3LEPA

Human aldose reductase mutant t113c in complex with idd388
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPCGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 313
sequence length 313
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lepA00
2BGSA 1Q13A 3UWEA 2BP1A 3GHRA 3H7RA 1ZSXA 4JTRA 1Z9AA 3H4GA 4I5XA 3Q65A 3GUGA 1LWIA 1R38A 1XF0A 1YNPA 2DUXA 4PUUA 3ONBA 3DN5A 4ZFCA 4PUWA 1VP5A 3ERPA 4IJCA 2A79A 3BCJA 4JIIX 2WZMA 4F40A 4ICCX 3CV6A 2HEJA 2PDCA 4XZNX 2FZDA 4OTKA 1US0A 3LQGA 3M64A 3UG8A 3R58A 2IKGA 4FALA 1UR3M 1VBJA 2FZ9A 2I16A 4IJRA 3LN3A 4WGHA 3UZZA 4JQ1A 1K8CA 4GACA 2C91A 2F2KA 5LIWX 1Z89A 4XVEA 4GA8A 2IKJA 3RX2A 2DV0A 1Q5MA 2PF8A 4DBWA 4JTQA 1XGDA 5LIKX 3V35A 1PZ0A 3UFYA 4GABA 3DOPA 4NKCA 3EB4A 3LZ3A 2F38A 3LNMA 2IPGA 2ACQA 2PDUA 2PD9A 2I17A 3WBXA 3LUTA 4WDUA 2PDBA 2NVDA 3U2CA 5C7HA 1MRQA 2IQDA 2FVLA 1JEZA 1FRBA 4ASTA 4HMNA 1T41A 3WCZA 4DBUA 2R9RA 1RALA 3CASA 3UP8A 2VDGA 1AFSA 5M2FX 4Q7BA 5HNTA 4QR6A 1J96A 5LIYX 3UYIA 1PZ1A 2PDKA 2IPJA 4YS1A 5AZ1A 1HW6A 2PZNA 4GQGA 1Z3NA 2PDLA 2R24A 4YVVA 2PEVA 4JQ2A 2PDNA 3V36A 4JQ4A 2ISFA 2J8TA 1AH0A 1Z8AA 2HV5A 1A80A 3WBYA 4EXBA 2P5NA 4QX4A 4Q3MA 3D3FA 2HVOA 1HQTA 3Q67A 1YE4A 4QBXA 4DBSA 2NVCA 2IPWA 4GQ0A 3R94A 3T42A 3EAUA 2WZTA 2PDJA 3P2VA 1EXBA 4XZHA 1AZ2A 3UZXA 1AH4A 2HDJA 3CV7A 3R8HA 4LAUA 1X96A 5JH1A 3UZWA 4PRRA 3CAVA 3O0KA 1ZQ5A 3NTYA 4LB4A 4JTCA 4YVPA 1T40A 4JIHA 1ZGDA 2PDQA 1C9WA 1SM9A 4FAMA 2IKHA 1X97A 4L1WA 4XZMX 3ONCA 3CAQA 4PRTA 4XVDA 3R6IA 4H8NA 3KRBA 1QWKA 2AGTA 1QRQA 3CMFA 2PFHA 3R8GA 2HVNA 5HNUA 4G5DA 1RY8A 2PDYA 1ADSA 3RX4A 1S2CA 5AZ0A 1IEIA 3R7MA 2FZBA 3O3RA 3V0UA 3C3UA 4EXAA 1MZRA 1LQAA 1S1PA 1PWMA 1AZ1A 1AH3A 3R43A 1S2AA 2INZA 3N2TA 4GIEA 1YE6A 3LENA 4MHBA 4YU1A 2FGBA 4PR4A 3B3DA 3RX3A 2HE5A 4WEVX 1OG6A 4RPQA 3LQLA 4L1XA 5DANA 3BURA 3WBWA 4HBKA 2IS7A 2QXWA 4LB3A 1ZUAX 4FZIA 4WRHA 2PDWA 3H7UA 3LD5A 4JTDA 4GCAA 1PYFA 4PMJA 2DUZA 4WDTA 3LEPA 2PDIA 4WDXA 4AUBA 2PDHA 4XZLX 5LIUX 3EB3A 3MC5A 2IQ0A 4JTAA 3M4HA 4XO6A 3MB9A 1S1RA 3S3GA 3G1RA 3F7JA 1GVEA 3M0IA 2FZ8A 1IHIA 4JQAA 3G5EA 1MI3A 2ACUA 2PDMA 2IKIA 2HE8A 2PDXA 3UZYA 4YVXA 2IPFA 4LBRA 4FA3A 1PWLA 3WG6A 4IGSA 3N6QA 2PDFA 2INEA 1EF3A 4H7CA 4XO7A 3UGRA 2PDGA 1YNQA 4QXIA 1EKOA 4LBSA 4XAPA 2ACRA 4WDWA 3FX4A 4R9OA 3BV7A 3BUVA 5HA7A 3QKZA 3GHUA 2ACSA 1XJBA 4XK2A 3VXGA 2PDPA 5LIXX 3V0SA 5JH2A 3LZ5A 2ALRA 2PD5A 4DZ5A 4XZIA 2CLPA 2BGQA 3GHTA 5KETA 3FJNA 4JQ3A 1X98A 1RY0A 4JIRA 3COTA 4LAZA 3GHSA 3LBOA 3V0TA 1M9HA 1EL3A
chains in the Genus database with same CATH superfamily
1MXGA 2XGIA 3LG3A 4JDYA 1JAEA 3STEA 1HKMA 1G69A 4LEFA 2XGZA 5DCDA 5ABEA 2CLKA 1WUEA 1XGZA 4DYEA 5CPSA 1YDOA 2BVWA 2BX7A 3QMRA 2FHBA 2W63A 4AF0A 3SY5A 3SCUA 3HG3A 4MG4A 3PZ9A 2C19A 2GUBA 1VLIA 5A94A 4ZFCA 3CU2A 4LV4A 5FA5A 3KVJA 4GYPA 4MMWA 3ITTA 3ZYZA 4DEFA 3LHUA 3OIHA 4NYYA 1L6YA 3T08A 1RP9A 1E1CB 4DZIA 1Z69A 1TIWA 1E4IA 4LY4A 1ADDA 1Q7QA 3M64A 4WJXA 3R0UA 3R58A 1TJ1A 1UR3M 1DJWA 4DBEA 1TV2A 1OYCA 4OGZA 1FWHC 4MDPA 3S42A 3H2CA 3IJ9A 1EYWA 2F2KA 2J88A 4FK9A 2YW4A 3E74A 4JYEA 3KRZA 4PULA 1ISWA 2VEMA 4QFUA 2G4FA 2WJDA 1B5TA 1TRDA 2WCGA 2WHMA 4C6OA 3L4YA 1XIDA 4EVZA 3H4XA 4CVWA 1WB0A 5I02A 1E4MM 2OODA 2Y7EA 3NO3A 1GOQA 1TR1A 3WLPA 4P5UA 4HHHA 4S3AA 4PB3A 3K4DA 3WBXA 3GG0A 3D6NA 3QTPA 2DIEA 1G01A 1HKVA 1W5PA 2Y4SA 5E1QA 5EMYA 3IIPA 1QUMA 2NVDA 1I1XA 3BOLA 3PTDA 4KIEA 1OC5A 4QHRA 3SRKA 3TW7A 3UNTA 4HMNA 4JR5A 1QFEA 3EWYA 4BQ2A 4J28A 4CCZA 4AD1A 2D0GA 1AFSA 3ZJ8A 2TMDA 3VOHA 3MBDA 1BKHA 1JUKA 3I4EA 3KXQA 3LI0A 5A8QA 4EANA 2J27A 5AZ1A 3KWSA 3QVQA 4B9YA 3C0LA 4BFAA 1J0JA 4FX8A 5JIPA 4DZHA 4JIQA 1H49A 3RFAA 3W26A 5A6AA 1XYMA 3IRSA 5JQ9A 3KX6A 1W56A 4MZ8A 2J8TA 3B9OA 1E0XA 3W1LA 1KCXA 3U0HA 2Q6ZA 1E1FA 3TSBA 2NXIA 1XSIA 3SGUA 1O12A 3OB8A 2WWDA 3FHAA 4B5VA 2WC4A 1R87A 1QI0A 4KWWA 3NZQA 4TTGA 1JCTA 1PV8A 3P2VA 3G1FA 7XIMA 5EMMA 3E0IA 3C2YA 4XAFA 3GNDA 1UC5A 1EP2A 1MRAA 3GFXA 3HGSA 3INPA 1C8QA 4U4MA 3NZRA 5HK4A 4ENLA 3NWRA 2YCLB 1OX6A 2G50A 1YX1A 5FEWA 4FO4A 3UA3A 5GNYA 2Z0IA 2WJZA 3NTYA 4IMFA 2DT2A 3NO5A 3TAOA 2F9RA 2EXOA 3LNPA 1ZGDA 5A8GA 1SM9A 3FAXA 1D3HA 4AZIA 3SURA 1EB3A 2X8RA 1Q2RA 4JHZA 4EE9A 1QRQA 1H7XA 3CMFA 3FHQA 2PFHA 4XSMA 3R8GA 5B7YA 1YEYA 4H6RA 5G1MA 4TX6A 5BZAA 3PFRA 3MQTA 1XWYA 2HBXA 5DT5A 4LVFA 3VCRA 1G94A 4E4UA 4UFMA 1V3KA 3BV4A 4A22A 1KBJA 1EYEA 2W92A 5IBXC 4QG6A 2OQHA 2ZXQA 5AB3A 3RM4A 3AS1A 4LSBA 3R2GA 4JTUA 4YU1A 1EJRC 4I7UA 3LPOA 1RUSA 5H2ZA 3VD3A 4IIFA 3VC6A 3EBVA 4YTTA 1J8VA 4I6KA 5FF3A 3ZO9A 1UWTA 1A49A 1V6TA 4IPLA 1ZB5A 1KKRA 1EGVA 1I0DA 1HNYA 1DJXA 4NXKA 3R0DA 1MZHA 4FR6A 2D0FA 2Q01A 4G8TA 4MJ2A 7ENLA 3RG6A 1ZP4A 1G6CA 2Y62A 4RE2A 1PZ2A 4H6KA 4W4QA 1XGEA 1YDNA 1JZ5A 4JHMA 4GHRA 3EDFA 4KFNA 3DBPA 4E3TA 4P2VA 2AOSA 3TU9A 2WW5A 3PUGA 1NDYA 4GIYA 1TFVA 3TXZA 5F4SA 1FWNA 1QNPA 4PMYA 4DZAA 1OABA 4LF1A 2FZ8A 9XIAA 2VZUA 4BQ3A 4Z0SA 2CZVA 2PLKA 2H3DA 1DQWA 4FEZA 4PMZA 2VM8A 2HE8A 2PDXA 2E1DA 1AQMA 4AZGA 1TVPA 1KXHA 3QV7A 1RPXA 1FH9A 4UQDA 2J79A 5ABFB 3H2AA 4LJ3A 2H9AB 2E25A 1KRMA 4S3EA 2QNEA 4W8LA 4RUBA 5D2YA 1F8MA 1XIFA 3FA5A 4QEHA 4IGSA 2PDFA 3M0JA 3QPZA 2PDGA 3A4WA 4IH3A 4DVOA 2JQXA 4RE3A 4ZO6A 4L6DA 1FKWA 1DJYA 4WDWA 3WL1A 1NDZA 1UP3A 1VJSA 4LT9A 4I8YA 2P3EA 2J9YA 3T40A 3PC0A 3NIYA 3BAXA 3QY6A 1TUFA 3BWWA 3LPFA 1OT1A 4OFCA 3PZNA 4ZOEA 4M7TA 3LZ5A 1RQBA 3VZZA 2HPIA 4DZ5A 3A4XA 8XIAA 3STFA 5JU6A 3GVQA 4HK6A 3VFLA 3NPVA 5D4YA 3W7PA 2JKAA 3W83A 2NWSA 1PTGA 1ITQA 5HWJA 3RRXA 3NVTA 4FIRA 3SN0A 3QZEA 1TMHA 1QK2A 1IZJA 3NQFA 4O1CA 3QZAA 2C1HA 4J35A 1EJVC 3W76A 3T2OA 3CH0A 3G6MA 4KFOA 1IXPA 1KFJA 1QAPA 1EJ7L 4QJ5B 1QCWA 3CIXA 1XDLA 5A6BA 5EKYA 4KF1A 1S38A 1OEPA 3CBWA 4F40A 2BFGA 5I5RA 1L2QA 1U5VA 3NQBA 3VC5A 4XAZA 3HZ3A 3TLLA 2YYUA 3GXPA 2GZXA 1EC7A 2W6RA 1A5KC 3PN8A 1X6LA 1UOZA 1D7KA 3ARXA 2QJJA 1RK6A 4HP5A 3QYQA 2C91A 5I3FA 5L9FA 3GNXA 1K7FA 2DH3A 3L4ZA 3VM7A 3SI9A 2A4AA 1R5YA 3PUOA 3WJXA 3MP5A 3WLOA 1S39A 3H70A 4QNWA 1PZ0A 2OXNA 4ES4A 1O94A 4FF7A 3EB4A 3HQOA 3PSVA 1EGZA 4S1FA 5MHBA 5FSEC 3AMGA 4GLEA 4IICA 3T7VA 2WBGA 3BG9A 2PDUA 1W1YA 2YLLA 3PFMA 1PKYA 1TPDA 3TA6A 5CG0A 3XINA 5FESA 3WMBA 4E4PA 1MW0A 5H8MA 2IQDA 1JEZA 3T9PA 3JVAA 3IUIA 4FOKA 3WNOA 3LM7A 4GH3A 3P82A 1E55A 4DBUA 2R9RA 1E3XA 3ME3A 3CHEA 1T5AA 1FWGC 1TWSA 2E8YA 1S5TA 1FWDC 2YBTA 2J4GA 1KWGA 1LBMA 3W88A 2CYGA 1RJPA 9RUBA 3W6YA 1A5LC 1NM9A 2FPVA 1T0OA 4JEQA 1Y8BA 2OZ3A 4UOQA 2EPKX 3DECA 3BE7A 4C6NA 1JGIA 1M03A 1GNXA 1PJ9A 1LL7A 1A80A 2HV5A 3MVIA 2BB0A 3A9IA 4PB5A 4HMEA 4D6EA 1TVLA 2VQUA 4E2VA 3MJYA 2QYGA 2FZNA 1YE4A 4IQEA 2PRMA 3HTWA 4DAIA 3DEQA 5FAJA 1HVXA 4L4LA 5LHFA 4YHGA 5DCBA 1A5BA 3WJWA 4GINA 1LF1A 2QJNA 1LG2A 3D0CA 5GPRA 3KBWA 1AJ2A 4H8VA 4DAFA 4DWSC 9CGTA 1R47A 3LSBA 1I2QA 3W2JA 4Y9AA 1WOBA 1LZOA 1GQJA 3MO7A 3QXBA 4UFHA 3B97A 2X7WA 4PMVA 1W5OA 3QKEA 2PSNA 2CLOA 2RGMA 3NOEA 3W7EA 3UJ2A 4PRTA 3AMDA 1AQHA 1C9DA 4U5KA 1HO1A 1OB0A 2HVNA 5HNUA 3EGJA 3EXSA 4V27A 4X3ZA 4A6GA 2OR2A 3R7MA 2V5LA 3K1DA 4CQAA 3EDDA 2QR6A 2QUMA 4WX2A 2GSJA 4M80A 4E4FA 1KRCC 4ILSA 3POHA 1JCJA 3MDUA 1EDTA 1U5JA 4PUJA 2XIBA 4DO7A 4HA4A 2V38A 3LYEA 1I6NA 3PTQA 1S1PA 4KWVA 2PP1A 2XN0A 2YPIA 1HZYA 1MEWA 3WLQA 1LTDA 4KGJA 2E9MA 1KM1A 5A6SA 3PAJA 2OJPA 2OLAA 3RITA 5FIPA 1W1TA 2BHYA 5A5WA 4FHAA 1Y7VA 4NSBA 2GJNA 2QULA 5KINA 2X09A 1F4AA 1H7NA 4HTBA 3ES7A 1KFKA 3WZ0E 1VRXA 3CNYA 4AZ6A 4FZIA 2QCHA 1EP3A 4NZ5A 3R8RA 3AS0A 4WDTA 1KFLA 1XPYA 3A5FA 1K7XA 3MC5A 3VA8A 4E8GA 1FWEC 4JGDA 1ECEA 1LT8A 3FFSA 4LWWA 3F2BA 2HK0A 4DWSB 4NL1A 1CDGA 1JZ6A 5DCEA 1N55A 4JX4A 4GX9A 3W3OA 1CBGA 1DIEA 3G5EA 3G3MA 2QEZA 3LA4A 2Z26A 2BVDA 4IF2A 3WYZA 1CYGA 3VGFA 3IGXA 3EKLA 4NUWA 4GQRA 4Q33A 4FX6M 3L5MA 4XD5A 4JFUA 1QPQA 3BJSA 1QI4A 4PBGA 4UTJA 2CWNA 5I3GA 4B5UA 4EPEC 3W74A 2VMFA 4LAMA 4K36A 1OHLA 1EKOA 4F2TA 5IRPA 3P84A 3KTSA 3W82A 2ZA2A 4ZODA 1PX4A 1H11A 4EIVA 4O52A 3G3DA 2C15A 3QKZA 1RP8A 3N11A 3NPXA 2ZZ5A 5D38A 2P10A 3MKCA 1B3VA 2OLHA 1PDYA 3PZOA 2QCNA 3PVFA 3APYA 3PUEA 5M1TA 1C7SA 3NXFA 2GJPA 4PSPA 4RCXA 4IQLA 5XINA 3M41A 1VIZA 1IXQA 4XZIA 2WSYA 4KEZA 3VDCA 5D2WA 3T09A 3URQA 4ATLA 3AYVA 3FVMA 1I75A 1UIPA 3RU8X 2QCMA 1FCQA 1D3CA 2PS2A 4B91A 2DVUA 2CPUA 2XH4A 1LL6A 1U83A 4MWAE 3CQHA 4M81A 1HTIA 3UWEA 1CXLA 3KP0A 5CAKA 3PBVA 1W0MA 3KOFA 1UWUA 3TC3A 1RLDA 3EPMA 3WQ8A 1V6UA 2D22A 4ZA0A 4QG9A 1S5MA 4NIRA 4UFKA 1KM2A 1XP3A 3VIHA 1CPUA 3TVAA 1YNPA 4K7VA 1HO4A 3B9NA 2Z1KA 4WOZA 1NF7A 4QRNA 4JKLA 4MNLA 3NXLA 3DI0A 2WNQA 2ZRVA 3NZGA 4BA0A 4PL1A 4AIBA 3WLSA 3ARZA 4O57A 4B4FA 5CC3A 2FZDA 2C16A 2NZLA 1FWIC 3LQGA 1QHOA 1WXJA 2ZA3A 3MA8A 3HN3A 4JNZA 1B54A 5CJNA 3VCNA 1SZEA 1JQXA 3E1F1 3LN3A 4ORIA 1U1UA 1I0BA 4BWLC 4ZQPA 2R6OA 3MCMA 1EF2A 3KL5A 4ADUA 4HN4A 5LIWX 4PEKA 2ZUMA 2NLIA 3FSTA 3M0MA 3NDZA 4AEEA 2GOKA 1L2UA 2J8GA 3QHMA 2PF8A 4DBWA 1KD0A 1XLAA 3BG3A 3L68A 4K39A 3DOPA 3GFYA 1QNRA 3LLFA 2DZWA 4N4PA 2CBVA 3DYMA 3T44A 3PG8A 1H62A 1WV2A 4GX8A 2J8FA 1D9EA 2PD9A 1KB3A 1NOUA 4J27A 5TBOA 4WDUA 4J3ZA 1T99A 4QNEA 1A0EA 1E6SM 3VD7A 3PK7A 3RK8A 2V69A 3CS2A 4CQCA 5CPTA 2E8ZA 3CC1A 1O5XA 5IXEA 2A2IA 1NAL1 4HJWA 3Q37A 5C9ZA 4IPIA 2OT0A 2QT3A 4U33A 1L6GA 1ONEA 3C8NA 3SQLA 3M16A 2P76A 4KEMA 1XSKA 3K5XA 3NQEA 2Z2UA 2QPXA 1SW7A 5FI8A 4GY0A 4Y9PA 1ECQA 3EWUA 1RPKA 4REQB 3APGA 3T0CA 2PDLA 2RDTA 5EY5A 3SGZA 5K4XA 3UCCA 2TYSA 1E6QM 1J0HA 4M0XA 3PPCA 3TW9A 5HMFA 5H8PA 2VC5A 4KETA 3U57A 3QSTA 4BY3A 6A3HA 1E4NA 4A4AA 4O54A 3LV5A 4GYJA 2O55A 1JXJA 4LCQA 5HNRA 4GQBA 2PPGA 1VH7A 3NEVA 2Y2WA 3LLDA 3FXYA 1E71M 3IVTA 2AGKA 3SECA 3WLKX 3OA3A 1UC4A 3W7NA 2OYLA 1ONWA 2FMNA 2OU4A 3LGDA 3MWAA 4C1KA 3UXIA 1AH4A 3BTNA 1QHPA 1HKJA 3R8HA 1W17A 1VJZA 3NM3A 5I03A 4Z1AA 1JZ4A 4JS3A 1H5YA 3TMQA 4PFMA 1YADA 2G97A 2ZWZA 3N3TA 4PCTA 2PU1A 3UESA 1DXEA 1TYGA 4UTHA 3WENA 3GDMA 2ZZ7A 3THAA 4GI4A 4W87A 2PA6A 3D47A 2Z7KA 1SZRA 4I9JA 2UY4A 4YXGA 1QWKA 2ZXBA 3BSMA 5CPLA 4Z2IA 1XC6A 4HA1A 2O9OA 1RY8A 1TJPA 2G41A 4E8CA 3VDBA 2OPJA 5E09A 2A21A 3LCLA 3PZVA 1HGWA 1E9LA 2PODA 3EB2A 4ZB5A 1M68A 3OBKA 3DX5A 5G4EA 1Q7MA 1KV8A 1W1PA 4J3XA 1JDEA 3IJ6A 3N18A 3QM3A 4JY9A 4GMEA 3RX3A 1Z7AA 1X8FA 2WVVA 2XVKA 5I24A 2O92A 1CWYA 1O7AA 2OMAA 3RNDA 1WKYA 3WBWA 3CJPA 3E12A 4US5A 4N9DA 2GFTA 3VD9A 3P6LA 4ZVJA 1OT2A 3P61A 5DFAA 1XISA 3WF4A 1V3LA 1E9ZB 3DZ1A 4RXFA 4ZQRA 4DUOA 3NL2A 2NV2A 3M0ZA 3VNMA 1SFTA 4JY8A 3UJFA 4JD4A 4R33A 3TJLA 1WDPA 1J9YA 4CD5A 4LUTB 1E4LA 1QVBA 4R7JA 3IPWA 1IEVA 4CCCA 1GZJA 5DY3A 3E38A 3PJUA 1K8ZA 3GKAA 1JF5A 1MYRA 4DXVA 3L4WA 4W84A 2GJLA 1A5UA 2QF7A 1A50A 3VGEA 1VYSX 2ZTJA 1AL8A 1TTQA 3UZYA 1UPPA 2YXXA 4RPPA 1JYWA 4X2PA 1JDCA 3WG6A 4XBSA 2ISDA 1HP5A 4W8AA 4M19A 4XO7A 4JN6A 1TTJA 3S9IA 6REQB 1JDFA 1Q6QA 3EDJA 5CBBA 1X6NA 3EEGA 1V93A 2VFDA 1TB3A 3D3AA 1F6KA 1JPDX 5T9BG 1V02A 2ZZ4A 1BXBA 3LM3A 1IEXA 4O1FA 3GXMA 2XZ7A 1O1HA 1R86A 3BAKA 3GTFA 1KXTA 3AS2A 3QYSA 1BVZA 1DWGM 3FAWA 2P0IA 2J75A 4UC5A 1Z42A 1F5ZA 2A7NA 4UTFA 3UWWA 4DM2A 5DO8A 3CZLA 4GYPC 3COTA 1X7FA 4RKAA 3MSDA 1X39A 1XUUA 2OSYA 4FP1A 4BCEA 4K8GA 1JPMA 1S3TC 2BVTA 3L4UA 4MSSA 4LOCA 5DMYA 4L64A 1XIIA 3UXLA 3Q94A 2EG7A 1RK5A 3O16A 1QHZA 4HSOA 2OO0A 2H3BA 4IP4A 1TWZA 3H4GA 3BAYA 3FGCA 2E28A 4IWWA 3L23A 4D72A 3LHTA 3KBSA 2PTWA 3M44A 3S8HA 3NR0A 1TUXA 2ZC1A 3FN9A 4N6EA 2XTKA 2FDSA 3OG3A 4K6AA 1SO6A 3BLOA 4PTVA 4TMBA 1GONA 3IV8A 4TQTA 3UG8A 1KM4A 2EKGA 4FALA 4AEFA 4F4RA 4HYRA 1YNYA 2W66A 4H2HA 2IUZA 2X05A 4I7WA 3FIGA 3E0FA 4Z2LA 3AS3A 3F1QA 1QI2A 3C6CA 4PCPA 1M7XA 2J6VA 4R88A 4J2MA 1VBGA 2V3DA 3TJIA 3RX2A 3S2JA 4IPNB 3EA2A 2CNCA 4AF0B 3URNA 3MYOA 3THUA 4YYFA 3PPGA 3S5SA 2QUVA 1DWHM 1XYCA 1SUXA 2F61A 2OGJA 3W7HA 5FJRA 3OGVA 4B3LA 4IL2A 3VUPA 3VINA 3PPFA 4F48A 1KW1A 1W2PA 4KFPA 3U2CA 4S3FA 1LOSA 1XCFA 4AXKA 4ASTA 5A3HA 1UIOA 2WMFA 4CD4A 3WKZA 2X30A 2QUNA 1FY6A 3S5NA 5HDRA 4DNHA 1GJPA 3N2XA 5TIMA 4AZ5A 3SO7A 2CETA 2BHUA 1VR6A 3DFQA 4GISA 4NVTA 4EOUA 3LLXA 2IPJA 4YS1A 1UJPA 5HBFA 4E2BA 4DIAA 3MYPA 1MXSA 3NQ6A 4J3WA 4OOUA 1W32A 2E6YA 4S2BA 3LK6A 1MUCA 2Y63A 4GY7A 4RW3A 3V36A 3SUVA 3W72A 4MTVA 1OGGA 1ZJHA 1V5XA 4J1OA 4JKMA 3G1VA 1QBAA 5C0QA 2P5NA 1KLZA 1LWJA 2E5BA 3N6HA 4O1AA 2CHNA 4UCFA 4GQQA 3M47A 5I23A 1DTUA 1AUSL 1GVOA 4A8IA 3I7RA 3N25A 3AZSA 4B2DA 3G1SA 5EL1A 1CGXA 1ZNNA 3UZXA 1O5KA 5FEPA 4Y90A 3TTOA 2HDJA 4IGMA 3USBA 3AXXA 4GWEA 2GJXA 3AIBA 4D6DA 3EOLA 3WLIA 3G8EA 3I7SA 3H53A 3AUJA 4DUXA 3F5JA 1R3VA 2DEPA 3LMYA 1KA9F 1T40A 2J24A 4QCEA 4Q8VA 4LGXA 2G8ZA 3MUAA 3WUFA 1SO4A 1MW3A 1JI2A 3TROA 2W9MA 1PO9A 3RGTA 3L2LA 2WLYA 1Q6EA 3UG3A 3RPMA 3EA1A 2DSWA 4DJDD 3U2EA 3WK3A 3ZT6A 1AD4A 2OEKA 3W7DA 4DJED 4ACYA 2GUYA 3IUDA 1R9ZA 1AZ1A 3WEOA 2YXGA 4FLOA 4DBDA 5I00A 2X1SA 4Q6JA 3S83A 1H1NA 3DFPA 2DJXA 1E6XM 3W6LA 3EWBX 4IX0A 1W1ZA 3GH5A 4P8WA 3RILA 3GDTA 2D2GA 1OC7A 2OZ8A 1H1YA 2VCBA 1VEOA 3IACA 4NZJA 1ZUAX 3E02A 3WLRA 4WRHA 4GRSA 3RCYA 3QPEA 2JFEX 5XIMA 1JR1A 4OJYA 1OD0A 2G5WA 4PMJA 2DUZA 3WMSA 4GGHA 3TUUA 1HVQA 1YXDA 1C7TA 5LIUX 4QE4A 3GBDA 4GNKB 4K37A 1B90A 3CIWA 2NQJA 2FTPA 5F2MA 5AN7A 3QGKC 4F8XA 4MIMA 1I60A 1LORA 2WO5A 4KWOA 1ZZMA 1RVKA 2V5JA 1O5QA 4PSRA 1KWKA 3HQPA 1O68A 1WE5A 5H8UA 4C6JA 2HZGA 4HYVA 3E96A 1I2OA 4QQUA 2HNEA 3USZA 3URBA 4LBRA 3AU2A 3CWHA 1GYLA 4FNTA 1OFDA 3N6QA 4H7CA 4I9AA 1OFOA 3ZQ9A 3WLHA 4D6FA 2A7RA 3A23A 4QAWA 3SM0A 4IGHA 1EC8A 3FKKA 1A5OC 3RO8A 5DXYA 3CV2A 1AMYA 5HMEA 4QP0A 3VKDA 4YJ5A 1PB0A 1X7IA 3B8WA 4HZMA 3EMZA 3AHZA 3K4WA 2C7FA 1PUDA 4LUSA 4GXMA 1EQCA 1D3GA 2OQYA 4W5ZA 5LIXX 3H2OA 2DFAA 3TZNA 1XD0A 3RF9A 2QIIA 3REQA 1XDJA 3T2QA 1L6SA 3ZOAA 3FJNA 3ZLHA 4JQ3A 2OELA 4N9EA 5A2CA 1W9XA 4Q8OA 1TPWA 2PRHA 2VC9A 4O1EA 1TV7A 2VKZG 5E5CA 1EC9A 4WQ6A 4CNUA 1RCXB 4DM1A 4I90A 1KR0A 4UTWA 4HU4A 4MY1A 1CENA 3N15A 3H7RA 4MADA 3U9IA 3AIWA 4P8XA 3GYEA 2DUXA 1UKOA 1WA3A 2PURA 4GK8A 3LBCA 2F6XA 2VNCA 3HG5A 3VMNA 1V3JA 1E6PA 1V7AA 1CNVA 1XRFA 4D6HA 1JZ2A 2JGYA 4WXZA 3RCNA 4IXXA 1Y5XA 5C2GA 2A3HA 4XQ6A 3NUKA 4HVXA 3UVIA 1DP0A 2BTMA 3E2RA 3CUZA 3GUWA 1KTCA 1YXCA 1EQPA 1ME7A 1J10A 2FPYA 3CZJA 1QK0A 1S2WA 4GYFA 1EDGA 4ZZ9A 5CSRA 4OBSA 3P5ZA 4LYQA 5HUPA 2V30A 3BMVA 4E0CA 1GTHA 4LX4A 5CEWA 1TVNA 1PIIA 4A3UA 1T8XA 4XVEA 2JALA 3BO9A 3A3WA 4Y9OA 3DDMA 3RHGA 1MMFA 3V18A 3ZJKA 2GGEA 3WUBA 3AALA 4J3SA 2PU0A 4GE8A 2XJ7A 4RZBA 8XIMA 1GT8A 1JXKA 2I17A 3IIZA 2UY3A 3LERA 5D04C 1VJIA 4UQ9A 1G1YA 1JGMA 4DO4A 1E9YB 3FK4A 4UFIA 3B8VA 3TJXA 1OIMA 2NQLA 4KMQA 3SN4A 2GUUA 3TOPA 1IE7C 4TVCA 1NWSA 5E9XA 1GVYA 4A8LA 3EXTA 4IMDA 4XWUA 2QCDA 1KXQA 1TPUA 1GOOA 1VBHA 3TSMA 3A47A 4MFDA 3OZYA 4FMVA 1YW1A 1GPWA 3WX7A 4AX6A 1G0CA 4F0SA 2E77A 1JD7A 4O50A 2YJQA 3VKJA 4C1NA 5LGXA 3GFZA 1XH1A 2FZMA 4NZCA 3MTWA 1EX5A 3PBYA 4JNMA 3WBYA 1DWFM 4EXBA 4FNPA 4NJJA 5D8WA 1E6ZA 5C2XA 3KW3A 1T6MA 3ITVA 3B8IA 1R6WA 4ZEPA 3E0WA 2CEQA 2WZTA 1AQFA 2R1PA 2ANUA 4V1YA 3ATZA 2OX4A 1BPLB 1W5NA 2WMJA 4RDWA 2QGHA 4PTNA 3TCSA 3AIRA 3IANA 1MUMA 4NZ1A 4PRRA 3GDRA 1NH6A 1A5NC 3KBJA 2YA1A 1H2JA 3QJAA 2OSXA 1C9WA 3NQ7A 4DO5A 3VMPA 3CXOA 3W2NA 2A1YA 3VNLA 5D32A 1LUCA 3R6IA 2PCEA 1TIMA 2PGFA 3I6EA 4C7FA 4GJ1A 1BF6A 2V9DA 3WF3A 3HURA 5EB8A 3O3RA 3M0KA 3VGDA 4A29A 4NX5A 4LANA 3EKGA 1LQAA 3PANA 1MQRA 2FB2A 1EWEA 3MCNA 3OYZA 5A8NA 1VCGA 1S2AA 4GIEA 1A0CA 4MHBA 2R82A 4MAVA 3B3DA 1LLZA 3CEPA 5CSYA 1Q8JA 1T8QA 3BLDA 4Y96A 1FWRA 4UNLA 3IV3A 1SFLA 2P88A 3L4VA 1XBXA 4GUHA 4UOZA 4TX9A 5D9OA 4N4QA 3S0CA 1OGSA 3RLVA 5DBTA 2AKZA 4L4OA 3H7UA 1GTEA 1GPFA 1J6PA 4A2SA 2VZSA 2XFFA 2G95A 2PDIA 5FJIA 3LHWA 2VHLA 2PDHA 4XZLX 3EB3A 2JE8A 2BOEX 3H24A 2VGGA 7A3HA 2QPUA 1JCYA 5C2CA 4G7EA 1IIHA 3EXRA 3WQEA 3MO4A 4H01A 2WSKA 4WGXA 2NXGA 3TTSA 3R5EA 3WEMA 1SZFA 4PCSA 3V75A 1XSJA 1SW0A 2EPMX 1HF6A 3ITYA 2Y0FA 4Q4SA 1Q6FA 3KBMA 2C13A 1CXIA 2YDAA 2XIOA 1K77A 4G7FA 1M7PA 3G18A 5HXMA 1Q3NA 2GGGA 3S2NA 3PWAA 1XIJA 2CCRA 3CZEA 4X0NA 3J7HA 5GJMA 4YCPA 1YNQA 1AA1B 2VZVA 3QV9A 4ZOAA 5HWMA 4MFEA 1QI5A 3UJEA 3CTLA 4ZFMA 2XIQA 2V5DA 3M1ZA 1NSJA 1W2VA 3M5VA 1QOXA 1ZBKA 2CBIA 5EU9A 4YPJA 1R3QA 5EMKA 3R11A 2CESA 2HISA 3NSNA 4LCSA 1ONRA 2H8XA 4N2YA 1TX2A 4MUPA 3EOOA 2Z1SA 1KRBC 3AO0A 1F74A 2DQXA 1MQPA 3PJTA 3AUOA 1EBHA 1W9DM 2UY2A 4NHVA 2BNJA 4XIAA 3IIXA 3WDHA 5A6JA 3UR5A 4CNOA 3KP1A 2ZYFA 3H2MA 1FP8A 4MWAA 3I65A 3UVAA 3NG3A 4IFKA 4MZYA 5D9PA 3F2CA 4NAEA 1V3MA 3QF0A 1TV8A 3EMCA 1P7TA 1XH0A 1H7WA 4B16A 4LEQA 3CAWA 1JCXA 1R38A 3MS8A 5ENLA 2PC4A 1U5HA 1DXFA 3WDIA 2A79A 4NZ3A 2FGZA 4Z1BA 3RMEA 5KTLA 1LBLA 4XBKA 1Y0EA 1GQLA 3OBAA 1UD2A 3S4TA 1XYZA 4LNYA 5KZ6A 3HGOA 2ZX7A 4F66A 3TYUA 4MY9A 4CNSA 1MVYA 5FF2A 1JZ3A 4A3QA 3ITLA 3L5LA 4Q32A 1VCFA 4JQ1A 1H0IA 1W3KA 1ZS2A 5C8BB 1UMLA 1JCMP 3L5AA 4CCDA 2J7CA 2X1RA 2JGQA 1U1JA 4EWJA 2Y5JA 2OQLA 1OCBA 2IKJA 3RXZA 1IZKA 5JBDA 4PZVA 4MM1A 1SMDA 5FEZA 1A53A 4BR1A 2UV8G 1FHVA 2VYOA 1TTIA 3ELFA 4E3VA 3K8LA 2F38A 4M7SA 1KFWA 3PBUA 4Q4OA 3UWVA 1WAWA 1CXEA 3SCSA 4I5UA 4UFLA 1Q45A 2ZQ0A 1SJBA 3PUDA 2YCIX 3LUTA 3PF3A 4HNNA 1S2TA 1UCWA 4HNLA 2OFJA 2B4GA 4QE5A 4BF5A 2XM1A 2VR2A 3TWBA 4ORMA 1H4PA 4LH8A 4RDVA 2Q8ZA 2Z4GA 3CUXA 4I6VA 4JDBA 1JPKA 3DIPA 3CZ8A 3ZLFA 1XCWA 5TF0A 4DO6A 4CU8A 1VIWA 2E5DA 4DRSA 2V5BA 1BQCA 2HJPA 4CLMA 4DELA 4WJ8A 3BSHA 5KZMA 2DPEA 4Q7BA 2YZ5A 2HSAA 5HNTA 4JTGA 1UG6A 4MB1A 4W86A 1XRVA 5I3HA 1MNZA 4NNBA 1EZWA 3ICJA 3OGRA 3IK2A 3W38A 3GTHA 3TV8A 2PTXA 3GDKA 4D8ZA 3WD3A 4HMDA 1PIFA 1UR9A 4NNCA 3HM7A 3DI1A 3IAPA 4PN2A 4MB3A 1HJQA 1R7AA 4QBXA 5MF5A 3BGAA 3SJNA 1GHSA 3UR2A 1ZLPA 2YDSA 4IP5A 2CZ5A 4YL2A 4ZE5A 3WNLA 3AROA 1CECA 1EA9C 1XCXA 3QR1A 4ZXLA 4I7VA 4LAUA 1IR1A 3UYCA 2Y8VA 4OKDA 4ACZA 2D2HA 4O15A 1UA3A 1ZFJA 3O6DA 3PTKA 3P0WA 4L65A 1J01A 3VOFA 2XIIA 1DIDA 2D73A 3SY8A 2W62A 4O0ZA 4Q7IA 2WQDA 1R2SA 4HIBA 3KBVA 5BU6A 1POKA 3BQ5A 1CGVA 4G5DA 1TPB1 2PDYA 5AYYA 3RX4A 3W53A 1ITUA 3L0NA 3DGRA 3WK1A 2CFFA 1YPXA 3CWNA 4NP7A 4C6LA 3FNDA 2PCQA 1TELA 2Q09A 2XSXA 4EXAA 3GIPA 2XIJA 3SQSA 3T0DA 1XLCA 1I1WA 3NYZA 1XHGA 2Y88A 4EPBC 3ABQA 1A4MA 4GIAA 2WCAA 3VD4A 1MW2A 3SY1A 5DX7A 3WUEA 3OTRA 3MP3A 4HBKA 2CLEA 2PWVA 3H21A 2GQ9A 2QJMA 3KOYA 1HGYA 1FCUA 4GCAA 3QQ1A 3SCPA 3SN1A 3AYSA 1ZBCA 1HFBA 4PMNA 3BJFA 1DOSA 2ZDSA 2O7QA 3JW7A 4PUMA 2DZAA 4MNKA 2YSWA 3NL6A 1VBUA 5HMSA 3RJXA 4C1LA 3G1AA 4WY0A 3QY8A 4F0LA 2ZVIA 3HQ1A 1FWAC 4UBPC 3KVMA 5KEZA 2DSVA 3I10A 1JCNA 3UF9A 1DE6A 1QO2A 1JG9A 4W5UA 4D1JA 5D09A 2A5HA 5M5DA 1BLIA 2OX1A 1AQ0A 1ZTVA 2WVVB 1PX8A 1YDYA 1UP0A 4PMQA 1I9CB 1KTNA 1U2YA 3RPTA 2GOUA 1ISXA 1SO3A 4WKAA 4QXIA 2GGHA 5AC5A 2I5QA 3WD1A 5CGTA 1JYNA 3T07A 3LI1A 3LGGA 4V15A 1WBHA 3GG8A 3ZSSA 4Q8WA 4JIPA 2VC6A 1W6TA 4C60A 2XIMA 2ACSA 7REQA 5LNVA 3GR8A 2J7BA 3IGUA 4M29A 5JH2A 5JUVA 1S2VA 4XAGA 3QR0A 5KETA 1K03A 2EPNA 3WH5A 3M5ZA 2OT1A 3PB2A 5E0CA 5M03A 4TX8A 2Y8UA 4JIRA 4UTIA 4RL3A 3CL8A 4NRRA 2DZVA 1I4NA 2J66A 2VR5A 4MPKA 1UPMB 1V3IA 2POTA 1EL3A 3HU7A 5LYRA 1JUBA 1UP2A 3RM9A 4TO8A 3IS4A 4P7LA 2X0SA 3WH6A 3HA1A 2BASA 4CQ9A 5FJPA 5DXXA 3NSXA 1MEHA 3GKFA 2HROA 1IGWA 1UW9A 2NV1A 2AAAA 1VFSA 2ZRXA 4R53A 3TYDA 1J5SA 1SQ7A 4PUUA 3DN5A 1JQVA 2RDXA 2R8WA 3S6DA 3TDFA 2DSZA 3N19B 5CGMA 3AWNA 3VI2A 1R9YA 5MKGA 5LKYA 2UZ9A 1GORA 4XKYA 5I09A 1ISYA 4ICCX 3ITXA 1TE6A 5EMJA 3V5CA 3PHAA 1Y5WA 3PY2A 3GR7A 1M7JA 2EQDA 3DYOA 1WZMA 3O6CA 1UWAA 3WNKA 3OVQA 2JEQA 3GH7A 3L0KA 3VIFA 3W1PA 1E56A 2B81A 4G9PA 1RV8A 5HINA 3W2UA 2HCVA 3CQIA 3W7OA 4AY7A 3W6MA 4P7RA 3A3HA 4ZTYA 1E40A 3U3HA 3GG7A 1GW1A 4AYSA 3AQUA 1G67A 4IPJA 3MMWA 1Q2SA 3M0LA 4IHCA 3MMTA 4JTQA 2OSWA 1N8FA 3T6CA 1P0NA 3DENA 3LTPA 2RFGA 4GABA 2QDDA 2GVGA 3AAMA 3GU9A 2XH2A 3P8JA 4FB7A 4EACA 3LS9A 4A8RA 3P67A 2GJRA 1SYTA 3WIJA 1MXDA 2P50A 4PTMA 4FXFA 3T2PA 3AYRA 4JNYA 3GTNA 2CXEA 1JRCA 4LS1A 4LBUA 3E2SA 4UXDA 1J4EA 1B1YA 3W28A 3EWXA 2BS9A 3JR2A 4JFVA 4PEEA 2YZRA 1F7BA 3CL6A 3UYIA 1XUZA 1M7OA 4O4WA 1Q8AA 1LRNA 1BEUA 1F9CA 1EWDA 1TQXA 3QQ0A 4LU0A 3SJ3A 1OFBA 2X1TA 2W27A 2QZRA 4CNNA 3I3BA 1M04A 1RA0A 4KS0A 4W89A 3CQ0A 1QU4A 2Y7DA 2EEXA 1DPMA 2ZX6A 3W87A 5KSWA 4AZBA 4IFRA 2JK2A 4GI6A 3ARWA 4D6GA 3HPZA 3W1RA 3EKZA 1AJ0A 2Z1BA 2YA2A 5HR6A 1OYAA 5ABHA 3NPWA 4AHQA 4IFOA 2VI0A 3DG3A 1PKMA 3THQA 1UZ1A 3KOZA 3OJGA 2FHFA 4J3UA 2CKSA 2BSLA 1X96A 2VRQA 3WQCA 3UZWA 5CJMA 3U4AA 5T26A 4QGCA 1V0NA 1C93A 2B0MA 2XHYA 2D1ZA 1YBQA 4QTGA 4EXQA 3VDHA 2FHCA 5G1TA 4BEUA 1L9WA 1B3XA 5CSSA 4RDYA 5D9MA 3RIKA 3N13A 4LS0A 1V02E 1AD1A 2XH7A 3HPXA 2D20A 1ZJIA 1RD6A 2JIEA 3KLKA 3BCDA 4TMCA 5B7ZA 2MNRA 1TSIA 3VILA 3IGHX 2VP8A 4OU1A 3ORWA 4UUIA 4AMCA 3DHUA 4O11A 4E5TA 3ZIZA 1YHTA 1OBAA 2GJXB 3WN6A 3AOFA 2E6DA 4RPQA 4W7VA 1PSCA 5I3JA 4GYKA 4F0MA 1TWDA 3MU7A 4LF2A 1KQYA 3L9CA 1IT8A 2Y7GA 2GWGA 1GOKA 4I9MA 4OUEA 1XFBA 5AC6A 4XTIA 2QLYA 3STCA 5C9WA 2PDWA 3KAOA 3WDJA 4LS2A 1YIXA 2YDQA 3AI0A 3TC6A 4DJFC 1ZJBA 4R9XA 1LROA 3MHGA 3DCPA 4NF7A 2HXTA 2W91A 3UETA 3O06A 4WIWA 4F2BA 3UBPC 1FDZA 1O5RA 2EAWA 1BF2A 3DC0A 5D02A 4HOZA 3B8UA 2XUCA 2WMIA 3G1RA 3F7JA 5C9XA 2VX6A 3OPSA 3W01A 3CHFA 1HKWA 3SFKA 4EPDC 4KERA 3PB0A 3QV8A 2WYSA 3DH7A 3L0GA 3E49A 3ID7A 3A22A 4B5WA 3W1UA 4QSFA 2DJLA 1NU5A 4CVUA 4LNCA 2IPFA 4GUJA 3B0XA 4EPKA 4MOZA 4TTUA 1KTBA 2V3FA 1C90A 1PWLA 1EO7A 3W75A 3HGJA 3UZ5A 2NLYA 3UGRA 3RJYA 4TIMA 2WSPA 3HPSA 4DUWA 2BWGA 3MHFA 4DLFA 4EAYA 3U48A 2HS6A 5BRPA 5C55A 4MZ1A 1E15A 3H54A 4UTWC 3VNYA 1VYPX 2XSBA 2ZBTA 2YIHA 4IIGA 4CQDA 3DFOA 2J7DA 4WXYA 2WK2A 3W86A 2P1FA 4H7ZA 5EPDA 4QDMA 2VGFA 4FNQA 2XM2A 5ABFA 2H9AA 1GVRA 4P8VA 4F0RA 1RBLA 3WQWA 1DIOA 1V0LA 3BAJA 2ESCA 3NQMA 1Q13A 2BP1A 1B4EA 2ZA1A 5AHEA 5TNVA 3G1XA 4XB3A 3N73A 4YN5A 4NILA 1PKNA 4CN6A 3VNDA 3RMJA 4PUNA 1OINA 4I5XA 4DN1A 1GVIA 1E0UA 4IG2A 1DQUA 2VX7A 1KM5A 4C90A 3AJXA 4XZBA 2VOMA 5CLWA 1I2NA 2PF0A 1J12A 4PL2A 1HL2A 3LY0A 4R5EA 1CB7B 2C79A 1JVNA 4NJKA 3W7LA 3T4CA 4GKTA 2ZRYA 3MZNA 4LUSB 1KCZA 3TYBA 1N7KA 1SR0A 4HN8A 4AZCA 3QFEA 3REQB 4HHPA 1HXJA 4I8DA 2GSHA 2YKKA 3NGFA 4OTKA 3OLGA 2CBUA 8A3HA 1RAKA 1B57A 1GK8A 4JX5A 3ITGA 3ES8A 1YLVA 3C2OA 4H8HA 5L6UA 4AWSA 1F61A 3LTYA 4Y9NA 1WZAA 3UZZA 4CQ8A 1B31A 3WUGA 4RJEA 1ZJAA 3D5HA 4K8HA 2QKFA 4HGXA 3IJLA 4O19A 1Z89A 3MMUA 4K2SA 4DF1A 4LCRA 1EOKA 1UOKA 4ML9A 5FSDC 1OK6A 4MNJA 1EJXC 1EXPA 1CGTA 3WQGA 3H26A 3ANVA 1F07A 2ASHA 2D3NA 4UMBA 3TMLA 4D6CA 3EX1A 4F9JA 4ERAA 1OIFA 1JULA 3TIMA 3N9RA 1JPHA 1DL3A 4TV5A 1IWAA 2WANA 1GGOA 4ZL1A 3OO2A 2JKPA 1XLHA 3VABA 3WDRA 4GCXA 3C2RA 2VVSA 1A3WA 4KEVA 3UA4A 1N8IA 2FVLA 2XWEA 4HA0A 3DKJA 4BS0A 5C70A 3F4DA 5F4XA 4DHGA 1XS2A 5CPNA 1CLXA 2PWUA 3ZR4A 3UP8A 3O6AA 4BF9A 1VPQA 3AU6A 3HJEA 1HL9A 2BV9A 3S47A 3OG2A 1H1ZA 4GO9A 4QR6A 5KITA 1WQ5A 3QGVA 4HSHA 4MKNA 4YMZA 4PODA 3NEHA 3T1GA 1PX3A 2WSQA 4IMGA 1PPIA 4XAYA 3ARVA 4Q4PA 2PWEA 4CEUC 3UY8A 3NQAA 5C6MA 2A6LA 1GEHA 4UOJA 4JQ4A 1XPGA 5IDIA 3W71A 4Q4RA 5CAHA 1G5AA 3BK0A 1X1OA 4FF5A 2WM0A 2XVNA 1SJCA 1YTDA 2CHOA 2REQA 1XM3A 4XIMA 1B9BA 2XWDA 3ANUA 1BAGA 4W7UA 1U1HA 4G56A 2PDJA 2ZC8A 3IJ8A 2VGIA 5A69A 5CBJA 1CLVA 5G2WA 4AWUA 4I9TA 2Z2BA 2NX1A 2FB3A 3ARSA 3PZUA 1ZBWA 2QCDB 2GL5A 2ABBA 4ERGA 3LSCA 1FKXA 2WVUA 3SBFA 4GGBA 6ENLA 3O0KA 3W7QA 2XFYA 3F4NA 4KRZA 3QLLA 4FLSA 4GPNA 3TR9A 2D0HA 3SZ8A 4RNHA 3QPYA 4TVUA 3ALFA 3W7CA 4FAMA 4JHOA 2ATMA 1VYRA 5LNRA 4XZMX 4HCDA 2TODA 3U7BA 5I07A 2Z6IA 2WMKA 3B4YA 4OUIA 3T8LA 1K70A 1JDDA 2GVJA 4IXHA 4C1NB 1Y65A 1DJIA 2V81A 2YLAA 1FQ0A 2XVPA 3KEHA 3TW6A 3V0UA 1PTAA 1E70M 8CGTA 4UMCA 1VFTA 3C3UA 1M3UA 2FGLA 1OK4A 4LYKA 3PJWA 1YE6A 4W88A 3MSGA 3E2VA 4NJGA 2HXUA 3B8DA 4X22A 1W3NA 2MUCA 3F03K 4RXGA 3P14A 3PULA 3ZMRA 4JICA 4FLRA 4UQCA 3EOSA 2QXWA 1IYXA 5IHRA 3A3XA 3FEMA 4JTDA 3NL3A 1LUCB 3AYTA 4HB7A 1EBGA 1OM0A 4B5SA 1OWQA 1EUNA 1RJQA 1XLJA 1TJ0A 3A4AA 4RE0A 2YCEA 1MEIA 1JIBA 1NFGA 3EWCA 1C92A 4F2UA 4IMEA 3UT0A 3GXDA 3W9ZA 2CWXA 3MCOA 4K3ZA 3MUIA 1DWAM 4PUDA 1WKEA 4C7DA 1ISVA 1WPCA 2VO5A 4PMRA 2WMHA 4LRTA 4L6HA 2G96A 3GRIA 1ICQA 3G0SA 4Y7EA 2CZEA 2QDEA 4AIUA 1QOPA 3L12A 2Q02A 3O07A 4GC3A 5HQEA 1QO5A 1AL7A 3WLLA 2OVLA 1ZAHA 5HA7A 4MWAC 1H0GA 1OFPA 2VEPA 3AZTA 3BLIA 4B5NA 4XK2A 3NGJA 3PP7A 2PDPA 3CUGA 3W1NA 3BLEA 3WJZA 2YL8A 3WL0A 2QQ6A 2UY5A 1A47A 1PL9A 2BHZA 4RNIA 2ISVA 1OX5A 4G2DA 2PTYA 3CT2A 3FYPA 6ALDA 2KX9A 1U22A 1W9PA 4L9XA 1UBPC 4KGLA 4QAIA 2CZFA 2Y61A 3DU0A 1G4PA 2G3FA 1XLMA 4KPLA 3GU2A 3LB0A 5HJLA 1TV3A 5BCAA 3MKKA 3CHCA 1ODUA 1DJNA 3SCWA 5CLTA 4LAKA 5G5IA 5A8PA 2XN1A 2ZUVA 3O1NA 1J0KA 4IMAA 2BGNE 4HNUA 1P4CA 5HANA 4JIIX 2WZMA 1Q63A 1RCQA 1WXYA 2HEJA 3EEZA 1TA3A 4HTYA 3M7SA 3B0YA 2YCJA 3ABOA 4PGLA 4LFYA 4OE7A 5FF0A 1YPIA 1NDVA 1I45A 2IXUA 1UUMA 2IKGA 1BVWA 4PTWA 2O9RA 2Z1WA 3OEXA 1J2WA 5CPMA 4WGHA 1LT7A 2E7FA 2ALDA 1TMQA 4MWAB 1ZU8A 2AKMA 3IWPA 1X6UA 4NAFB 4U3AA 4NAEB 1NFPA 1ZL1A 3NQDA 2A0NA 4MAZA 2KAUC 4OT7A 1KM3A 4GNVA 5HMDA 3T81A 4O8RA 4LUYA 2G3NA 1P7TB 2X0HA 2CLIA 3SCRA 1PYMA 3LRKA 1SSGA 3W84A 4EP8C 4IIHA 3DESA 2RH9A 1HP4A 1VD6A 5A6TC 1YDVA 2ZUUA 3UWUA 3VNIA 3VX0A 4QROA 4WKFA 2X2YA 3RM8A 2DUAA 2RAGA 4Z2GA 3OVGA 3B05A 3AXHA 4M6UA 3AHTA 4L6OA 4ICMA 3BLPX 2DT0A 3H6OA 4YNGA 2H8ZA 4AIEA 2VEKA 1UD8A 3O7UA 1P43A 3IJDA 1VGAA 3MPGA 1RD5A 5A2BA 3EDKA 1T41A 4ZE4A 3S1WA 7TIMA 1MDLA 3VIPA 2VDGA 4AEOA 8TIMA 3WQVA 1XBVA 3ZM8A 3OHIA 6TAAA 2WHKA 3QRHA 4C7GA 1JYVA 4GZEA 2BOGX 5BXTA 5C71A 1P0DA 3M0XA 2PZNA 3W7GA 1OFAA 3OZPA 4X63A 4GQGA 3TC7A 5I78A 1BHGA 3ARRA 1F4HA 4BI7A 3GDBA 3QN3A 2VUNA 3GQYA 2QUTA 4POCA 4A2RA 1KC7A 1YYAA 4HPGA 3B4UA 4XKMA 5M17A 1F73A 4Q3MA 3A24A 4HQVA 4MPQA 3CH9A 4Q8MA 1PVNA 1HQTA 1KRAC 4NRSA 3DHFA 3SW6A 2IPWA 3TYCA 1US3A 3PR2A 5DMMA 3MI3A 3WQOA 3BLKA 4ZR8A 4NJIA 1CTNA 3CLMA 3H4WA 3O9NA 3P81A 1XQKA 2DT3A 2R91A 4D1IA 3M5XA 1KV5A 4JTEA 4K1WA 1EDQA 3DHDA 1UKPA 2A3AA 5GVJA 1VFUA 4ZQOA 5LA0A 5BWAA 4EF9A 4O4VA 4C5ZA 1ESWA 1G4SA 4C6KA 3CAQA 4Y6GA 3ZR6A 4H8NA 1I2PA 1NWTA 1WNOA 2GQ8A 5AYBA 1NY1A 3WQPA 3CL7A 1BWKA 1MWOA 1UH3A 2DW6A 3RDKA 3KE0A 3NM1A 1VEPA 5AZ0A 1IEIA 1JNDA 2GWNA 4HZ8A 3K8MA 1IQ8A 4JTIA 4AZHA 4YYCA 1BYDA 3AISA 4OOZA 3LU2A 3RLGA 3VM5A 4XTDA 4XG1A 2B7NA 2DVXA 4L5ZA 3S5YA 5JIWA 1E5NA 2V2DA 4RK8A 3M07A 2ABAA 4FOJA 2AL1A 1VCVA 4YLWA 1SU5A 1KR1A 3UPWA 1OF6A 3LQLA 4ACZB 1EHNA 3IEBA 4FI4A 5REQA 1BXNA 1RQEA 3WELA 4MLJA 4JTLA 4UTTA 5G1YA 4NNAA 4UTMA 5D30A 4JZ5A 3WDQA 4Z42C 3LCFA 4GJJA 4WKHA 1O66A 2FJUB 3FSUA 3W1AA 3W7KA 3GSMA 4OECA 2J7GA 1NWUA 1RXOB 4KEUA 3ARTA 1HG3A 3BLLA 4XO6A 1E43A 4MKVA 1RR2A 1M5WA 2NX9A 3TCEA 3HGRA 4FR1A 1JZ8A 4ICNA 3TK7A 1RQHA 4FSAA 3GXTA 3S1GA 2ACUA 2QJIA 1H5VA 3U6WA 2DIJA 2WC3A 3SCTA 5KMYA 4HYWA 2X40A 3DAQA 3PG9A 5T9CE 1WDQA 3WLMA 1IF2A 2YL5A 2G3JA 3IJQA 4LVAA 1R3YA 4AC1X 1BGGA 4FLQA 2R94A 2WXDM 3CTTA 4B5TA 4Y8FA 3P80A 3H2FA 1VENA 1W3IA 3OA5A 3ZZ1A 2QW5A 4R9OA 3BV7A 1HJWA 4A3YA 3H2EA 7ODCA 5AVHA 3C0QA 3W7MA 2EPOA 1H61A 5FJOA 3WQFA 5PTDA 1UA7A 2EBNA 2ZKMX 1JD9A 4LQ1A 1SZNA 3SUTA 3GW0A 2HRWA 2OOGA 4G1NA 1GVSA 4K68A 4WY0B 2FH6A 4K7YA 1QJWA 1POJA 4HZ6A 5C9UA 1TJRA 2E5CA 1NELA 1UWRA 4PTDA 3GHSA 3AIQA 4W7WA 1U33A 2DT1A 2WZIA 2ZFAA 2J77A 3T0AA 3W27A 3TNOA 4D71A 1VB9A 4E8DA 4C6FA 3EYPA 5LSMA 4OV9A 3OZOA 4D8AA 3VZYA 3LV6A 4DJDA 3GUGA 1UR2A 5T8GA 3CB3A 1XF0A 2HTMA 1DTNA 1HUVA 3QC3A 2WZEA 2QV5A 4DJEA 3F4CA 5FF7A 2QDGA 3OGSA 4PUWA 1UWQA 3TKFA 3SIMA 1TZ9A 3C4UA 7REQB 4GNJA 1J93A 2GK1A 2JF7A 1K8XA 1UBSA 3GYCA 4O12A 2W5FA 4DUVA 2DIKA 2EF9A 5U4NA 4XZNX 1GOIA 2D3LA 2OEMA 4AY1A 3A21A 4X2RA 6TIMA 1VBJA 4O14A 5K9XA 1H7PA 5EGRA 1OF8A 3HFYA 4IJRA 2I5IA 1O1ZA 1QATA 1K8CA 4DWSD 4AQLA 1CT5A 4HNOA 3AXKA 4EK7A 2XYLA 1BWLA 2FTYA 3VDGA 4E38A 1V0KA 2A85A 2QJGA 3K4AA 4HZ7A 1TCDA 3AMKA 3GH4A 4N9BA 3P93A 5GJNA 3GVRA 1NFBA 2QJHA 3UWYA 2BXZA 2EGZA 1WDDA 3G8RA 1WO2A 3PZMA 3WLJA 5J5RA 4FNSA 2PBOA 2CU0A 2DH2A 3W23A 1R3TA 1DJHA 5MKGB 4XKYB 3RLUA 4RZ6A 2PMQA 1V8EA 4CD6A 2DW7A 2XVLA 3UR7A 1TMLA 1D2KA 4H8UA 3WY1A 2PP0A 1SW3A 5F2GA 1W9BM 2Y5EA 3MI2A 2BVYA 3CK5A 4CN1A 5J04A 1RALA 3LXBA 1B3OA 1P0BA 4AG0A 1BWVA 1WUFA 4U5IA 4GZIA 4ZXOA 1TPFA 2GDVA 2FVKA 3TQ0A 5LIYX 2DZTA 4MF4A 3DUGA 1HW6A 1YTKA 3RO6A 3SCVA 1PEZA 5DQPA 1A4LA 1UUOA 3KL0A 1CIUA 3GVVA 1JYXA 4HU3A 1UZDA 2CKRA 4ADSA 1W31A 1GOMA 4QIUA 3D3FA 2HVOA 3HFTA 3PTMA 3WD4A 4PCNA 4AH7A 1W9VA 4ZO8A 4LC6A 1XV8A 4D6JA 1K7EA 3Q67A 2WLZA 3Q58A 4GZJA 1B9ZA 3T42A 1XIBA 1UWIA 1EXBA 2CBJA 3C86A 3TP4A 4CN4A 3QW3A 3BGGA 4AC7C 1FP9A 1NP2A 3HMJG 3PZIA 3GZ3A 1XRTA 4CUCA 1QW8A 4C6BA 1H7RA 4U31A 4H2CA 1XI3A 3FJLA 3SUSA 1W37A 2AMXA 1A3HA 2YA0A 3QEZA 4WHBA 1GKPA 4JTCA 4YVPA 1NWRA 3SDOA 1XLBA 4PH6A 2A3LA 4P7OA 3WO8A 3B03A 2V82A 3VD5A 4HU8A 1QDSA 1WDWA 2AL2B 2EKCA 4N42A 5DF0A 4XVDA 4NQ1A 1DVJA 4DI9A 4QS5A 1VC4A 2VD9A 1K8YA 4IMCA 3L21A 2E1WA 3W85A 3ARYA 3MANA 2DZPA 2IW0A 3KFTA 4JFTA 4AD0A 3R13A 3L67A 4EAMA 4IIEA 5I2UA 2Y85A 3S2CA 1AH3A 3EA3A 5AOUA 4IM4A 3N2TA 3FDKA 2OKTA 5HWNA 4PUEA 3LCHA 2VFGA 2NVAA 2ZTKA 2W4XA 2OYMA 4WR3A 2O9TA 1OADA 4JTJA 4MJZA 3SGGA 2WJFA 4NZFA 5F2LA 3TLQA 4ROQA 2VXNA 1K6WA 4TOQA 4J3TA 4EKJA 3CPGA 4QEEA 3RUBL 1PXGA 1REQA 3HO8A 3GLCA 3P60A 1UR1A 1YBQB 4CEXC 1ICPA 5BMWA 2E67A 3V1HA 3W7IA 3VNJA 1PYFA 3PWGA 2R1MA 2J47A 3HV9A 3GZAA 1TO3A 2J7EA 4JTAA 3OLEA 5F4WA 4GVFA 2HS8A 1TTPA 2E6FA 1WAUA 2JEPA 4JFWA 5CPOA 1ZRQA 1GOWA 1R85A 3GNNA 2F8QA 2PLJA 3XIMA 1JI1A 2D2OA 2WC7A 2FJKA 1KGWA 4C6EA 3QY7A 3VGHA 3OQEA 4NJHA 5K4ZA 4FPSA 2XG9A 3RN6A 4S23A 3N14A 3CMJA 3SCQA 2PE4A 2A7PA 3U5YA 5D9NA 2E3ZA 3BZJA 3L7RA 1XFCA 1HKKA 1UKSA 5BYWA 4QG8A 2ACRA 1XC4A 2E4TA 1DXIA 3N04A 3AMCA 2VDIA 5F1VA 2CHRA 4JL1A 2HWGA 3ABXA 1SZGA 4JCLA 1K9TA 1FDJA 2YOCA 1M53A 1F6YA 2Q8XA 3UNDA 1CB2A 2WMIB 3GHTA 1JJKA 1VQTA 2QVHA 3W0KA 1ML1A 3CUHA 5LHEA 4KCTA 4BI6A 5HPCA 2CERA 2ZZ3A 1BRLA 5ABTA 3W4RA 5H6HA 2VGBA 2VZOA 4OBRA 5FD0A 4O53A 1O6IA 3PWIA 1A5AA 4UR9A 3S6TA 4B3ZA 4WSHA 4JPGA 1S5NA 2B7OA 3MUZ1 5I3IA 3P0XA 3VOGA 3VIOA 2OB3A 1ZSXA 3B06A 2NV9A 1LWIA 3O05A 4BI5A 2GQAA 3VZXA 3VIKA 1R3SA 4NU7A 4XX6A 4Z1DA 1BG4A 3V16A 4X9YA 1Q4WA 1DJZA 2EG6A 3CGTA 4R85A 2DZXA 4WJEA 1DJQA 3QR3A 2YR1A 1FFQA 1RVGA 3ENLA 2IQTA 5FKYA 1DIKA 4MJ4A 1SSDA 1WYIA 1TQJA 5LNSA 4A3RA 1TE1A 5LXXA 1J2BA 3TYEA 1CZ1A 5CXPA 4LVDA 4KRUA 3L2MA 4H9VA 1TV4A 2X1UA 3LOTA 1RA5A 2FZ9A 4C91A 3JZEA 3MHUA 3DERA 3MW7A 1ME8A 3CHDA 5IDZA 1IT7A 4GACA 2CIPA 4S3JA 1KM6A 1XIEA 2FFCA 3S5ZA 4MYXA 1LG1A 4OIFA 1LWHA 3WQ6A 5A6KA 2Z24A 4GA8A 3LCIA 4HHLA 3ZVIA 4LALA 3PNUA 2PGRA 4IG2B 3SCOA 1SMAA 5DMNA 5LIKX 3UFYA 1W3LA 4Z1CA 4OVXA 2DDXA 2VEFA 4H9YA 2BXYA 1LJYA 3G1YA 1RSCA 1C29A 4IP7A 3BPWA 3DFYA 5AHLA 2QGYA 2ZADA 3GWQA 4Q4KA 4AWTA 4AZCB 5C7HA 4WSJA 3GXIA 1K4HA 3KM8A 3OVRA 5A95A 5I6SA 1OGBA 1LLOA 2XISA 1XIGA 3UXAA 3TZFA 1PAMA 3ZSTA 5G2HA 1KGUA 2OKOA 3HF3A 5DY2A 5C7VA 1RZMA 3CB8A 1GEQA 1R30A 1VRDA 1VFFA 4MLRA 1OYBA 2ZRWA 2V0TA 3UWZA 3NSMA 5AKQA 4K1GA 1CEOA 1K3UA 1TJ2A 3M0VA 3FCPA 2VCAA 1V7YA 3I6TA 1Q6OA 3QZ6A 4P7NA 5I06A 2C0HA 1CXKA 4UZUA 4QX4A 3SRHA 5HULA 1ODZA 3EAUA 2OOFA 2NWRA 4DPQA 2PRLA 1MUWA 5DT7A 5AHMA 3ZFHA 3WFAA 8RUCA 1TZ7A 1W3JA 3NURA 3VFCA 3CV7A 5AFDA 1FH7A 5JH1A 2PWGA 1UD5A 3FDGA 4E6MA 4CNTA 1V6WA 3ALGA 3PBGA 1QOQA 2ZE0A 1WZKA 3V7PA 1KBBA 3KDOA 4JIHA 2RDUA 2D69A 2G0WA 4IZGA 1EPVA 5CG7A 4GXPA 5SWUA 5CZJA 4R7OA 2DQWA 2AGTA 2ADAA 1RCOB 2CLMA 1CXHA 1W91A 3S9YA 2VC7A 3WFZA 4ZBCA 4B5XA 3EMQA 1OZQA 5E0KA 3SB0A 1NP0A 4J7RA 2FZBA 5CZTA 5DRCA 1BSIA 3W2MA 3W29A 2REQB 4A21A 2WB5A 3PPHA 3KDNA 3M5YA 2J13A 3GC5A 4BKNA 2X2GA 4MY8A 3MZ2A 5LA2A 3KRUA 3S1UA 4PTXA 4PR4A 1E0TA 3WH9A 1H09A 1UH4A 3FOKA 2QF8A 1ZAIA 2FDMA 2NW0A 3VGBA 3R89A 4AD2A 4NG3A 5DANA 2PP3A 5I3KA 4MB4A 2QCLA 1TZZA 2F6UA 1S5VA 3THDA 4W85A 4NASA 3SIZA 3TONA 1QBBA 3N9KA 4NY2A 1Q85A 4UZSA 3UERA 2CW6A 1XLLA 1XKYA 3EX6A 4NX0A 1UZ4A 1Q7ZA 3TR2A 3GY1A 1FUYA 1TKKA 3GAKA 3EWZA 1TPVA 2HVMA 3NOYA 3SAZA 2IQ0A 4AB4A 3M4HA 1UD3A 2I56A 4WSKA 1R2RA 3AXMA 3M7WA 4Z08A 4PMXA 4HNCA 3GU1A 3CMGA 1UYQA 3A9BA 3TEVA 3II1A 1Q6RA 3JZUA 3W7JA 1ZCCA 4ONVA 3FJ4A 4R34A 3UG5A 1NJJA 5BOEA 2FH8A 4OZOA 3BANA 2HMCA 3FXGA 5DLCA 4LC8A 3DXIA 4FA3A 2V3GA 3IGSA 5BOOA 3QMTA 3VIMA 5CPQA 2BMBA 1R7OA 1T96A 1NQKA 3LPGA 1M6JA 3VDAA 4XAPA 4FS9A 1N8WA 1L6WA 1KXVA 4Z2KA 4GC4A 1OFEA 3BUVA 4ZSTA 1D7FA 4K8EA 2DP3A 4GH1A 1LOQA 1BGAA 2GVYA 4M6PA 1HJSA 1S46A 1XYFA 4JTHA 2NQHA 3GVWA 1X1ZA 3FV9A 3V0SA 2ZX5A 3KRSA 4GO8A 1UD6A 2VOTA 2ALRA 4PA8A 2PD5A 5A6LA 3TQPA 2CLPA 4QDWA 1L6FA 4DYJA 3B04A 5AYXA 3ZWSA 3QSRA 1UB3A 4WD0A 1AJZA 3P74A 2P3ZA 3W2KA 1R0MA 2POZA 2JIWA 4MB5A 3G1DA 2P8BA 4M5PA 4JTFA 3BAWA 4N02A 3IAQA 2C8NA 4JN8A 1FVPA 7TAAA 4S3BA 3FYOA 2NUXA 3Q65A 3E0VA 2WKGA 4HOXA 1NARA 4QSHA 4LV9A 4A35A 2QHAA 1QPKA 3ERPA 4IJCA 3QOMA 1M41A 4TU1A 4RZ4A 4YCOA 1O60A 2YL9A 1IXNA 1NOWA 4KWUA 1FHUA 2BDQA 2YFNA 4DXXA 3I4KA 3VUSA 4HPJA 2BLEA 3UPMA 4AU0A 3ECQA 3MKVA 2GGJA 1Y5VA 3A12A 4HOWA 1US0A 1GQNA 1BYBA 2ZUTA 2CXGA 3GR4A 4Z2JA 1W8GA 4CD7A 5RUBA 4OBTA 2VWTA 3E0LA 3TSDA 3UXDA 3W25A 5KZEA 3LCWA 3FY1A 4OWGA 3VU2A 3O6YX 4JX6A 3VOCA 4D8LA 3LHVA 3AHVA 3HJZA 2BY0A 4D9PA 4WUIA 1Q5MA 3ABZA 1OJXA 3K30A 2Y1HA 2NQ9A 2ZUSA 4V1XA 4C6DA 3U7VA 4M6VA 2PBGA 3SUUA 4M8UA 3R12A 3QLDA 3PM6A 3KCLA 1VLWA 1ZP3A 5EA9A 2C1GA 3GTXA 1P1MA 1EIBA 2W67A 3KUMA 3M43A 3JUGA 1H3GA 1TA3B 1E5JA 4C6CA 1GYMA 3MBFA 2WNZA 2XPKA 1MRQA 3URAA 2ZX9A 3CEUA 1L0PA 5D37A 3BOFA 3MY9A 4AAJA 3WQ4A 3WCZA 3KWXA 3UG4A 3HQNA 4M82A 3L4XA 2Y89A 3CO8A 3M6DA 3B8TA 1W1B1 3WK2A 3HPFA 4PMOA 5BRBA 5EYWA 4JYFA 2ZZ2A 4MGGA 2YDRA 2QMJA 4LUIA 4DPPA 1UKQA 1EPXA 4DLMA 2VT0A 4GKLA 1XX1A 4YVVA 3HG2A 2X16A 4M3PA 1V0MA 5EBUA 4OHQA 5I77A 1BSLA 2V8ZA 1Z8AA 4RNFA 1SFSA 3BGJA 4IX2A 3Q2DA 4DI8A 1ITXA 5ABGA 4QQ3A 5LNUA 4IT1A 4IIBA 4L56A 1FCBA 1XG3A 2VUYA 4RR4A 4E2OA 4IUGA 4N9CA 4GQ0A 3EWDA 4UIOA 5IHSA 4MKSA 4GZ7A 1PHWA 4ML4A 2ISSA 3QH2A 3GNPA 4P61A 3VVGA 4DYKA 2YX0A 2PAJA 2I9UA 3BJTA 1KO0A 5U7SA 3BOXA 1QTWA 3GDLA 1BVNP 2HPMA 2NUWA 3C8FA 1QNQA 3N4AA 1SPQA 3DFHA 1WDRA 3VO0A 4X0VA 2V67A 5K7JA 1TRIA 2J7FA 1G7UA 2YB1A 1V08A 3NA8A 3WBEA 5LGZA 5CCZA 4BF7A 4AYGA 1PHQA 3ATYA 3G2GA 3NO1A 3DG6A 4ZB0A 3OHMB 4UTTC 2EG8A 4FNRA 2FPTA 3CWOX 2C0AA 1BQGA 2G3MA 3DFNA 2B7QA 1ZHAA 3W1TA 1U30A 1IEQA 2RJHA 4EWND 1ZPTA 1GZGA 3LCGA 3IIOA 3M0YA 1MZRA 4L80A 3K8KA 3AICA 5LXEA 1Q6DA 4J9JA 5A6BD 1G4EA 2WCSA 3C56A 3S46A 4H9TA 3THCA 2VFHA 2D24A 1HJVA 1ZAJA 4L4PA 1JPIA 2YB4A 4PMDA 3IRDA 1FWBC 5CQ1A 1ADOA 5A2AA 1XBZA 2EO7A 1XRSA 4UMAA 3LD5A 1FDYA 2CLHA 3BDKA 3UWQA 3AIVA 4AD5A 4H9UA 1LQ0A 1P0KA 3ARQA 1XLEA 3BMWA 4M24A 1E3ZA 3B9EA 4WVXA 4GFSA 1IEWA 2VFIA 3WNMA 5AY7A 1V03A 3E9AA 3S3GA 3I7QA 3KLLA 3T55A 1W9UA 4O0KA 4HCHA 1JNEA 4ERIA 3L66A 1TX0A 1VFHA 5J8LA 2IKIA 2CITA 1N2VA 5AHNA 3VIIA 3RCMA 3SADA 2R1NA 5E70A 1IWPA 4MDOA 1H50A 3WJSA 4D2JA 3OU8A 3TN6A 1MNSA 5H91A 4H9ZA 4ZQNA 3W1MA 4IJBA 4L9YA 4C6MA 1EP1A 5REQB 4HMCA 3G0XA 3W81A 2A6NA 4GIRA 3AJ7A 2J74A 4CD8A 3EOUA 2A3EA 1F2JA 5IM51 2YBUA 3N17A 2F6KA 2ZXDA 1XD1A 4EX4A 1OQFA 1DWIM 1G7VA 1UJQA 4LPCA 1EH9A 2ZWYA 1YMYA 3GIYA 3A64A 1EA0A 3AFBA 4Y9MA 1ME9A 3S2MA 4WY0F 1FFRA 4DJDC 4GUFA 3N12A 3BMXA 4JL2A 1VKFA 3NQGA 4IIDA 3LHZA 3BC9A 4DJEC 1E9IA 3S1VA 3MT1A 2UBPC 3PBWA 1PKLA 3EPOA 1J0IA 1E1EA 1BFNA 1KBIA 1R2TA 3B0PA 3B9DA 3V4BA 4RE4A 3LBOA 1YTEA 1DEDA 2OGYA 2PGWA 4QM1A 4HKPA 4UQEA 3S9ZA 4CQBA 4MYAA 3CM4A 4GBUA 5JBFA 3A5VA 3EDEA 1SO5A 4JOMA 4MUZA 2GDUA 5CBIA 3POCA 5BXSA 3B0UX 4JTRA 2QIWA 5CC5A 5FOOA 3RPDA 3A6OA 3FVDA 4IGNA 4KRTA 2ZZ1A 2YXOA 4O1BA 2VX4A 3GG1A 5HNNA 2DZBA 1FXQA 3ZS4A 2CLLA 3HV8A 3KHDA 3GTIA 3MSRA 1T7LA 4L9ZA 1OFRA 2RHGA 1DHPA 2PZ0A 4Z17A 3W73A 1J0YA 4CU6A 1XG4A 5FJTA 4PCFA 3A4JA 2QAFA 3SUWA 5C9RA 1I2RA 2WHJA 1VHCA 4D6IA 1GG0A 1PCWA 1UUQA 1F05A 2C3ZA 2J7HA 3QHNA 1XKJA 2Q3RA 4HPXA 3CO4A 4NT0A 3MJMA 2VEGA 3UCQA 2GDQA 4J3VA 2DVTA 1J6OA 4UWMA 4Q8UA 1W8SA 2G3IA 1H41A 1S3HA 3EZ4A 2TPSA 4NKCA 4BZYA 1GQIA 1RH9A 3C2EA 4HNVA 1BYAA 1K9FA 1F8IA 1E72M 3AXIA 5FACA 3LNMA 1US2A 1UZHA 3SCNA 5I7GA 2ACQA 4MVAA 1XIHA 2L5HA 1E0VA 6PTDA 3GVGA 3IVUA 3LDVA 2GK1B 2W0UA 6CGTA 3H22A 3AHYA 3ZVHA 2WZHA 2WPGA 5E93A 2NSOA 3CYJA 4H19A 1C8XA 5F7UA 1H7OA 2XU2A 3SR7A 2VFFA 1FHDA 2PWHA 5M2FX 2FVMA 3MSYA 2WHLA 1VFLA 2FYMA 2QV4A 5EFDA 3BQ6A 3W1QA 3AWOA 2ONEA 1C3FA 1VF8A 1GW9A 4XISA 4CU7A 5A8OA 4FXJA 3UJRA 4QDPA 1AW2A 4ZB2A 2VURA 3RR4A 1FA2A 3W37A 1Z3NA 2R24A 2GLKA 2PEVA 4JQ2A 4EF8A 4HT3A 4LXFA 1VFMA 1YRRA 2FQIA 2ISFA 4LVBA 4ZCWA 3CT7A 1ZALA 4O10A 1B2YA 5AHFA 1J5TA 2GVLA 1TV5A 2V68A 3BSGA 3GS6A 5CKSA 4UR7A 4O16A 3FS2A 2OWWA 3B8SA 4ZTXA 4H04A 1R8LA 4ZENA 2NVCA 3FYYA 3ZWTA 1UR8A 2C14A 1BKSA 4KW2A 3PZGA 1CW2A 1W5MA 2BY3A 4U2YA 1GG1A 2Y7FA 5LA1A 3P7YA 1JL8A 3ZJ7A 1AW5A 3NDOA 3N2BA 1UQYA 1GVFA 1YPFA 3CYVA 2LLEA 4F3HA 1BTMA 1K4GA 3F5LA 4AD3A 3C0SA 3HPAA 2O4QA 4UTLA 5DMLA 3PSWA 1F76A 5D2VA 2WKJA 3UEQA 3N2CA 4J2PA 3TX9A 1R3RA 2F2HA 4FXRA 4L1WA 1OX4A 3DG7A 2QMKA 5FEXA 3CV1A 4KQNA 5FCZA 1BG9A 5G4WA 2GGIA 1GKRA 1F3EA 2J25A 1S2CA 2HNHA 2XINA 4RX0A 3B40A 3JU2A 3VGGA 1A3XA 3HB9A 2BG5A 1HX0A 1Z44A 3NYDA 4GI8A 2Z1VA 5AHIA 3E5PA 3UD6A 3OP2A 4OQVA 4U3CA 4AIOA 1KM0A 2FGBA 3GD6A 1XINA 2HE5A 9XIMA 3LX9A 4L1GA 5HJXA 2ZRUA 1VZWA 4L1XA 4JTKA 4KCWA 3TOYA 4V2XA 3BURA 4AZ7A 1JRBA 2IS7A 4LB3A 1C8YA 5I3DA 3HOJA 1OD8A 1FWFC 1MDRA 3WH7A 1OZMA 3WH8A 3U2OA 4C65A 1IGSA 3C3NA 3B0VC 3EPNA 3XISA 1IWBA 3CUJA 5AECA 2NQ5A 3S5OA 2RGLA 1HN1A 1KGXA 1VHNA 2OG9A 3EWWA 3LHYA 3ITOA 4QLLA 3HBLA 4UTUA 2YCKX 4NZ4A 3C2FA 4RNJA 3MB9A 2WJEA 3BAIA 2WBKA 2Y70A 1K1DA 1V6YA 2XFRA 3M0IA 2YBVA 3U5UA 1GVQA 4O17A 2Z25A 1KCKA 5XIAA 4C6IA 1MFVA 4ECLA 5F1UA 4DX3A 4HPHA 2GYIA 1E51A 2PUZA 2ZRZA 3Q45A 2NT1A 4YVXA 3TXVA 3LTSA 1WX0A 4S2CA 1WZLA 2X0YA 3LCXA 2H90A 1EF3A 2Q3OA 3H8AA 3F4WA 4NI3A 3TYZA 1YXYA 1KFCA 1UMYA 4HNTA 1F6PA 3GNRA 4LBSA 1FWJC 1UKTA 2BXVA 3MVTA 1V4YA 3IVSA 1REQB 3PZTA 3UJSA 3FGCB 4HU0A 5D33A 3GHUA 4ZQCA 3N2OA 1XBYA 1FXPA 1B3WA 2Y24A 4BHYA 2RUSA 3H23A 4ZSUA 3BCFA 3GAYA 3WJYA 1N82A 5AYIA 4B4HA 1P0EA 4KWSA 1E1CA 4S38A 1UR4A 3LMZA 5DN1A 2PGEA 1CGYA 3C5QA 4H00A 1LRTA 4S3CA 4IPPA 4U2ZA 3T78A 4PB4A 1V51A 3W7RA 3ZXWA 4URIA 4INFA 4YTSA 2VFEA 3VX1A 5BWFA 2XDFA 1EJSC 4N0RA 3BW4A 1FHLA 2QAPA 1PDZA 4C6QA 1A5MC 1TCMA 2I5GA 3SFWA 1DQXA 2E68A 2NQZA 3W1XA 3B9AA 2BZNA 1MW1A 5HQMA 4BK9A 4ZOCA 3JRKA 1VEMA 4KT2A 1GUVA 1VP5A 4TXEA 3S2LA 1TPC1 4Z1YA 4U28A 2FKPA 4QLKA 1QWGA 5FL0A 1JZ7A 4DXKA 4IQDA 1GKQA 3DC8A 2PDCA 3ARPA 1IV8A 4B3KA 3GC2A 2TSYA 3GM8A 1GWJA 1P6WA 1ALDA 4QISA 4Q4MA 3W00A 3ABSA 4QJ1A 1W5QA 3BARA 3GXFA 3WLTA 3ZT5A 1BRLB 1PBGA 1QASA 4DJFA 4GOAA 1O95A 4XZ9A 2XN2A 1WP6A 3KBNA 3R25A 2YGYA 3MDWA 2E0PA 1ITCA 2E9BA 5KZDA 3KZSA 5FJJA 3RR1A 3CAKA 4MJMA 5HAOA 1A0DA 3OQ8A 4UTKA 1LP6A 1QI3A 2DV0A 4X9SA 1GZ1A 5EBAA 1OVDA 2BODX 2C71A 4ADTA 3NQ2A 2G4JA 2VCCA 1XGDA 2O9PA 4Q6XA 1DORA 1Z6KA 4GJIA 3O15A 3OBEA 1Z48A 3R0KA 3PAOA 4I3GA 1KKOA 2OWCA 3VKCA 2CZDA 2GSEA 3TFCA 2IPGA 5K3VA 4G6CA 4US5D 3BW2A 1L8PA 2OCZA 3L4TA 3M6YA 4V33A 1LYXA 4N7QA 2WOQA 3BW3A 2WWCA 3HIJA 1HT6A 2PDBA 3MUCA 4QS6A 3CZGA 3N3MA 1UASA 2BBFA 3M0HA 5C54A 1V79A 5CH9A 3SQMA 3DBNA 4HCLA 3CASA 1D8CA 2YCLA 2FTWA 3VKAA 2DGAA 1VPYA 1WKDA 2ZXAA 3VMOA 1A5SA 3FW6A 2P0OA 1W1IE 2WM1A 1VFOA 2YL6A 1J96A 2XVGA 3MMDA 1TWIA 3VNZA 5JBEA 1E6NA 2PDKA 3CZKA 1LLWA 2J6XA 1DE5A 3ARUA 1UROA 2W61A 4H1ZA 3BH4A 3M46A 4O28A 5CZSA 2PWFA 4XUYA 3PJXA 5D05A 1EFZA 4C5YA 1JCLA 4YTQA 1WOAA 2GVEA 1B4KA 4F9DA 4FX7A 2PI6A 3W24A 4JYDA 3M9YA 5D8ZA 1AODA 3NVDA 4B9ZA 2IXVA 1Z41A 3U2ZA 1NIUA 1XR2A 2H6RA 2AQOA 1AZ2A 2BY1A 1XYBA 4M1RA 3NDYA 3GE7A 3NQCA 4M6QA 2R14A 4LYPA 3MI6A 1RJRA 3ITCA 5TD4A 1EO5A 2AQWA 3CAVA 4WCJA 4K38A 4LB4A 3KTXA 1OCNA 4HJFA 1OCJA 2PDQA 3SRDA 1B3ZA 2IKHA 1X97A 4FIQA 1FX6A 1EJUC 4GG9A 3H55A 4JCMA 2J62A 3UR8A 2NXHA 3VOIA 4BQ4A 1H60A 3QC0A 3S6OA 1ADSA 3STPA 4GVIA 3TA9A 4WOQA 3WF0A 1PS9A 6XIAA 1X38A 3WQ5A 1Q6LA 5BXPA 3T05A 4HD5A 3UCDA 3V1PA 4AVFA 3R43A 2PTZA 2VDHA 2INZA 2HBVA 3GBEA 2DSKA 3BICA 5AVNA 2VL4A 3AIEA 2V3EA 5BU9A 2FLIA 4US6A 1JF6A 5EMUA 5AC7A 4H9XA 1KBLA 1W54A 2JF6A 3NJ3A 4WZHA 5EMLA 2I7GA 1UQZA 1P1XA 2WMGA 3KOXA 4DF2A 4FNUA 3WNNA 3VKKA 5CC7A 1B3YA 4F0HA 4JTTA 1UHVA 1GYNA 4Z2HA 3P62A 1ONXA 5IBXA 3RAOA 1DBTA 2KZHA 4UFJA 3DKLA 4H3DA 3IIVA 1E6RA 3L65A 1P5BA 1FCVA 3LEPA 1R3WA 4WDXA 3RRAA 4AUBA 1MFUA 3P5YA 1LBFA 1S1RA 4JBRA 1DHKA 1FBAA 1GVEA 4TR9A 1ELSA 1ZBVA 2I57A 3QW4B 1RBAA 3TQVA 3WF2A 4O13A 1OY0A 1FH8A 2WNWA 1AVAA 1MI3A 3BVJA 2X42A 3W02A 5BXRA 4RZ5A 4Y8EA 2P8CA 2WNNA 4B92A 3N2MA 4HK5A 3LRMA 4S3DA 1NDWA 3GW3A 5K9CA 5TQLA 3K13A 4Q8NA 3ZLGA 1W1VA 2E6AA 5GNXA 4GD0A 3TE9A 4ROPA 2YW3A 4GVGA 3H12A 3UZJA 4J40A 3MUY1 5K9DA 2E9LA 3BL3A 3SSZA 2F7FA 3CUFA 4JKKA 3I3EA 3TFXA 2QCEA 1XH2A 2D2JA 2HQAA 3VXGA 2OWXA 3FLUA 4UQAA 3F4VA 4IQJA 5M3WA 4LUJA 4Q22A 4AHOA 3PZQA 1R9XA 1Q6GA 3O8AA 3K2GA 4GVHA 3VE9A 3CUIA 4L7ZA 5HOSA 2VRKA 1M9HA 2Z27A 4JAWA 3U4FA 1K6AA 1QNOA 4B90A 4AY8A 5FJUA 4DB7A 5HJYA 2ISWA 5CJ5A 4L61A 3GHRA 1X1NA 4B2DD 3G22A 1Z9AA 2OO6A 2RJGA 4MNMA 2AQVA 4ZQMA 3TJ4A 5ECUA 3ZJ6A 3YPIA 4JIEA 1QR7A 2X41A 3N1AA 2QUUA 1ZY9A 1JFXA 2VEIA 1XYAA 2Z00A 2ZZ6A 4HK7A 4YWIA 1EJWC 4YIWA 3VNKA 3O2LA 1O4UA 5I0DA 3CQJA 1XDMA 5F2IA 3BG5A 3I6RA 1XLGA 4XD6A 5H1WA 3IJ7A 2V5CA 4A3HA