DBQ A;  2AWC A;  4A4A A;  3UMH A;  3NMJ A;  4J32 B;  3ZDL A;  3W4Y A;  4E0I A;  1CGM E;  3AJM A;  5L0H A;  2A0B A;  3E70 C;  3W8I A;  4MQ9 F;  2EIL C;  3N0T A;  3WG7 C;  2LFF A;  1VK5 A;  4PFO A;  4JTD B;  3G4X A;  2IOQ A;  3ABK C;  2AVK A;  1T9K A;  2MHR A;  3NYJ A;  3SZR A; 
#chains in the Genus database with same CATH homology
 4AL0 A;  5HV9 A;  3PCV A;  4YL3 A;  5BQH A;  4YL0 A;  3HKK A;  4BPM A;  5BQG A;  2Q7R A;  4YL1 A;  4NTB A;  4WAB A;  2H8A A;  2UUH A;  3B29 A;  5K0I A;  4JRZ A;  4JCZ A;  2UUI A;  2PNO A;  4J7T A;  3DWW A;  5BQI A;  4NTF A;  3LEO A;  4NTA A;  4AL1 A;  4JC7 A;  4J7Y A;  4YK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...