3LEOA

Structure of human leukotriene c4 synthase mutant r31q in complex with glutathione
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
150
structure length
150
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARQAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Arginine 104 is a key catalytic residue in leukotriene C4 synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 58
structure length 150
sequence length 150
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3leoA00
4YL3A 4JC7A 4YL0A 5HV9A 4JRZA 5K0IA 3PCVA 5BQHA 4NTBA 4YL1A 5BQGA 4WABA 2Q7RA 4AL1A 3LEOA 4J7TA 3HKKA 4J7YA 4YK5A 2PNOA 3B29A 4BPMA 4NTFA 2H8AA 5BQIA 2UUHA 4NTAA 4JCZA 4AL0A 3DWWA 2UUIA
chains in the Genus database with same CATH superfamily
4JC7A 2LIGA 1NSGB 1R5ID 5B1AC 4JTDB 1CGME 3UMKA 1JR8A 3AQCA 4XLNF 3Q7GA 2R7UA 4AE4B 2XLDA 4R32A 4E18A 2WVOA 1V74B 3U9MA 4CS7A 2VASA 5KYWB 4DXWA 1LS4A 2G62A 4XTKA 4G7ZF 1OW7A 2EPNA 1QKRA 4U9EA 1KU2A 2X51A 3OEOA 4O6NA 1VLTA 1Z5ZA 1VMAA 4BEMJ 1HW2A 1TR2A 4PK4A 1Z3IX 1DOWA 1G5ZA 1RCPA 2WVNA 4NQFA 3RYLA 3A9CA 4EKWA 1NBBA 3MFNA 3AJMA 4RBNA 3NMIA 1FNTc 2V3CC 3CQZA 2CNWD 2NUPA 3GODA 2YKZA 1R4TA 2Y69C 2J8WA 3DKAA 1T5OA 4CJGA 3I5PA 1OCZC 1AEPA 1S05A 3DJUB 4P9TA 4YL3A 4E0HA 4YT4A 4XEFA 4E17A 4MVUA 5JLIA 4YL1A 4FAPB 1QZXA 2LP4A 1MMAA 2PBEA 3EGXB 3KPHA 2VCAA 3K6BA 4P6IC 5EK0A 3U8VA 1HW1A 4MVQA 4OIOF 3L8IA 3JRMO 1M2OA 1K05A 1TFKB 2RSEB 1NU9C 2ZD9A 1D0ZA 2J0XA 4K1OA 1WN0A 2VB6A 4PJMA 4DBRA 3TJ6A 4E7SA 3EZHA 3FAPB 1M2VA 5T1DB 2DI3A 4CDAA 3HJCA 4AX2A 2HZ8A 3FDQA 1AVOB 1YYJA 2PX0A 2XLOA 3US6A 5CIVA 3WHNA 3G50A 3VM6A 4A4AA 2HS5A 2AP3A 4DJ9A 5BUOA 3JYHA 1TWHA 3U2LA 4EIYA 2FFHA 1PD1A 4OINF 1ZHZA 2ASRA 2DYRC 2NSFA 4CS8C 1D1BA 3SXYA 2KJGA 1VTMP 3TD7A 4CS8A 3T6BA 3B0VC 3EHMA 4N6CA 4HFKB 4FESA 4PACA 5F28E 2R7QA 2Q7RA 2NUTA 5KYXA 2YHSA 3ECSA 2OEXA 5A6JA 3PMRA 4J7TA 2VC9A 1M6TA 2RD9A 1GM5A 3ABKC 4MQ9F 1NLXA 3K1IC 3Q6MA 4DOZA 1YAUO 5L0IA 3JRTA 4D4NA 3NYJA 1M57C 2A6HF 5T3WA 3GM1A 4NTAA 3U3BA 4DBQA 4PFPA 3W2VA 4MW3A 2J9UA 3ZDLA 5E2QA 2CDQA 3O39A 3U0CA 1I4ZA 3C8GD 4KBLA 3CZ6A 3AQBA 5KYXB 2R7XA 1ZW3A 4JTCB 3UMHA 2J45A 1Z6AA 4JZAA 3TOLA 2YVKA 1OW8A 2WZFA 4O7GA 4J30B 1SR2A 1ZYRF 3IQCA 4JVSA 3T4RA 2Y39A 5E33A 1E2XA 4AK9A 2CNWA 2MHRA 1YA9A 4C3BA 5A6BD 3FAJA 3DI5A 1ORJA 2R7WA 3MX3A 3M79A 5D92A 2KQ9A 2Q00A 3S28A 1YLMA 2XLMA 3S84A 1C17M 3GEEA 3AG4C 1VOMA 4ULVA 4XPYA 5A69A 2KC3A 2XLEA 3K66A 1VB5A 3B0UX 4J32B 3O55A 4ZLCA 1LI7A 2A68F 2Q3TA 4U5FE 2L6GA 4I1MA 2A69F 2E87A 2PF4E 2XLWA 1FTSA 3AG3C 3VYWA 4WGZA 5A6KA 4JURI 4A2NB 1EQ1A 4JEBA 5L0CA 1Z23A 3RKOF 1OR3A 4Z9JA 2YL7A 3F46A 1BBHA 4RD9A 3B71A 4U9DA 3SXMA 2QUPA 3UMIA 3I5QA 3ZIBA 5EHHA 4G7OF 3C63A 5F5FA 3ZTMA 2CCYA 4MS2A 4NCQA 4BPMA 3RVYA 1L7CA 2P1AA 3N0TA 3MYFA 4M63A 4YJWA 4YK5A 5A6AA 4CSAA 4XEVA 4PJJA 2EIMC 3GWNA 2PX3A 2EPOA 2OJED 1E85A 1TKNA 3JSEO 4JTAB 4W8KA 3EFOB 4I3MA 4NY3A 5JT4A 3FMSA 1RKCA 4JCZA 1FFHA 1T6QA 5COGA 3RVZA 3HNLA 3IQ5A 1NZEA 2HSBA 5KYNA 3JT1A 2AWYA 1ZHTA 2XL8A 2YZSA 4CIHA 2CYDA 5JS5A 4IARA 1Y6DA 2XXAA 1PD0A 3QTHA 3EH1A 1G8XA 4IRUA 5BQHA 4CDVA 4DRIB 5JRAA 4C3DA 3V5ZA 4P9FA 3R2PA 2LFDA 3ABLC 3U3FA 5JUAA 3EG9B 3SXKA 2TMVP 1T6IA 1QLEC 3Q6NA 4K7BA 1LE2A 2OCCC 2CW0F 2DB4A 1CGOA 2IM8A 2NUTB 2YLGA 3LEVA 4J7YA 2YQYA 1G4WR 4IB4A 3KMIA 3HLZA 3GEIA 3L0IA 2MYSA 3KYJA 4JE9A 4JW1A 2PFDA 2W45A 4U5HA 1E86A 1MNDA 2YRFA 3M4CA 4L6RA 3RQEA 1V4AA 1HMOA 4H54A 3V5YA 3DM9B 1JAFA 3I4UA 2EPMX 4XPXA 4D4XA 3VRCA 1NU7D 3DAGA 5HV9A 1H7IA 1SZIA 2EIJC 3QW1A 4DRHB 2XM0A 2MWQA 2OU6A 3G4ZA 3MLGA 1TWAA 1VK5A 4IAOA 2ZXWC 3E70C 2LD6A 1RMVA 4WABA 1RJ9A 4W8PA 3EZIA 3RH3A 4JIOA 3WODF 3PDMP 1F1MA 1H6GA 3RQFA 3EPVA 1BZ4A 5B1BC 2ZXRA 2OG2A 4ULWA 3EGXA 2HJ3A 5E3CA 3LNMB 3JTLO 2KK1A 1KNYA 3LS1A 2IXNA 3R7CA 4Q7CA 2OQMA 1A7DA 2A6EF 3M4BA 4AL0A 4G7HF 1B68A 3M15A 2NUPB 2VH3A 2D5RB 2YL3A 2Y3GA 2Z15A 2KW3C 4JRZA 2FGYA 3DXJF 3IQ6A 5COMA 3NRHA 3BRJA 1D0XA 3S29A 2J9WA 3TQOA 5EGYA 4N4WA 4I1OB 3QVZA 4GQHA 3ZQVA 2XRHA 4MVOA 1HE1A 2KYHA 3AG1C 2Q4FA 3DE9A 4MTOA 2O9XA 3C8GA 3ZTZA 4AL1A 1SMYF 2ZPAA 2GAQA 1WGWA 3JCUQ 3OWTA 5KYWA 4CX9A 4MTGA 4IWBA 2V26A 4HE8D 3C62A 1AUEA 5IY5C 1U89A 1MQVA 3T9OA 5L3QA 3L1MA 3JZ0A 2OJQA 3QVYA 4U5BE 3SNHA 5DLJA 3GM3A 4MVMA 4Q4ZF 4DRJB 1V55C 2R7RA 1ZU5A 3EGDA 5D91A 4QI0A 1EI7A 1YJGA 2PP4A 1K40A 2YEVA 3LLIA 4CSAC 5JSLA 4Q5SF 2QE9A 2I8BA 3EGDB 3FOOA 2HMZA 4BEJA 3W4YA 1JMWA 1S7ZA 3EJNA 2R02A 1OQCA 2R7OA 4FX5A 1BDJB 1MMGA 2IXMA 3AGTA 5L3VA 5KYYB 5T3TA 1OXKA 2D4UA 1GS9A 2HV6A 3K7DA 3EH2A 3RFYA 1N1CA 3ZWIA 5COFA 5KYUA 1QPUA 1CGNA 1Q0MA 2Q9BA 3C7JA 3IPMO 4YT2A 2WL8A 2YL1A 2XXAB 1TWGA 1Q0GA 5L0JA 1WTYA 1BR1A 3IHUA 3TJ5A 3UR3C 3U2MA 3HNIA 2EPLX 4EBJA 3KYIA 1RJ9B 1QSPA 3O10A 4XLPF 2L9JA 2YWAA 1HMDA 1NG1A 1IZMA 4C7OA 3U5SA 1OKKD 5A6BA 3A11A 2H7BA 2HV7A 2H7OA 3BEHA 5E3AA 1YZAA 5L0HA 2OEVA 3PCVA 1YVIA 3DE8A 5L0FA 4KNWA 4U5DE 1K04A 1FMVA 4BJTA 3L34A 3C18A 5GPGB 1PCXA 1ZW2A 4O6MA 4XPWA 4JKVA 5JP7A 5B3SC 1KTMA 3H65A 2LQGA 1FAPB 4LDKA 2HFIA 2EPKX 3NYLA 1VLSA 1I4YA 1ORSC 3EQLF 4OD4A 3HKKA 4HFFB 5DVWA 3ZQYA 4KC9A 3LAYA 5AC5A 2EIKC 4NTFA 1YDIA 2H8AA 2L81A 2LFFA 4YWQA 1A7VA 3QZCA 2F22A 2IBFA 2R7SA 3DD7A 3NMJA 3F47A 1JOGA 1VYKA 3LNRA 2B0HA 1RKEB 3FHDA 1Z7Qc 3K1IA 1OR2A 2HKVA 4MW8A 3K33A 3GM2A 2OOCA 4PR9A 5FCLA 4YN0B 1JPNA 3AG2C 3L8JA 3ITFA 3VF0A 2JD3A 4EWCA 4BJ6A 4LERA 2P7VA 2DYSC 3S9OA 4KI2A 3DMDA 5AC4A 1M56C 2R03A 1BR4A 1LIHA 1MMNA 2C04A 3HTKC 3RQGA 3SXZA 2Y3HA 1E83A 1ZHXA 4ONSA 4PFOA 2XL4A 2ICWG 3U9JA 2GFHA 4PJNA 4BJ1A 4LDQA 1D0YA 1OXBA 2XS8A 4JJFA 2VCBA 4EHPA 4IGGA 3UNGC 1ZHWA 3FXHA 1Q0FA 3POVA 3H2VA 2A1DD 3DWWA 1OW6A 3M1CB 4CS9C 4NC3A 4N06A 1OCCC 1O87A 2X0CA 3ZVRA 3NYMA 4U5CE 4H4KC 2I15A 4MTFA 4YL0A 4CIPA 3GWLA 3PHF2 4PJLA 3TK0A 3ZG1A 3CAXA 1OKKA 4MVZA 1V54C 2J7PA 3LUTB 3TOMA 5F5HA 4F4BA 1JPJA 3QMKA 2QY9A 2XM4A 3EFOA 4LLCA 2Y3DA 2W4MA 1TFOB 2QTVA 4IAQA 1RKEA 2L6FA 4LLEA 5CI9A 1WWPA 2G3KA 1C02A 2H7VC 3RF3A 3FOPA 3RW0A 4DVZA 4DVYP 4EBBA 4UDVA 2W9YA 5KYYA 4QI2A 1YYXA 2A0UA 3N24A 2AU5A 1ZZPA 3SEOA 4BJ5C 1H9GA 1HY5A 1DOVA 2QNLA 4U5GA 3V7OA 1Q0KA 3DJNB 2L6HA 1HE9A 1BR2A 2QLAA 3B0PA 1FFTC 3V5XA 1JRAA 1T01A 2FAPB 2IYLD 4IJJA 4ANJA 1UFBA 3ATPA 2HMQA 4YT5A 4G0HA 1LE4A 1UG7A 1SF8A 1XWJA 2R9RB 2GDCA 3CEXA 3GORA 4WGYA 1VYIA 1T9KA 1G4US 2NSGA 3TULA 4G78A 2WZLA 2R05A 1EA8A 3N2ZB 3T6GB 3KL4A 4CDYA 1YZCA 1O5HA 1LPEA 1A0BA 5TJ5E 1E84A 2J46A 2VCCA 1LKXA 3U8PA 3HNJA 3LS0A 4OIQF 1J8MF 2AVKA 2WZGA 3RIPA 3SZRA 3ZC4A 2LCHA 2R25A 1SYQA 2J9BA 4BG0A 3C8GB 2P61A 3MBGA 4B6IA 2EILC 2G3VA 3E9VA 1OCOC 1XZPA 3ABMC 1ORYA 2BE5F 4OIRF 1YA7O 2LK4A 4C3EA 3NDBB 3J06A 1MNEA 3IQTA 2A0BA 4JEAA 3FVYA 4RDAA 3X2QC 4E7ZA 5DQTA 4E0IA 4JCHA 2YL0A 3OA1A 2XLHA 2OKUA 4KNVA 1CPQA 3W8HA 2IXPA 1IW7F 4BJ6C 1A7EA 2KGOA 3WAQA 1I5NA 3DAFA 1A41A 3NG1A 3EHNA 4O79A 2Q9CA 4I44A 3NMKA 5FZTA 2XL6A 2P0NA 2XSEA 1PV3A 2Q9AA 4FWVA 4GEHA 2BL2A 4LDRA 4NTBA 3T6JA 3AOUA 3S0XA 4JJGA 5CI8A 5BQGA 3SYNA 4OIPF 1RXQA 4Z9HA 4C7OB 1Y4CA 3JYYA 4EUKB 4XWJA 2EINC 4AE4A 1GQAA 1M2VB 1FR0A 1NFOA 2HJMA 3MYIA 4K0DA 4CS9A 1H9TA 1U6HA 2NPUA 1WATA 2PNOA 2ZXPA 2M64A 3B29A 3IEEA 2HUJA 1LI5A 2CGEA 2BC5A 3GEHA 4CJOA 3H2UA 5JVEA 1FMWA 5DS6A 3LJBA 1J8YF 2YLIA 2LSEA 2ETSA 2UUIA 3HNKA 3ASOC 2R7TA 1YARO 4Z9IA 2R7VA 3S90A 3UGPA 1ST6A 4MVRA 3X1OA 1Q0DA 4YT8A 2JX0A 1ZVZA 5AGFA 3Q7LA 1QQ3A 5DQZA 3UGOA 4OD5A 3DZAA 1L3PA 2WB7A 2L7AA 3LESA 2AWCA 2B0JA 2J9VA 4XQ1A 5L0GA 1EKYA 3EG9A 2ZXOA 1LS1A 4N6HA 4GYTA 3O6XA 2YLDA 1OCRC 2WVQA 4CBEA 3K1HA 1ZU4A 2UUHA 3DM5A 3ZSUA 1C03A 3NKEA 4HEAJ 1T6UA 4MNDA 3CSKA 1LM3B 5B3IA 3SP1A 2GA0A 2JPUA 2GWWA 2KNHA 2P6VA 5K0IA 3KKBA 3VAYA 2W4BA 1LVKA 2XLVA 2KSFA 4QDLA 3JSZA 4XEKA 4EBKA 5L0DA 3GANA 3W2WA 3S27A 1Z63A 1W2WA 1TWCA 3G4XA 5DS4A 4X0RA 5KYUB 5HSWA 2NG1A 4LACB 1CPRA 3LEOA 1MMDA 1APCA 1TQGA 1O3UA 3QW0A 4O6YA 3WG7C 3C8ZA 4BJ5A 2XS1A 1QVXA 2HSQA 2Y3BA 1XZQA 2C03A 3B9QA 3LLKA 3NKDA 1D1CA 4U5EE 3W8IA 1U0BB 1D1AA 2M4EA 3ASNC 4ER9A 2IXOA 1WASA 1NFNA 5BQIA 3AGUA 3KH2A 4WJ0A 2J0WA 2J7PD 4MVSA 1GGQA 2DGJA 1WOLA 1ZHYA 5DS5A 4ZLDA 2IOQA 256BA
chains in the Genus database with same CATH topology
4YL3A 4JC7A 4YL0A 5HV9A 4JRZA 5K0IA 3PCVA 5BQHA 4NTBA 4YL1A 5BQGA 4WABA 2Q7RA 4AL1A 3LEOA 4J7TA 3HKKA 4J7YA 4YK5A 2PNOA 3B29A 4BPMA 4NTFA 2H8AA 5BQIA 2UUHA 4NTAA 4JCZA 4AL0A 3DWWA 2UUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  4JC7 A;  4YL0 A;  5HV9 A;  4JRZ A;  5K0I A;  3PCV A;  5BQH A;  4NTB A;  4YL1 A;  5BQG A;  4WAB A;  2Q7R A;  4AL1 A;  3LEO A;  4J7T A;  3HKK A;  4J7Y A;  4YK5 A;  2PNO A;  3B29 A;  4BPM A;  4NTF A;  2H8A A;  5BQI A;  2UUH A;  4NTA A;  4JCZ A;  4AL0 A;  3DWW A;  2UUI A; 
#chains in the Genus database with same CATH topology
 4JC7 A;  2LIG A;  1NSG B;  1R5I D;  5B1A C;  4JTD B;  1CGM E;  3UMK A;  1JR8 A;  3AQC A;  4XLN F;  3Q7G A;  2R7U A;  4AE4 B;  2XLD A;  4R32 A;  4E18 A;  2WVO A;  1V74 B;  3U9M A;  4CS7 A;  2VAS A;  5KYW B;  4DXW A;  1LS4 A;  2G62 A;  4XTK A;  4G7Z F;  1OW7 A;  2EPN A;  1QKR A;  4U9E A;  1KU2 A;  2X51 A;  3OEO A;  4O6N A;  1VLT A;  1Z5Z A;  1VMA A;  4BEM J;  1HW2 A;  1TR2 A;  4PK4 A;  1Z3I X;  1DOW A;  1G5Z A;  1RCP A;  2WVN A;  4NQF A;  3RYL A;  3A9C A;  4EKW A;  1NBB A;  3MFN A;  3AJM A;  4RBN A;  3NMI A;  1FNT c;  2V3C C;  3CQZ A;  2CNW D;  2NUP A;  3GOD A;  2YKZ A;  1R4T A;  2Y69 C;  2J8W A;  3DKA A;  1T5O A;  4CJG A;  3I5P A;  1OCZ C;  1AEP A;  1S05 A;  3DJU B;  4P9T A;  4YL3 A;  4E0H A;  4YT4 A;  4XEF A;  4E17 A;  4MVU A;  5JLI A;  4YL1 A;  4FAP B;  1QZX A;  2LP4 A;  1MMA A;  2PBE A;  3EGX B;  3KPH A;  2VCA A;  3K6B A;  4P6I C;  5EK0 A;  3U8V A;  1HW1 A;  4MVQ A;  4OIO F;  3L8I A;  3JRM O;  1M2O A;  1K05 A;  1TFK B;  2RSE B;  1NU9 C;  2ZD9 A;  1D0Z A;  2J0X A;  4K1O A;  1WN0 A;  2VB6 A;  4PJM A;  4DBR A;  3TJ6 A;  4E7S A;  3EZH A;  3FAP B;  1M2V A;  5T1D B;  2DI3 A;  4CDA A;  3HJC A;  4AX2 A;  2HZ8 A;  3FDQ A;  1AVO B;  1YYJ A;  2PX0 A;  2XLO A;  3US6 A;  5CIV A;  3WHN A;  3G50 A;  3VM6 A;  4A4A A;  2HS5 A;  2AP3 A;  4DJ9 A;  5BUO A;  3JYH A;  1TWH A;  3U2L A;  4EIY A;  2FFH A;  1PD1 A;  4OIN F;  1ZHZ A;  2ASR A;  2DYR C;  2NSF A;  4CS8 C;  1D1B A;  3SXY A;  2KJG A;  1VTM P;  3TD7 A;  4CS8 A;  3T6B A;  3B0V C;  3EHM A;  4N6C A;  4HFK B;  4FES A;  4PAC A;  5F28 E;  2R7Q A;  2Q7R A;  2NUT A;  5KYX A;  2YHS A;  3ECS A;  2OEX A;  5A6J A;  3PMR A;  4J7T A;  2VC9 A;  1M6T A;  2RD9 A;  1GM5 A;  3ABK C;  4MQ9 F;  1NLX A;  3K1I C;  3Q6M A;  4DOZ A;  1YAU O;  5L0I A;  3JRT A;  4D4N A;  3NYJ A;  1M57 C;  2A6H F;  5T3W A;  3GM1 A;  4NTA A;  3U3B A;  4DBQ A;  4PFP A;  3W2V A;  4MW3 A;  2J9U A;  3ZDL A;  5E2Q A;  2CDQ A;  3O39 A;  3U0C A;  1I4Z A;  3C8G D;  4KBL A;  3CZ6 A;  3AQB A;  5KYX B;  2R7X A;  1ZW3 A;  4JTC B;  3UMH A;  2J45 A;  1Z6A A;  4JZA A;  3TOL A;  2YVK A;  1OW8 A;  2WZF A;  4O7G A;  4J30 B;  1SR2 A;  1ZYR F;  3IQC A;  4JVS A;  3T4R A;  2Y39 A;  5E33 A;  1E2X A;  4AK9 A;  2CNW A;  2MHR A;  1YA9 A;  4C3B A;  5A6B D;  3FAJ A;  3DI5 A;  1ORJ A;  2R7W A;  3MX3 A;  3M79 A;  5D92 A;  2KQ9 A;  2Q00 A;  3S28 A;  1YLM A;  2XLM A;  3S84 A;  1C17 M;  3GEE A;  3AG4 C;  1VOM A;  4ULV A;  4XPY A;  5A69 A;  2KC3 A;  2XLE A;  3K66 A;  1VB5 A;  3B0U X;  4J32 B;  3O55 A;  4ZLC A;  1LI7 A;  2A68 F;  2Q3T A;  4U5F E;  2L6G A;  4I1M A;  2A69 F;  2E87 A;  2PF4 E;  2XLW A;  1FTS A;  3AG3 C;  3VYW A;  4WGZ A;  5A6K A;  4JUR I;  4A2N B;  1EQ1 A;  4JEB A;  5L0C A;  1Z23 A;  3RKO F;  1OR3 A;  4Z9J A;  2YL7 A;  3F46 A;  1BBH A;  4RD9 A;  3B71 A;  4U9D A;  3SXM A;  2QUP A;  3UMI A;  3I5Q A;  3ZIB A;  5EHH A;  4G7O F;  3C63 A;  5F5F A;  3ZTM A;  2CCY A;  4MS2 A;  4NCQ A;  4BPM A;  3RVY A;  1L7C A;  2P1A A;  3N0T A;  3MYF A;  4M63 A;  4YJW A;  4YK5 A;  5A6A A;  4CSA A;  4XEV A;  4PJJ A;  2EIM C;  3GWN A;  2PX3 A;  2EPO A;  2OJE D;  1E85 A;  1TKN A;  3JSE O;  4JTA B;  4W8K A;  3EFO B;  4I3M A;  4NY3 A;  5JT4 A;  3FMS A;  1RKC A;  4JCZ A;  1FFH A;  1T6Q A;  5COG A;  3RVZ A;  3HNL A;  3IQ5 A;  1NZE A;  2HSB A;  5KYN A;  3JT1 A;  2AWY A;  1ZHT A;  2XL8 A;  2YZS A;  4CIH A;  2CYD A;  5JS5 A;  4IAR A;  1Y6D A;  2XXA A;  1PD0 A;  3QTH A;  3EH1 A;  1G8X A;  4IRU A;  5BQH A;  4CDV A;  4DRI B;  5JRA A;  4C3D A;  3V5Z A;  4P9F A;  3R2P A;  2LFD A;  3ABL C;  3U3F A;  5JUA A;  3EG9 B;  3SXK A;  2TMV P;  1T6I A;  1QLE C;  3Q6N A;  4K7B A;  1LE2 A;  2OCC C;  2CW0 F;  2DB4 A;  1CGO A;  2IM8 A;  2NUT B;  2YLG A;  3LEV A;  4J7Y A;  2YQY A;  1G4W R;  4IB4 A;  3KMI A;  3HLZ A;  3GEI A;  3L0I A;  2MYS A;  3KYJ A;  4JE9 A;  4JW1 A;  2PFD A;  2W45 A;  4U5H A;  1E86 A;  1MND A;  2YRF A;  3M4C A;  4L6R A;  3RQE A;  1V4A A;  1HMO A;  4H54 A;  3V5Y A;  3DM9 B;  1JAF A;  3I4U A;  2EPM X;  4XPX A;  4D4X A;  3VRC A;  1NU7 D;  3DAG A;  5HV9 A;  1H7I A;  1SZI A;  2EIJ C;  3QW1 A;  4DRH B;  2XM0 A;  2MWQ A;  2OU6 A;  3G4Z A;  3MLG A;  1TWA A;  1VK5 A;  4IAO A;  2ZXW C;  3E70 C;  2LD6 A;  1RMV A;  4WAB A;  1RJ9 A;  4W8P A;  3EZI A;  3RH3 A;  4JIO A;  3WOD F;  3PDM P;  1F1M A;  1H6G A;  3RQF A;  3EPV A;  1BZ4 A;  5B1B C;  2ZXR A;  2OG2 A;  4ULW A;  3EGX A;  2HJ3 A;  5E3C A;  3LNM B;  3JTL O;  2KK1 A;  1KNY A;  3LS1 A;  2IXN A;  3R7C A;  4Q7C A;  2OQM A;  1A7D A;  2A6E F;  3M4B A;  4AL0 A;  4G7H F;  1B68 A;  3M15 A;  2NUP B;  2VH3 A;  2D5R B;  2YL3 A;  2Y3G A;  2Z15 A;  2KW3 C;  4JRZ A;  2FGY A;  3DXJ F;  3IQ6 A;  5COM A;  3NRH A;  3BRJ A;  1D0X A;  3S29 A;  2J9W A;  3TQO A;  5EGY A;  4N4W A;  4I1O B;  3QVZ A;  4GQH A;  3ZQV A;  2XRH A;  4MVO A;  1HE1 A;  2KYH A;  3AG1 C;  2Q4F A;  3DE9 A;  4MTO A;  2O9X A;  3C8G A;  3ZTZ A;  4AL1 A;  1SMY F;  2ZPA A;  2GAQ A;  1WGW A;  3JCU Q;  3OWT A;  5KYW A;  4CX9 A;  4MTG A;  4IWB A;  2V26 A;  4HE8 D;  3C62 A;  1AUE A;  5IY5 C;  1U89 A;  1MQV A;  3T9O A;  5L3Q A;  3L1M A;  3JZ0 A;  2OJQ A;  3QVY A;  4U5B E;  3SNH A;  5DLJ A;  3GM3 A;  4MVM A;  4Q4Z F;  4DRJ B;  1V55 C;  2R7R A;  1ZU5 A;  3EGD A;  5D91 A;  4QI0 A;  1EI7 A;  1YJG A;  2PP4 A;  1K40 A;  2YEV A;  3LLI A;  4CSA C;  5JSL A;  4Q5S F;  2QE9 A;  2I8B A;  3EGD B;  3FOO A;  2HMZ A;  4BEJ A;  3W4Y A;  1JMW A;  1S7Z A;  3EJN A;  2R02 A;  1OQC A;  2R7O A;  4FX5 A;  1BDJ B;  1MMG A;  2IXM A;  3AGT A;  5L3V A;  5KYY B;  5T3T A;  1OXK A;  2D4U A;  1GS9 A;  2HV6 A;  3K7D A;  3EH2 A;  3RFY A;  1N1C A;  3ZWI A;  5COF A;  5KYU A;  1QPU A;  1CGN A;  1Q0M A;  2Q9B A;  3C7J A;  3IPM O;  4YT2 A;  2WL8 A;  2YL1 A;  2XXA B;  1TWG A;  1Q0G A;  5L0J A;  1WTY A;  1BR1 A;  3IHU A;  3TJ5 A;  3UR3 C;  3U2M A;  3HNI A;  2EPL X;  4EBJ A;  3KYI A;  1RJ9 B;  1QSP A;  3O10 A;  4XLP F;  2L9J A;  2YWA A;  1HMD A;  1NG1 A;  1IZM A;  4C7O A;  3U5S A;  1OKK D;  5A6B A;  3A11 A;  2H7B A;  2HV7 A;  2H7O A;  3BEH A;  5E3A A;  1YZA A;  5L0H A;  2OEV A;  3PCV A;  1YVI A;  3DE8 A;  5L0F A;  4KNW A;  4U5D E;  1K04 A;  1FMV A;  4BJT A;  3L34 A;  3C18 A;  5GPG B;  1PCX A;  1ZW2 A;  4O6M A;  4XPW A;  4JKV A;  5JP7 A;  5B3S C;  1KTM A;  3H65 A;  2LQG A;  1FAP B;  4LDK A;  2HFI A;  2EPK X;  3NYL A;  1VLS A;  1I4Y A;  1ORS C;  3EQL F;  4OD4 A;  3HKK A;  4HFF B;  5DVW A;  3ZQY A;  4KC9 A;  3LAY A;  5AC5 A;  2EIK C;  4NTF A;  1YDI A;  2H8A A;  2L81 A;  2LFF A;  4YWQ A;  1A7V A;  3QZC A;  2F22 A;  2IBF A;  2R7S A;  3DD7 A;  3NMJ A;  3F47 A;  1JOG A;  1VYK A;  3LNR A;  2B0H A;  1RKE B;  3FHD A;  1Z7Q c;  3K1I A;  1OR2 A;  2HKV A;  4MW8 A;  3K33 A;  3GM2 A;  2OOC A;  4PR9 A;  5FCL A;  4YN0 B;  1JPN A;  3AG2 C;  3L8J A;  3ITF A;  3VF0 A;  2JD3 A;  4EWC A;  4BJ6 A;  4LER A;  2P7V A;  2DYS C;  3S9O A;  4KI2 A;  3DMD A;  5AC4 A;  1M56 C;  2R03 A;  1BR4 A;  1LIH A;  1MMN A;  2C04 A;  3HTK C;  3RQG A;  3SXZ A;  2Y3H A;  1E83 A;  1ZHX A;  4ONS A;  4PFO A;  2XL4 A;  2ICW G;  3U9J A;  2GFH A;  4PJN A;  4BJ1 A;  4LDQ A;  1D0Y A;  1OXB A;  2XS8 A;  4JJF A;  2VCB A;  4EHP A;  4IGG A;  3UNG C;  1ZHW A;  3FXH A;  1Q0F A;  3POV A;  3H2V A;  2A1D D;  3DWW A;  1OW6 A;  3M1C B;  4CS9 C;  4NC3 A;  4N06 A;  1OCC C;  1O87 A;  2X0C A;  3ZVR A;  3NYM A;  4U5C E;  4H4K C;  2I15 A;  4MTF A;  4YL0 A;  4CIP A;  3GWL A;  3PHF 2;  4PJL A;  3TK0 A;  3ZG1 A;  3CAX A;  1OKK A;  4MVZ A;  1V54 C;  2J7P A;  3LUT B;  3TOM A;  5F5H A;  4F4B A;  1JPJ A;  3QMK A;  2QY9 A;  2XM4 A;  3EFO A;  4LLC A;  2Y3D A;  2W4M A;  1TFO B;  2QTV A;  4IAQ A;  1RKE A;  2L6F A;  4LLE A;  5CI9 A;  1WWP A;  2G3K A;  1C02 A;  2H7V C;  3RF3 A;  3FOP A;  3RW0 A;  4DVZ A;  4DVY P;  4EBB A;  4UDV A;  2W9Y A;  5KYY A;  4QI2 A;  1YYX A;  2A0U A;  3N24 A;  2AU5 A;  1ZZP A;  3SEO A;  4BJ5 C;  1H9G A;  1HY5 A;  1DOV A;  2QNL A;  4U5G A;  3V7O A;  1Q0K A;  3DJN B;  2L6H A;  1HE9 A;  1BR2 A;  2QLA A;  3B0P A;  1FFT C;  3V5X A;  1JRA A;  1T01 A;  2FAP B;  2IYL D;  4IJJ A;  4ANJ A;  1UFB A;  3ATP A;  2HMQ A;  4YT5 A;  4G0H A;  1LE4 A;  1UG7 A;  1SF8 A;  1XWJ A;  2R9R B;  2GDC A;  3CEX A;  3GOR A;  4WGY A;  1VYI A;  1T9K A;  1G4U S;  2NSG A;  3TUL A;  4G78 A;  2WZL A;  2R05 A;  1EA8 A;  3N2Z B;  3T6G B;  3KL4 A;  4CDY A;  1YZC A;  1O5H A;  1LPE A;  1A0B A;  5TJ5 E;  1E84 A;  2J46 A;  2VCC A;  1LKX A;  3U8P A;  3HNJ A;  3LS0 A;  4OIQ F;  1J8M F;  2AVK A;  2WZG A;  3RIP A;  3SZR A;  3ZC4 A;  2LCH A;  2R25 A;  1SYQ A;  2J9B A;  4BG0 A;  3C8G B;  2P61 A;  3MBG A;  4B6I A;  2EIL C;  2G3V A;  3E9V A;  1OCO C;  1XZP A;  3ABM C;  1ORY A;  2BE5 F;  4OIR F;  1YA7 O;  2LK4 A;  4C3E A;  3NDB B;  3J06 A;  1MNE A;  3IQT A;  2A0B A;  4JEA A;  3FVY A;  4RDA A;  3X2Q C;  4E7Z A;  5DQT A;  4E0I A;  4JCH A;  2YL0 A;  3OA1 A;  2XLH A;  2OKU A;  4KNV A;  1CPQ A;  3W8H A;  2IXP A;  1IW7 F;  4BJ6 C;  1A7E A;  2KGO A;  3WAQ A;  1I5N A;  3DAF A;  1A41 A;  3NG1 A;  3EHN A;  4O79 A;  2Q9C A;  4I44 A;  3NMK A;  5FZT A;  2XL6 A;  2P0N A;  2XSE A;  1PV3 A;  2Q9A A;  4FWV A;  4GEH A;  2BL2 A;  4LDR A;  4NTB A;  3T6J A;  3AOU A;  3S0X A;  4JJG A;  5CI8 A;  5BQG A;  3SYN A;  4OIP F;  1RXQ A;  4Z9H A;  4C7O B;  1Y4C A;  3JYY A;  4EUK B;  4XWJ A;  2EIN C;  4AE4 A;  1GQA A;  1M2V B;  1FR0 A;  1NFO A;  2HJM A;  3MYI A;  4K0D A;  4CS9 A;  1H9T A;  1U6H A;  2NPU A;  1WAT A;  2PNO A;  2ZXP A;  2M64 A;  3B29 A;  3IEE A;  2HUJ A;  1LI5 A;  2CGE A;  2BC5 A;  3GEH A;  4CJO A;  3H2U A;  5JVE A;  1FMW A;  5DS6 A;  3LJB A;  1J8Y F;  2YLI A;  2LSE A;  2ETS A;  2UUI A;  3HNK A;  3ASO C;  2R7T A;  1YAR O;  4Z9I A;  2R7V A;  3S90 A;  3UGP A;  1ST6 A;  4MVR A;  3X1O A;  1Q0D A;  4YT8 A;  2JX0 A;  1ZVZ A;  5AGF A;  3Q7L A;  1QQ3 A;  5DQZ A;  3UGO A;  4OD5 A;  3DZA A;  1L3P A;  2WB7 A;  2L7A A;  3LES A;  2AWC A;  2B0J A;  2J9V A;  4XQ1 A;  5L0G A;  1EKY A;  3EG9 A;  2ZXO A;  1LS1 A;  4N6H A;  4GYT A;  3O6X A;  2YLD A;  1OCR C;  2WVQ A;  4CBE A;  3K1H A;  1ZU4 A;  2UUH A;  3DM5 A;  3ZSU A;  1C03 A;  3NKE A;  4HEA J;  1T6U A;  4MND A;  3CSK A;  1LM3 B;  5B3I A;  3SP1 A;  2GA0 A;  2JPU A;  2GWW A;  2KNH A;  2P6V A;  5K0I A;  3KKB A;  3VAY A;  2W4B A;  1LVK A;  2XLV A;  2KSF A;  4QDL A;  3JSZ A;  4XEK A;  4EBK A;  5L0D A;  3GAN A;  3W2W A;  3S27 A;  1Z63 A;  1W2W A;  1TWC A;  3G4X A;  5DS4 A;  4X0R A;  5KYU B;  5HSW A;  2NG1 A;  4LAC B;  1CPR A;  3LEO A;  1MMD A;  1APC A;  1TQG A;  1O3U A;  3QW0 A;  4O6Y A;  3WG7 C;  3C8Z A;  4BJ5 A;  2XS1 A;  1QVX A;  2HSQ A;  2Y3B A;  1XZQ A;  2C03 A;  3B9Q A;  3LLK A;  3NKD A;  1D1C A;  4U5E E;  3W8I A;  1U0B B;  1D1A A;  2M4E A;  3ASN C;  4ER9 A;  2IXO A;  1WAS A;  1NFN A;  5BQI A;  3AGU A;  3KH2 A;  4WJ0 A;  2J0W A;  2J7P D;  4MVS A;  1GGQ A;  2DGJ A;  1WOL A;  1ZHY A;  5DS5 A;  4ZLD A;  2IOQ A;  256B A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  4JC7 A;  4YL0 A;  5HV9 A;  4JRZ A;  5K0I A;  3PCV A;  5BQH A;  4NTB A;  4YL1 A;  5BQG A;  4WAB A;  2Q7R A;  4AL1 A;  3LEO A;  4J7T A;  3HKK A;  4J7Y A;  4YK5 A;  2PNO A;  3B29 A;  4BPM A;  4NTF A;  2H8A A;  5BQI A;  2UUH A;  4NTA A;  4JCZ A;  4AL0 A;  3DWW A;  2UUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...