3LEPA

Human aldose reductase mutant t113c in complex with idd388
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPCGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 107
structure length 313
sequence length 313
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lepA00
1AH0A 2PDLA 4Q3MA 3LNMA 2F2KA 3KRBA 3WCZA 2PDJA 3O0KA 1AFSA 1XF0A 2IKIA 1YE6A 3G1RA 3ONBA 4JQ1A 4GQGA 3UZXA 5JH2A 3V0SA 4LB4A 3LZ3A 3UWEA 4IJRA 4NKCA 1A80A 1MI3A 5HA7A 3V0TA 5LIUX 3M64A 2NVCA 2PDQA 4JIRA 1S2AA 3N6QA 3T42A 4IJCA 4JTCA 3H4GA 4JTAA 3LQGA 1HW6A 2BGQA 2F38A 4XZIA 2FZ8A 2P5NA 4PMJA 3LZ5A 1ADSA 2CLPA 2IPWA 2FZ9A 2PDMA 2FZBA 2IPFA 2DV0A 1IEIA 4IGSA 4ICCX 2FVLA 1AZ1A 3EB4A 3WG6A 4WDTA 4LBRA 4ASTA 5LIXX 1FRBA 1S1PA 2DUXA 3H7RA 4F40A 4Q7BA 1IHIA 1QWKA 4PRTA 4PUUA 1XGDA 3NTYA 3R8GA 4WRHA 3RX4A 1PYFA 4JTRA 4R9OA 1RALA 3C3UA 2ALRA 4XO6A 3GHRA 4QX4A 3H7UA 2PD5A 2IQDA 4FALA 3LEPA 1EF3A 4JTDA 3UG8A 4WDUA 2A79A 3GHTA 2FGBA 4YS1A 3V35A 1ZUAX 3UZZA 3WBYA 1ZGDA 2ISFA 3R58A 4L1XA 3UZYA 1Z8AA 2ACSA 4HMNA 4WDXA 2C91A 2PDYA 1X96A 2QXWA 2J8TA 3FJNA 3M4HA 3CAVA 5HNUA 4AUBA 3R6IA 5HNTA 3DN5A 4XZNX 4I5XA 3LD5A 2IKJA 3BURA 2PDBA 3CV7A 3R43A 2PD9A 4QBXA 5AZ1A 3FX4A 1X98A 4YVXA 4XK2A 4GACA 1PWMA 3GHSA 1JEZA 4H7CA 1AZ2A 3UZWA 3LBOA 4G5DA 2WZMA 3GHUA 1T41A 3VXGA 2ACQA 4LB3A 1T40A 3DOPA 3F7JA 4WGHA 4YU1A 1S1RA 4XVEA 4QXIA 1RY8A 2AGTA 2IPGA 3UYIA 3COTA 3MC5A 2INZA 2NVDA 4EXBA 1R38A 2WZTA 1Q5MA 4GCAA 4HBKA 3CMFA 3G5EA 4RPQA 3LENA 1QRQA 2PFHA 2HDJA 4FA3A 3R94A 1ZQ5A 2PDCA 1S2CA 3CV6A 2PDPA 2PDHA 3BV7A 4DBUA 1YE4A 4GABA 4LAZA 1X97A 1YNPA 2PDNA 2HV5A 4JTQA 2HVOA 2IPJA 4WEVX 1K8CA 1MRQA 2IS7A 3D3FA 5LIKX 2PDIA 1PZ0A 5JH1A 3N2TA 3B3DA 2HEJA 4H8NA 3EAUA 1VP5A 3Q65A 1AH4A 2R24A 3UGRA 1Q13A 1EXBA 1Z89A 3V0UA 3P2VA 4ZFCA 3BCJA 4XZLX 4GQ0A 1Z9AA 1PZ1A 3ERPA 2IQ0A 2R9RA 1M9HA 5LIWX 2HVNA 3LQLA 3MB9A 4PRRA 3WBXA 4XZHA 2PDKA 2PDWA 4WDWA 4YVVA 1EL3A 3WBWA 1EKOA 2PDFA 4JQ2A 2DUZA 4PR4A 4JQ4A 3O3RA 2ACUA 1XJBA 4L1WA 4GA8A 4PUWA 5DANA 3M0IA 1PWLA 5KETA 2HE8A 1VBJA 4MHBA 2I16A 3UP8A 3LN3A 1LQAA 2ACRA 3ONCA 5M2FX 2HE5A 2BGSA 3BUVA 3QKZA 4JQ3A 5C7HA 2IKGA 1LWIA 2I17A 3R7MA 3V36A 4DZ5A 2INEA 2PEVA 3RX3A 1J96A 3LUTA 4LBSA 2PDXA 2BP1A 4JIHA 1ZSXA 1UR3M 1US0A 1YNQA 2VDGA 3S3GA 4GIEA 3CASA 4JQAA 4JIIX 3EB3A 1RY0A 3RX2A 4QR6A 4YVPA 4DBSA 5LIYX 2PF8A 2FZDA 4XO7A 4LAUA 2PDUA 1OG6A 1MZRA 2PZNA 5AZ0A 1SM9A 1HQTA 2PDGA 3UFYA 1GVEA 3GUGA 4FZIA 4XZMX 1Z3NA 4DBWA 4EXAA 3R8HA 3Q67A 4XAPA 1AH3A 2IKHA 4OTKA 1C9WA 4FAMA 3U2CA 4XVDA 3CAQA
chains in the Genus database with same CATH superfamily
2C1IA 2D2OA 4Z0JA 3RAOA 1QT1A 3RO6A 3MWCA 4DJFD 1VRXA 2EGZA 3WQ4A 1V8EA 4GC3A 2WWDA 5FJTA 5ECUA 4W84A 2O4QA 1C8YA 3M6DA 3ONBA 1OFEA 4ZO7A 2GPTA 1GQNA 5CXPA 5B7YA 3PUDA 2E6YA 2QHAA 2ZTJA 3GC4A 4HGXA 3T55A 1OFBA 3VD9A 4LPCA 3U8GA 1X38A 4WKHA 3ZVIA 2J47A 1RJQA 2JKEA 2ZVRA 3C0SA 4BA0A 1DWGM 3NPUA 1UWUA 3T42A 3B0XA 1S39A 1J0KA 5CEWA 3T2OA 5D8WA 2ZWYA 1XYZA 1PAMA 1F74A 1GG1A 3WH5A 3QGKC 1ECQA 3AMGA 3WH6A 2G50A 3PM6A 4C6NA 1P0NA 4INFA 3HPZA 1B2YA 1PB0A 3UZ5A 4A3HA 1ADSA 4BQ3A 4BCEA 1VB9A 3W27A 3L0NA 3QY7A 2VENA 3XINA 1M1BA 1BYDA 1KTBA 2JEQA 2ZADA 3HMJG 4XKYA 1FRBA 1SZFA 3DI1A 3TE9A 1JPIA 2TODA 1RLDA 3W3OA 1LORA 4IHCA 1W5OA 1C91A 2X42A 3LS9A 4WRHA 2Z1XA 4RZ4A 4JTRA 3IGXA 1DL3A 4FOKA 2FHBA 3D47A 3T4WA 3WLHA 5AHNA 4C6BA 3C3UA 3H7UA 4WKAA 3VUPA 3B05A 1G1YA 3SN4A 1NWRA 3RUBL 1W6TA 2FB3A 1MW3A 5E93A 5FIPA 3GHTA 3PFMA 1IZKA 3FA5A 2DVUA 2OX1A 1S3TC 4GOAA 4E4UA 2GZXA 2OZTA 2PB1A 1EQPA 3DFSA 4B4HA 1TUFA 3MT1A 1FWEC 1MW1A 4HHMA 3P8JA 2QULA 3DEQA 1JFXA 2EJ1A 3TONA 3S9YA 3NOYA 1WDPA 4I5UA 3OHIA 3K2GA 2YLLA 3LX9A 3POHA 4XZ9A 4S39A 3SFWA 2Q3OA 3WEOA 4MKSA 1M7PA 2X8RA 3IGSA 4QSFA 3W01A 4GK8A 2ZC8A 1JZ3A 3CV7A 2POZA 2QW5A 2YL5A 1SW7A 5DMNA 2OR2A 5DMLA 5DEZA 1UZ4A 4NI8A 3PNZA 4LGXA 3CYVA 2XWDA 1EF2A 3GFXA 1YXCA 5EPDA 1IF2A 4AZCA 1Q66A 1AA1B 2P0IA 4LVFA 4AEFA 1P7TB 1A4MA 1PKYA 2Z1VA 4C6CA 5FD0A 3VTRA 3EA3A 1G7UA 2JQXA 3CL8A 5CPTA 3C2OA 2WJEA 3MI6A 4H2HA 3BCFA 3CPRA 4YU1A 3UXIA 3PK7A 4KEZA 4RZ5A 4UR8A 3GXPA 4FLRA 3M5ZA 2VUYA 1FHLA 3FN9A 1NSJA 4QJ5B 2YFNA 4GQQA 5C9XA 2QR6A 3S47A 2PDCA 4N9CA 3ARZA 4JNMA 1GZGA 1GTHA 3L4VA 2RHGA 1B3WA 3VU2A 1H5VA 5KZDA 5T26A 1J0YA 4UZSA 4LC6A 4DBDA 3UR8A 4JX6A 1OGGA 4UFHA 3HO8A 4G6CA 4AXKA 1XM3A 4QJ3B 1RCQA 3H54A 2VC5A 3GDKA 1O60A 1TMLA 1UB3A 4NG3A 2VEPA 1ESWA 3JR2A 4H9VA 4MY1A 2DZXA 1VP5A 3ZVHB 1MDRA 2G0WA 2VEKA 3WBAA 5TIMA 1O5QA 4Q8WA 3UWUA 4HYWA 4M8UA 2VOTA 2AQVA 3Q2DA 3W73A 2W63A 3KWXA 4YYCA 1IWPA 3QBUA 4IL2A 4JIPA 1JCTA 2IQ0A 5G1MA 3M0ZA 5CBJA 2UY2A 2QUUA 3L5MA 4Z08A 2PBGA 3AYRA 2XG9A 3SBFA 3WQDA 2BWGA 2NX1A 4HSNA 1EP3A 1JGIA 3ARPA 3DFOA 4MPKA 3PJTA 1I0BA 4S2BA 4JR5A 4MNJA 2YDRA 3OG2A 2ALDA 4Z2KA 2VQUA 3T7VA 1H7OA 3R89A 3MSDA 3P5ZA 2E28A 2XSXA 2J4GA 1F8MA 4H9UA 3R13A 3R12A 1K7XA 1A0EA 4C6MA 3WFLA 3PSVA 1NOUA 1HFBA 1YTDA 2X41A 3M0IA 1DJYA 5LHFA 2I16A 2JIWA 1UJQA 2QV5A 4DJEC 3W07A 3B9DA 4HJFA 1LWIA 5HJLA 1K8XA 1KFEA 4IIFA 4UUIA 4MVAA 5E6YA 4E2OA 1X1OA 2E68A 4MKNA 3GQYA 5G4EA 1QOPA 4LX4A 3W1NA 1BXCA 4HT3A 4WXZA 1IWAA 1TTJA 2BVYA 2Z1WA 5ECVA 1E6NA 3BJFA 2VC6A 2I5GA 4N7QA 4QR6A 1I9CB 3WQ8A 3F5JA 2PDUA 3ZJ8A 1F61A 4C1NA 4CEXC 4G2DA 1NWUA 3EX4A 1E71M 5BMWA 2RDXA 5I7GA 2VQTA 1WDWA 3BAIA 4IP4A 4ZSTA 3W88A 1ICPA 2ATMA 3GS6A 4OU1A 3RMJA 3BXWA 3BOFA 5M03A 2YW3A 3CT2A 3BARA 3CUXA 4R7OA 3N13A 5BXTA 4XISA 4ILSA 1B5TA 2J7EA 4OUIA 4TUFA 1AH0A 1I1WA 3K8MA 3H8AA 2WYSA 4KFOA 1W3LA 5HNNA 1FBAA 3CWNA 1JD9A 2V3EA 3U48A 3MANA 3IRDA 5IOBA 3W2KA 2I9EA 3HG4A 5FSDC 2P8CA 2OVLA 3GYCA 4G7EA 1W8GA 3NNTA 3GAKA 3ZYZA 2V2DA 2J24A 1NDYA 4UQCA 1QNOA 2XH0A 1N7KA 2VFFA 1CIUA 2OX4A 1TE6A 3FYYA 5EMLA 3TN5A 3NZPA 1OFPA 1XC6A 2O92A 1W56A 4WKFA 4B5WA 3PJUA 3GC2A 5D4YA 4AWUA 1TO3A 1OINA 4F4RA 2FPYA 3L2MA 1SQ7A 3FCPA 4V28A 3KOWA 1LRNA 3SCPA 4XWUA 1QFEA 4R88A 4OWGA 3T0CA 4JBRA 3P62A 2KX9A 4A3YA 2XGIA 3OA5A 2E0PA 1JCNA 3C86A 2IPWA 1OWQA 1TWSA 1IT7A 1H0GA 4R33A 4UB9A 1EYEA 3BWWA 3OG3A 1UKPA 3U7VA 2E7FA 2X30A 5FF4A 1VFHA 3QKEA 1PTAA 2XIOA 3LV5A 1UD4A 2VFDA 4KCWA 5FAGA 1PKMA 1EHNA 2QIIA 3SCUA 2WHLA 3TAKA 1RAKA 3R0UA 5J5RA 1H63A 4PGLA 5A2AA 2WZIA 4QHRA 2OGJA 4WDUA 7REQA 1V3JA 4M3PA 4YTUA 1I2PA 1E1CA 3B8DA 1RBOB 5C8BB 4MMWA 3UZYA 5AC5A 1ELSA 2PDYA 2AL2B 1BF6A 1TRDA 2QKFA 3E1F1 3QR3A 1E43A 3TTQA 1BTMA 1RK5A 1TJ2A 4R27A 2SFPA 3IPWA 2DH3A 2E40A 1XIFA 4CN1A 2R1KA 4U3CA 1F07A 3VNLA 3VIFA 3C6CA 5F2GA 2ZRXA 2J6XA 4EPEC 3BOXA 5HBFA 1V5XA 1LLWA 3SW6A 3BURA 3W29A 4CD5A 2WMFA 1NJJA 1QI4A 4O16A 1N2VA 1DP0A 4L80A 4QBXA 1E4NA 1GVQA 3C56A 4J3VA 3UJFA 2PURA 3G8EA 5E6ZA 1W1VA 3WMLA 2I57A 3NCOA 4H2CA 1CXFA 2PSNA 4ZB0A 1XXXA 2YGYA 3P60A 5FJRA 1NOWA 3LI0A 1A5UA 3EA1A 1J5SA 2V30A 4GNVA 5FI8A 4V15A 4XVEA 4QXIA 2V5LA 3EX2A 3GBDA 3IUIA 4IQJA 4MAVA 1MZHA 3GNPA 1XH1A 4CVWA 2QEZA 2OWWA 4IPNB 3E5PA 1MWOA 3E02A 2XIBA 3IJ7A 4TV5A 3G22A 3CO8A 1K1DA 2PPGA 2D24A 3OU8A 4KBXA 2DSVA 3W7PA 1OJXA 4C7DA 2Q6ZA 4DY1A 3RJXA 1M3UA 3GNRA 3T0DA 3PTMA 3CV6A 2E1DA 5F2MA 3WLIA 4CQBA 4X0NA 1J10A 1EX5A 3U6WA 2JGYA 1P6CA 3S46A 1QPNA 3SUVA 3U2EA 5AOUA 1UWQA 3HFTA 4NASA 5K7JA 1VLIA 2V69A 3GKAA 3SUSA 5HR6A 2CKRA 2OT0A 4UCFA 2PGFA 5DMMA 3POCA 3D3AA 3SCWA 1DJNA 4UOJA 1J8VA 4H8NA 4ZTYA 4QJ4B 1TIMA 1GKRA 3HBLA 3K4WA 4B2DD 1VJIA 4S23A 2FTYA 5CSRA 3N19B 4ZO8A 4A8IA 1EDGA 1TR1A 2YZ5A 4RPPA 1UOKA 2YKKA 4PRRA 1RJPA 3WNKA 4WDWA 3FOKA 5MKGB 2V3FA 1EL3A 2PDFA 2VZSA 2WXDM 3R11A 1I2RA 4NX0A 1CYGA 1GUVA 4PR4A 3AUOA 1OD8A 2O4MA 2WM0A 1EJSC 1UUQA 3QFEA 2RH9A 4ZSUA 4U4MA 2R94A 4N6FA 5D9NA 1UIPA 2W61A 2AQOA 1BVZA 4ZOEA 5EKYA 1TV2A 4IXXA 4LYPA 1BVWA 5GQBA 1MVYA 3GXNA 4OBRA 3WF2A 5FEWA 1Z48A 3YPIA 3B9AA 3EDJA 3O6YX 4L4PA 3PVFA 2PU0A 1K7FA 4IM4A 1JXKA 2DZVA 2JF7A 2J7DA 4DBSA 3S6DA 4H9XA 2WKGA 2PF8A 4X22A 2FJUB 3OVGA 5BCAA 2A1YA 3WUEA 1S46A 4EVZA 4D6CA 2C7FA 3CZKA 5FESA 3GUGA 3WJXA 4X61A 2QIWA 2VWSA 4I7WA 3VMNA 4W93A 4AZCB 3CWHA 1JJKA 3LRKA 5EMMA 5CSYA 2B81A 4HCDA 1EGZA 3P3BA 3ZZ1A 3TA6A 3URQA 3ENLA 2FLIA 2QCNA 4XVDA 3VUSA 3ES8A 2OB3A 3CIXA 2ZRWA 3VKKA 1C8QA 4Q3MA 1E6ZA 1EDTA 1D8CA 1V0LA 4HHLA 4EP8C 5BRQA 1CXKA 1XF0A 1E3ZA 2IKIA 2FJKA 3OBKA 1YDOA 4XAGA 4NQ1A 1TCDA 5JH2A 1E6SM 4PMOA 3BLOA 1QNRA 4PSRA 1I0DA 4QNEA 3QHOA 8CGTA 3G77A 3GZAA 1GCYA 4IH3A 5T9BG 4LFYA 3RDKA 3H2OA 3QH2A 4UFJA 1JDDA 3IVUA 5MF5A 4CGTA 1XBYA 2J8GA 1EEXA 3L0GA 4Q22A 3S2CA 1PHQA 3VMPA 4W89A 2PWEA 2G4FA 4IT1A 3PTQA 1NWTA 1GZJA 3UCQA 3LSCA 3R5EA 4GZIA 3KRUA 5IDIA 5D30A 1FWRA 8A3HA 1CXLA 3AWNA 3VFCA 4MIMA 2CLHA 1EYWA 3KP0A 5FJIA 3G3DA 2V67A 5H8MA 3LZ5A 1G4TA 4JTEA 2QJJA 1EFZA 1OCNA 3RCMA 1KD0A 1XLHA 2Z2UA 1DJZA 3IVTA 2WW5A 1EJTC 4RDYA 1UH4A 4PFMA 2VJXA 4UTTC 1OGSA 1OHLA 3H7RA 1PDYA 3W1TA 1ZRQA 4DUVA 1ISYA 2ZIDA 3TLQA 1GG0A 4LUTB 4UR7A 3ANYA 3LCHA 5CBBA 1UP3A 3O63A 4MWAE 3GNXA 3EGJA 3BTNA 5I0DA 3UBPC 1AG1O 2AKMA 4QEHA 1XYFA 4FALA 2GQ9A 3LEPA 3BK0A 1FXPA 3SZ8A 4D6JA 2EEXA 4GJIA 4FNPA 2IW0A 2R1PA 3KTXA 2R14A 5DQPA 2QF7A 3I65A 3AHTA 1M01A 3LCLA 1U33A 1XLCA 3QZ6A 1GGOA 4AMCA 2R82A 4EWND 2HISA 1OX6A 2GSEA 4I90A 1A5BA 4TXEA 6XIMA 4WQ6A 1DORA 2Z2AA 4PMZA 4ADTA 3MPGA 3UNTA 3UWWA 3BAJA 3DUGA 1RP9A 1V02E 1W2PA 1W1ZA 2W79A 3KS5A 3MMTA 3ICJA 3G3MA 1KKOA 3NR0A 3SN1A 1EB3A 1HKWA 5B80A 1VFFA 5BOEA 1XINA 5EMJA 2XN2A 3EKGA 2IKJA 1H49A 4I8DA 5CSUA 1HL9A 4IFKA 1ZZMA 3E12A 4MUZA 3W7RA 1W3IA 2PUZA 3P14A 5DELA 2WNNA 5A6AA 4KS0A 4JN6A 4GACA 3VFLA 4D8LA 1R3RA 4L7ZA 1EO7A 3I68A 4X2PA 5HDRA 1A5OC 3BLKA 2J27A 4O1BA 3F2BA 4G7EB 4LRSA 4WR3A 3WUFA 1HJUA 5AYIA 1BSIA 4GI9A 3UYIA 5ABFA 1A5CA 4LCRA 4LNYA 2NVDA 1V6VA 4PMQA 1DQWA 4AIOA 1XIIA 4FP1A 3KTCA 3QVQA 2YFOA 3E2VA 4JN8A 1V08A 4Z2GA 3M0VA 4LVGA 2PRLA 2I9UA 2NQZA 1X6LA 3JZUA 2AQWA 3D46A 3FLUA 2GQAA 4GVIA 4W7UA 3W87A 2PDNA 1GVYA 4JYDA 2Y4SA 4LANA 1K8CA 1J5TA 1PIIA 3QZEA 3QYSA 4NILA 3D3FA 3GH7A 4GX8A 3M7WA 3CQ0A 1CWYA 3ZWTA 4ML4A 2D0GA 4PTNA 2Z6JA 4JS3A 4C65A 1A49A 3GR7A 3UCCA 4IMDA 4G9PA 2H3BA 3W83A 2C3ZA 1Q13A 3M0XA 5I3GA 1O5KA 1OC7A 1QAPA 3ZLFA 2ONEA 1Q6RA 4XD4A 4ROPA 1KTNA 1KV5A 5I78A 5CBIA 2ZQ0A 3F4CA 5IRPA 2D22A 2C13A 3T09A 4JHZA 1Q6QA 4F2UA 3MCNA 3SY1A 1RD6A 1O6IA 4K6AA 3UWZA 4YVVA 2JKPA 1E15A 4IQEA 4DO7A 3WD0A 5E9XA 3SIZA 1J9YA 5JIPA 1JRBA 5CZSA 3TYZA 1VH7A 4PCSA 3WQ6A 4NT0A 4ZR8A 1V0MA 4B5XA 2CKSA 1W9XA 1F4AA 4MHBA 4TVDA 4JQ3A 1SO4A 3STGA 2HCVA 2QUMA 4WZHA 1UD8A 1SFJA 4XV0A 3SJNA 3V36A 4GNJA 1XW8A 3VC5A 1RPKA 5CJMA 1E6RA 3S3GA 5I3FA 3B8UA 4HMCA 1ECEA 2UWFA 2WQPA 3TW7A 3LLDA 2Z4GA 3TLLA 3AZTA 3VZXA 5BROA 3LTYA 3JW7A 5HMSA 3WDRA 4J4KA 3CPUA 2F9RA 5U7SA 1TJ0A 3E0LA 4GVGA 3S4TA 4QEEA 2AKZA 4UQEA 1UBPC 1RBLA 3Q67A 3DBNA 4IPLA 3DKLA 2DORA 1X7IA 3S5ZA 5XIMA 1AH3A 2OPJA 4ZB2A 1RQHA 2Q8XA 3N4FA 2V5KA 4FAMA 3U2CA 1EOMA 4MUPA 2PWGA 3CAQA 3BLPX 4XD6A 3W7NA 5C2GA 2XGZA 1FY6A 4PULA 2PWDA 3HJEA 5I5RA 1XH0A 1WDDA 1B3XA 3AXIA 3CMJA 1M5WA 3RLGA 1R3VA 3TQ0A 1TV4A 3EKZA 1UPPA 3KXQA 4IJRA 2P50A 3RM8A 4B91A 1O68A 1UJPA 1SZEA 2CIPA 2X7VA 3ITGA 5HA7A 3WLOA 2YPIA 3HU7A 8RUCA 1O1ZA 3WJYA 3D5HA 3MO4A 2BLEA 1KCLA 4RV8A 2D0HA 2CFFA 1LBMA 4L4OA 4WD0A 4YWIA 2DPEA 2QUNA 3N6QA 3ATYA 5D9PA 3H4GA 2PWFA 5D2TA 1VJSA 4ORMA 2GJXA 3TW9A 3ELFA 5E70A 3CAWA 4HU4A 2F61A 4XZIA 1OX4B 4K7VA 4ORIA 2GVGA 3TMQA 3CC1A 3H26A 2ZX6A 4B9YA 4PMJA 2QCFA 3B8WA 4AY8A 2EHHA 3OLIA 3S1UA 3TWBA 4G1KA 2WBKA 3TP4A 3FS2A 4I9AA 2GGGA 3GD6A 4OKDA 4CN4A 3HV9A 4YYFA 1KM4A 4WJEA 3CHEA 3TZFA 5LIXX 4RW3A 1QNSA 3PY2A 3WF4A 1S1PA 3LK6A 3AHZA 2YOCA 2V63A 1CB2A 1ZB5A 3E5BA 3RX4A 3QQWA 3MUCA 2CBIA 4ZODA 1KFBA 3WSUA 3ARRA 1DBTA 1KBIA 4O50A 4Y7EA 1S5VA 2PP0A 1CT5A 5E0FA 3C4UA 3LHUA 3VNDA 3BGAA 3WD2A 4O53A 1FCBA 2GSJA 1LBLA 2D73A 3I6EA 5AC6A 1QWGA 3SIMA 1HL2A 2GL5A 2ZUWA 1OK6A 2PBOA 1P0KA 2Y1HA 4EKJA 4PMDA 1KQYA 1GVRA 4IP5A 2ACSA 2HZGA 1WNOA 3PBGA 1SSGA 4PMNA 2AMXA 3ZFHA 3GXTA 4KIRA 1OEPA 1D9EA 1F6PA 4MWAD 3CLMA 4XZNX 4JFWA 1AW2A 2P88A 1TB3A 3M46A 4LS1A 2HTMA 2XN1A 4NRSA 4Y90A 2E6AA 3NYZA 4HD5A 1NARA 3SRKA 4KH2A 4RE2A 2R8WA 2VL4A 3CHVA 3KBNA 3PZNA 4DM2A 2A7PA 3NM3A 1KM2A 1ZHAA 4D71A 2GQ3A 3GVRA 1W5NA 2JK2A 1EJRC 3BQ5A 2WZEA 4MF4A 3M1ZA 2D20A 3FJLA 3BW4A 2NSOA 2GJPA 4IQDA 1NQ6A 2RJHA 1CGVA 7ENLA 4O14A 4LUIA 3RPTA 4WSHA 2XVNA 1PSCA 1B3ZA 3HJZA 1OFOA 5AHMA 3VGGA 4FX8A 3NSNA 2A5HA 4QNWA 3PAJA 4FA3A 4X3ZA 1LP6A 2XYLA 4IICA 5D37A 4AAJA 3LI1A 3CO4A 4GABA 3TTSA 2J75A 1V3IA 2PLMA 4E5TA 3K13A 5GNXA 5A2BA 2PGEA 4R34A 1W3HA 2A3BA 4K1WA 3WDIA 2GUUA 4E4PA 3VGEA 2PWUA 2NT1A 3UWVA 2CEQA 4IWWA 4PTVA 2BOGX 3N18A 3UNDA 3UA4A 1VPXA 3UGRA 3BQ6A 3M7SA 1JRCA 1RHCA 5EMKA 3P2VA 2X1SA 2ZZ4A 3TJXA 2RDTA 1KBBA 4Y8FA 3KOXA 4GQ0A 1YLVA 1ISZA 3S2LA 3WH7A 3BG3A 1LL6A 4ZA0A 4M1RA 3ITOA 4UNIA 5BNKA 4CQ8A 2VDHA 4LCSA 4PUNA 1LTDA 4EF8A 4HHHA 4S38A 1YMYA 1YX1A 5CJNA 2WSQA 4DNMA 1GQKA 1M6JA 2ZXDA 3QHNA 3VDCA 5DANA 4RE0A 4IPPA 4PBFA 2HE8A 4TX8A 3LGGA 3NQCA 4FPSA 3WZ0E 2YCIX 2ACRA 1EJ7L 3FK4A 4BQ5A 1GQJA 2BGSA 3RN6A 5I3JA 1A50A 5A8GA 1GJUA 3DECA 2DQXA 1M03A 3HZ3A 3OYZA 2VDGA 1MQRA 4JIIX 3WD4A 1YDYA 4IQLA 4XO7A 1YRRA 2EPHA 4M5PA 4DYJA 4K1GA 2FMOA 1IEVA 1JAKA 2ZUTA 4DHGA 3GG7A 3UFYA 4NSBA 3P8IA 1XRTA 4GG9A 2YA0A 3IUDA 3M5VA 1PO9A 3KDNA 4NL1A 4RNHA 1LL7A 2EKCA 3E2QA 1QW9A 1XLIA 4LV4A 4HCHA 4BZYA 1B90A 3QMRA 1XIGA 3PC0A 5BRPA 5HMDA 3URNA 1VQTA 1SO3A 4HSOA 3UJEA 1ZNNA 3BSMA 2G37A 2Y70A 4A05A 3R8RA 1XP3A 4HA4A 3QN3A 1XIHA 1UD5A 2J62A 5AN7A 1XWYA 2VHLA 3WDHA 2XM1A 5TBOA 3WF3A 5AYXA 4FLQA 3LCGA 4AD3A 1WYIA 4B9ZA 4HZ7A 4H9ZA 2RJGA 4IG2A 3MDUA 3FYPA 3QV9A 3ZJ7A 1CGUA 3HM7A 3K30A 4LVBA 1AODA 5I3HA 5DXYA 2DZUA 1QHZA 3MP5A 3GSMA 4Y96A 2OWXA 3N04A 2GJNA 4JICA 1XLBA 1W54A 4AD2A 3INPA 1FP8A 4J3UA 4UMCA 4FNUA 2ATSA 1K6AA 2VEIA 1TV3A 3HPAA 4Q4QA 4QG9A 3S1VA 3W00A 5AC8A 1P0DA 2I1OA 9XIAA 4DQWA 3BC9A 4OV9A 4Q4SA 3AS0A 1OT2A 3U4FA 2DUXA 1YPIA 3QM3A 4XAZA 2PAJA 3EOUA 3AQUA 4PRTA 2VZVA 1TELA 4S3EA 4XBKA 4GXMA 1RCOB 2XPKA 1KGXA 4FS9A 3SFKA 4Z1AA 1DWAM 2ZICA 1NP0A 1ZJAA 4O0QA 3UY8A 3W9ZA 2BX7A 4AFYA 3AHYA 2ZE0A 3KVKA 1BVNP 2ZKMX 1B9ZA 2YXGA 1JZ7A 1VEPA 1AW1A 3VIIA 1JXJA 3LSBA 1DJGA 4A4AA 4K2SA 2RUSA 4GX9A 1FOBA 3ZMRA 3N3TA 4IGMA 3UGVA 3LPPA 1KA9F 2EBNA 3TYDA 5C2CA 2OMAA 1V0KA 4E8CA 1GOOA 5AYBA 2V68A 3UD6A 2QAPA 4PH6A 3OB8A 4J5NA 4ZL1A 1Q6OA 3P93A 5A8NA 3DHPA 1EUNA 3OW1A 2YB4A 3FKKA 4JDYA 3S42A 1EXPA 5D2VA 3DN5A 2BS9A 5HXMA 3BGGA 3GU1A 1XLDA 1UWTA 3GVGA 1AW5A 4W87A 4B5SA 2EQDA 2OQYA 4PA8A 5KZ6A 3R4IA 1MEWA 4O1FA 1TPFA 3B0YA 1Q4WA 2ZX8A 3MCOA 2FFIA 3WLKX 3REQA 1CBGA 1PWMA 2OEKA 3KDOA 4H6QA 3VVGA 2DH2A 1VYRA 3LBOA 3V75A 2WZMA 2UZ9A 1FCVA 2QYGA 4JTFA 3EZ4A 4TVCA 3WK0A 3T44A 3EWDA 3A3XA 4UTHA 4Y8EA 2Z6IA 3VKBA 1JDFA 3H2NA 2FH8A 2HK0A 3MUZ1 2BGNE 3O06A 2INZA 1K70A 3WO8A 4BS0A 3CQJA 3MQTA 3MSYA 3NO3A 3CMFA 5JQ9A 1JDAA 3ZT5A 4O28A 1B0IA 1ZBCA 2NXIA 3R94A 5LA0A 1A5LC 2A6NA 3VCRA 3W1AA 4US5A 1PX8A 2FDSA 5A6KA 3W1LA 1TWIA 3TIMA 1RVGA 4WEVX 2VZTA 1VC4A 3HFYA 4X0VA 3N2MA 4PUMA 3GDLA 1M65A 4OGZA 1HXJA 4CQ9A 4CLMA 1XLGA 1GONA 3WFZA 4C6LA 6XIAA 3EAUA 2E9MA 1C8VA 1CEOA 5DRIA 3I3BA 4XZWA 3BJSA 3LG3A 3DYOA 4O18A 1A5MC 3MJYA 3SB0A 3AXKA 4OT7A 3M0LA 1KQZA 1MUWA 3PZOA 4HNOA 3QW3A 2Z7GA 1M53A 3L4WA 5FF0A 2PDKA 4J3XA 5G1TA 2QGYA 4TTUA 5DY2A 4HQVA 3MYPA 2HS8A 1GVFA 3WLPA 3EDKA 3HTWA 3CV1A 1MW2A 3RITA 3A47A 3O3RA 3QOKA 4UTMA 1E0XA 2HBXA 1VHNA 1CCWB 2QT3A 1R2SA 4ICMA 5AYYA 3TWAA 3UR5A 2MNRA 1OT1A 3T8LA 3RXZA 3LN3A 1P0BA 3AYVA 5C7HA 3N9KA 3OPSA 2YCLB 2CLEA 2NUXA 3ZOAA 5A3HA 4S3FA 1RR2A 5AC4A 4B5VA 1TTPA 1WKYA 2WZHA 4LC8A 2GYIA 2XFFA 1KV8A 2DY3A 2C18A 2VEGA 2YXXA 3V5CA 3AROA 4UIOA 4OECA 3P6LA 1WXYA 1OFQA 4DJED 1RSCA 4EPKA 5XINA 1W2VA 3IAQA 1V6TA 3VNMA 4JFVA 3W1UA 1IT0A 4TV6A 4FSAA 1MO0A 5U4NA 1ICQA 4DUOA 1EA0A 5E0KA 1JDCA 5FJPA 1GVEA 5A6TC 2VGFA 5F7UA 4AHPA 2QVHA 4JTIA 1UUOA 2CPUA 4YPJA 4OTKA 1XLKA 3E2SA 4DZHA 4ZXLA 1TFVA 4GISA 3UERA 2QPUA 1A3XA 4AH7A 2EO7A 2ZXBA 5I03A 3PZQA 3UVIA 1WKEA 3OJGA 3EDDA 1OCBA 3LOTA 2F2KA 4N2YA 3GIQA 3G0UA 1XC4A 1TX2A 3HQOA 1E0UA 3TAOA 4IMEA 4M6UA 2OO6A 4XD3A 4NF7A 1FWFC 2XINA 2G5WA 4PMYA 3TJ4A 2JEPA 2FTPA 3B0VC 4MPQA 4QGCA 1A80A 1CGXA 4H8HA 3EOLA 4U33A 2GK1B 3O7UA 1CGYA 3DC0A 2V8ZA 3KBWA 3V0TA 4M7SA 3CS2A 2QQ6A 3M64A 4PCFA 3KOYA 1XKJA 3ZIZA 2Z26A 3HA1A 2G95A 3LTSA 2VEFA 4CNOA 2ZUMA 3N1AA 3RFAA 2OOFA 5BU9A 4FO4A 1GK8A 3H24A 1CLXA 4GMEA 1MXDA 1DWFM 1K9FA 3N9SA 3I7RA 3FY1A 4DXXA 1UD3A 1IEQA 2DT2A 2FZ8A 3QSRA 1ISWA 1WDSA 3SJ3A 4GUIA 3KX6A 1CECA 1WXZA 4NUWA 1XYAA 1G69A 2Y62A 3EPNA 5CC7A 4H04A 3GTXA 4JTSA 4TVUA 2FH6A 4B90A 3PPGA 3TEVA 3ZSTA 1LUCB 1HN1A 4Q7BA 1N82A 4ZENA 2REQA 1FWIC 7REQB 4D9PA 4IMGA 1QI0A 2GLKA 3V4BA 2XH4A 1UMYA 4KCUA 1FDZA 1LROA 3R8GA 3STPA 3SQSA 3M0YA 3DZ1A 2JALA 4XSLA 1TJPA 3M9YA 4QIUA 1RQEA 1JUKA 5T8GA 1IR2A 2I5IA 1GTEA 4HTBA 3FNDA 3VGHA 1Q6FA 1SYTA 1PZ3A 4O1DA 4GQBA 2DEPA 1W17A 4LUSA 1XHGA 3QTGA 2Z29A 1GOMA 2XZ9A 3H2FA 2OSWA 3G1HA 1ENUA 3TSDA 2BVDA 3IANA 1GYMA 1DOSA 3L68A 1KTCA 4L1XA 3LHTA 4HMNA 3SCOA 3DXIA 3AOFA 4DAFA 4DO6A 3GXIA 4JX5A 2ZA3A 1W8SA 1FWSA 4L56A 3O0FA 4GUJA 4M56A 2WJDA 2F6KA 1WZAA 5EL1A 1Y65A 3CAVA 3VA8A 4JTJA 3BMXA 3PR2A 3OP2A 4BWLA 3SCSA 4I5XA 2B7PA 2J9ZA 1P6WA 3JVAA 3UY7A 1T0OA 4MLJA 2FYMA 3PZMA 2DT3A 3RLVA 3CL6A 4Y9OA 1UCWA 3UETA 3V5OA 1GOXA 1PKLA 1LYXA 5D32A 4PL1A 4GUHA 2X16A 1NAL1 5EFFA 4F0SA 3TV8A 2E9LA 3HF3A 4XBJA 3FXGA 4BF9A 4NVTA 5C70A 5M5DA 2V5JA 1Y5VA 5CC5A 4TQTA 4WVXA 5AKQA 1AMKA 3TK7A 1R2RA 3TXZA 1OYBA 4E3VA 5K9DA 2QAFA 1VHCA 4NZ1A 2Y7FA 5CZ0A 2WOQA 4GLEA 4MWAB 3F2DA 3M44A 2IXUA 3P61A 4UQDA 3R1ZA 1BG4A 1LDCA 5ABEA 4HZ6A 3WLMA 1W9BM 4IFRA 4YLWA 4U31A 4GZ7A 1W1IE 3G24A 3LMZA 1ALDA 4PN2A 3DX5A 4P8VA 4TR9A 4Z1YA 2O55A 4QS5A 5DN1A 1EBHA 1MRQA 3CAKA 4RJEA 2QPXA 5CAKA 3VKCA 5HJXA 5HMFA 1U1HA 3EXRA 1UKQA 1JNEA 1I45A 1E6QM 3IGUA 4E4FA 1F3TA 5C0QA 4X9YA 2H9AA 1TWWA 5HQMA 5MKGA 5AVNA 4CNSA 2R24A 3H55A 1N8WA 3EWZA 2TPSA 5EMYA 4GY1A 3O05A 2GGIA 3VOIA 3LYEA 4LALA 3QSTA 4MTVA 2FHFA 4HIBA 1J79A 4H01A 2R9RA 3GR8A 1V4YA 2YYTA 3TYBA 4L6HA 1VFLA 1OB0A 4CNPA 3E3HA 2HXTA 1R46A 5K4ZA 3DU0A 4Q6JA 1Q6CA 2BY2A 2VZOA 4LAOA 3B4YA 4UTWA 1W3KA 2ZZ5A 1XGZA 3RU8X 3PTKA 2DUZA 1Y0EA 4JQ4A 4CNNA 1OIFA 1E4LA 1U22A 1RZMA 3EA2A 4EWJA 3W1QA 3O8AA 1VCFA 3S2MA 3UP8A 2ZYFA 3PBWA 3BUVA 4XUYA 2GDVA 1V02A 4A35A 4DELA 3R7MA 2QF8A 3LHWA 1LQ2A 1OFRA 1H09A 2PEVA 3SCRA 1CXIA 1O1HA 3RX3A 1SPQA 2PDXA 3C52A 3CLWA 3NFUA 1KRBC 5JU6A 1P0EA 2PTXA 2ZX5A 4MZ1A 4GBDA 3CGTA 3W85A 3DG6A 1Q8AA 2FZDA 2XVGA 3AIEA 2O9OA 1OG6A 3U9IA 1E9ZB 2CLMA 2TRSA 4NAEA 3CTTA 3LY0A 5HOSA 3GNNA 3PZVA 1TZ9A 2NXHA 2OG9A 2ISDA 2OEJA 3BW2A 5AECA 1WBHA 3SEPA 1OSEA 4XZMX 2BHZA 4RK8A 2VZUA 5E0CA 3ZLHA 1PIGA 4DWSB 1R9XA 4WOQA 4GYPA 4J3WA 2IKHA 3VX0A 4RR4A 3E9AA 2CZVA 4HZMA 3WNNA 2ZUVA 1P7TA 2DFAA 4N4PA 1LZOA 1KXQA 3I6RA 2YL9A 1A3WA 3NPXA 3WLRA 1Y8BA 2PTYA 3ABSA 3Q58A 3BW3A 2CHNA 3IJDA 4UFIA 1XLLA 2XIMA 3DG7A 4E3TA 3QPEA 3M0HA 3UVAA 1B4KA 4HN4A 1EJWC 1M04A 3STCA 4J9JA 3NJ3A 4B3KA 4H8UA 3NOEA 5CAHA 3E96A 1N8IA 3TROA 3II1A 1ADDA 1QTWA 3SCTA 4WHBA 5HWMA 4UZUA 2B7QA 3A9BA 3LHZA 3LHVA 3P80A 1KM3A 1ME7A 1TWDA 1HJQA 1ZJBA 3E2RA 4G1NA 1TTIA 2V2CA 4JDBA 3SQMA 2CLPA 4UTTA 1E0TA 4JEJA 2FZ9A 4J35A 1AL7A 2DV0A 1TPEA 3TOPA 1E73M 2ODOA 4WDTA 2QCHA 2Z24A 3QOMA 2E25A 4KEUA 3NXLA 4LY4A 3MI2A 3BDKA 2O56A 1BPLB 4FNTA 1TR9A 1R30A 1V51A 2GDQA 1PE1A 3FSUA 3MHGA 3H6OA 4C6JA 4PUKA 1RQBA 3G1VA 3A23A 2W92A 3PPHA 5A8OA 2PD5A 4XG1A 1IXPA 5KZEA 2Y24A 3UG8A 3N34A 3TJLA 2FGBA 2D3LA 4W8LA 1F76A 1NVMA 3UR7A 5JUVA 4KEMA 5BXPA 2ISFA 2NV9A 1B3VA 4IMFA 2H6RA 2VC7A 1HT6A 4NAFB 5CPNA 1EP1A 4TOQA 3ALFA 4W5ZA 2LLEA 1C8XA 1HZYA 2RFGA 4AZIA 3DC8A 2OEMA 1UQZA 5AC7A 3B04A 3LGEA 3ARQA 3W4RA 4F0HA 4D6HA 3LXCA 1EJXC 2XTKA 3R0DA 4MGGA 4I6KA 2KZHA 3EWUA 3TTOA 1R47A 3LPFA 3LM7A 3MKVA 3VD5A 2JE8A 1B9BA 3EYPA 4RXFA 2GGEA 2PD9A 1DTUA 1PIFA 3MTWA 3URAA 1X98A 5F1VA 3KVJA 4KT2A 3RJYA 4UTJA 1UR0A 1E9YB 5G4WA 2HS6A 1W31A 5ABTA 1E4MM 2Y7GA 2H8XA 3VXGA 4KESA 3BZJA 1VFTA 3WQOA 1YDNA 4R9XA 1IXQA 3FJ4A 4GIAA 3VIJA 3VNKA 3RPDA 2NUYA 4HN8A 4K8HA 4MJ4A 2IPGA 4CEUC 9XIMA 1PZ2A 3MC5A 3N2XA 3IK2A 4J27A 1YKWA 1V3MA 2A3CA 2OYMA 3PTDA 4JKKA 4IP7A 1PS9A 1E5JA 4GE8A 2XVPA 3GU2A 5FJJA 2D2HA 1TMHA 2GGHA 3THUA 2UBPC 1YADA 2NXGA 4IGNA 5E1QA 5DRCA 4LY8A 1YE4A 5D8ZA 3RR1A 2Y63A 4E2BA 1KM6A 2Z2BA 1UKTA 1JZ2A 4GBUA 2HVOA 1J0ZA 3RF9A 1U30A 1X7FA 2CZFA 1TPVA 4E6MA 4Z1BA 3L2IA 1PZ0A 2Z0IA 2OLHA 3GH4A 2NQHA 4ALDA 4MDPA 3PPFA 3C3NA 1DTNA 1FA2A 2EKGA 3WEMA 1KCZA 2WBGA 3ORWA 3BCJA 1L9WA 3CHDA 1W32A 3I3EA 4L4LA 4DM1A 3MB9A 2NSXA 2VMFA 2XGBA 3W2UA 3U3HA 4S1FA 4F3HA 5CC6A 4NZ4A 2J7GA 2QPSA 4TX9A 4BQ4A 3G2GA 1NF7A 4GO8A 4RKAA 1EIXA 3NQGA 1V6UA 4GFSA 1NU5A 1QK2A 1VYSX 3O6CA 4LRTA 3N6HA 3B8IA 1HNYA 1VBHA 4ZBCA 1UMLA 2V81A 1Z44A 3LBCA 1ZAIA 5FL1A 5FF7A 3QKZA 3EOSA 2P53A 5HPOA 2WHKA 3A64A 4UCGA 4O52A 4DZ5A 4GXPA 3DFHA 1H3GA 1V6XA 2GSHA 1US0A 4HPNA 4KFPA 1G9HA 3A6OA 1QNPA 4O10A 3E0IA 5ABFB 1SFSA 1UWIA 2CZ5A 5AHIA 3NAVA 3B9EA 2ZZ2A 3NQEA 4K36A 3RRXA 4PODA 3QPYA 2F8QA 4TMCA 1GYLA 3B0PA 1QO2A 5BU6A 1HQTA 3TJIA 3TNBA 1QK0A 4RE3A 3CEUA 4AF0A 4DBWA 3CUHA 1M41A 3VDAA 2NVAA 2CLIA 1P1MA 1B57A 3I4KA 3DYPA 3FSTA 3BAWA 3FA3A 3ANVA 1J12A 1LLZA 2YCLA 1YBQA 1XUUA 3EPOA 1BXBA 1UWAA 4DZIA 4AZ6A 4AZ7A 3S0CA 5IHSA 1ONXA 4UMBA 5JXQA 1E70M 1WKDA 3AIRA 5HINA 4RZ6A 2V5BA 3BLFA 4AEOA 2J7BA 4LS0A 4UNKA 1J0IA 2VVNA 5AHEA 3W7QA 2A7NA 3IJ6A 3UXAA 1UA7A 1ONRA 2X0YA 1MQQA 3M0JA 3NEVA 4FIQA 3W86A 2FHCA 4WUIA 5F2IA 2R1MA 1JCJA 1FFRA 3BMVA 3CIVA 4H7VA 2INFA 5T9CE 4C91A 1JAEA 4IUOA 5AYZA 3LDVA 1C29A 3A13A 2G3MA 2ZRZA 3VD3A 2ZXAA 3HQ1A 3FAWA 3P81A 3L2LA 4K37A 2ZZ7A 3N14A 5LIUX 4BJHA 3RGTA 1V77A 6TIMA 4DEFA 5D04C 3RLUA 4I9MA 3U5UA 2PDQA 4GUFA 1JNDA 3WQ5A 4DIAA 4XKMA 4ZQOA 1EJUC 4R85A 1HO1A 1XIMA 3N3MA 1REQA 4JTTA 3M41A 3UCDA 3DDMA 2DDXA 3O07A 3ZXWA 1DKWA 1BXNA 3HQNA 4RNIA 2V6AA 4CCDA 3UG4A 5H8PA 2RGMA 3VIHA 2CBVA 3ZVHA 6ENLA 2P8BA 2C0HA 3THDA 4US5D 1SJCA 2BMBA 2ZC1A 2IPFA 1TPUA 4DLFA 1LLOA 1JQVA 3H2AA 3F2CA 3EB4A 2J74A 4LJ3A 1K8YA 3GDTA 5C9UA 1UC5A 5A6BD 5EYWA 2WO5A 5JVLA 3AXMA 4IPJA 4F40A 1CPUA 2E6FA 2QDDA 1SFLA 1XGDA 1XSIA 1HJWA 3REQB 3UXLA 3GNDA 4D1JA 2OZ8A 2CU0A 3ITVA 3VD7A 1AUSL 4ZOCA 3ARXA 1ISVA 2ADAA 2J77A 2BTMA 3FDGA 4DJDA 5C9WA 3ZJ6A 1HP4A 3NDOA 3OODA 4L9YA 1ZENA 1DIDA 2PLCA 3W7KA 3G1AA 3PB0A 3MDWA 1P43A 2ESCA 5CPMA 1VZWA 2YCJA 5FKYA 1Q6GA 5F4XA 1BHGA 3UG5A 4TO8A 2ON3A 4TMBA 5M1TA 1Z8AA 1TE1A 3WNLA 3R10A 4O13A 1NY1A 2ZBTA 1PX4A 1UHVA 4LAKA 3VM7A 5EMUA 3FJNA 3M4HA 1BYAA 2D0FA 1TSIA 5HQLA 2D3NA 3W72A 1OY0A 5A6LA 1MMFA 2NV1A 4YN5A 1GJWA 2VVSA 3EMQA 4ZMGA 3VGBA 5BZAA 4HK6A 4H6KA 2PDBA 1ICSA 3LRLA 3W7DA 3GDRA 1PDZA 4I3GA 3S9ZA 3ARTA 3SRDA 5HMEA 2CW6A 3N15A 3UWYA 3SI9A 3CUFA 4EXQA 1KRCC 5AHLA 2GVEA 4ZQMA 2BZNA 1JCXA 2DJLA 2QS8A 3BLLA 1UH2A 3GXMA 1KR0A 3UW6A 2G97A 1FVPA 2OO0A 3A5VA 4LB3A 1OADA 3GTNA 3ARVA 3LCFA 1Z69A 3DFYA 1RVKA 1W1B1 5CSSA 2BY3A 2ASHA 3RILA 4LXFA 4HNCA 4UTWC 1TPWA 2Y89A 4AHQA 4HBKA 3AAMA 2TYSA 1J2BA 1JCLA 3WNOA 2HDJA 4V1XA 2CWNA 2PDHA 3TH6A 4O1AA 5I00A 3H22A 6REQB 2BXZA 4LAZA 1XV8A 1YNPA 4A2SA 1SO6A 3QV6A 1B4EA 2Y7EA 3TC7A 1F4HA 2ZX9A 1R9ZA 4PRWA 1O95A 3SQLA 1R0MA 3WLSA 3CQKA 2OLAA 1LUCA 2Y6ZA 3IJQA 4KCVA 3DYMA 2FVMA 4HVXA 2OODA 1XDMA 2OQLA 4FMVA 4HCLA 4CD8A 4WY0B 3N2TA 1US3A 1MSSA 3AJ7A 1FQ0A 3FKRA 1PJ9A 5FOOA 3NO5A 3SUWA 5C54A 3R2GA 4GVHA 1W3JA 1Z89A 4GGHA 4OVXA 1JZ6A 4MY8A 4NJIA 4XZLX 1R9YA 3HPSA 1IZCA 1E0VA 4Q8TA 3MS8A 3ERPA 1M9HA 1NDZA 3N17A 2VRQA 3DERA 4ZQCA 2QJMA 1BWLA 3LERA 2BHYA 1AD1A 2YDAA 3B40A 4E38A 1XI3A 5CC3A 4C60A 4BFAA 4UQAA 1S2WA 3EMCA 3G1FA 4D1IA 3HPXA 1XIJA 4QLLA 4BHYA 2GK1A 3VMOA 1SJDA 3VCNA 4KMQA 3EB2A 3KL5A 4ZOBA 2EG6A 3LCXA 1PX3A 2H9AB 4CCZA 2X0HA 3W7JA 2VCCA 3ONCA 5D03A 3NQ2A 1BWKA 1CW2A 1W5QA 4QCEA 2GOUA 3KBVA 3LUTA 1P5BA 4JFSA 1YNQA 3KBSA 3HMCA 3BVJA 4F79A 4UFKA 3C2VA 1W1A1 4XKYB 1OC6A 3K8KA 1DIEA 1IEXA 4X63A 4Q33A 2YCKX 1WP6A 3SCVA 3APGA 5AZ0A 1EGMA 4I9TA 3GXFA 4PTXA 1LT8A 5D09A 5HJYA 9CGTA 1JULA 4S3CA 4XAPA 3ZWSA 3A12A 2HMCA 4DPPA 3IJ8A 2WQDA 3H70A 1UR8A 2NT0A 3GXDA 2P10A 1G4PA 3OYXA 3T08A 3MO7A 2E09A 5I02A 4Y9AA 2J7FA 1Q3NA 4DXVA 2RAGA 5IM51 2G4JA 2WHMA 1E55A 1U5VA 1HVQA 2Q71A 1WUFA 3FHQA 3W24A 3O0KA 5DCDA 4P5UA 2XVKA 3AU2A 3TZNA 4Q8VA 1OIMA 3KS6A 1SR0A 2ZA2A 4F0LA 1X8FA 2ZE3A 5FA5A 2E8YA 3PSWA 4MADA 3GE7A 1JPHA 3RHGA 1HJXA 1MI3A 3AMLA 2YB1A 1WZMA 5CPQA 3TC3A 3V3WA 3O15A 5A8MA 5DXXA 3JRKA 4S3GA 3G1SA 1WCGA 2AOSA 2POTA 4LUSB 4ES4A 1S2AA 3TOYA 3SURA 3WK2A 1ZPTA 4JTCA 5REQB 2H3DA 2V0TA 4US6A 4CCEA 2E67A 1FWJC 3EX1A 2YA2A 4PBGA 1AQHA 2WAGA 2OXNA 1R7AA 1TZ7A 3HIJA 4W9TA 2VYOA 5M3WA 2BOEX 4AB4A 3BCDA 2NQ5A 1H7XA 2E5CA 2JKAA 3C8NA 4FEZA 3E38A 3IS4A 3KW3A 1XBVA 2CHRA 3BE7A 2FZBA 1H7RA 3CHCA 4Q4MA 4XB3A 1H60A 4ICCX 2VELA 5B7ZA 1U83A 3WG6A 4LBRA 3CUJA 4Q8OA 4PB4A 1MEHA 5DX7A 1WX0A 4O12A 1T6MA 2GVJA 1S5TA 3B8TA 4G7FA 2QCDA 1NEYA 5FEXA 4EE9A 1FTXA 2VFEA 4DF2A 2HK1A 1EPVA 1LF1A 4C5YA 4XO6A 1SZRA 2OCZA 4J28A 3H4XA 1CZ1A 4XAFA 2ICSA 1D7KA 4V1YA 2Y85A 4LYKA 3HQPA 3WUGA 4UC5A 3GM8A 2WCAA 1DJIA 3HG5A 3VNZA 3M47A 4RE4A 1MW0A 3TTEA 2WNZA 2I5QA 1QW7A 3ME3A 4AU0A 3W38A 4CU8A 1UP2A 1XX1A 2C91A 2VGGA 4GQRA 3RM9A 5KZMA 1RA0A 4OOZA 4ZFMA 5C6MA 2YJQA 2F7FA 2J8TA 1L8PA 1TMQA 1JPDX 4H19A 5I6SA 1C9DA 4RNJA 2A3HA 2C16A 3W7OA 1E9IA 3NPWA 1RA5A 4YTRA 3FDKA 2ABBA 4IZGA 3N12A 4H9TA 3KRSA 5K2ZA 3R25A 3R43A 3C0JA 4FR6A 1OG0A 5G4HC 2XWEA 4XK2A 3AHXA 4O19A 1HJSA 4IMCA 3P0WA 3AMKA 3WQVA 2PU1A 3DCPA 3GHSA 2FPTA 3XISA 5D33A 2CESA 7XIMA 1VR6A 5C9ZA 2YX0A 2QUVA 1T8XA 4NIRA 2DGAA 4OJYA 4YCPA 1DHKA 2DVTA 1T40A 4DJFA 2FVKA 3W37A 2GJRA 1XS2A 1P48A 2AGTA 4XX6A 1UD6A 4P8UA 2DJXA 4I5RA 1VRDA 3L9CA 4E8GA 4ERIA 3WL1A 2FB2A 4CU6A 1J01A 1K3UA 3NQBA 1VIZA 3WH9A 1L2UA 1VJZA 3DGRA 1HKJA 3GAYA 4TU1A 2B7OA 2WPGA 4OE7A 1NQKA 3BV7A 1Q45A 1UA3A 1H50A 3DFPA 1X97A 4O11A 7ODCA 3VIPA 1QVBA 4JL2A 1J4EA 4X2RA 2Q8LA 3KWSA 1AVAA 1ZCOA 2IPJA 5AVHA 3EBVA 4Q7IA 4HOZA 1BFNA 6A3HA 3WLJA 1KC7A 5KMYA 2ISWA 3VE9A 1A47A 3GC5A 2HXUA 4NJKA 2X2YA 4JHOA 2RDUA 3KHJA 4HOXA 1LM1A 3HB9A 1KFLA 4ZFCA 3RIKA 4PMRA 3NEHA 3QZAA 5GPRA 1CX9A 4AIUA 1IGWA 2NQJA 4EX4A 1EHAA 3BICA 4BKNA 4MZYA 5C71A 4KCTA 1KGWA 4RCXA 3WMSA 3AU6A 1CB7B 2QDHA 4P8XA 3KCOA 4B3LA 3W2LA 3NZRA 3OGVA 5ABGA 3SCQA 3QC0A 3DHFA 3FEQA 3SSZA 4DJEA 2E4TA 2VI0A 3AMDA 3GG0A 1OZMA 3A3WA 2A0NA 2VP8A 2NW0A 4QRNA 4W85A 4KWUA 4DI8A 3T9PA 1KRMA 4L64A 4JHMA 1TIWA 4LF1A 3TYAA 1PXGA 4DJDD 3G1XA 1YTEA 3G1YA 2BY0A 3S5NA 4J2MA 1D3GA 3BANA 2A7RA 3PJWA 1F3EA 3TKFA 2YA1A 1UZHA 3NVDA 2W4XA 4PC8A 1VBUA 1GT8A 4L1GA 3RG6A 1TPH1 1SM9A 1OYCA 4GIYA 1LRQA 8XIMA 5LA1A 2YCEA 3PAOA 4UFLA 2Z27A 3W22A 1SSDA 4JKLA 1TTQA 1B3YA 1K03A 4D72A 3IJLA 1M7OA 1E1EA 3CZJA 4A3UA 1J2WA 3AC0A 1XG3A 1IIGA 1AJ2A 1BYBA 3AIVA 3APYA 2YXOA 3LNMA 3KM8A 1QU4A 4NP7A 3VKAA 3GIYA 2E5DA 4AZBA 1AFSA 3G1RA 4P7LA 1EJVC 5M17A 3VABA 1KXVA 4DWDA 1LG1A 3DG3A 3IRSA 4JQ1A 3NURA 1KW1A 2XUCA 1WE5A 1E1FA 1VBGA 1BYCA 2VXNA 4FHAA 4BI5A 3GFZA 4NKCA 1KLYA 3GWQA 1H7PA 3OVRA 4AD1A 2Z1BA 3L4YA 4NI3A 4POCA 2CNCA 1F8IA 4IG2B 3GDBA 1H61A 3B8SA 3GVVA 4TX6A 4MZ8A 1IWBA 2W91A 3EEGA 3DBPA 4NAFA 4EAYA 3TXVA 5CG7A 1RLCL 2L5HA 3CH9A 1LCOA 1SFTA 2DQWA 3CK5A 1T5AA 3G0XA 1DQUA 1KXTA 3APTA 3GBEA 1VYPX 4NJHA 4K38A 4RNFA 2WC7A 1A5AA 4PTWA 3BZGA 4H7ZA 1T96A 3NL2A 2FZNA 3PZUA 1IEIA 1UZDA 4F48A 3OLGA 3PZ9A 3SO7A 3IARA 3A4AA 3QMSA 1FWAC 1Z7AA 1M7XA 3MMUA 3WQPA 3NTYA 1RCXB 4C6PA 3FGCA 1FWGC 1Y5WA 2HNHA 3GR4A 3FW6A 3LPOA 4PBEA 4BR1A 5KITA 3N25A 2EPNA 1OFDA 2DIEA 5GJMA 3M5YA 3DFNA 4QX4A 4ATWA 4GC4A 3WQEA 2WM1A 4CQCA 4A29A 1IYXA 4DO4A 2J9XA 3W0KA 2A79A 4PUJA 7A3HA 1V03A 1JL8A 1BKHA 3OIHA 3RPMA 3OZPA 4GXWA 3IWPA 3BLDA 2OELA 4JTKA 3R58A 4PYSA 4JTHA 2YW4A 1O94A 3L4TA 4Z0SA 3GTHA 1XBZA 5LHEA 2NUWA 1C92A 1THFD 3O6AA 4O1CA 1XL9A 5IBXA 5J8LA 4ZGYA 1EC9A 1TYGA 4L5ZA 3QW4B 4AUBA 4EAMA 4F0MA 3S2NA 3BL3A 1ZTVA 3WMCA 2CBUA 2VR4A 2J79A 2RKXA 2FTWA 3QPZA 5A1AA 4HA0A 1HVXA 1HJVA 1WDRA 1FCUA 3AXXA 4IXHA 4PL2A 3E74A 5HNRA 5JBFA 1ZP3A 1E72M 1IZJA 5LNUA 1G4EA 3J7HA 4RX0A 4PZVA 5AZ1A 2IUZA 1F2JA 2OSYA 4IL0A 5CGQA 4QLKA 3UWQA 5BRBA 4FNSA 2PRHA 4O54A 1UBSA 1H1NA 2CBJA 3CNYA 4JOMA 4CD4A 1KFJA 1HP5A 4DF0A 6REQA 3W6MA 2Y8UA 3G0SA 2Y8VA 1UWSA 3TN3A 3W7LA 4LVDA 3WELA 3ITTA 1R3QA 3ITLA 4GZEA 3DOPA 1VS1A 4HNVA 1R86A 1HKVA 1GOKA 2PC8A 2C1GA 4W7VA 4MJMA 2ZXQA 1G94A 3DH7A 2WHJA 3WLNA 2WLYA 1YNYA 3COTA 2R1LA 2BV9A 1K02A 4FNRA 1U5HA 5G1YA 3VCCA 5I79A 1TPB1 1KM1A 3KHDA 4P8WA 4A8NA 1DWJM 3U57A 1IIHA 4AZHA 4HYVA 4MY9A 4P2VA 4C6QA 1HO4A 1W9DM 2OWCA 2IS7A 5C55A 4FB7A 1H1YA 2XFWA 3N73A 2PS2A 1XIEA 3K1DA 2PDIA 4LV9A 1YYAA 1FXQA 2A3AA 3NQVA 1D2KA 3EWXA 4XTIA 3VK5A 1L6YA 5DLCA 2VCBA 3Q65A 1FP9A 1AH4A 3URBA 2VFHA 2C79A 4S2CA 1EPXA 1RD5A 1C7SA 3GW0A 3MY9A 2ZRYA 4TIMA 3PWIA 4N42A 3S1GA 4H9MA 1H4PA 3EMZA 3MSRA 1OBAA 2GJLA 2J78A 5LGZA 2XH2A 1W91A 3WL0A 1NP2A 3MUY1 3T07A 3IV3A 2QJGA 1TX0A 3IJIA 4GVFA 3QF0A 1PTGA 4D2JA 1ZLPA 2ACUA 3MVTA 4S3JA 5A8QA 3AS1A 4JIEA 3GYEA 2O9PA 4IIEA 1AQMA 2Y0FA 3ZT6A 4Q4PA 4YHGA 4DXKA 3QRHA 5KETA 1LQAA 3PBUA 4WF7A 3CV2A 4WXYA 2I56A 1QI2A 2YBVA 4RZBA 3H2EA 2INEA 5D9OA 3UEQA 2H90A 4QAWA 2BVTA 4PCPA 5DY3A 1UR3M 2P76A 3KZSA 3PWAA 3WK3A 4GIEA 3VDGA 3E49A 3THAA 1OVDA 4UFMA 3EB3A 3SGUA 1XSJA 1HKMA 4Y9PA 3PP7A 1PPIA 1I2OA 3NQMA 2XU2A 2HWGA 2PZNA 3OA3A 1NDWA 4LUTA 2XM2A 3KAOA 3VNJA 2EJAA 4JGDA 2CITA 1KFWA 1T99A 3RRAA 1QOXA 1Z3NA 4ZEPA 4AD5A 3B03A 4L6DA 1KM5A 4YIWA 3SRFA 3KP1A 2AGKA 2OTDA 2C6QA 1SO5A 2VEMA 4U28A 4LAMA 1TVLA 1TQJA 3HN3A 2H8ZA 3DFTA 2FZMA 3A4WA 4Z1CA 4KPLA 4F9DA 1VENA 3HV8A 3NDZA 2GFTA 3WBEA 3MWAA 2WJFA 1KGUA 2YLAA 3UF9A 1FWTA 4GQGA 2VOMA 3QC3A 3RR4A 4BK9A 4MAZA 4PSPA 1VKFA 3USZA 2BASA 4LUJA 3ZJKA 4U10A 1XCFA 5G2WA 3NDYA 1DE6A 5I24A 2NVCA 4ATDA 3KOZA 4Q4KA 1TVPA 4E8DA 2PWVA 3GRIA 4DRSA 4AVFA 2DZAA 4N02A 5J04A 1YPXA 1YPFA 1JYXA 2MUCA 1YEYA 3L66A 2B0MA 5E09A 1L0PA 2F84A 1HW6A 5LNWA 3NQ6A 1DV7A 3L23A 3VGFA 5CZJA 1JCMP 3MUXA 4Q7NA 3CQIA 4HPJA 3TDFA 2V3DA 4GY7A 1J93A 4W5UA 3CXOA 2VURA 3C0LA 1WO2A 2J25A 1UIOA 4WCJA 1R5YA 4KF1A 3C2RA 4UMAA 3T40A 5ENLA 1GQLA 2GOKA 4DI9A 3AZRA 4AC1X 1OF8A 4NNCA 7CGTA 4HNTA 3B8VA 2Q01A 1R7OA 4ASTA 1Z32X 4A3RA 4Y2WA 4L9XA 5BW6A 1L6SA 4L61A 3K4AA 2Z00A 4FF7A 4HMEA 2REQB 1ODUA 4FXFA 4JEQA 4LS2A 1YHTA 1DJXA 2ALRA 1MUMA 4NZCA 4H00A 4HJWA 2E5BA 1IR1A 1UROA 4GI6A 5HR7A 3PWGA 2ZWZA 4BEQA 4XBSA 4BWLC 5K9XA 3NA8A 4JTDA 4JTGA 4Q6XA 1E51A 4YS1A 3WENA 1FHUA 5EBAA 2AAAA 3I3DA 3UZZA 2CLOA 1CI1A 3SAZA 3BG5A 1AJ0A 1TZZA 2X0SA 3U0HA 4I6VA 2ZUUA 1Q4NX 1GORA 2PCEA 1VFSA 4CQAA 3H21A 2WC3A 4AX7A 3CM4A 4RUBA 4KW2A 4I7VA 3M16A 4JAWA 4OHQA 3WJZA 2WKLA 3GFYA 1S5MA 2PLKA 4AD0A 5HNTA 4HA3A 3U4AA 1PVNA 4XD5A 3TN6A 1I4NA 4UQ9A 5JIWA 3ARSA 1I2QA 3W25A 2F6XA 2CYGA 4H83A 2QCCA 4QG6A 3VIKA 5D2WA 2ZCGA 4ERGA 2V82A 4NX5A 3L12A 1CDGA 5CKSA 1V3KA 4YVXA 4N9EA 1FWWA 3G1DA 3S1WA 3VOJA 3ZT7A 1QXLA 3HURA 4J3TA 5BYWA 1E6XM 4H7CA 3C8FA 3LRMA 1A5NC 4ZE5A 1E56A 4O4WA 3UU0A 4N4QA 1TV5A 2XN0A 2FKPA 3GO2A 2WVTA 1JZ4A 1RY8A 2XH7A 3T8QA 3CT7A 1ZP4A 2GGJA 4CNUA 3PN8A 4EXBA 4W86A 1OQFA 1RPXA 3VZYA 3LB0A 2ZOXA 2WSYA 3G5EA 1A53A 3LENA 3UZJA 4DF1A 3W23A 2PTDA 2BY1A 4PMVA 3VX1A 2WNWA 3UJRA 4DWSA 1ME8A 1B54A 5G5IA 4IX2A 3KCJA 1WAWA 4B92A 2HV5A 1CGTA 4GWEA 3V1HA 3HPFA 2W27A 3FIGA 5D2YA 1JR1A 2PI6A 4O17A 4Q4RA 3T2PA 4N6EA 1UR1A 1KO0A 5DT5A 3BJTA 3B06A 2WWCA 2D2JA 1NELA 2Z1SA 2WSRA 3G6MA 2Z28A 2JF6A 4YL2A 1Y7VA 4CUCA 3ZR4A 3QLDA 3QYQA 4FF5A 4UTIA 3CTLA 2A3LA 2PTZA 2A2IA 1BQGA 3R0KA 1W3NA 3SSJA 4H4IA 3UXDA 3W2NA 5HWJA 4JNZA 4B16A 4JIQA 3LQLA 1UD2A 1PL9A 2UY5A 3UPBA 1WDQA 2EG7A 3NXFA 4JZ5A 4UQBA 1PKNA 3IJ9A 5C9RA 1L8NA 3Q94A 4GYJA 4HNNA 4PCTA 2QCEA 3CL7A 5EA9A 1FH9A 1RBAA 7TIMA 1F05A 1I1XA 1X39A 2CETA 3VKJA 5KSWA 1H51A 3AIQA 1K7EA 3AXHA 4E0CA 8XIAA 2FGZA 2PTWA 4WLCA 4PUWA 3W2MA 3P74A 4W8BA 1OZQA 4IF2A 4C1NB 2J9YA 1EBGA 1HKKA 4NJGA 3W02A 4ADSA 1Q6LA 4BI7A 5HANA 3NZQA 4Q8PA 3ABOA 3CYJA 7TAAA 1SJBA 3DESA 4MB1A 5TQLA 2VRJA 4JIHA 1F6KA 3MP4A 4GIRA 4MWAC 2CXEA 4C1LA 4YTSA 4Z17A 4R3UA 1V93A 1EDQA 3OQEA 3VKDA 3FVMA 2Y8KA 1S2UA 2I7GA 3N6JA 5IHRA 2DZBA 1MZRA 1XLAA 1VF8A 5BXRA 1RV8A 1JQXA 4LYRA 1VD6A 3DKJA 3K5XA 2ISSA 4JN7A 3LMYA 3VOGA 4QISA 4O0KA 3UESA 3T2QA 1JIBA 3G6LA 3WNPA 4H41A 3A24A 4F0RA 5C2XA 5CLWA 4B15A 1Q2RA 3EX6A 1XR2A 2PMQA 1DPMA 1TRIA 3AHVA 3UXKA 3TQVA 3OLDA 2PDJA 1ODZA 2VTFA 3NGJA 3T0TA 4IUGA 1TPC1 3IV8A 1YE6A 2BXYA 1L2QA 4HP5A 3SCNA 3IIPA 1R8LA 1KM0A 1YW1A 5SWUA 4KGLA 4E2DA 1G6CA 4JD4A 1TVNA 4URIA 1VEMA 4FX6M 4B2DA 4GD0A 1RK6A 3HOJA 1QNQA 1W0MA 1XISA 3S5OA 1QPKA 3OIXA 4QDMA 3CPGA 4R5EA 2E3ZA 1J11A 3ID7A 3CB8A 3NWRA 1R6WA 2G41A 4FI4A 2WV8A 1Q7QA 3DAQA 1DJHA 3MJMA 2EPOA 4IJCA 1GVIA 4OQVA 4DLMA 1E4IA 3PBVA 4JTAA 4JKMA 3LQGA 2YBTA 1HL8A 2OYLA 3ZQ9A 1WQ5A 2EXOA 4EK7A 1PCKA 4S3BA 1IGSA 3EEZA 3W7CA 1B3OA 1ZFJA 2VNCA 1W1TA 2ANUA 3O16A 1BGAA 5HATA 1XQLA 2DVXA 4JCLA 5I3IA 4M6QA 1UG6A 2OYKA 1DQXA 2V5CA 1O66A 2PDMA 3ZSSA 3IIXA 3LLXA 3WDJA 5CPSA 1NWSA 1LOLA 4Y6GA 4IGHA 1O4UA 2OQHA 1R3WA 3EDEA 4Q8NA 4MB3A 5HUOA 4JPGA 1LT7A 1NOFA 1IHIA 1QWKA 1BTCA 2XIQA 4D6FA 4PUUA 3U2ZA 4J1OA 2W6RA 1J0HA 1XBXA 3V1PA 3C0QA 3AZSA 1XRFA 5EBUA 2X7WA 3F5KA 3GHRA 4F2TA 2IXVA 1XCWA 4PEKA 4Q4OA 4AYGA 1GYNA 4E2VA 2VR2A 5CGTA 1OCJA 4CVUA 2Q02A 3V35A 1DIOA 3DFQA 4G56A 3TFCA 1GJPA 3NIYA 1ZGDA 3AIUA 1QCWA 1G0CA 3SUUA 4WY0F 4A8LA 2QJIA 1K4GA 2YDSA 1DWHM 2J8FA 4H9YA 4GKLA 4KRUA 4LH8A 2QXWA 4P7RA 1F5ZA 2ZRVA 4IISA 1EEPA 4XZBA 3H2CA 3N4AA 3QGAC 3M5XA 5IBXC 5EFDA 3WDPP 4JY8A 1PV8A 2CLFA 3VILA 1EA9C 1IV8A 4BI6A 3I4EA 4J3ZA 4KRZA 4MOZA 2X1UA 1ZU8A 3TQPA 2PE4A 1NFGA 1SVDA 4Q8MA 3I7SA 2QMKA 1XRSA 3FX4A 2ZA1A 4AMAA 3JUGA 1V0NA 1TKKA 3KVLA 1QMLA 4UWMA 4AZGA 3L65A 1L6WA 4J40A 3RCNA 1UUMA 2I14A 3EWBX 3W76A 1DYSA 3FV9A 4HZ8A 3IIOA 4ACYA 3LA4A 5K9CA 3CZEA 2HPIA 1RUSA 2OFJA 3C2EA 1UR9A 3PPCA 2J7HA 3S5YA 1LL4A 1GW1A 1TV8A 2FGLA 3QQ1A 1LWJA 1QHOA 3F7JA 2OU4A 3RCYA 3IVSA 3VINA 3AYTA 4RL3A 3M0MA 3SN0A 4B5TA 1WUEA 2GVLA 1R38A 4HK7A 2WZTA 3WEZA 4D6IA 1LQ0A 4GCAA 1C90A 3TYCA 1JYVA 2C14A 5EY5A 3BLEA 4RPQA 3WD1A 3QGVA 3TX9A 3LCWA 4NYUA 3OOQA 4C7FA 4J7RA 2C15A 3PG8A 2NZLA 3WQFA 2QLYA 4Y9NA 4BY3A 3CZGA 3NO1A 1XCXA 4WK9A 1UC4A 2TSYA 1XYLA 1S5WA 2BOFX 3W71A 4CD7A 1AJZA 3BAKA 4GJJA 1H41A 2CLLA 3UJSA 2DIKA 4U2YA 2PP3A 3F4WA 3RM4A 1QHPA 4D6GA 3W1PA 5G2HA 1W1YA 5JH1A 5LXEA 2OT1A 1DWIM 3OGRA 4JXCA 3V16A 4D8AA 1GPFA 1FKWA 4LBUA 5RUBA 1GEQA 3KFTA 2FIQA 3NL6A 3PNUA 3WD3A 3VOHA 2HROA 3UT0A 2IMRA 3V0UA 1ITUA 3NQFA 2P0OA 4QDWA 3MKCA 1GNXA 2HSAA 5FAJA 2RDWA 2DW6A 2Q09A 4OZOA 4ENLA 4ZQNA 1ITQA 5DF0A 4GYPC 1GKQA 1NM9A 4HA1A 5CZKA 1QJWA 1FWCC 4MLRA 4KFNA 4KRTA 1WXJA 3ZS4A 4AY1A 3VDBA 3TMLA 2ZDSA 6TAAA 1P4CA 4GA8A 5LGXA 1EC8A 1R87A 4M29A 3QLLA 4OBTA 1WZLA 1VBJA 4RW5A 3S83A 3GZ3A 1QPQA 2BB0A 2WNQA 4RXGA 1F73A 4HPHA 5FEZA 2C8NA 8TIMA 2A3EA 1OYAA 3H53A 4LUYA 2WVVB 2JFEX 4ACZA 1GOWA 4LBSA 2C0AA 1BQCA 4MFDA 4AIEA 3AMCA 4AD4A 4MKVA 4LYQA 1KBLA 3N4EA 3CJPA 5FEPA 3VIMA 2Z7KA 4IIHA 3W7HA 3KL3A 2ZZ1A 4UXDA 1WPCA 1SUXA 2YYUA 3BSGA 4LAUA 1UKSA 3F4NA 2WPBA 1KR1A 1T8QA 4HNUA 1JGMA 1E40A 1GPWA 1Z41A 3OEXA 2OZ3A 2PDGA 1PUDA 2OGYA 3CUIA 5BOOA 1HUVA 4A8RA 1JI2A 1W9UA 3PZTA 1OX5A 4NZ3A 4DJFC 1GWJA 3CBWA 1FWDC 1E5NA 3SADA 4MG4A 1ZBKA 4LSBA 4C1KA 2Y61A 1A0DA 3P0XA 4MNLA 3MV11 1C9WA 1G67A 3D6NA 4YTQA 3I6TA 1YQ2A 3T78A 1GOIA 3MBFA 3A4XA 4ZQRA 3QHMA 1XLMA 2V9DA 1XQKA 4HU8A 1SJAA 1HG3A 4RDWA 2BG5A 4QCFA 4REQB 3K46A 3NQAA 1QR7A 5FACA 3UZXA 1XLEA 3C2FA 4ZB5A 2DSWA 3AS3A 3TSMA 3VGDA 4ECLA 3TYUA 2PLJA 1HKIA 2VX6A 5D05A 4YXGA 3AS2A 1CLKA 3ISIX 2V5DA 2OLSA 2WANA 5CH9A 1QI5A 3PJXA 4V2XA 2A85A 4RV3A 1E1CB 3BMWA 1WKFA 3ATZA 3GH5A 2X2GA 5HK4A 2C1HA 2X1IA 2WMGA 1EWEA 3ABRA 1FDJA 1X8CA 2CHOA 3T4CA 4GHRA 1BSLA 4CU7A 3CU2A 4FXRA 3NYDA 4Q8UA 3USBA 3GDMA 2YBUA 1BF2A 4XQ6A 4H3DA 4LWWA 5H91A 3KUMA 1D3CA 1VAHA 3GG1A 3F03K 7PTDA 4NY2A 4G8TA 2O9RA 3UJ2A 2WB5A 2FVLA 4I9JA 3KTSA 4PCNA 2ZVIA 1M7JA 1X6NA 4AWTA 4ZO6A 3ECQA 2ZRUA 4AWEA 2ZZ6A 1WAUA 3DIPA 2UY3A 4NNAA 1UKOA 5H2ZA 1DXEA 3ZR6A 3GX9A 4C6KA 1TREA 4R9OA 4JTLA 4DX3A 2G8ZA 4ZQPA 4ERAA 4IX0A 4FXJA 4ML9A 1Q8JA 2ZZ3A 3ITYA 2VO5A 4ONVA 1XIDA 4YJ5A 4UTFA 4N9DA 3TFXA 5ABHA 4GYKA 5A94A 1DEDA 5I3DA 1PTDA 2NQLA 1TA3B 3EOOA 3L4XA 3LNPA 3QY6A 1GEHA 1A5SA 4WSKA 2G3FA 3WBYA 1Q7ZA 4YNGA 1S3HA 4C6FA 4GNKB 3SDOA 1R3TA 4IFKB 2CWXA 2NWSA 3ARWA 3W1MA 1FH8A 1XPGA 3JU2A 2CZEA 2VX4A 5CGMA 2BODX 4U5KA 2P3ZA 4AX6A 5CQ1A 3ZR5A 5HNUA 2BBFA 3PANA 2ZUSA 1WV2A 4NZJA 3VNYA 5L9FA 1KFKA 3NSXA 3EWCA 3THCA 3PG9A 2NWRA 3GU9A 3FVDA 3LD5A 5DCEA 3LCIA 4K8GA 2QCMA 1WOBA 5HULA 4BF7A 2DU2A 3GIPA 4LT9A 1POKA 3AWOA 1PYMA 1XDLA 2VUNA 3I10A 2QDEA 4Z2LA 3IIZA 3MHFA 3PHAA 1BEUA 1NFPA 4ZZ9A 3WIJA 4NXSA 4L9ZA 5CG0A 3ES7A 3VZZA 3KLLA 4U2ZA 3Q45A 2IQTA 4ATLA 1VLWA 4RDVA 4LEQA 1POJA 4H8VA 3K1GA 3NSMA 1PBGA 4MB4A 3B0UX 4MNKA 1FFQA 1LJYA 2VX5A 1F7BA 4KWOA 3CZLA 1QW8A 3NQ7A 2QV4A 4OFCA 3QV8A 4LU0A 5I77A 4JX4A 3VOFA 1OD0A 1PHWA 4C6OA 5A95A 4DN1A 1QRQA 4OV4A 2VX7A 1Q6EA 4GPNA 1EP2A 1MEIA 1KCXA 2E9BA 3SY5A 5L6UA 4I8YA 2PDPA 4A3QA 1B30A 3KL0A 2WC4A 3W7IA 1KWKA 4EACA 1CLVA 4JTQA 3W6LA 4PTDA 4GCXA 3VNIA 4D8ZA 3OO2A 2W62A 1UASA 1NF0A 3CMGA 1QUMA 3OGSA 4XIMA 1B1YA 2A4AA 3FJ6A 1D7FA 3NUKA 1TWZA 3F5LA 3XIMA 1E9LA 4QQUA 5I3KA 4UTKA 5CLTA 4ICNA 4X9SA 3TN4A 2GJXB 4O0ZA 1AMYA 5D38A 1ME9A 3AI0A 2EF9A 4XAYA 1GKPA 1QPRA 3K8LA 4K3ZA 4PFHA 1PZ1A 5LXXA 2VT0A 5TF0A 1VCGA 3S6OA 5LIWX 2HVNA 1CTNA 2ZUNA 4JNYA 4KETA 1MXGA 3WBXA 4LCQA 1X1ZA 3MVIA 4M19A 1U1UA 4I7UA 4UOQA 3L0KA 3WBWA 3KOFA 4GYFA 2X40A 4B4FA 5LNRA 4OUEA 1DHPA 3IACA 2Z25A 4JCMA 4R7WA 3WN6A 1W3TA 4L1WA 1V3HA 4CCCA 2QZRA 4AG0A 3N9RA 2OOGA 3PZGA 3WF0A 1XYBA 2ZTKA 3FEMA 4JTUA 4QE5A 3EKLA 2PP1A 3PB2A 1NFBA 2HE5A 3AISA 4M0XA 3E0WA 4EPDC 5I07A 1I2NA 4B5UA 2IKGA 4O4VA 3MP3A 3UPMA 3B4UA 2XIIA 2XZ7A 3LM3A 2NQ9A 1J96A 4AQLA 5EU9A 2ZX7A 5FJOA 2J66A 1XLFA 3PBMA 1H1ZA 4JQAA 3WK1A 4J2PA 5H8UA 5A6JA 1XD0A 3HGRA 2VDIA 1S5NA 1VCVA 4QAIA 1ONWA 1XH2A 5C7VA 1UOZA 3Q37A 4HHPA 3O9NA 1A4LA 1HIZA 4GJ1A 4M6PA 3WJWA 4OOUA 3C61A 2W5FA 3MHUA 4ZXOA 3WF1A 1O12A 2YIHA 4AC7C 1BKSA 1K9DA 2PC4A 2X1TA 3BLIA 3MA8A 2GUBA 1ITXA 1GHRA 2YR1A 1JF6A 3WCZA 1XYMA 2A6LA 1AQFA 2EPMX 1S38A 3QR1A 1OM0A 3C2YA 3BG9A 2J13A 1KWGA 3V0SA 5DBUA 4JL1A 3OVPA 1IQ8A 2ABAA 3M07A 3VYLA 2VFGA 2WVSA 3AFBA 1ZAJA 4P61A 2QGHA 3L5AA 2AL2A 4NHVA 4NZFA 4RDZA 2D2GA 4M82A 3ARUA 4QTGA 4ZCWA 3P82A 4GRSA 1XKYA 1TG7A 4JY9A 5HAOA 3IUHA 3L4UA 1GOQA 1JYWA 4GH3A 3N2BA 3TR2A 1ZCCA 4MM1A 1R3YA 2EAWA 2Y5SA 2F38A 3KE0A 4KGJA 1UYQA 4FOJA 2WMKA 3CEPA 2VGBA 2XSAA 3OVQA 3EXTA 3OBEA 1I75A 1LG2A 2O9TA 5DMYA 3QXBA 3IGHX 2PRMA 4FLOA 5I2UA 4QE1A 4QSHA 1C93A 1DIKA 2D1ZA 1A0CA 4B5NA 1KXHA 3W1RA 3NQ8A 4H1ZA 3P5YA 4U5IA 2WJZA 1TV7A 5A5WA 3KEHA 4WJXA 3HGJA 1NTHA 1YXDA 2TAAA 3F1QA 4W4QA 1OABA 3SGGA 1JPKA 1RJRA 3OTRA 3U5YA 5LA2A 1YIXA 4LF2A 4DYKA 2HQAA 1REQB 4MJ2A 2DT0A 1VBRA 2XJ7A 2FDMA 4YCOA 4N0RA 2TMDA 5DCBA 1FHVA 2X09A 4EIVA 4EOUA 2YZRA 3BPWA 1KBKA 1JFHA 1XRVA 1ZALA 3IAPA 1EUAA 1P6BA 1O5XA 2KAUC 1V79A 2WSKA 4GO9A 4W88A 4Q8QA 4WDXA 1KB3A 4M51A 4AVNA 1V7AA 1ZY9A 3FYOA 1RP8A 1XFCA 4PUDA 3MYOA 3C5QA 1E3XA 3SR7A 3MU7A 1Z42A 3UPWA 4QLJA 4F8XA 3WY1A 1H0IA 3BAXA 1AD4A 3LPGA 1X1NA 1AK5A 1VPQA 5LSMA 4HU3A 2AMGA 5F1UA 5H1WA 4S3AA 2WMJA 1Q85A 4O8RA 3VAVA 3WLQA 1OF6A 4AW7A 4QM1A 3W70A 4JYEA 5FF2A 3ZM8A 4CN6A 3RLHA 3ITXA 3KCLA 4AWSA 2BDQA 1GZ1A 2J88A 5CPOA 2BNJA 3TA9A 3UZWA 3WLTA 3O1NA 1B31A 1SMAA 5IFTA 3BOLA 4MSSA 2ZDRA 3E0VA 1XUZA 3MBDA 1E0WA 3W7EA 1W9PA 5CCZA 3GG8A 2Z1KA 1ADOA 1BAGA 3KBJA 1QDSA 1T7LA 1N55A 5FSEC 3OLEA 3UA3A 2GUYA 3FGCB 3LU2A 4J3SA 2E6DA 3HG3A 5FCZA 3BH4A 4P7NA 2DZPA 1EGVA 2XISA 4U3AA 4NAEB 1DJWA 2PFHA 1KRAC 3RU6A 3AUJA 3FFSA 4KKXA 3I7QA 1FH7A 3GY1A 3LGDA 5REQA 4PB3A 4LNCA 1ZJIA 3N11A 3VIOA 4M80A 1Q6DA 2P1FA 3RNDA 1OX4A 5IXEA 4C7GA 5PTDA 2Q8ZA 3RK8A 2AAMA 4GKTA 3S5SA 1F6YA 5DO8A 1VIWA 3B3DA 5BXSA 1QATA 1XFBA 2UY4A 4IIBA 1ZL1A 5F4WA 4PUEA 4HOWA 5BWAA 2DW7A 1C3FA 2DIJA 3HGOA 3UR2A 4WOZA 3NL5A 5H6HA 4A2RA 1H2JA 3TQKA 4BEUA 5DBTA 5TD4A 3IIVA 4CQDA 1MYRA 3EXSA 4YHEA 9RUBA 2WKJA 3HG2A 3DGBA 3H7VA 4UTUA 4HYRA 3B97A 4XSMA 2ZFAA 3MMDA 4F9JA 1XJBA 1H7NA 3OZOA 4C6EA 2B31A 3W82A 3GLCA 4V33A 1KKRA 3LV6A 3A22A 5JBEA 2OKTA 1H11A 1PWLA 2GVYA 1FHDA 1YTKA 4WY0A 3TCEA 3ITCA 5F2LA 3UYCA 5CZTA 1LRTA 4JYFA 2CERA 3NVTA 3ANUA 2I17A 1W1PA 3T1GA 3G8RA 3DI0A 5F4SA 3W7GA 1US2A 4DWSC 3MW7A 1XPYA 5HWNA 1HX0A 3TYEA 3NG3A 3RX2A 4YTTA 2C71A 1BLIA 2P3EA 1TJRA 3CWOX 4OBSA 4M6VA 3BGJA 4B3ZA 2VKZG 4RLIA 2E1WA 5K4XA 1FWHC 4FLSA 4PMXA 3NGFA 1W5MA 3OZYA 3ZO9A 1UH3A 1G4SA 3FAXA 4EXAA 5A6MA 1VPYA 4Z2IA 3R8HA 4IIGA 1Q63A 4AHOA 2D23A 3V5FA 2PGRA 3WFAA 3WJSA 1ZJHA 4AEEA 3BV4A 5I06A 3MSGA 4YMZA 3T0AA 1P1XA 2QMJA 3M43A 1G7VA 3KRBA 3NL3A 1K8ZA 4FNQA 3S8HA 5JBDA 2E8ZA 3LBMA 1OGBA 4O8AA 1R3SA 2BSLA 4QFUA 3GW3A 2YSWA 1BRLA 1QOQA 1FWBC 4LB4A 1KNWA