3LEPA

Human aldose reductase mutant t113c in complex with idd388
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPCGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 313
sequence length 313
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lepA00
2PDCA 1EXBA 4XVDA 3RX3A 4HMNA 3ERPA 3R6IA 1AFSA 3BV7A 2BGQA 3FX4A 3EB3A 1AH3A 1X96A 4LAZA 1M9HA 4FALA 3LNMA 3O0KA 3Q65A 1X98A 2PDPA 3LD5A 2PDYA 2PDMA 2ACSA 2HVNA 4L1WA 4JIRA 2C91A 4YVVA 2PDIA 4WDTA 1YNQA 3FJNA 4WEVX 3LZ3A 2P5NA 3UZWA 4JTAA 4IJRA 4FAMA 2IS7A 4GA8A 3V36A 4PRRA 1Q5MA 3RX2A 2DUZA 3B3DA 2CLPA 4JQ2A 5DANA 2FZDA 4XK2A 1EF3A 3C3UA 1ZUAX 2R9RA 3N6QA 2NVCA 1Z3NA 2PD9A 3V0SA 3R94A 4MHBA 3O3RA 4H7CA 2DV0A 3T42A 4XZMX 3UP8A 1J96A 2WZTA 4JQ3A 1Z89A 3UFYA 2A79A 1ZSXA 2FGBA 2PDNA 3M4HA 1QWKA 3LUTA 1PZ0A 2ALRA 2FZ9A 4XZNX 4XO6A 3F7JA 1MZRA 3BCJA 4WRHA 3KRBA 3LN3A 4AUBA 3MC5A 3VXGA 4DBUA 4DBWA 2IKJA 4WGHA 4LBRA 3LQGA 2PDWA 4XZHA 2BGSA 1PYFA 4XZIA 2IPJA 2ACUA 1YNPA 4YS1A 1S2CA 3WG6A 2I16A 2PDQA 5HNUA 3EB4A 3MB9A 4XVEA 1C9WA 1AZ1A 1GVEA 3RX4A 2DUXA 2PDKA 1HW6A 2HE5A 3UGRA 3COTA 4PR4A 2IKIA 3R8HA 1RY0A 2QXWA 2PDLA 5KETA 4DBSA 1QRQA 2IQ0A 5LIXX 3LEPA 3DN5A 1X97A 3WBWA 1Z9AA 3D3FA 3ONBA 1K8CA 2HEJA 3R7MA 2HVOA 3GHTA 4PUUA 3WBYA 1ZQ5A 5LIUX 1MRQA 2PDGA 4YVPA 4GQ0A 4DZ5A 4ZFCA 1ADSA 5AZ1A 4PMJA 3V0TA 3R58A 3GUGA 4JTCA 3ONCA 5LIYX 3M64A 1A80A 4QR6A 3LENA 1SM9A 3DOPA 2INZA 4GIEA 1OG6A 4Q3MA 5AZ0A 2IKHA 4LB3A 1YE4A 4PRTA 2J8TA 2PDJA 4RPQA 4IJCA 4JIIX 3CASA 4XAPA 4PUWA 3LZ5A 1IHIA 4XZLX 3UZXA 4ICCX 3LQLA 3U2CA 4WDWA 1VP5A 4R9OA 2ISFA 1FRBA 3V0UA 5LIKX 2AGTA 2PDHA 2PDFA 4FZIA 2PEVA 4F40A 4WDXA 3EAUA 1ZGDA 2PDXA 4XO7A 4IGSA 4LB4A 1MI3A 4YU1A 3P2VA 2FZBA 1AH4A 3GHRA 1VBJA 3UZZA 1LWIA 3CAVA 4EXBA 4NKCA 4WDUA 1PZ1A 4JTQA 4GCAA 3S3GA 5HA7A 2VDGA 3G1RA 1Z8AA 1AZ2A 1AH0A 4H8NA 1JEZA 2F2KA 2HDJA 3UWEA 4LBSA 3H7UA 3WCZA 2PF8A 5JH2A 3QKZA 2FZ8A 5HNTA 3BURA 3LBOA 4JQAA 3V35A 1XJBA 2PDUA 1T40A 4HBKA 4OTKA 3WBXA 2FVLA 4JIHA 3CMFA 4JTDA 1PWLA 4JTRA 2ACRA 2HE8A 1PWMA 1IEIA 4JQ4A 3BUVA 2IPWA 3R8GA 1T41A 4LAUA 2NVDA 3GHUA 1RY8A 1US0A 2PD5A 2ACQA 1HQTA 1LQAA 2HV5A 1S2AA 3CAQA 4FA3A 2R24A 5JH1A 1XF0A 2IQDA 4YVXA 1S1PA 1EL3A 3R43A 4GACA 3NTYA 4QXIA 4L1XA 1Q13A 1XGDA 2F38A 2IKGA 4EXAA 1YE6A 1EKOA 1RALA 2PDBA 4JQ1A 2PFHA 2PZNA 3CV7A 5C7HA 2WZMA 3G5EA 1S1RA 4Q7BA 4GABA 2IPGA 4G5DA 4QX4A 1UR3M 3H4GA 2I17A 1R38A 3UYIA 3GHSA 3H7RA 4I5XA 3M0IA 3N2TA 4GQGA 4QBXA 4ASTA 3UZYA 5M2FX 3Q67A 2BP1A 3CV6A 3UG8A 5LIWX 2INEA 2IPFA
chains in the Genus database with same CATH superfamily
1TZ9A 2PDCA 3G0SA 1AA1B 3G8RA 2JFEX 3TJIA 2P50A 3HPSA 2CLMA 2E0PA 4WSKA 2KZHA 3ABRA 4U2YA 3MZ2A 1SZGA 1H7PA 1MW0A 4LF2A 3OTRA 4EKJA 1HKMA 5BCAA 4MPKA 5L9FA 1IZKA 5AHFA 3BK0A 5AHMA 1A5OC 3NQAA 4EVZA 4M7SA 1Z7AA 1AQFA 3B0UX 2GVJA 3B06A 3O15A 1SO6A 1B3VA 1JF6A 3U5YA 1TE6A 1TE1A 4LYQA 3QPEA 1RLDA 2WNZA 3KBMA 5C55A 1XLEA 3RX2A 3BW2A 2VC6A 2ZADA 4MDPA 4PEKA 3ZT5A 3L2LA 3E74A 4ZCWA 3ITXA 1E6SM 1MQPA 4J9JA 4C1NA 1QASA 2KX9A 1K9FA 3WJXA 1TR9A 2NUXA 4PFMA 4X2RA 4KESA 1K02A 3QSTA 4LUTB 3MCMA 4BF7A 1QMLA 3DAQA 1PCWA 1UZ1A 3UCCA 3C8FA 3VIMA 4DLFA 3QR1A 3UJRA 4QDPA 1LP6A 1OGBA 1EO7A 3N2CA 2P0IA 4K3ZA 1OC6A 4JTFA 4Q4PA 2QLYA 3GFYA 5KEZA 4CN1A 1UWQA 3VGFA 1Y8BA 1W9BM 3WF4A 3LI1A 4LW7A 3FNDA 3W84A 2B7NA 4B5XA 1L6FA 3TQPA 4Q6JA 4XZIA 9XIMA 1B9ZA 3VUPA 2PSNA 3UT0A 4DEFA 1O5QA 4ZB2A 1XUZA 2P3EA 1AW1A 2A6NA 1P6WA 3W6MA 3S6TA 3WH6A 3MJYA 1Q6CA 5HNUA 3MB9A 1G67A 4IHCA 1UG6A 2REQA 2XFRA 1R2TA 1XIGA 3MKKA 2C79A 4GINA 1IIGA 1P5BA 4ZBCA 2D20A 2R1NA 4N6FA 5GPRA 1U83A 3QXBA 3TQVA 3VIGA 3W7GA 3SGUA 2GJXA 3M0JA 4IIEA 1O1ZA 2DVXA 3PM6A 2NX1A 2OZ0A 4J5NA 3IJLA 4DX3A 3P5ZA 4CN4A 3G1DA 2IQ0A 3ABOA 4JKLA 1NEYA 3M0MA 4OGZA 1TYGA 4PCNA 4FK9A 3RIKA 5H1WA 3SSJA 3AS0A 2I56A 4RDWA 3IGSA 4PUUA 3OP2A 3P5YA 5A8GA 4DUOA 1MRQA 3STGA 3ENLA 1IT8A 1ZAJA 1OT1A 2DDXA 1GOOA 3CTTA 2P53A 3R58A 3C3NA 1OYBA 2R94A 5I23A 3OU8A 2PGRA 1VF8A 1OFRA 1WNOA 3L0NA 1XDJA 1M68A 7XIMA 4UFKA 2CLFA 1O7AA 2IMRA 3AIEA 2ZBTA 3E2QA 4FNRA 3IIOA 5I2UA 4L65A 2XSBA 2D2JA 4AC7C 2R1LA 2VWSA 2HS8A 3HBLA 4WF7A 1M6JA 3LCHA 1B3OA 3WDIA 3EBVA 4XB3A 1RPKA 3GM8A 1E4NA 3S2LA 3E49A 1K8ZA 4NJJA 3LPFA 4OWGA 1I2RA 4WDWA 1K7EA 4ZSUA 3M7WA 2VFEA 3TN6A 4C60A 1S5NA 1K9DA 4B3KA 4LV4A 4DUXA 4O1FA 4D6HA 5ABHA 4PN2A 4MJMA 1GPWA 4IL0A 2PRLA 1BKSA 1ITXA 3RRXA 1QBAA 1FBAA 1KWGA 1LRNA 2GQAA 5BU9A 4QSHA 5F2GA 3WK2A 1B0IA 4UTKA 4WXYA 1LWIA 2VXNA 3CT2A 1PZ1A 1V6TA 1OT2A 1JVNA 4G2DA 4JGDA 4MY8A 3ALFA 5G2HA 3S3GA 1PV8A 1RVKA 1R2SA 2J75A 3HPXA 5CSYA 4PB3A 2X1RA 1LZOA 2C18A 4KKXA 1AH0A 1WDSA 4R9XA 4QHRA 4AHOA 4S23A 4RW5A 1PAMA 3CHCA 4GQRA 3OLEA 4AF0B 2ZTKA 3AAMA 3JU2A 3HO8A 4O1DA 5FD0A 3TSDA 2DH2A 2LLEA 4ADUA 3ZLGA 1QNPA 1PXGA 3R8RA 3NCOA 3P6LA 1VB9A 1A5MC 1TRDA 4IMAA 2XH2A 4JIHA 4AMAA 5C5YA 4LUTA 1RZMA 3KX6A 1ONWA 3GVQA 3AHTA 3GTFA 4D6IA 4XBJA 3M41A 5B7YA 3B8DA 4BK9A 3SIZA 3MHFA 1G6CA 3FK4A 2BG5A 1W8GA 1LQAA 2D3NA 1F05A 4HU0A 2OLSA 4LBUA 2V2DA 3WD3A 5JH1A 4M24A 4LOCA 3MVTA 2D0FA 4A3YA 2ZZ4A 4C7GA 3URBA 3VI2A 4QXIA 1Q13A 1XGDA 4NX0A 3W1TA 1VJZA 3AS2A 4NJHA 4UB9A 3NYDA 1XIDA 4P8UA 4TTUA 3MWCA 1YTKA 3K8LA 1S1RA 4LY8A 3P60A 5AYYA 4PL2A 4TX6A 2YA1A 4W93A 3TJ4A 1TJRA 3GHSA 3K4AA 4F3HA 4ATWA 3M0IA 2YZRA 3VIIA 1E3ZA 4X9SA 4JIQA 3L68A 3IJDA 2INEA 2E1DA 1B90A 4TX8A 2WBKA 1FVPA 2Y4SA 4FMVA 1SJBA 1Q2SA 1AFSA 1VGAA 1EFZA 1KQZA 3P93A 3PF3A 4HK5A 5CEWA 4ZOEA 3EX2A 1EOMA 4LAZA 4HTYA 2X09A 4XBSA 1PTAA 4AXKA 1TA3A 1XISA 3GDKA 4IIHA 4ZQRA 2OQLA 4WR3A 1VFFA 2ZXAA 4KEZA 2X16A 2V8ZA 1YNQA 3PJTA 2ZWYA 3WL0A 4P61A 2WNNA 2Z25A 1F74A 4QDWA 3KBWA 2IS7A 3VDHA 4GY0A 3VIJA 2VFHA 1TFVA 2VD8A 1VJIA 4LUYA 2I5IA 4LC8A 4C91A 2BY0A 1GVRA 1X6NA 4NX5A 3QGVA 1E0VA 3A9BA 1K03A 1J0KA 2BTMA 1SJDA 2PGWA 3DX5A 4NIRA 4D8ZA 1WOBA 3CC1A 1Q6RA 4QNEA 2BB0A 1EC8A 4TVDA 1TJPA 3K4DA 5JVLA 1I2QA 1WYIA 1JGMA 1XH1A 1G1YA 3B40A 2MANA 5C2GA 3H12A 2QCMA 4LNCA 1QPKA 2NXGA 2XUCA 3M6DA 1FH9A 3NUKA 3PFRA 4JQ3A 3I6TA 2I9UA 3W38A 1M01A 4FIRA 3NO5A 5CZSA 1DWGM 1LBMA 3HFTA 4G7EA 3D6NA 2BBFA 1T8QA 3KDNA 4LVFA 2FZ9A 1MZRA 4FSAA 4H9ZA 5TAOA 4ZEPA 3KOXA 3BLPX 3WD1A 3BAYA 5HXMA 1MEIA 4GBDA 1MFUA 2Z0IA 4LBRA 3BV4A 3N15A 3WDPP 2NXHA 1BGAA 2V69A 3A4JA 4MFEA 1QXLA 4F0RA 4AY1A 1Q66A 1LWHA 1SSDA 2Y62A 1UKSA 3TN3A 3BSMA 1EJ7L 2Y63A 3TA9A 3UWVA 4AF0A 1IT0A 2PZ0A 1YBQB 3JZEA 3NL2A 3BG5A 4A3RA 4LGXA 1HP4A 4TXEA 5D9NA 1VPQA 3A23A 2BASA 3CNYA 1QVBA 3PZNA 4ZE4A 3TP4A 3W7MA 4MFDA 1HKIA 4E0CA 3ARZA 3DFQA 4GC4A 1E4IA 3BCDA 1LUCB 4UWMA 2WPGA 4UTTC 2C71A 3R2GA 5DMNA 4B5UA 1JZ7A 4TUFA 2BDQA 4IWWA 4Z2HA 4NILA 3TWBA 3BAKA 1UASA 3GBEA 3GXPA 4DAIA 1CGWA 2HVOA 2VZOA 3E02A 3WY1A 1YW1A 5CQ1A 1TJ1A 3EOUA 4F9DA 2QZRA 5DO8A 2G97A 4JTCA 4ICNA 4XAGA 3LXCA 4FIQA 4ZXOA 1HO1A 3G6LA 3N2XA 2FPYA 4QR6A 1R87A 1W3LA 3WL1A 4RZBA 3FAXA 4UTUA 2CZEA 2J79A 2E3ZA 3R13A 2J7CA 3TYZA 1O5RA 4J40A 5DN1A 3HG3A 1GHRA 5HQEA 3T0CA 3BGAA 2NWRA 3EOOA 2Q71A 2DPEA 2VVSA 5FJTA 1EHNA 4IJCA 3WDRA 4ZZ9A 1JPIA 1NQKA 2X05A 3UESA 3M47A 1H7WA 4DI9A 2HJPA 1MEHA 1VBGA 1X1ZA 4NUWA 1OX6A 1A5NC 1GQLA 1TMHA 1E6RA 2E6YA 5CAKA 2XH7A 3HTWA 4PTMA 3RJYA 3D0CA 4WDXA 4XD6A 2NUYA 3DECA 3QLLA 1VFUA 4ORMA 3K2GA 5HQLA 4WX2A 4IM4A 5AY7A 2Z1XA 5FEWA 1IWBA 4HHMA 4K37A 1V51A 2W62A 4YN5A 3M16A 3W2JA 3BLFA 3G1RA 1SMDA 1AZ2A 2GUBA 1VRDA 5TF0A 2HDJA 3EXTA 1V02E 4M6VA 4F0KA 4HNLA 2VWTA 3W7EA 1U33A 1Q8AA 4KEUA 1ODUA 4ZL1A 1A50A 3EX4A 4NAEB 2AOSA 2A3BA 1DPMA 3PWGA 1ICPA 1OF6A 4H6EA 2BVDA 4MB1A 2Z1VA 4GUFA 2EBNA 1KNWA 4O0KA 1US3A 1R5YA 3GY1A 1SW0A 2DT0A 4D8AA 4AZ6A 4MUZA 3E2VA 1R9YA 4PMRA 3LHWA 3WBAA 3THCA 3VNZA 3MMDA 4OFCA 4LAKA 2XWDA 3WQFA 2Y2WA 1I0DA 3I3DA 4F0HA 1FWGC 1V93A 3JZUA 3HQNA 3ATZA 4AIBA 2ZC8A 3W85A 3ARRA 3NQFA 3I10A 3U8GA 2JIEA 4L61A 1DJZA 2WMIB 4F2BA 5DFAA 1NP2A 1G7UA 1Y5VA 2WZMA 2WM1A 1RAKA 4UZSA 4X2PA 1WBHA 3H4GA 4H8UA 1VPYA 2YL8A 2GQ3A 4PB4A 5AKQA 1TX2A 4DJEC 4NG3A 4AIEA 1N2VA 3RR4A 4DF0A 3P0WA 3VKDA 5CPNA 2QGHA 4HPJA 5ABEA 2VP8A 1R8LA 3DG3A 2YXXA 3ITVA 4H6QA 4I9TA 3G1YA 3ZSTA 1TTJA 1JDDA 4G1KA 3FAWA 3TLQA 4A29A 2CLEA 3H22A 4CKQA 3MSDA 1ZCCA 3A3WA 7ODCA 1EJXC 2R82A 2BVYA 5D05A 1EUAA 5SWUA 4PSPA 4ATLA 1QBBA 3S6DA 3C5QA 4O18A 4WDTA 3LYEA 3A21A 3FJNA 4IOTA 2ZUUA 3E0FA 4DIAA 1KW1A 2HNEA 3TU9A 1DIKA 1G5AA 2DSZA 4UMAA 8XIMA 2G3IA 3V75A 1GEHA 3V36A 1XCWA 2XIMA 2G5WA 3MVIA 3E6EA 4LCQA 1ZALA 1NOFA 3MP5A 3LM7A 4N02A 5DT7A 4HYVA 4O4VA 1SR0A 2QEZA 4JQ2A 3TC7A 3TNBA 1K4GA 1JXKA 1FQ0A 3TZFA 3GWQA 3O6CA 5DXXA 4EWJA 5DEZA 3W0KA 1RV8A 4BEQA 3F2CA 4L6DA 1DXEA 3OGVA 4HNUA 1TIWA 1UC4A 1FOBA 2QJJA 3O0FA 3UERA 3WQPA 3DERA 3VCRA 3MCNA 4LC6A 3VIFA 3GAKA 4JY9A 4TMBA 3T78A 3S83A 3EKGA 2H6RA 1DWJM 3IRDA 1WKEA 5E0FA 4I9JA 1I60A 2C13A 3F7JA 2WCAA 5GQBA 3EOLA 1HJQA 1GUVA 1DJIA 2VEPA 4DBDA 3VXGA 1UROA 1FKXA 1GVFA 5MHBA 1UKOA 2J88A 3GXNA 1M03A 4X0VA 5DY3A 3IV3A 3SR7A 1OFBA 2ZX8A 3CIXA 3SECA 1B54A 1O68A 1JCXA 1VZWA 2WSKA 3G6MA 1CYGA 1B5TA 4UQDA 3BG3A 4E2VA 3AMLA 4NAEA 4PR4A 1O1HA 4ATDA 2WJDA 4GK8A 4H9MA 1W1TA 4XSLA 2HNHA 4DO6A 2Y8VA 2PTDA 4B5VA 3P7YA 5BOOA 3ZT7A 2PAJA 1O94A 3N13A 1XFBA 1XLKA 1L6SA 1HG3A 1JCMP 1OX5A 5CCZA 1H7OA 2VTFA 4FNPA 4JTLA 5IOBA 3WF2A 1PX8A 1L8PA 2OG9A 5J04A 4PUJA 4QJ4B 4TIMA 4QE1A 5FF2A 4JN6A 4L4PA 3TQ0A 3LY0A 4AD3A 4LV9A 4BCEA 1JYXA 3CHDA 1OK6A 3U7VA 4DZ5A 3KP1A 2OB3A 2Z6IA 2FMOA 2A3LA 1V3MA 3IUHA 2WMIA 4UOQA 1R3TA 2RDTA 1WAUA 4IQLA 1TPH1 1NSJA 2CZVA 1V6YA 3EMQA 1QHPA 3AHZA 4L4MA 4XUGA 4UR9A 3I7RA 1KC7A 3W1LA 4JAWA 1B4KA 2OT0A 1R0MA 4DWSA 5A69A 2X1SA 5K7JA 4LX4A 4PODA 2QJHA 3LK6A 3BMWA 2ZYFA 3VGHA 3U2CA 4DJDC 3FYYA 3MMWA 4IH3A 4QG9A 2XGIA 1CI1A 3W25A 3LS9A 4LYRA 1HN1A 1UMLA 4AWEA 1J79A 1GOXA 2J13A 1V5XA 1TQXA 1XGZA 1MQQA 4QSFA 2W27A 1XDMA 5I02A 4AMCA 3GVWA 2Z28A 3GE7A 1RQEA 1FDJA 2A7RA 3TAKA 1QU4A 1RBOB 1UZHA 3ZWSA 1PPIA 3SAZA 2CBUA 3NWRA 1V3JA 4E5TA 1XIEA 4K68A 4UMCA 4KCVA 1W0MA 4MWAC 1WDQA 3VNDA 1GVQA 4ZTYA 2FVLA 1B9BA 1D3HA 3OZMA 1EGZA 5BRPA 1JGIA 3WNNA 3U57A 3GR8A 3UXKA 2PMQA 4WKHA 1XLFA 1CB7B 1I2NA 3EX3A 3APYA 4UTTA 1VYPX 2O55A 4QAIA 3DCPA 4J4KA 3W7CA 4ZSTA 3EGJA 3CAQA 4P5UA 4DO5A 3USZA 3Q37A 1LJYA 4C6PA 1U30A 4EIVA 4MNLA 2W9MA 1TSIA 3L66A 4KCUA 1JZ4A 1E56A 5EMMA 1BVZA 1FFQA 3V1PA 5JIPA 5EU9A 3QV7A 3L4VA 1TREA 2EEXA 2PFHA 3MSYA 2E6AA 1XBZA 3PSWA 1P0BA 1TPB1 1JZ2A 4I3GA 4MSSA 3EDEA 4YTTA 2RUSA 4O53A 4LCRA 3LOTA 2YX0A 4BQ3A 1UR3M 1MUCA 1XLHA 4A8IA 1GJPA 4DELA 4I5XA 1WXYA 4J3WA 4GQGA 2RH9A 2B4GA 2JKEA 2YZ5A 3VFLA 3UPBA 3CUZA 4Q8OA 4NY2A 3K4WA 3EMZA 3DFYA 4B3ZA 3O06A 3KS5A 4GJIA 4HB7A 4UQAA 3LGDA 3UWYA 2F8QA 4GYPC 4UFIA 3IS4A 4L7ZA 1V4YA 3EB3A 3M9YA 1X96A 4JL2A 4KWWA 4H9TA 4MNJA 1BTCA 4S2BA 3RMEA 5C9XA 3SFWA 1OF8A 2ZRXA 2DSKA 1SJAA 4JTUA 4O13A 5DRCA 3LLDA 1JDAA 3AOFA 3GW0A 3HPZA 3B8TA 2PLKA 2C6QA 1VJSA 2ZXQA 3UZWA 1C8YA 4FB7A 3B8SA 1TIMA 4PRRA 3IV8A 1D9EA 4XISA 1F6KA 2J6VA 1SFTA 3ZMRA 3UVIA 1HKKA 2Y7DA 3CQJA 3KWSA 2XM1A 2CWNA 3H2EA 3N4EA 3NXLA 2NVCA 3S9YA 1LT7A 5CPTA 4RZ6A 2DSUA 2VR2A 5CG7A 1P0KA 3ITLA 4RXFA 1SFJA 1VCFA 3GH7A 1I45A 2WQDA 2BXYA 3W81A 4OUIA 3RJXA 4R34A 5BU6A 3GZAA 1UJPA 5B7ZA 3LBCA 4RE0A 1FWFC 3BCJA 1LTDA 2VELA 2WZEA 3KBVA 4WRHA 2AQVA 4O1BA 4WKAA 4DBWA 4PFHA 5BMXA 4PBFA 1WKYA 2BGSA 2RKXA 2JQXA 5DMYA 1DJHA 1GOQA 4YCPA 3ME3A 3V5FA 5AYIA 1O12A 1XBXA 5I0DA 2R14A 5KSWA 3H23A 1W3TA 4M8UA 2YW4A 4M3PA 1UKQA 4HK7A 1J0HA 3GNOA 3W7PA 3W1NA 1G4TA 1SSGA 3UGRA 1ZAIA 4DM2A 1JAEA 4B9YA 1F76A 3INPA 6A3HA 3O1NA 1GVOA 7REQA 4DJEA 4GISA 3SCOA 2OKOA 3N19B 2V0TA 4PCSA 4IIGA 1V3HA 2Q8ZA 3AU2A 3C2RA 4S39A 5C8BB 1DP0A 3L2IA 4I8YA 1UBSA 1ZRQA 5PTDA 3UNDA 4LU0A 1E9LA 1UR2A 2WWCA 1DOSA 1I0BA 4DUVA 4JKMA 3VDGA 4JDYA 5I6SA 3R1ZA 3EKZA 3QW3A 4NNAA 1E51A 4ROPA 3RK8A 3PWIA 4JDBA 1LL4A 1QUMA 3VKBA 4OE7A 2WAGA 1ZBKA 1MXGA 3H8AA 3LMZA 1WX0A 4GNVA 3TV8A 4F79A 4UIOA 4RNJA 3CZJA 3WK1A 1GJUA 2V5DA 1I9CB 2YPIA 2V3FA 5CBJA 1AQ0A 1R9XA 1OABA 3CWOX 4AFYA 1ISVA 1F3TA 2V3DA 1F9CA 4JEQA 1GKRA 2WJFA 1WZLA 1NJJA 3NM1A 4GNJA 3BARA 3WMCA 3WDJA 2I14A 1TRIA 3GUWA 4MNMA 4AD2A 3E38A 5AZ0A 3NL5A 1UWUA 3LTSA 3DDMA 3B05A 3L4YA 2PDJA 4MWAB 5AOUA 1DJQA 3WLPA 4W7WA 3RFAA 3GKFA 4LJ3A 4DJED 3L0GA 3WNMA 4UTIA 3SSZA 3LRLA 3ID7A 3ZJ6A 4A2SA 2VFIA 2WSYA 1RK6A 5FSDC 2H90A 3WJWA 1IXNA 3AMGA 3M0ZA 1G7VA 2FB3A 3GNDA 4FZIA 4EAMA 2XIBA 2Z1SA 1Z44A 4PUMA 1TMLA 5EBUA 5DX7A 1H5YA 2P88A 1KM4A 3PPHA 4Y96A 3NPXA 3KZPA 4IGHA 2VGFA 5D09A 1MW2A 1KB3A 3OLDA 1AD4A 4Y9PA 1DJWA 4NZJA 1XI3A 3THAA 4UQEA 4L9YA 1WCGA 2QHAA 2YA0A 4Z0JA 3WDQA 2X0YA 1FA2A 3WUFA 3WCZA 3B8UA 2FYMA 1PO9A 2FZ8A 1EA0A 3TTEA 1XLJA 3GC4A 3EA3A 3GVVA 3P14A 4UQCA 2WVSA 3WMBA 1H4PA 4TR9A 3BMXA 3DFTA 3BW3A 4B91A 1ZENA 1PBGA 4Y7EA 4I5UA 2Y5EA 4LUSB 2ZX6A 1ZBWA 3IVSA 3E96A 3CMFA 4MTVA 2FH8A 2QQ6A 4FF7A 3AZSA 3VMNA 3AS3A 5H6HA 1H51A 1W5NA 3EPMA 2QGYA 1UUQA 1C29A 3VIKA 2XVLA 2B7PA 5CH9A 1KM2A 2FHBA 5HMEA 3WIJA 1EJTC 1W9PA 3A12A 1BQGA 1S5WA 2NV1A 3B9DA 3L2MA 4HOZA 4NYUA 4AVOA 3A3HA 2OU4A 3IEBA 2WLYA 2B81A 1HGWA 1LDCA 3R25A 4URIA 5U4NA 3ABZA 4HT3A 4HPHA 3UXIA 1ZJBA 2XFWA 3T8LA 4JOMA 1TWIA 5HMDA 3OLIA 4QAWA 4PTNA 4LWWA 1JYWA 2YFOA 3AHYA 4IFKB 3VUSA 5A6KA 5EA9A 1Z69A 5FESA 3NJ3A 4GABA 2IPGA 3NVDA 3BICA 4HPXA 2EPHA 4H8HA 3U2EA 1CIUA 3WX7A 5LHEA 2VJXA 4GLEA 1G94A 1EP2A 2QULA 1K6AA 5D2YA 4LVGA 2BP1A 1XINA 5CBBA 1DJGA 1ZB5A 4K39A 1KA9F 3WNKA 1T96A 2QDHA 2VRJA 5AHEA 3A4AA 2Q01A 5DBTA 3R6IA 4H7VA 5DLCA 3SGGA 3WLQA 4DJDA 1SZNA 4C6DA 4D71A 3FYOA 4TOQA 2EF9A 3GR4A 5HNRA 3Q65A 3RDKA 1MUWA 1VEOA 2NV2A 2QV5A 3NGFA 4EF9A 2YGYA 4M56A 1BF6A 3MV01 2OTDA 4RK8A 4GY7A 3RGTA 3GNPA 3WUEA 3A3XA 4JTAA 3AS1A 3N4FA 3BTNA 1T99A 4K36A 3G24A 2HQAA 3QV9A 3MU7A 1NTHA 1YXDA 2VR5A 3WKZA 1W1PA 1A5LC 3ES7A 1UBPC 2CLPA 3CUXA 4M81A 7TIMA 1X6LA 4F48A 1KO0A 1A53A 2C14A 4MWAA 1Z3NA 5EMKA 1EIXA 4IPNB 3T08A 3VCCA 4QS6A 1MFVA 1XX1A 3LGGA 3BLOA 1JXJA 3RMJA 2C1GA 4JTEA 1OFDA 1H1YA 1OINA 4ECLA 3CYJA 2O9RA 3W70A 3W23A 4DJDD 2VC5A 3CAKA 4IQDA 5HBFA 6TIMA 3QGKC 4WSHA 1E72M 4YHEA 2QVNA 1UD4A 4MB4A 3W6LA 1TWZA 4HIBA 4WD0A 1KXHA 5E6ZA 1ZJIA 4FHAA 3REQB 4I8DA 3BANA 2CU0A 3PZTA 2Q3RA 4GG9A 4JNYA 2OVLA 2PODA 3CM4A 1B3ZA 1UP3A 4WKFA 2Y7FA 4HHPA 4P7NA 1EYEA 1SW3A 3W87A 3LGEA 5BRQA 4Q8NA 1GPFA 4Z1BA 3R0UA 3WDHA 1UP0A 1Q6DA 3V7PA 2Z00A 3OO2A 3LCGA 5EMLA 3TSBA 4HZMA 1KM3A 4WXZA 3A24A 3ARWA 4MWAD 3TJXA 1GYLA 1W8SA 3TYUA 4BFAA 2YLLA 1S3TC 3FDKA 3UG5A 3OW1A 2HZGA 4I7VA 1TVPA 2VZTA 4NI3A 3LHYA 3EA1A 3LEPA 1EGMA 2YBUA 4ZE5A 4Q8QA 4U3AA 1VIWA 4F9JA 3ONBA 3R7MA 2HTMA 5FCZA 5LA2A 3ZR5A 3VM5A 2DVUA 1KD0A 4UR7A 1KLYA 4HNTA 3MY9A 2TSYA 3OG3A 3OG2A 3QQWA 1ADSA 5AZ1A 2AMXA 1HVQA 3V5OA 1NARA 2ZZ3A 4AIOA 3PUEA 3O6DA 2BNJA 4IFKA 4M5PA 1FWJC 3KVJA 3W76A 2NT0A 1KQYA 2Z6JA 4C5YA 3W1MA 2QT3A 3R0KA 4Q3MA 3TCSA 1H61A 3W1RA 5F4SA 3BPWA 4HD5A 4Q22A 4C6OA 3HGRA 2BXVA 1ME8A 3O63A 4RZ5A 1VEMA 4ERIA 5CPMA 1LORA 3QKEA 1LBLA 3MA8A 1NU5A 4NJIA 4KGLA 1BHGA 4JFSA 1EP3A 3EXSA 2CKSA 5I79A 1T8XA 3URNA 6XIAA 1E1EA 2GGEA 4JIPA 4NZ4A 1L0PA 5LIKX 2PDHA 1X38A 1E70M 4O1EA 4N7QA 4F40A 3VZYA 1G9HA 3SY1A 3S5SA 3GSMA 3PUOA 1BYDA 2FVMA 5FOOA 1XCXA 1HUVA 1LWJA 5GVJA 4YU1A 1UD5A 1W91A 2PUZA 1KCXA 1V6UA 4CUCA 4EPDC 3I68A 4OKDA 4NJKA 3T6CA 1D2KA 1UPPA 3E0LA 4LUIA 1MNSA 3M5VA 3MI2A 1CXEA 4YIWA 1V8EA 4U10A 3TH6A 1XLCA 1JEZA 2AAAA 1QHZA 3H7UA 2YSWA 4KRTA 1WKFA 1TTIA 4UC5A 1G4PA 2BHZA 2XVNA 4D9PA 1MVYA 1EEPA 1BTMA 1IT7A 3KHJA 2A4AA 4UTLA 1CCWB 4GJ1A 4AYGA 3L0KA 4NZFA 3UU0A 4HBKA 2OOFA 3AQUA 2UY3A 2CW6A 1JIBA 4FX6M 4YNGA 1THFD 4ZOBA 4M80A 2Q09A 4O0ZA 4JS3A 3SCRA 4E4PA 1EBHA 3N9KA 2ACRA 1GGOA 3HG5A 4QFUA 2FJKA 4XSMA 3E0VA 3HN3A 2WLZA 2E5CA 2QR6A 2GGJA 2GQ9A 1GZJA 4IPIA 3SFKA 3E0IA 1SVDA 5HAOA 2J77A 3OBKA 2HISA 2W91A 1AW5A 4MJ4A 1E6XM 3W07A 2JK2A 3AO0A 4BF9A 4Z2GA 2JBMA 3TC6A 1MDRA 7TAAA 3W73A 1FFRA 1RUSA 1YPXA 2RJHA 2ZFAA 1OVDA 4TX9A 3B0VC 2IQTA 1CW2A 4CNNA 3EPNA 5JIWA 3CJPA 4E2BA 2OCZA 3VC5A 4TMCA 1W2PA 3GYCA 4N6EA 4NXKA 2F7FA 4FXSA 1REQB 3KVKA 4G1NA 4GI9A 4ZB5A 1S5VA 2I17A 5DCDA 2W0UA 2ZTJA 4GQQA 4H9YA 4LS0A 1KFCA 4CD7A 1OZMA 3F4CA 3TOYA 4H6KA 2A6LA 3HGSA 5M2FX 4S3GA 2NQHA 5FI8A 1JR1A 2ZDSA 1BSIA 1X39A 2IPFA 1KM1A 5XIMA 1XD1A 4XVDA 3ERPA 2VENA 2ZUWA 1XGEA 4QITA 1RQHA 2ADAA 3A4WA 2ZCGA 2YL9A 4AX7A 1OADA 1BD0A 2GDVA 2ZRYA 3DHDA 3I6EA 1AH3A 1AG1O 3DH7A 1PSCA 3CUFA 5HPCA 5EB8A 1BRLA 1VC4A 2VFFA 3PSVA 3K8MA 4Y90A 5I03A 4I7WA 1JUKA 1RP8A 4IISA 5L6UA 3LPOA 4TTGA 3IK4A 4XKMA 2WNWA 1ONXA 3NO3A 2QUTA 4IXHA 3LZ3A 1BGGA 1DBTA 3CL6A 1B3XA 1EYWA 1GVYA 1KKOA 1QOPA 4IPJA 4WUIA 1ECQA 4LVDA 4F2UA 3N73A 4DO4A 1TX0A 4NZ3A 3GB6A 1EUNA 3UR5A 1QPOA 1EF2A 1TCMA 1IEXA 3N9RA 4BQ2A 3B9EA 4CLMA 4YHGA 1FXQA 2YYUA 3F5JA 2QNEA 3NSXA 4N9BA 3KBNA 2XH0A 1FWSA 3SN1A 1VKFA 3PTMA 2R9RA 2UY4A 3T44A 1JG9A 3LV5A 1QHOA 3CT7A 4H9XA 5FF0A 3GXFA 3G1VA 3VIOA 2J27A 5T9BG 3BSGA 2E40A 4LTSA 2HXTA 5AYBA 3BLDA 1UYQA 2R1PA 1WKDA 2O0TA 3SY8A 5LNWA 4W7VA 3W2LA 4E2OA 5XINA 1GK8A 5E70A 1UIOA 1WUFA 4LVAA 1VFHA 2Y70A 1JJKA 2PLJA 1LLZA 4O19A 1WDDA 3NOEA 5C7VA 4CU6A 3BJSA 4YL2A 1POKA 3RM8A 2UZ9A 2X42A 4O54A 3SCQA 1RCXB 2DEPA 2FDSA 2PWEA 1EO5A 3AXMA 4QGCA 1UD6A 4GFSA 1XG4A 1ADOA 3GG0A 4J3VA 4TV6A 5A5WA 2YCEA 3HFYA 3S42A 3BJTA 1C8VA 3ZLFA 4IMGA 4G7FA 4GNKB 4LT9A 4UTWC 3QMRA 3ITCA 3WH5A 1L6GA 2PRMA 3T40A 3UY7A 4N9EA 3TW6A 2R8WA 3NQ7A 2GL5A 1PJ9A 4M6UA 2UY2A 3TXVA 2QXWA 5KETA 3P80A 3PS7A 3QY7A 4DJFD 4PMZA 3W27A 3DHFA 1JPHA 4TVUA 2W4XA 5EMYA 2J9YA 3KDOA 3NA8A 6REQB 2EG7A 3EDJA 4QQUA 1H0IA 2BY2A 4HZ8A 3M44A 1K9TA 3IK2A 1Q6FA 3QH2A 4GKTA 4L6OA 5HMSA 3VGGA 2J66A 4IUGA 2Y8UA 2CXGA 3CMJA 3FHQA 2C1IA 3ORWA 2ABAA 4W8AA 1QI0A 3VNMA 4CD5A 3S5YA 3WLJA 3ONCA 1A5CA 4MIMA 4FX8A 1DJYA 3OGSA 1QI3A 2QJMA 4S3CA 3KL5A 4YYCA 4BY3A 3VKJA 4IMEA 3GO2A 1CGTA 3ALGA 1YE4A 3U48A 4AG0A 1CDGA 1FTXA 3ICJA 5JU6A 2QAPA 4X3ZA 1CGUA 1EXPA 5CZJA 1XCFA 4EOUA 3WK0A 1PHWA 3RM4A 2YCLB 3LQLA 1VP5A 4S1FA 1YTDA 2CBIA 3GDMA 2FFCA 2H3BA 2J25A 1EJUC 2BHUA 3ZJKA 2INFA 4MKVA 3NQ8A 2Z2UA 6ALDA 1V3KA 4D6FA 3WF0A 5HWJA 3OQ8A 3TZNA 3OQEA 2PDXA 3M1ZA 1OB0A 4IICA 5BZAA 4QTGA 5FJPA 3HV9A 1QT1A 5KZMA 5CBIA 1GW9A 4PE8A 3UZZA 3SCSA 5FF4A 2O9TA 4JTQA 1S3HA 2WSRA 3WENA 2Q3OA 2PBGA 2JGQA 4N42A 2G37A 2WOQA 2PWDA 2X0HA 5EGRA 4LBSA 3ARXA 1JL8A 1BPLB 3NL3A 1B2YA 1DWFM 3TJLA 4JL1A 5FF7A 3CO8A 1PHQA 5KTLA 1OFOA 4RNFA 3WBXA 1KCLA 1LL7A 1HTIA 1R3RA 4IMDA 2EPMX 4KS0A 4Z0SA 3FJLA 4ZMGA 4TO8A 1AD1A 3QLDA 3GG1A 4QRNA 1KXVA 3LG3A 4D6GA 2WK2A 2EPLX 3AIVA 3IWPA 3UWWA 3R8GA 4OBTA 2ZA2A 3GHUA 5ECVA 3FJ4A 2PWVA 2GK1B 2GVYA 4H83A 4OBSA 2R24A 4MAZA 3EDKA 3GIYA 2VR4A 4O8RA 3W53A 1YNYA 4GFIA 3DG7A 3BG9A 1ZBVA 3H2CA 3VNLA 3W88A 2FZNA 4GACA 3HOJA 3W1AA 3F2DA 2W61A 2TODA 1C8XA 2XFFA 2IKGA 5HNNA 5D2TA 4RKAA 3P0XA 4RDZA 1S2TA 1MXSA 2JE8A 1PTGA 3C56A 4EXQA 2NLIA 3IANA 2AAMA 3AC0A 5E0KA 2DIEA 1O5XA 4UNIA 4XD3A 2CBJA 3VPLA 4AZ7A 3FSUA 1CEOA 1N55A 1F07A 2B7QA 4UQBA 2E6FA 3CH0A 2PP3A 2PE4A 4K7YA 3NEHA 1YDNA 2P8CA 2VUYA 3T05A 3EEGA 2VUNA 2VC7A 1ENUA 1XLDA 2DUAA 3B9NA 1X7FA 4PUNA 4HMNA 3MMUA 4ZO8A 1IYXA 1J9YA 4PMVA 2NVAA 1EHAA 2BMBA 4A3UA 5RUBA 3QV6A 2QMJA 5I24A 3CQIA 4GD0A 5B80A 1PZ2A 3NFUA 4IP7A 3BH4A 1C7SA 2V3EA 3A13A 4OHQA 1CX9A 3CLMA 2CBVA 2PDPA 3GAYA 3ITYA 3ARPA 2ACSA 4JIRA 2YDSA 1XHGA 1POJA 4MZYA 2QCCA 4PUEA 3R12A 2QYGA 1UKTA 3QTPA 1BAGA 3S46A 5MF5A 4B5WA 4GC3A 3TA6A 4GI8A 1F73A 4JY8A 4J28A 3UYCA 2OX1A 2CEQA 4HQVA 1Z48A 2ZXBA 3OPSA 1XD0A 2QV4A 1F3XA 2WVVB 3C3UA 3O9NA 5AC5A 5HJXA 1QWGA 1XSKA 2H8ZA 3EB2A 4W86A 1WBJA 1J01A 2PD9A 3LSCA 3TSMA 2WC3A 4H7CA 2DIKA 3K30A 5BNKA 2DV0A 4EP8C 3U4AA 3PVFA 5FJIA 2VX6A 1RXOB 2GGIA 2YCLA 2VEKA 3W00A 2YL5A 3A6OA 1TUFA 3WLKX 1E5JA 2OO0A 2A79A 2J7GA 4PL1A 4M0XA 1NDYA 3M4HA 1OC5A 2ZXDA 2BOGX 2E09A 1CXFA 3TN5A 3KAOA 3UNTA 2WC4A 1XSIA 1LRQA 2YCJA 4XG1A 3W1UA 1I1WA 7ENLA 3UG3A 2WV8A 3B03A 4P2VA 4XZHA 5F2LA 3BLLA 1WDWA 2HRWA 3PBMA 2HMCA 3DHPA 1PKYA 4ZQNA 3VU2A 1HJVA 4GUHA 4HPNA 2VDIA 4BZYA 4GCXA 3BO9A 3T4CA 2B0MA 2ZUMA 4FLSA 2VGIA 4GE8A 3CK5A 4DF1A 3MJMA 4WHBA 2D2OA 3UGVA 2WKLA 1MSSA 4DZIA 4AEOA 2TPSA 3DZ1A 2VKZG 1IGSA 1OCJA 4CNOA 1IWPA 5AYXA 3SIMA 1JD9A 4EPEC 2Q02A 3MUY1 3MKVA 1HJXA 2D23A 4XIMA 1ALDA 5A6JA 3GTXA 1TPEA 1QRQA 2DW7A 2REQB 2PTYA 3MP4A 5I78A 1XYAA 1J5TA 1K77A 4WJEA 4B90A 1XYLA 2AMGA 3BWWA 4PBEA 1QO2A 5DBUA 4A2RA 1BVNP 1H09A 4IMFA 4US5D 1W5QA 1ECEA 3UCDA 4IGMA 1SZRA 2GGGA 3AXKA 2GJXB 2VZVA 3WBYA 2OSYA 1ZQ5A 4AWSA 1XPYA 4KF1A 1PIGA 2BLEA 4J3UA 3AUJA 4TU1A 1KFJA 3D46A 4IIBA 3EWDA 5K2ZA 3NG3A 4ERAA 1GYNA 4XIAA 4HN4A 1EQCA 4JR5A 1FKWA 3RYSA 3PN8A 1EWEA 3QYQA 2O7SA 1V3LA 2P1FA 3PTKA 3JR2A 2A2IA 3I4KA 4LNYA 5FEPA 3F4NA 3NAVA 4GJJA 1EIBA 2GVLA 1YEYA 2P8BA 4JIIX 1F61A 5M1TA 4QLKA 3LZ5A 4CCDA 2OFJA 3S1VA 4JEJA 4MLRA 2DGAA 2Z2AA 4YTSA 3TTYA 3AHXA 4FS9A 1QK0A 1XSJA 3DESA 1RJPA 5D9MA 4KRUA 3FHAA 3QGAC 2WVTA 1WDPA 3GDRA 3M46A 3C2VA 1TZ7A 2GQ8A 5G5IA 1X6UA 1KRBC 3UJ2A 2XISA 2FQIA 1Q85A 3CAVA 1P7TB 3EYPA 3MP3A 3QBUA 3RITA 2V5KA 4IG2B 3KOYA 3RLUA 3LI0A 3DBPA 3KOZA 4AD4A 3FDGA 2PDUA 5D9PA 1DE5A 4UTWA 3GRIA 2Y7GA 4DNHA 4MM1A 3TTOA 2WVVA 2O9OA 3PZMA 4OTKA 1X1NA 1RR2A 1KBKA 3HA1A 4W87A 3U2ZA 1QW9A 3DGBA 5AC7A 2ZZ7A 4MJZA 1IEIA 3W24A 3M43A 5I3FA 5GJPA 3SJ3A 2ZQ0A 1M7JA 2WHLA 1AJ0A 2E9BA 4DPQA 4JCLA 3T0DA 2HV5A 1PCKA 1LOQA 3HG4A 4H8VA 4MJ2A 2ON3A 4UTJA 4U33A 3BAJA 4L1XA 4V1XA 2F38A 3A5FA 1A5KC 4EXAA 1HJSA 2EPNA 3MCOA 1BSLA 1RALA 3RO6A 3LM3A 3MO4A 3QSRA 3BAIA 3G0XA 3CV7A 3C8NA 4INFA 3UA4A 4KWUA 1XYZA 4M51A 2X1UA 4C6MA 3W9ZA 3YPIA 3KEHA 3NQCA 4R7OA 5A6AA 1G01A 1J0JA 9RUBA 4NZ1A 4C6EA 1BG9A 3A5VA 3NQMA 1P48A 3CV6A 4EX4A 1VS1A 3NNTA 3CQ0A 2JIWA 4CD6A 1BYCA 4J2PA 4HNCA 1ISYA 3RUBL 1Q6OA 3MTWA 1Y7VA 2BGQA 3QHMA 2J4GA 5EMUA 1ZFJA 7A3HA 4JHOA 1DWIM 2NQZA 3GIPA 2OX4A 3POHA 1X98A 1LQ2A 4KCWA 2G0WA 2HVNA 4L1WA 1K8YA 2PDIA 3ZR4A 3TYCA 3IIPA 4XTDA 2HPMA 4IQEA 4BI7A 3TMQA 3W83A 2J8GA 4FAMA 3T8QA 3IACA 5CSUA 1TA3B 2XVKA 1FWAC 2VDHA 3CV1A 1E9ZB 3BZJA 2XZ7A 1H3GA 2W6RA 2DP3A 2ZA1A 4MAVA 2WNQA 1FWTA 1WAWA 3F2BA 4MYAA 1IEWA 1JCTA 4WSJA 3TYDA 1QW7A 4O4WA 3IJ8A 2ZIDA 1TPC1 1Q7MA 2ODOA 2W5FA 2XINA 3R94A 1R3YA 3LXBA 4HCHA 2QS8A 3IAPA 3UP8A 4A05A 2PWGA 1Y5XA 5ECUA 3KRSA 1I2PA 1CGVA 4YWSA 1ZSXA 2FGBA 3NR0A 2Z4GA 4B3LA 1WDRA 2F6UA 1LROA 1PZ0A 2GSHA 3GG8A 2WWDA 3LRKA 3OEXA 4OJYA 1O5KA 3C2FA 4KWSA 4I90A 1Q65A 1KM6A 2DIJA 3M0VA 2BWGA 3EKLA 1V3IA 4Z2JA 4D6EA 1LLWA 3USBA 1QOQA 3N3MA 5A8NA 4LFYA 1P7TA 1KTNA 2FTYA 3C0SA 4AY8A 3CMGA 4LS1A 4MZ1A 2O7QA 3E5PA 4G7EB 4IG2A 2E9MA 1VRXA 4XVEA 1JFHA 5AHLA 4C90A 5HANA 1VCVA 5K3VA 4GMEA 1GNXA 3GC2A 3FGCB 1KFBA 3DFHA 4DNMA 2DFAA 4R3UA 1KGXA 4KETA 1F5ZA 1L8NA 2C0AA 4HOXA 3LHZA 3L9CA 5CZKA 3KTXA 1GOIA 4NHVA 3SQSA 2H3DA 1FWHC 3VO0A 1UQZA 5IHSA 2ALDA 5C9WA 3GKAA 3GQYA 2FH6A 1B31A 3KL0A 1GHSA 2G8ZA 1W9UA 4ZB0A 3IJ7A 1DIEA 3DN5A 4DI8A 3IJQA 1EPXA 1H1NA 2HEJA 1KBIA 3WD0A 3VD7A 4PB5A 4O1AA 1XIMA 3WNLA 1XICA 3ARVA 4ZGYA 2FTPA 4MNKA 4GQ0A 1MYRA 1ITQA 1K6WA 3HGJA 2GDUA 1I75A 4EAYA 1JRBA 4PMJA 3V0TA 3GUGA 3KOWA 4I9AA 1JPKA 2V68A 3V5CA 3B97A 1KFKA 1E3XA 1YXCA 1E6ZA 1NWSA 3PPCA 1GYMA 4KPLA 3WH7A 1J8VA 3QEZA 2GZXA 4PSRA 2QAFA 1VHCA 1ZS2A 1PL9A 3UJSA 1R9ZA 4HJWA 1GKQA 4EPKA 1SZFA 5EMJA 1RHCA 3FEQA 2OJPA 4XAPA 2G3NA 3PZGA 3UZXA 3OVRA 2WCSA 3T4WA 1XH0A 3TW7A 4A6GA 4QQ3A 3J7HA 3ISIX 2F84A 1XRTA 5A2BA 4B2DA 2O9PA 3VNKA 3DU0A 4ML9A 2OEKA 3QHOA 4MWAE 3UVAA 3PANA 1XLLA 5CKSA 4QIUA 4FI4A 2GLKA 3VKKA 3EZ4A 1TVLA 3EA2A 5CGMA 1RK5A 3UXDA 2FGLA 4JTKA 2QKFA 1S5TA 4NKCA 5LNVA 5M03A 5D8WA 4AZIA 1NELA 3BL3A 3BGJA 4NT0A 2VDGA 4LPCA 2RJGA 4D1IA 5FSEC 4HOWA 1S46A 4QJ3B 4B5NA 1UUMA 4WJ8A 2XSAA 3GC5A 3OGRA 5G4HC 3IVTA 2D69A 1XJBA 2ISSA 2XN2A 1QCWA 4UTFA 3N6JA 1O66A 4REQA 4G56A 4DO7A 5HDRA 1XLBA 4KERA 5DY2A 1A4MA 1OG0A 3GU9A 4U2ZA 4PMUA 3MYPA 4JQ4A 3GZ3A 1U5HA 2J74A 1AL7A 3PZIA 4DWSC 1LYXA 2XHYA 2NVDA 3T2OA 3XIMA 1JPDX 3AJXA 2ACQA 1F4AA 4B2DD 5C70A 2VMFA 2XPKA 3OVQA 3AZTA 2YFNA 2WCGA 4W4QA 4LANA 1TO3A 4HA1A 2KAUC 4H4IA 1U1JA 3STCA 4S38A 2DQWA 3BOLA 3E12A 3AWOA 1AVAA 3RPTA 5HQMA 1GG1A 3O6YX 3UJFA 4BKNA 1IF2A 2Q8LA 2J8FA 4OV9A 1RQBA 4C6CA 5C7HA 2PBOA 2CHNA 1NWRA 4JTTA 1W1IE 2NQ5A 3WQEA 3KTCA 3TYEA 1L2UA 3L4XA 1TV7A 2DSVA 3H7RA 3ZR6A 1GOWA 1XBYA 3FGCA 5LA0A 3ATYA 4GVFA 4K6AA 2D0GA 3S9IA 1XP3A 1XRSA 2DZXA 1BXCA 3UWQA 1OBAA 3UG8A 1JCYA 3PPGA 3H2NA 6PTDA 1Q8JA 4IFRA 2D3LA 3W1PA 2YDAA 4CQ9A 4NI8A 2CLHA 1TKKA 1OFQA 1UWSA 4JYDA 4OQVA 1XYBA 3O0KA 2ZUNA 1KFLA 1UMYA 4CNUA 3P62A 4U28A 1EP1A 5A2AA 3W2KA 1C90A 1YDVA 3KBSA 1BWVA 1EB3A 3SCTA 4EWND 3PZOA 3V1HA 1YQ2A 2I7GA 3ABXA 1JFXA 5AECA 2GJRA 2CYGA 5CC6A 1NFPA 3AU6A 5AC4A 1ME9A 5LXXA 2ZRUA 2BY3A 3H2AA 4GI6A 4UBPC 4QJ5B 2P10A 1UKPA 2G4FA 4Q7IA 1AJZA 2OYMA 2BGNE 4ACYA 3QY8A 2VHLA 5LGXA 1EF3A 3KLLA 2EPOA 1JNDA 1JQVA 3QOMA 3W2UA 1CT5A 3FJ6A 3GNRA 2Q6ZA 1YDYA 3QC0A 3ANVA 1G0CA 4OZOA 4UTHA 3WH9A 3N34A 1IR2A 3T42A 3A64A 4MY9A 4JTJA 3W3OA 3JRKA 5FL0A 4DYKA 2Y7EA 4OUEA 3W28A 3V3WA 3S47A 3M5XA 2ALRA 1J0IA 2V2HA 1ITCA 1DQXA 1GT8A 2IKJA 4WGHA 3RILA 4AXNA 5A6LA 3PTDA 2QJGA 3VYLA 4S3BA 2FJUB 4P8XA 4H41A 4JNZA 4WOQA 5IM51 3ARUA 1FCUA 1E0WA 3PZUA 4KWOA 3VOHA 4LXFA 3PZ9A 3MHUA 1VCGA 3PNZA 1H62A 5DMLA 1FWEC 3TVAA 2I16A 4WZHA 2HVMA 2EO7A 1NDVA 3AIBA 3CQKA 2NUWA 3QM3A 2A1YA 3NQVA 1V0LA 1XLMA 4N9DA 1T5AA 5CPOA 3L4UA 4JHMA 5KZEA 2E1WA 2CHRA 1QNVA 1M04A 4PTXA 2CETA 2CITA 4E3VA 2YBVA 2BOFX 4XAZA 1DTUA 5FF3A 4AY7A 4A35A 1C9DA 2F9RA 5CSRA 3SADA 2GWNA 3BMVA 1HJWA 3B9AA 2OLHA 1X97A 1UA3A 5F7UA 1R46A 1LBFA 3ITGA 1XRFA 2WPBA 5T9CE 9XIAA 3UA3A 4IT1A 3NZQA 4QE4A 3G8EA 4KFNA 4C6QA 1ZPTA 1EZ2A 4NP7A 2YKKA 2OWXA 1KR1A 3LMYA 2CCRA 1VIZA 4P7OA 3N29A 2QCLA 4K8GA 3D5HA 1OC7A 2E6DA 3K1GA 3WLRA 4P8WA 3A22A 1RA5A 1HL2A 4C6KA 3M07A 2VZUA 4GIEA 2D24A 2WM0A 1GTEA 4DZAA 4CQAA 1XBVA 3NZGA 4MY1A 3UETA 3IJ9A 4R7WA 2EPKX 2GWGA 4GOAA 2GYIA 2AL2B 3CASA 3E2SA 1F8IA 3HZ3A 4W88A 2WANA 4L64A 1NOUA 3B4UA 4O57A 2WJZA 4LAMA 2VURA 3QZ6A 2QJIA 4OOZA 3V0UA 5C9UA 1Q3NA 4DWSB 2X1TA 3LTPA 3JS3A 1WOAA 2EXOA 2HK0A 3PBUA 3R4IA 3DYOA 3PAJA 2D2GA 3B0PA 5A8PA 1KKRA 3LLXA 3S2JA 4LB4A 1RH9A 3AJ7A 2UWFA 3P2VA 1PKNA 3N18A 1DWAM 1AMKA 3STPA 1AH4A 1YMYA 2ZVIA 1V03A 1GTHA 1NQ6A 1CXIA 4HCLA 3ZS4A 3I4EA 3WLSA 4RJEA 1H5VA 1R7OA 4NASA 1OEPA 1QPRA 1VR6A 3W7IA 3N25A 3P8JA 3VK5A 2VD9A 5I3HA 2E7FA 4KCTA 3V35A 3ZT6A 3MS8A 4UNKA 1E15A 3R79A 1DHKA 7PTDA 4HMDA 1A5SA 1PTDA 4C6BA 4V15A 2QIIA 4IJBA 3PB2A 4QNWA 4PTVA 3BW4A 2CERA 3KBJA 3N9SA 5T91A 1ZNNA 5C0QA 4OOUA 1KTBA 2X40A 4GGHA 3S2CA 1WV2A 1XIFA 1O95A 2DY3A 2WMGA 3IGXA 3T7VA 5JUVA 1XFCA 2CZFA 5D2VA 4JZ5A 2V6AA 3BQ6A 1BKHA 4LRTA 5KITA 1V7AA 1MEWA 3WQ6A 4DYJA 1FWCC 1OSEA 1TQJA 3R43A 1LRTA 5E6YA 1H63A 3H70A 5EFFA 3CPGA 1X1OA 5HUOA 4JQ1A 1AL8A 3IUIA 4K1GA 1M65A 3PBGA 3G5EA 1KBJA 4DQWA 1L6WA 1C92A 1KM5A 2QCGA 1X8CA 1MWOA 2ISDA 3TTSA 3CU2A 4UMBA 1A49A 1M3UA 1UOKA 4GH3A 3N2TA 3T07A 5LZLA 5TD4A 1CTNA 1E4LA 3HURA 4AIUA 1QATA 2J7DA 1AJ2A 4CNPA 2JEPA 4BS0A 4L1GA 1XW8A 4Z2IA 2WMJA 3W74A 4L4OA 4ENLA 4IZGA 5HPOA 4LALA 4TQTA 4DHGA 4QLJA 5CG0A 3RRAA 1XLAA 3PBWA 4LH8A 4I6VA 3RCMA 2DZVA 5C2XA 3MDUA 5D2XA 1UR8A 4AQLA 1WZMA 2QDEA 6ENLA 1SO3A 2D22A 4Y2WA 4H9UA 5KINA 2J6XA 3I7SA 5BRBA 3RLHA 1FWBC 3MUZ1 3PHAA 2GJLA 1BYAA 3FKKA 3T81A 1E71M 3G18A 4WEVX 2E9LA 5LNRA 4KMQA 1H7RA 2D0HA 4F8XA 4AZCB 2R1KA 2W63A 4D6DA 3HMJG 2DUZA 3P82A 2A0NA 4NL1A 1UJQA 4BI5A 3V4BA 1FH8A 4Q7NA 4YXGA 2XFYA 3VOCA 3PBYA 4E2DA 4G8TA 4C1KA 3BOFA 1F3WA 5GNZA 3V0SA 3H2FA 2AL2A 3AIWA 5HJLA 3VDBA 4QP0A 3EWWA 4E8DA 1B3YA 1J96A 3UW6A 1MMFA 1KM0A 2VX7A 1Z89A 1OQFA 3CEUA 1JDCA 4PULA 1J6OA 1KV5A 3W71A 1H7XA 2ZUVA 4H2HA 1KRCC 3BC9A 4N4QA 3UR7A 4XO6A 1H0GA 2WJEA 1RD5A 4QG8A 3DXIA 4AUBA 3FVDA 5A8OA 3BVJA 3OOQA 3NQGA 3KRZA 3BSHA 4L56A 1N7KA 2DVTA 4RE2A 4F2TA 4D6CA 3L65A 4RXGA 4QEHA 4IUOA 3TIMA 1XC6A 3MUCA 1SFLA 4CU7A 4GZ7A 2FMNA 1P1XA 2FZMA 4WLCA 3GYEA 4Y9MA 4NAFB 5G1MA 4GQBA 2QVHA 3LX9A 3H54A 4GIYA 1ZTVA 5JBDA 1LOSA 2DT2A 4ORIA 5I06A 3AZRA 1J2BA 1BLIA 1UH4A 3VOJA 4GVHA 4NVTA 1EOKA 1PKLA 1Q45A 4Q32A 4BR1A 1NWTA 5K9XA 4IIFA 3KRUA 1DV7A 3R10A 5AB3A 4IQJA 5LIXX 1A0DA 3GG7A 4O28A 4PMQA 5DQPA 1J5SA 3LXAA 4X9YA 5CZ0A 3M0YA 7REQB 4RLIA 1TMQA 4DWSD 4S3EA 4JN7A 4PRWA 3EWCA 4IP5A 5T8GA 4K7VA 3NM3A 1VH7A 1MXDA 3K5XA 6TAAA 3E5BA 2OR2A 1QI4A 1P4CA 3O07A 3G77A 4HNOA 2PTWA 2XVGA 2Z2BA 3BAXA 1QW8A 3T0AA 3NEVA 3KWXA 3WNPA 1TV4A 5A94A 2NLYA 5EPDA 4HJFA 2VX4A 4JX4A 4AD5A 4HMEA 3ZFHA 3A47A 3B04A 4H01A 3AWNA 2DZWA 5BWAA 3SY5A 5C54A 1CBGA 3QFWA 3GXTA 1OD8A 2MUCA 3NZPA 4ZFMA 4FPSA 2FFIA 1IHIA 3EXRA 4ICCX 5M17A 5IFPA 5H8PA 3S0CA 2WKGA 1S5MA 3DKLA 2C3ZA 1W3IA 4M19A 2DZUA 2QCHA 3STFA 3ANUA 2PRHA 4WY0B 1E1CA 2PDFA 4AZ5A 1YADA 3VABA 4Q4OA 2V63A 2BY1A 5IBXA 2IXUA 1ADDA 4GYFA 4GYKA 4ALDA 1WE5A 3CPUA 2QPUA 3RPDA 2NX3A 1M41A 1HL8A 4DF2A 1LT8A 4ZOAA 4EF8A 3UXLA 4C7FA 4EXBA 1H7NA 4WDUA 4U4MA 1E40A 4S2CA 3WF1A 3IRSA 3G1SA 3N2OA 3VCNA 4KRZA 5MKGA 2Z1KA 4PCFA 5FEXA 1OCQA 4WGXA 2V67A 3H21A 5HA7A 1TUXA 1SMAA 1CZ1A 1JCLA 4AZCA 2F2KA 1YTEA 2VOMA 3SM0A 5HNTA 4LF1A 1A5UA 3SUWA 3UZJA 5D37A 1V6WA 2BHYA 1U1HA 5G2WA 3OZOA 3KOFA 1F2JA 1VBUA 2B31A 3T0BA 1EZWA 4RDYA 3ZJ8A 1Y0EA 4U5IA 2A7PA 2NV9A 1R3WA 3FCPA 5CPLA 1NH6A 2QCDB 1OWQA 2Z1BA 2Y61A 4Z2LA 2QUVA 1HXJA 2OZTA 2QMKA 4DYEA 2YYTA 2RAGA 5JXQA 2Y88A 2DZTA 3A4XA 2FIQA 5HK4A 4YMZA 5GNYA 2PD5A 1A0CA 4ICMA 4JFTA 2QPSA 3WMSA 1TR1A 3ARYA 3VOGA 4CEXC 4ES4A 4NYYA 3WEZA 3C52A 1V6VA 2ZZ1A 4AAJA 1K70A 3G2GA 3GU2A 1W2VA 4HKPA 4FNSA 1NP0A 3LA4A 4PTWA 3UY8A 4QG6A 3IIVA 5A6BA 3W7KA 3POCA 3RU6A 2CLLA 4C6JA 3PNUA 1DL3A 1UWIA 3WLLA 4S3AA 1CGXA 4GUJA 3F4VA 1Q63A 3NVTA 1ZHAA 1ZJHA 4G5DA 1SO4A 4NAFA 4QX4A 1JI2A 3S1WA 1R86A 3QW4B 2QCEA 2WXDM 3AMKA 4M1BA 4ASTA 3C2OA 5CGTA 3W2MA 3SW6A 3W22A 5LIWX 1OZQA 1ZP4A 2BXZA 3PBVA 5D8ZA 1IE7C 1EX5A 1ZU8A 1IXQA 1T0OA 3RX3A 2X0SA 3N11A 4HNNA 1ML1A 5C9RA 3EWYA 4QM1A 4H00A 1GORA 3EWZA 3FX4A 1PEZA 5GJNA 3ZXWA 3WJSA 3DG6A 2V30A 1KRMA 1M9HA 3HPFA 2YB1A 3GTNA 1JRCA 3FEMA 3H7VA 3ZVHB 2FPVA 4GX9A 5I77A 2DZAA 3HGOA 2X1IA 8A3HA 5G4EA 4HSOA 2VVNA 4CQ8A 2HCVA 4ILSA 3LPGA 5A6BD 2P5NA 3WLHA 3L5LA 3VDCA 3FIGA 4FXJA 1TV8A 3SBFA 4GA8A 4IIDA 1UW9A 1KLZA 4F0MA 3T9PA 4A22A 3B3DA 4R85A 4W7UA 3OODA 2OGYA 4I5RA 4B9ZA 3VILA 1Z42A 2CLOA 2FZDA 3K13A 3MI3A 4E4FA 3FFSA 1XYCA 4QJ1A 5E1QA 4NQ1A 4MHBA 3OYXA 5E93A 3RO8A 1ZLPA 3WH8A 4J2MA 2I5GA 2ZC1A 1FWIC 5LGZA 2YR1A 3WLMA 4IP4A 4A3QA 2OOGA 8RUCA 3QOKA 3MMTA 1FHLA 4FEZA 1CENA 3KXQA 2J7EA 3RLVA 1W17A 1IZCA 4WY0A 3DFNA 4XZNX 5CGQA 2GSEA 4KIEA 3G1AA 3LV6A 2YIHA 3WEOA 4UFMA 5K4ZA 3WFZA 1UC5A 3IVUA 1UB3A 3LRMA 5CJNA 4PZVA 1MNZA 1W1B1 4X61A 4XQ6A 1VFMA 1E6NA 1FH7A 1X8FA 4AYSA 1S38A 1XYMA 5A2CA 2G50A 1C91A 3IJIA 4HCDA 4IGNA 2Z27A 3B9OA 2PDKA 3Q4DA 2PTZA 3CL8A 4RV3A 4E6MA 2HE5A 3CZ8A 1A5BA 3EDDA 1NF7A 2XDFA 3VKAA 2E67A 1BEUA 2ABBA 3VNJA 4CU8A 1VQTA 2DW6A 2QCDA 3O6AA 1A3WA 1ME7A 2FVKA 2IUZA 3MPGA 4HYRA 1RA0A 4XWUA 3RLGA 3SCNA 3NPWA 2Z1WA 1WXJA 4DBSA 1XH2A 4BQ5A 5I3DA 2BX7A 2DORA 1OYAA 1QR7A 2OWWA 1QNRA 4H7ZA 4IFOA 2GSJA 4O15A 1Z9AA 3D3FA 1WP6A 3ZOAA 3W29A 4DXXA 2Y8KA 4HZ7A 1C7TA 1H1ZA 2HBXA 3SI9A 2E4TA 3KLKA 4LVBA 3QJAA 2ATMA 2PURA 4ZFCA 1TPWA 1YX1A 1ICSA 4R53A 3CH9A 4J7RA 1H41A 2YJQA 1ELSA 4J3ZA 1R85A 4HA0A 5F2MA 1SM9A 3DIPA 1GVIA 4C6NA 4G9PA 2E77A 2RDUA 5BYWA 1W3KA 3L21A 4MF4A 3GDLA 3KVMA 4FOKA 3LPPA 1SZEA 3SCUA 1SW7A 2W92A 2VRQA 3CB8A 1ODZA 4AU0A 2PCQA 1ESWA 1SQ7A 3FSTA 1DJXA 1DQWA 3NPUA 2ZZ5A 3EWXA 4R88A 4RNHA 4AD0A 1IR1A 1A47A 2I1OA 4I9MA 2XN1A 3MSRA 1CLKA 1KBBA 4ZO6A 4PC8A 3SGZA 2NW0A 5ABFB 2WZHA 3LERA 5HR6A 4BHYA 3EAUA 3ZVHA 4PUDA 3P74A 3DYPA 3ZM8A 4OECA 3GFXA 1W5OA 3PC0A 2BS9A 2C15A 4EANA 2JGYA 5I5RA 1PKMA 3NURA 2PP1A 3TROA 1E6PA 4ZA0A 1WA3A 1WPCA 3TDFA 3UWEA 1V0NA 3VM7A 4Q8UA 3MWAA 3U2OA 2F2HA 3MHGA 3VD5A 1JNEA 3TCEA 4AWUA 2WW5A 3IGHX 1T40A 3W86A 3PPFA 3S4TA 3QV8A 1OFPA 3QYSA 2HPIA 2BSLA 3GDBA 1HKVA 3W2NA 5CSSA 2YCIX 3DKJA 4Y9AA 3W6YA 3B8IA 3WD4A 1QI5A 1HJUA 5BROA 1PB0A 4E8GA 3DFSA 1CB2A 4O1CA 1QFEA 1BXNA 1RY8A 3BAWA 2XN0A 1UD3A 3UPMA 4LY4A 3MKCA 4ZQPA 1K4HA 3OVPA 2YXOA 4XAFA 3FXYA 5K9CA 4GRSA 3TN4A 2VGGA 4PEEA 1S2UA 4IX2A 2ZZ6A 3SURA 5HMFA 1XIBA 2GOKA 1PX4A 2RGLA 3MUXA 5IHRA 2PDBA 4MKSA 3GXIA 3ZQ9A 4NRSA 2JKPA 1K7XA 3MBFA 2R6OA 3CPRA 3N14A 1OFAA 1XC4A 3L5AA 1HFBA 2W3ZA 4AISA 3EOSA 3OBAA 1BVWA 2PU0A 3SRHA 3WLTA 1F7BA 3HF3A 4XKYB 2EJ1A 1XXXA 1RBLA 3AICA 2DT1A 3KTSA 3VC6A 2AKMA 1ICQA 2VNCA 1R3QA 3EX6A 4FR1A 2V3GA 1I1XA 2Q8XA 4HU8A 4PMOA 5HINA 1JDFA 2A3HA 5HWMA 3N17A 5CLTA 4PTDA 3A9IA 1VFOA 3M5YA 4GZEA 2QUMA 3VTRA 3KE0A 1EC9A 1GKPA 1LM1A 3UR8A 2PDMA 1GWJA 1W56A 3UCQA 5DF0A 5FKYA 1N8FA 4CNSA 3WZ0E 1K8XA 2G3MA 2RFGA 3U6WA 1RCOB 3VNYA 6XIMA 1K7FA 2QUUA 2A7NA 1DYSA 2FLIA 2DZSA 4ZTXA 2OSWA 2GDQA 3AXIA 1TWWA 1RCQA 2VFGA 4PUKA 1FDZA 1BRLB 2IXVA 3CZEA 4FLRA 4L4LA 3AMCA 2PGFA 4NNCA 4RW3A 3BE7A 4C6FA 2ZE3A 3NDOA 3SJNA 4Z17A 5TIMA 2WKJA 4GPNA 2ZRVA 3AYTA 4HMCA 1FHDA 1MW1A 4PCTA 2HROA 4AW7A 3CWHA 1DWHM 1OCBA 4R7JA 2WZTA 2XSXA 4YWIA 3SQMA 1GZGA 4JHZA 4M6QA 4Z2KA 1XUUA 1UZDA 3M6YA 4C6IA 4JYEA 2B7OA 5TNVA 2OXNA 5ABFA 4JICA 4B4FA 3MC5A 2ICSA 1VEPA 3CL7A 2WYSA 3TAOA 2PLCA 4GZIA 4IX0A 3LCLA 3UEQA 1YBQA 2DJLA 3RXZA 5KZ6A 1D8WA 2ISVA 4Q33A 4WJXA 1PYFA 4A8NA 1I2OA 2PC8A 4LYPA 5HATA 1SU5A 2ACUA 1VLWA 1QNOA 1MDLA 3F1QA 4L9ZA 5CC3A 4HSHA 2PDQA 1J2WA 4MG4A 4ZENA 1GVEA 1LL6A 2DUXA 3EWUA 2Y0FA 1PVNA 1LF1A 1LUCA 1Z41A 4IXXA 2D2HA 4MADA 2QDDA 4FLOA 4AD1A 2IKIA 5DT5A 1TPUA 3R8HA 1RY0A 3OHMB 1WZKA 1V0KA 5CXPA 3G22A 4DXVA 5EYWA 3CV2A 3LB0A 1P0DA 2AKZA 2XWEA 3W75A 1BWLA 4A8LA 5D33A 5A3HA 5FIPA 3KUMA 1LQ0A 3STEA 2WMHA 4Z1DA 3UF9A 3LBMA 2DZPA 3W37A 1EPVA 3M0XA 3G1HA 3CIVA 3CLWA 4OT7A 4Q8TA 2XIOA 2X30A 2ZUTA 2O92A 1YHTA 4U3CA 4Q8PA 3NDYA 3TYBA 1QAPA 1Q6LA 2WSPA 2NT1A 1TELA 1NFBA 1NM9A 4W89A 3WYZA 2XIQA 2WZIA 3WQ5A 4QLLA 1K3UA 1J11A 1TB3A 3W7LA 2INZA 1SO5A 5AC8A 5H8UA 1C93A 4JN8A 3QHNA 2IKHA 1SUXA 4LB3A 4XKYA 4CCZA 4YJ5A 3GU1A 3ECQA 2J78A 3PUDA 4Q8MA 5J5RA 3NSNA 2PF0A 3GVGA 4N2YA 1W5PA 3KL3A 4PUWA 3FOKA 1VD6A 4J3TA 3MUIA 1EWDA 3AIUA 2L5HA 5AC6A 4UR8A 2X7WA 5HWNA 5HOSA 1S2WA 3ZWTA 3CUGA 2AGTA 2PWUA 3QR0A 4HSNA 4BJHA 1KBLA 2EG8A 3QQ0A 3WO8A 1K1DA 3TXZA 3URAA 4V2XA 3ARQA 5A1AA 1JDEA 4S3DA 4Q8WA 5U7SA 1EDQA 8CGTA 2E28A 1AMYA 1BYBA 3CGTA 3V18A 4K8EA 3LCWA 3C0JA 4X22A 3VMOA 2VCBA 4BI6A 2ZVRA 3P84A 2Y85A 3F4DA 4W84A 3QKZA 3QN3A 5DRIA 4D2JA 1FCBA 1NY1A 3C61A 2PU1A 3T0TA 4WVXA 1RJRA 3SO7A 5BMWA 5BXSA 4K2SA 4Q4QA 4AC1X 2UBPC 1RP9A 2ZX7A 3NO1A 1JYVA 1U22A 2PI6A 4N0RA 1ZY9A 1ISXA 1DJNA 3LDVA 4RL3A 3WSUA 1IIHA 4PH6A 3GIQA 3OLGA 4FNQA 3OZPA 1N82A 5G1TA 4NZCA 2HXUA 3RNDA 3UWUA 3HPAA 2WHMA 3F5KA 2IPWA 3EX1A 1T41A 1B4EA 2OSXA 3LCIA 3SN0A 4NSBA 5H8MA 3FA3A 3CZLA 2I57A 2ZA3A 2CLIA 4CQBA 1AQMA 4FA3A 1OJXA 4AZHA 4BA0A 2OPJA 2CZ5A 1UCWA 5LYRA 1TTPA 4YVXA 4ONVA 2NZLA 4DXKA 4CNTA 3NTYA 2GFTA 3EPOA 3HB9A 3K46A 4FOJA 3OA3A 1EKOA 2A21A 3MZNA 3IARA 1CXHA 1U2YA 2PZNA 1I8JA 4CEUC 4ADSA 3FKRA 5ABGA 2H9AB 4XTIA 4Z1YA 1T6MA 1LOLA 1TG7A 2ZUSA 2RGMA 2QJNA 3AIRA 2GJNA 1R38A 3G3DA 4PMNA 5DELA 1UD2A 3GW3A 3UZYA 3WQWA 3VMPA 1QK2A 3SUSA 4UXDA 4HN8A 1F8MA 1GVSA 3NGJA 3M0LA 1BFNA 3T09A 3AXHA 1JUEA 4N4PA 3T2PA 3KHDA 1PS9A 4KFOA 3BGGA 3QFEA 3BV7A 2QPXA 3NXFA 4QISA 1RBAA 1VENA 3FVMA 5J8LA 4FALA 2TYSA 3SCWA 4I7UA 1GW1A 4QROA 1H2JA 2JKAA 4UQ9A 1D7KA 2PLMA 3LD5A 2I9EA 1JZ3A 3KZSA 4YVVA 4J27A 2X7VA 3C4UA 3QPZA 1Q4NX 1UH2A 4L80A 3NYZA 3APTA 3XINA 2VL4A 2Y5SA 4IJRA 5LKYA 4O11A 4KQNA 5I3GA 4LEFA 4LYKA 2DZBA 3WUGA 1R3SA 1Q5MA 4D8LA 1EC7A 3UPWA 1Z6KA 4NU7A 4CCEA 1OCNA 1XLIA 2YCKX 3VOIA 5KMYA 4FP1A 1V0MA 1Q7ZA 4TVCA 3SUVA 3KVLA 1EDTA 2FHCA 3HU7A 3DI1A 3N6HA 3CEPA 5LNUA 1XIIA 4B15A 4O10A 3UBPC 3G0UA 4YTRA 5JMUA 3TTQA 3NDZA 1E0TA 4EACA 3G3MA 3VVGA 3HV8A 1QTWA 1LG1A 1UWTA 5LXEA 2XZ9A 4KBXA 3UFYA 4ZQOA 3Q45A 1J10A 2FKPA 3N2MA 1S39A 3S5OA 3C6CA 3LUTA 2X2GA 3TEVA 1EBGA 3ABQA 4DUWA 3ITOA 4CN6A 1TV3A 3HM7A 4NXSA 4ADTA 5CPSA 4GUGA 5T26A 3C0QA 4O14A 3CTLA 1O4UA 4CD8A 4IPPA 2PGEA 1HZYA 1OY0A 1QOXA 5FJJA 3CHVA 5AHNA 4P7LA 4QDMA 4V1YA 2FDMA 3ZIZA 1CXLA 4JKKA 4CVWA 1J6PA 4W5UA 1XDLA 4M82A 1WQ5A 2VEIA 3ARTA 1C9WA 4CQCA 4RNIA 1NWUA 2DJXA 3OA5A 2DSWA 1VLIA 2VX5A 2W67A 2XIJA 1LG2A 3COTA 3FYPA 3LHUA 3VGBA 4BWLC 1ONEA 3O05A 2FB2A 3IGUA 3W82A 1TCDA 3WF3A 5JBFA 2V5BA 3WLNA 4ZO9A 2E8YA 3KM8A 1HKJA 4MLJA 3ZSSA 1QNSA 1KXQA 2MNRA 3OYZA 1U5JA 4Q4KA 4HP5A 3ZO9A 4MB3A 1H60A 5C71A 2GUUA 1TPVA 1PYMA 5E9AA 2D1ZA 1KV8A 1FHVA 4FF5A 3TUUA 1RSCA 2OKTA 3MW7A 1T7LA 1M53A 4P8VA 2JEQA 1XL9A 1A4LA 1K8CA 1JI1A 2FTWA 1VFTA 1JQXA 5GJMA 3L4TA 4FX7A 4ZR8A 3H26A 2OYLA 1V77A 1UH3A 3EDFA 3L7RA 3L4ZA 1IGWA 1M7PA 4O17A 1I6NA 2OEJA 1CNVA 1A3HA 2EGZA 2X41A 3GFZA 1J0ZA 4A3HA 1XG3A 3BZGA 5DMMA 4CQDA 4AH7A 1YPFA 5DCEA 4OV4A 1LCOA 5LHFA 2H9AA 3RF9A 3DOPA 5LSMA 2PC4A 3MBDA 2AGKA 3FV9A 3PG9A 3TYAA 1IXOA 1M5WA 2WO5A 1XIHA 2J7HA 1QO5A 1UIPA 3T55A 3CB3A 3PB0A 1TJ2A 4RPQA 3LSBA 3CS2A 3T1GA 1BQCA 4XX6A 2WHKA 3CZKA 3WBEA 3L23A 1J18A 4U31A 1CLXA 2EJAA 2G96A 3KFTA 4RR4A 4DLMA 4R9OA 1MO0A 3AHVA 2G3FA 5K4XA 1XQKA 2CESA 3CXOA 4XBKA 1HP5A 2A3CA 2A3EA 3B8WA 4MPQA 3DENA 2WC7A 2PEVA 3VDAA 3R89A 1PZ3A 3U9IA 1D3CA 3CUIA 4XO7A 2ZICA 5BXRA 1JULA 1MI3A 3VZZA 1PE1A 5IFTA 4GIRA 2F61A 3GDTA 4RDVA 2X8RA 3WK3A 5F1UA 1GCYA 1FCQA 2OWCA 3P3BA 1Y65A 3IPWA 1XIJA 1LLOA 3VD9A 5HJYA 3RCNA 3PWAA 3S6OA 4H8NA 3PG8A 4KEMA 4LAOA 4YTQA 4YCOA 1UR4A 2PF8A 4GYJA 2GJPA 2CXEA 5F1VA 4AZGA 4GHRA 4Q4MA 1PIFA 1NOWA 3AFBA 5FJOA 1HO4A 5E0CA 4UOZA 3TR2A 2Z7KA 1B3WA 3E1F1 1NF0A 3IAQA 1ZP3A 2ZWZA 1XRVA 3S8HA 5A6TC 4JTDA 1R3VA 3W7JA 1PWLA 3DHUA 3BOXA 3VZXA 3P61A 4C1LA 3BUVA 3CYVA 4GXPA 4HYWA 2ZOXA 4LAUA 5BXTA 4DM1A 4KFPA 3L4WA 5G2IA 4QCEA 5ENLA 1JCJA 1VFLA 3VX0A 3HJEA 2EKGA 4MGGA 3O8AA 1J4EA 2QF7A 3ZJ7A 4FNTA 1OFEA 1S1PA 2R91A 3UQNA 3QRHA 1EGVA 1DXIA 4YPJA 3SDOA 1YE6A 5AYZA 5C6MA 3ANYA 2PCEA 1JUBA 4QCFA 4L5ZA 1QDSA 3PZQA 4HTBA 4CD4A 1WUEA 3WUBA 1JZ6A 2YXGA 3MV11 3W1QA 3TR9A 3ZZ1A 3BLIA 2Z29A 1IV8A 4XD5A 4MYXA 1ISWA 1TWSA 5AN7A 4ZXLA 2PTXA 4YLWA 3H4XA 4GY1A 4AZBA 4F0LA 4B4HA 3S9ZA 5CC5A 1CXKA 3ELFA 5DXYA 4V28A 3VINA 3W1XA 1HIZA 1NVMA 4IL2A 2ASHA 3NQEA 3WD2A 1W1ZA 3GNNA 1B57A 3T2QA 2NX9A 3LLFA 4H19A 2A5HA 4JX6A 3K8KA 3LTYA 2VT0A 4FR6A 1SGJA 3OIXA 4S3KA 2CFFA 1RD6A 1YYAA 1US2A 2GVEA 2VCAA 4MKNA 4Y6GA 1DKWA 2JF7A 4ML4A 4E38A 2VFDA 4DJFC 2ATSA 4O52A 3WQ4A 1JF5A 4P7RA 3CAWA 9CGTA 3AROA 3MQTA 3ZVIA 5LA1A 3OJGA 2V5CA 3HMCA 3F4WA 4M29A 3QMSA 3W4RA 1RLCL 3WLIA 1R47A 4C6LA 4HHHA 2WQPA 1WB0A 4IPLA 1Q4WA 3C2YA 2OO6A 2G3JA 1P0EA 3RCYA 1TTQA 2A3AA 4XK2A 1R7AA 2NQLA 1OM0A 4F0SA 1NDWA 1OIMA 4HHLA 4WQ6A 2NWSA 3W01A 1WXZA 3AIQA 3F5LA 3VNIA 3E3HA 1EEXA 3JUGA 4XZMX 3WN6A 1HNYA 3TNOA 4GVGA 2ZRZA 2GGHA 5A95A 2HSAA 2PDNA 1OD0A 1YRRA 5E5CA 5IDIA 5I3JA 2YOCA 2V38A 3OB8A 1KWKA 3LN3A 1HF6A 1SFSA 4XZBA 2V82A 3FA4A 2BOEX 3S1XA 1QPNA 2PDWA 3TMLA 3L67A 3PJWA 1DIDA 3WQ8A 5I00A 1VYRA 3HQPA 1YNPA 1IXPA 1FWNA 3FY1A 4Q4SA 2FHFA 5LNSA 3EMCA 1FCVA 4Q8VA 3OZYA 4GWEA 4OVXA 1JCNA 1DXFA 1UD8A 3RX4A 4D6JA 3GXMA 3TFXA 7CGTA 2EKCA 1D3GA 3AI0A 2VEGA 1JZ8A 1A0EA 3QY6A 4W8LA 2VM8A 5G1YA 5F2IA 3FW6A 5IDZA 4Z08A 1YIXA 1U1UA 4S3JA 3VIPA 4FNUA 4RZ4A 4JYFA 4J3XA 1G4SA 1UR1A 2TRSA 5CPQA 3NZRA 1ZBCA 5D2WA 3TQKA 3WQDA 3AYVA 3SCVA 5AFDA 3VA8A 1EX1A 2VOTA 3LCFA 2OLAA 1DE6A 4FOUA 2QCNA 3RG6A 5LIUX 2VCCA 4PGLA 1W1VA 1GG0A 1IZJA 2OQYA 2J9ZA 2XG9A 1P43A 3LNPA 3NQBA 2PWHA 3B0YA 4UFLA 3TK7A 3LENA 4HU4A 1GQIA 5EY5A 1OHLA 1TPDA 5E09A 3DUGA 1A3XA 4GGBA 3RPMA 3VAVA 3GBDA 3D3AA 1ZJAA 4B16A 2F6XA 5IRPA 2OELA 4WOZA 3AISA 3GNXA 2RDWA 3M0HA 1G4EA 1W32A 2WMFA 2WBGA 1V08A 4O12A 1KGWA 5I07A 1OX4B 1XKYA 3CUJA 3H24A 3WFLA 1KCKA 4QS5A 2PPGA 2TMDA 1HL9A 1FRBA 3TKFA 2YDQA 2XGBA 2OQHA 5GNXA 4C65A 1SPQA 5TQLA 2ESCA 3SQLA 1KFEA 2NSXA 4B5TA 4ERGA 4CGTA 2NQJA 1P6BA 3QC3A 4HNVA 1TVNA 3K1DA 3TW9A 4HVXA 1UQYA 1UR0A 4EE9A 3GLCA 2XGZA 1FXPA 3WNOA 3W7QA 2VRKA 5K9DA 3SRKA 3M5ZA 4A21A 4NJGA 5M3WA 4LUSA 5TBOA 3N3TA 4UCGA 1CLVA 3MUAA 4DWDA 4B5SA 4ACZB 3WJZA 4GYPA 4O16A 4NZ5A 4JQAA 4Y9NA 2XYLA 2GVGA 2XJ7A 2QCFA 4EK7A 4BWLA 1OGSA 5CAHA 4C7DA 3BQ5A 4XV0A 3NPVA 3AYSA 3TOPA 2HK1A 1GEQA 1VAHA 5AVHA 4G6CA 4UZUA 2HE8A 4K1WA 1H11A 2O56A 4LUJA 4OU1A 5D4YA 2BVWA 4GXMA 3PTQA 3S5ZA 3IUDA 3TONA 3GD6A 4NF7A 5M5DA 2AQWA 1UP2A 1M7XA 2PA6A 5D02A 2D73A 4H9VA 2ONEA 2VEFA 1UPMB 1HX0A 4REQB 3QPYA 2DH3A 3EWBX 3U7BA 3XISA 4KWVA 3B0XA 1EL3A 1E73M 1JPMA 3FN9A 4GO8A 4Y9OA 3N4AA 2XVPA 2VEMA 3MYOA 2ZX5A 1HVXA 4WIWA 3GR7A 2CHOA 1E0UA 3CHEA 1P6CA 2ZDRA 1W1A1 2ZZ2A 3ES8A 1WO2A 4ZODA 4Q7BA 5BWFA 3NL6A 1DORA 3PY2A 4J35A 3DC8A 3UYIA 3B4YA 5JBEA 4U5KA 1XYFA 4D1JA 1TWDA 2J7BA 3NQ2A 1W3HA 3HG2A 2BODX 1WZAA 2J62A 4JD4A 3PULA 4W85A 1W9XA 1EXBA 2AQOA 4OBRA 3KCOA 4GXWA 3PJUA 1BXBA 5A6MA 1NAL1 3NQ6A 2XTKA 4JX5A 3PUGA 3W7OA 4O50A 5EKYA 3DBNA 5J5DA 2PB1A 1PUDA 5D32A 3LNMA 4PMYA 3JVAA 1XS2A 2OEMA 6CGTA 1XR2A 1ISZA 1SJCA 3KCJA 2PDYA 2Y6ZA 5BXPA 2Z24A 3VOFA