3LESA

2f5 epitope scaffold es2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
SDPVRQYLHEIGEVLELDKWAELGAAAKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAAIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRGFAFSTYATWWIRQAINRAIADQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Immune system
total genus 61
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lesA00
4Q5SF 1IW7F 4G7ZF 4G7HF 4MQ9F 1SMYF 3UGOA 4OIQF 2A69F 3DXJF 4OIRF 4KI2A 3WODF 3EQLF 2A6HF 4OIPF 4G7OF 4OIOF 4OINF 3UGPA 2A68F 1ZYRF 2CW0F 4Q4ZF 4XLPF 2BE5F 3LEVA 3LESA 2A6EF 4XLNF 1KU2A
chains in the Genus database with same CATH superfamily
4Q5SF 3O55A 2HS5A 1B68A 3AG3C 1VLSA 3V5ZA 4J30B 1JR8A 2QTVA 3BRJA 3QTHA 5KYYA 2WZGA 2XLMA 1EQ1A 3Q7GA 4YT2A 2H7VC 2Y3BA 3S0XA 4N6HA 3TK0A 4MW3A 1R4TA 3AGUA 2FGYA 3ZTZA 1FAPB 2NUPB 1UFBA 1XWJA 2YLIA 4MVSA 4OIRF 3UMIA 3EGXB 5L0HA 5L0DA 4JZAA 2CNWA 1RKEA 4XEVA 4DOZA 4CSAA 4K0DA 2A6HF 3PMRA 4N06A 3MFNA 5BQGA 1FFHA 2P6VA 1TFKB 2A0UA 3DM9B 1JRAA 1LE4A 2YRFA 4U5BE 1Z7Qc 5F5HA 2ZXOA 3C7JA 3FOOA 2AVKA 1LVKA 5D92A 1D0ZA 4H4KC 3G50A 5B3IA 1YYJA 2XRHA 3OWTA 4M63A 4ULWA 4CBEA 5DVWA 2AWCA 1IW7F 5K0IA 2EIMC 5COFA 1ZW2A 4CJOA 1RXQA 2XS8A 2XSEA 4BJTA 3MBGA 4ZLDA 2R7XA 1AUEA 4EIYA 3LLKA 5B1BC 1QVXA 2KK1A 3W8IA 3F47A 2J46A 2R02A 4UDVA 3UMHA 1OCZC 1YLMA 2DGJA 2R7SA 4JIOA 1QPUA 3SXMA 2HKVA 3KPHA 3EZHA 4W8KA 3U9MA 1RJ9B 4AK9A 2LK4A 4H54A 3S29A 4EWCA 2XXAA 4NTFA 2MHRA 3RQEA 4A4AA 2Y39A 3HNLA 5EK0A 3JZ0A 3TJ5A 2CNWD 5B3SC 1C02A 4OINF 4CDVA 3KKBA 4ONSA 2PNOA 4LLEA 4PACA 4LERA 4U5HA 2ETSA 4BG0A 1TFOB 1JPJA 1A7EA 1ORSC 3G4ZA 3LAYA 2PP4A 4BEJA 1D0XA 5BQIA 3VM6A 3HKKA 4U9DA 2ICWG 1NBBA 1I5NA 2GWWA 4IB4A 1GS9A 4J32B 4FX5A 4PJLA 2J9VA 2OEVA 5E3CA 3W4YA 2P7VA 3POVA 2ZPAA 1MMDA 2O9XA 2EINC 3DKAA 3L0IA 4NCQA 2EPKX 2XL4A 3GANA 3LS0A 3QMKA 1OW8A 1SR2A 2L6HA 2W45A 4EKWA 1A7DA 3U3FA 1OW6A 1MNEA 5DQZA 3EQLF 5COMA 4WGZA 2G62A 2JPUA 3VYWA 2H7OA 3U2LA 4PJNA 3CZ6A 1Y4CA 2XLEA 1VTMP 1U0BB 4DVYP 2Q9CA 4XEFA 4DXWA 1WGWA 2Q7RA 3ASNC 3EFOB 4P6IC 1LS1A 2VCBA 1Z63A 1KU2A 1AVOB 2D5RB 1TWHA 3HNIA 3PCVA 3A9CA 2IXNA 4X0RA 1LS4A 3SXZA 1VMAA 3B9QA 3DAGA 1PV3A 3M4BA 3JCUQ 3KH2A 3OEOA 3MYFA 3O6XA 4CX9A 1GGQA 3B0UX 2CGEA 2NUPA 1CGME 3GM1A 1PD0A 3WHNA 4YT5A 1L3PA 3KYJA 4FAPB 2B0JA 1LPEA 2HUJA 2JX0A 2C03A 3C63A 4RDAA 3HNKA 4JJFA 2DYRC 3LNMB 3T4RA 3MX3A 2LD6A 2ZXWC 4IWBA 2DI3A 4OIPF 1LI5A 4G7OF 1TWAA 2Q00A 1RCPA 2BL2A 4O6YA 5DLJA 3NYMA 3R2PA 1YARO 4BJ5C 3B0PA 2J7PA 5AGFA 1NSGB 4AE4A 4L6RA 2CCYA 4XLPF 3JRMO 2GFHA 3DD7A 4KNVA 5KYUB 1ZU5A 3GORA 2V3CC 3ZQVA 3HNJA 5L0GA 2UUHA 2WZLA 2Y3DA 1CGOA 3K1HA 1O87A 2NUTB 3TULA 3VAYA 1G8XA 3N2ZB 4EBBA 4IJJA 1OR2A 2LFDA 2JD3A 3B29A 4AL0A 3O39A 1RJ9A 1LM3B 3ASOC 2HV6A 1HW1A 3BEHA 1Z3IX 4XQ1A 3NRHA 4K7BA 1LI7A 2H8AA 1R5ID 3W2WA 3L1MA 3IQ5A 1SYQA 4R32A 1EA8A 3T6JA 4I1OB 4BEMJ 4ANJA 4KI2A 3NMJA 4JEBA 2L6FA 3K33A 3NYLA 5JUAA 2MYSA 5A6BA 3B0VC 2HV7A 3ZG1A 3Q6NA 3JRTA 4HFKB 1ZZPA 5E33A 4WGYA 2A0BA 3JSEO 2EIJC 3QVZA 2J7PD 3K1IC 4W8PA 4XWJA 2MWQA 5COGA 4MNDA 1HMOA 1CPRA 3I4UA 2W4BA 3FOPA 4HEAJ 5L0IA 3DZAA 2NPUA 2Q9BA 5FZTA 5JLIA 4P9TA 2Z15A 2WZFA 3EH1A 3JT1A 3V5YA 4C3BA 1BR2A 2R7RA 5BUOA 5E3AA 5BQHA 4WJ0A 4O6MA 1EI7A 2VCAA 4I1MA 5CI9A 5JVEA 4LLCA 3RIPA 4ZLCA 4G78A 3TOLA 3E9VA 3ZSUA 5KYXB 2VC9A 4BJ6A 3A11A 4IAQA 2OU6A 3DXJF 4YK5A 3MLGA 3VRCA 1D1AA 4XEKA 2J0WA 2QY9A 2J8WA 2YL7A 3DI5A 1M2VB 4YL0A 1CPQA 4E18A 4DBQA 4F4BA 3C8GB 3ZC4A 1ST6A 3NYJA 4MVZA 1HE9A 5F5FA 4CS8C 3FDQA 1O3UA 2ZXRA 2YHSA 3U9JA 5L0JA 1EKYA 3EFOA 3OA1A 2VCCA 1UG7A 3GM2A 4YN0B 5A6BD 1E85A 3S90A 4KBLA 3S27A 5FCLA 1M56C 5HV9A 1G5ZA 3EGDB 3AQBA 3VF0A 1GQAA 1W2WA 3M1CB 5DS6A 2HMZA 1V74B 1BR1A 3ZWIA 5EGYA 2PBEA 2PX3A 2HZ8A 2LSEA 4JKVA 4MVMA 3T6GB 1YA7O 5JS5A 4YT4A 3IQTA 4BJ5A 2P0NA 4RBNA 3ABKC 4O79A 5KYNA 2IBFA 3EG9B 1NLXA 2LFFA 3ITFA 2CDQA 1YYXA 2Q9AA 4E0IA 4C7OB 1HE1A 2VB6A 3SYNA 2XL6A 3W2VA 4WABA 2J9UA 2WL8A 4Z9JA 3RVYA 2HJMA 1TKNA 4EBJA 3PHF2 1C03A 1QZXA 4N6CA 3SEOA 1ZHTA 2OOCA 4YL3A 4HFFB 4NY3A 3K7DA 3E70C 1FTSA 1WWPA 1Q0GA 1A7VA 1ZHZA 1LE2A 1RMVA 1ZHWA 5CI8A 4MVQA 3JSZA 1S05A 1ZHXA 1FMVA 1K05A 2L81A 1YAUO 2Q3TA 1MMNA 4CIHA 1PD1A 2LP4A 3UMKA 1Q0MA 4Q7CA 5JSLA 4KC9A 3US6A 4DJ9A 3K1IA 1ZHYA 5T3WA 1V54C 1WTYA 1A41A 3U3BA 2AP3A 3GM3A 2EILC 3KMIA 2AU5A 2YWAA 4I3MA 4EBKA 4CS9C 3CEXA 3AQCA 3ECSA 3KYIA 5T3TA 5CIVA 5EHHA 3RVZA 1YZAA 2KYHA 3U8PA 2X51A 4RD9A 3SXYA 4CIPA 2OG2A 1QKRA 2F22A 2GA0A 2ZD9A 2G3VA 2KNHA 1OQCA 2IXOA 3AG1C 1H9GA 2ASRA 3EGDA 3ZDLA 5IY5C 3L34A 1ORJA 2PFDA 3DE9A 4JCHA 4LDKA 1G4US 1HMDA 1KTMA 2J45A 2QE9A 3LLIA 2Q4FA 3S84A 1WATA 4Q4ZF 3EH2A 2NSGA 2D4UA 3RKOF 1E2XA 4CS8A 5KYWB 1T9KA 3JYHA 1NG1A 1IZMA 3R7CA 1VB5A 3QW0A 4AX2A 3LNRA 1FMWA 3N24A 3U8VA 4OIQF 3EGXA 1DOVA 1NU9C 3Q7LA 4U5CE 4E0HA 2YKZA 3C8GA 4DRIB 3L8JA 4YL1A 1DOWA 2XLVA 4I44A 2W9YA 3WODF 1Z23A 2DYSC 2HSQA 2XLDA 1T01A 4U5FE 4MVRA 2YLDA 3FVYA 3K66A 2Y3GA 3K6BA 4DRHB 2J9WA 2M4EA 3TJ6A 4JW1A 1NZEA 1TR2A 1OCCC 1VLTA 2XLOA 3IQCA 3U5SA 5L0FA 2HFIA 2OKUA 3DE8A 2TMVP 2KGOA 2R05A 3L8IA 1E83A 1GM5A 2WVNA 3ZQYA 2XLWA 4XPWA 1ZW3A 3NG1A 3EHMA 3HLZA 1N1CA 3I5QA 4MQ9F 3CSKA 4C7OA 1MQVA 1VYIA 2A69F 5A6JA 2YL1A 3M4CA 5AC5A 3GWNA 4KNWA 2KSFA 1NU7D 4JTDB 3C8GD 1M6TA 2R7WA 2YQYA 1Z5ZA 1XZQA 1I4YA 1M57C 3Q6MA 1U6HA 4QDLA 3NMKA 1HY5A 1XZPA 1FFTC 4D4XA 1LIHA 3NKDA 3H65A 1ZYRF 2OCCC 2W4MA 1G4WR 1APCA 3AOUA 3NMIA 4JVSA 1JAFA 1U89A 1A0BA 3O10A 3V5XA 2J0XA 2A6EF 3RYLA 4QI0A 2P61A 4PFPA 3GEEA 3GEIA 3C18A 5HSWA 2I8BA 4PJMA 4P9FA 2EPNA 4CS9A 3SP1A 3CAXA 3X2QC 1QQ3A 2NG1A 2XLHA 3LS1A 3UGOA 2YVKA 2QLAA 3UNGC 3RF3A 1D0YA 2GDCA 3CQZA 3FXHA 1QLEC 3AG2C 4FWVA 2I15A 4YT8A 5L3VA 2RD9A 4LDQA 1T6UA 3IPMO 4JEAA 1Z6AA 4E7SA 5TJ5E 3C62A 1VOMA 3ABLC 3PDMP 5L0CA 1E84A 3IEEA 1NFOA 2WB7A 4CDAA 4C3DA 3NDBB 2AWYA 4A2NB 4U5GA 4DBRA 3S28A 3LEVA 1SF8A 4YWQA 1BZ4A 1BBHA 5JRAA 2WVQA 2R25A 1JPNA 2VH3A 5KYWA 3FAPB 5JP7A 2XM0A 2R7TA 3FHDA 1D1CA 2P1AA 4QI2A 3RQGA 1YZCA 2XS1A 3GWLA 3ZTMA 1OW7A 2LQGA 1HW2A 2DB4A 2L7AA 2KC3A 3LJBA 4NC3A 4MS2A 1I4ZA 3SXKA 5A6AA 1BR4A 4MW8A 4EHPA 4HE8D 1OXKA 1PCXA 4K1OA 1NFNA 4N4WA 2YEVA 2PX0A 4JTAB 4ER9A 3FAJA 4NQFA 5KYUA 4MTGA 3M79A 1WASA 2YLGA 1MMAA 4AE4B 2C04A 3JTLO 4JC7A 4XLNF 3DAFA 3V7OA 3WAQA 4D4NA 1OCOC 2NUTA 2KJGA 2PF4E 4MTFA 1Q0DA 2OEXA 3TQOA 4MTOA 3MYIA 2IXPA 1TWGA 1T6IA 1VYKA 2EPOA 5GPGB 4OD4A 3DMDA 1MMGA 1Y6DA 5B1AC 1FNTc 1H6GA 2R7OA 3QW1A 4C3EA 3N0TA 2UUIA 2Y3HA 3DJNB 1V55C 3ZIBA 5L3QA 3RH3A 2LIGA 2Y69C 4J7YA 3EPVA 4E7ZA 1Q0KA 2HSBA 2IXMA 256BA 3F46A 3H2VA 2B0HA 2CW0F 2KW3C 1YA9A 1L7CA 2WVOA 1K40A 2IYLD 3B71A 3DM5A 3KL4A 1YJGA 4DVZA 2E87A 3AJMA 2L6GA 3SZRA 2FFHA 2YL3A 4JRZA 4IRUA 3LUTB 3QZCA 1ZU4A 2H7BA 3AG4C 3FMSA 2CYDA 4YJWA 3X1OA 5KYXA 4XTKA 2ZXPA 5KYYB 1WN0A 3UR3C 1OKKA 2M64A 1JOGA 4E17A 4EUKB 4U5DE 1VK5A 1WOLA 4BJ1A 1D1BA 1M2VA 1T5OA 3DWWA 4AL1A 4GYTA 3ATPA 2R7VA 1RKEB 3I5PA 2R03A 2RSEB 2QUPA 3EJNA 4Z9HA 3RFYA 3W8HA 4BJ6C 4O6NA 1K04A 1E86A 1YVIA 2J9BA 2BE5F 5T1DB 1TWCA 3HTKC 3SNHA 4OD5A 2G3KA 4GQHA 4PK4A 2HJ3A 1YDIA 1QSPA 4CSAC 4NTBA 1V4AA 3IQ6A 1BDJB 2BC5A 2EPMX 2HMQA 3IHUA 3TOMA 3EZIA 1J8YF 2GAQA 5DS5A 3LEOA 4XPYA 4CS7A 2VASA 5E2QA 1S7ZA 1H7IA 3T9OA 3HJCA 1TQGA 3GODA 3JYYA 2X0CA 4G0HA 1KNYA 5AC4A 3EG9A 5D91A 1SMYF 1T6QA 1SZIA 2FAPB 4B6IA 3U2MA 1M2OA 5A6KA 2OJQA 4GEHA 2XL8A 1OKKD 4JTCB 3NKEA 3S9OA 1OR3A 4PJJA 4FESA 1AEPA 4IGGA 3M15A 5JT4A 1F1MA 2A1DD 4LACB 4OIOF 4NTAA 3J06A 3AGTA 3DJUB 3TD7A 3UGPA 4U5EE 4CJGA 2XXAB 1LKXA 2KQ9A 4JJGA 3EHNA 1J8MF 2OJED 3RW0A 2YL0A 2NSFA 2XM4A 2QNLA 4J7TA 1JMWA 2R7QA 5F28E 1C17M 4JE9A 4JCZA 4Z9IA 4MVOA 3ZVRA 3H2UA 3U0CA 1FR0A 4G7ZF 4G7HF 2OQMA 3RQFA 2R7UA 1Q0FA 1O5HA 3G4XA 1CGNA 3T6BA 2YZSA 4LDRA 3QVYA 4PFOA 1MNDA 2V26A 2EPLX 2IM8A 4PR9A 2IOQA 4MVUA 3GEHA 4ULVA 4O7GA 4U9EA 2L9JA 5DQTA 1ZVZA 4CDYA 4IARA 1RKCA 5DS4A 5A69A 2A68F 4IAOA 4BPMA 2EIKC 3WG7C 4JURI 3C8ZA 2LCHA 4XPXA 3LESA 3ABMC 4DRJB 1OXBA 1H9TA 1OCRC 2R9RB 1ORYA
chains in the Genus database with same CATH topology
4Q5SF 3AG3C 4J30B 2QTVA 5KYYA 2WZGA 3Q7GA 4YT2A 2H7VC 2Y3BA 3S0XA 2FGYA 2NUPB 3UMIA 4OIRF 3EGXB 4JZAA 2CNWA 4CSAA 4DOZA 4K0DA 2A6HF 3PMRA 4N06A 1FFHA 2P6VA 3DM9B 5F5HA 4U5BE 4Q4ZF 2ZXOA 1LVKA 5D92A 1D0ZA 4H4KC 2XRHA 3OWTA 4M63A 4CBEA 4ULWA 5DVWA 1IW7F 2EIMC 2XSEA 4BJTA 4ZLDA 2R7XA 3LLKA 5B1BC 3W8IA 3F47A 2J46A 2R7SA 3UMHA 1OCZC 2DGJA 3EZHA 4W8KA 1RJ9B 4AK9A 3S29A 4EWCA 2XXAA 2Y39A 5B3SC 2CNWD 4OINF 3KKBA 4LLEA 4LERA 4U5HA 4BG0A 1JPJA 3LAYA 2PP4A 1D0XA 4J32B 4FX5A 4PJLA 2J9VA 3POVA 5E3CA 2P7VA 2ZPAA 1MMDA 2O9XA 2EINC 3L0IA 3QMKA 2XL4A 3GANA 3LS0A 2W45A 1MNEA 5DQZA 3EQLF 3VYWA 2G62A 2H7OA 4PJNA 3CZ6A 4DVYP 2Q9CA 1WGWA 3ASNC 3EFOB 4P6IC 1LS1A 1Z63A 1TWHA 1KU2A 2D5RB 2IXNA 4X0RA 1VMAA 3B9QA 3DAGA 3OEOA 3O6XA 3JCUQ 3KH2A 3B0UX 2CGEA 2NUPA 1PD0A 4YT5A 2B0JA 2C03A 4RDAA 4JJFA 2DYRC 3T4RA 3MX3A 4IWBA 2ZXWC 4OIPF 4G7OF 1TWAA 5DLJA 4O6YA 3NYMA 4BJ5C 3B0PA 2J7PA 4AE4A 4XLPF 3DD7A 2GFHA 4KNVA 5KYUB 1ZU5A 2V3CC 2WZLA 2Y3DA 3K1HA 1O87A 2NUTB 3VAYA 1G8XA 3N2ZB 4EBBA 4IJJA 2JD3A 3O39A 1RJ9A 3ASOC 2HV6A 1Z3IX 3NRHA 4K7BA 3W2WA 4KI2A 4ANJA 3T6JA 4I1OB 3K33A 3NYLA 2MYSA 3B0VC 2HV7A 3ZG1A 3Q6NA 3JRTA 4HFKB 5E33A 2EIJC 2J7PD 3K1IC 4XWJA 3RKOF 2MWQA 4C3DA 4MNDA 4HEAJ 3I4UA 2W4BA 3DZAA 2Q9BA 2Z15A 2WZFA 3EH1A 3JT1A 4C3BA 2R7RA 1BR2A 5BUOA 5E3AA 4WJ0A 4O6MA 5CI9A 4I1MA 4LLCA 3RIPA 4ZLCA 3ZSUA 5KYXB 3E9VA 4BJ6A 3DXJF 3MLGA 1D1AA 2J0WA 2QY9A 4DBQA 1M2VB 4F4BA 3ZC4A 1ST6A 3NYJA 5F5FA 4CS8C 3FDQA 2ZXRA 2YHSA 3EFOA 3OA1A 4YN0B 4KBLA 3S27A 5FCLA 1M56C 3AQBA 1W2WA 3M1CB 5DS6A 1BR1A 5EGYA 2PX3A 2LSEA 4YT4A 4BJ5A 4RBNA 3ABKC 4O79A 5KYNA 3EG9B 3ITFA 2CDQA 2Q9AA 4C7OB 2VB6A 3SYNA 3W2VA 2J9UA 2WL8A 1TKNA 3PHF2 1QZXA 3SEOA 1ZHTA 4HFFB 4NY3A 3K7DA 3E70C 1FTSA 1ZHZA 1ZHWA 5CI8A 4BEJA 3JSZA 1ZHXA 1FMVA 2L81A 2Q3TA 1MMNA 4CIHA 1PD1A 3UMKA 4Q7CA 1ZHYA 5T3WA 1V54C 3KMIA 2EILC 4I3MA 4CS9C 3ECSA 3AQCA 5T3TA 5EHHA 2X51A 4RD9A 2OG2A 2G3VA 2KNHA 2IXOA 3AG1C 3EGDA 5IY5C 3L34A 2PFDA 4JCHA 2J45A 3LLIA 3EH2A 5KYWB 4CS8A 3JYHA 1NG1A 1IZMA 4AX2A 3LNRA 1FMWA 3N24A 4OIQF 3EGXA 1NU9C 3Q7LA 4U5CE 4I44A 3WODF 2W9YA 1Z23A 2DYSC 4U5FE 3FVYA 3K66A 2Y3GA 3K6BA 2J9WA 2M4EA 4JW1A 1NZEA 1TR2A 1OCCC 2KGOA 2WVNA 3NG1A 3EHMA 3HLZA 1N1CA 3I5QA 4MQ9F 3CSKA 4C7OA 2A69F 1VYIA 4KNWA 1NU7D 2R7WA 1Z5ZA 3Q6MA 1M57C 4QDLA 1FFTC 3NKDA 3H65A 1ZYRF 2OCCC 2W4MA 4JVSA 2J0XA 2A6EF 3RYLA 4QI0A 4PFPA 5HSWA 2I8BA 4PJMA 4CS9A 3SP1A 3X2QC 2NG1A 3LS1A 3UGOA 3UNGC 1D0YA 5L3VA 3CQZA 1QLEC 3AG2C 4FWVA 4YT8A 1Z6AA 4E7SA 1VOMA 3ABLC 3IEEA 2WB7A 3NDBB 4A2NB 4U5GA 4DBRA 3S28A 3LEVA 1SF8A 4YWQA 2WVQA 1JPNA 2VH3A 5KYWA 2R7TA 3FHDA 1D1CA 4QI2A 3LJBA 1BR4A 4HE8D 1PCXA 2YEVA 2PX0A 3FAJA 5KYUA 1MMAA 4AE4B 2C04A 4XLNF 3DAFA 3V7OA 1OCOC 2NUTA 2KJGA 2PF4E 2IXPA 1TWGA 1VYKA 4OD4A 3DMDA 1MMGA 5B1AC 2R7OA 4C3EA 3N0TA 2Y3HA 3DJNB 1V55C 3ZIBA 5L3QA 3RH3A 2Y69C 3EPVA 4E7ZA 2IXMA 3F46A 2KW3C 2CW0F 3KL4A 2WVOA 3DM5A 4DVZA 2IYLD 2E87A 3SZRA 2FFHA 4IRUA 3QZCA 1ZU4A 2H7BA 3AG4C 4YJWA 3X1OA 5KYXA 4XTKA 2ZXPA 5KYYB 3UR3C 1OKKA 4U5DE 1VK5A 4BJ1A 1D1BA 1M2VA 4GYTA 2R7VA 3I5PA 3RFYA 3EJNA 3W8HA 4BJ6C 4O6NA 5T1DB 3SNHA 2BE5F 1TWCA 3HTKC 4OD5A 2G3KA 4PK4A 4CSAC 3EZIA 1J8YF 5DS5A 4CS7A 2VASA 5E2QA 1S7ZA 3HJCA 3GODA 4G0HA 3EG9A 5D91A 1SMYF 1SZIA 4B6IA 1M2OA 4GEHA 1OKKD 3NKEA 4PJJA 4FESA 2A1DD 4LACB 4OIOF 3DJUB 3TD7A 3UGPA 4U5EE 2XXAB 1LKXA 2KQ9A 4JJGA 3EHNA 1J8MF 2R7QA 3ZVRA 4G7ZF 4G7HF 2R7UA 1O5HA 3T6BA 2YZSA 4PFOA 1MNDA 2V26A 2IOQA 4O7GA 2L9JA 5DQTA 5DS4A 2A68F 4IAOA 2EIKC 3WG7C 4JURI 3LESA 3ABMC 1OCRC 3EGDB 4KC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5S F;  1IW7 F;  4G7Z F;  4G7H F;  4MQ9 F;  1SMY F;  3UGO A;  4OIQ F;  2A69 F;  3DXJ F;  4OIR F;  4KI2 A;  3WOD F;  3EQL F;  2A6H F;  4OIP F;  4G7O F;  4OIO F;  4OIN F;  3UGP A;  2A68 F;  1ZYR F;  2CW0 F;  4Q4Z F;  4XLP F;  2BE5 F;  3LEV A;  3LES A;  2A6E F;  4XLN F;  1KU2 A; 
#chains in the Genus database with same CATH topology
 4Q5S F;  3O55 A;  2HS5 A;  1B68 A;  3AG3 C;  1VLS A;  3V5Z A;  4J30 B;  1JR8 A;  2QTV A;  3BRJ A;  3QTH A;  5KYY A;  2WZG A;  2XLM A;  1EQ1 A;  3Q7G A;  4YT2 A;  2H7V C;  2Y3B A;  3S0X A;  4N6H A;  3TK0 A;  4MW3 A;  1R4T A;  3AGU A;  2FGY A;  3ZTZ A;  1FAP B;  2NUP B;  1UFB A;  1XWJ A;  2YLI A;  4MVS A;  4OIR F;  3UMI A;  3EGX B;  5L0H A;  5L0D A;  4JZA A;  2CNW A;  1RKE A;  4XEV A;  4DOZ A;  4CSA A;  4K0D A;  2A6H F;  3PMR A;  4N06 A;  3MFN A;  5BQG A;  1FFH A;  2P6V A;  1TFK B;  2A0U A;  3DM9 B;  1JRA A;  1LE4 A;  2YRF A;  4U5B E;  1Z7Q c;  5F5H A;  2ZXO A;  3C7J A;  3FOO A;  2AVK A;  1LVK A;  5D92 A;  1D0Z A;  4H4K C;  3G50 A;  5B3I A;  1YYJ A;  2XRH A;  3OWT A;  4M63 A;  4ULW A;  4CBE A;  5DVW A;  2AWC A;  1IW7 F;  5K0I A;  2EIM C;  5COF A;  1ZW2 A;  4CJO A;  1RXQ A;  2XS8 A;  2XSE A;  4BJT A;  3MBG A;  4ZLD A;  2R7X A;  1AUE A;  4EIY A;  3LLK A;  5B1B C;  1QVX A;  2KK1 A;  3W8I A;  3F47 A;  2J46 A;  2R02 A;  4UDV A;  3UMH A;  1OCZ C;  1YLM A;  2DGJ A;  2R7S A;  4JIO A;  1QPU A;  3SXM A;  2HKV A;  3KPH A;  3EZH A;  4W8K A;  3U9M A;  1RJ9 B;  4AK9 A;  2LK4 A;  4H54 A;  3S29 A;  4EWC A;  2XXA A;  4NTF A;  2MHR A;  3RQE A;  4A4A A;  2Y39 A;  3HNL A;  5EK0 A;  3JZ0 A;  3TJ5 A;  2CNW D;  5B3S C;  1C02 A;  4OIN F;  4CDV A;  3KKB A;  4ONS A;  2PNO A;  4LLE A;  4PAC A;  4LER A;  4U5H A;  2ETS A;  4BG0 A;  1TFO B;  1JPJ A;  1A7E A;  1ORS C;  3G4Z A;  3LAY A;  2PP4 A;  4BEJ A;  1D0X A;  5BQI A;  3VM6 A;  3HKK A;  4U9D A;  2ICW G;  1NBB A;  1I5N A;  2GWW A;  4IB4 A;  1GS9 A;  4J32 B;  4FX5 A;  4PJL A;  2J9V A;  2OEV A;  5E3C A;  3W4Y A;  2P7V A;  3POV A;  2ZPA A;  1MMD A;  2O9X A;  2EIN C;  3DKA A;  3L0I A;  4NCQ A;  2EPK X;  2XL4 A;  3GAN A;  3LS0 A;  3QMK A;  1OW8 A;  1SR2 A;  2L6H A;  2W45 A;  4EKW A;  1A7D A;  3U3F A;  1OW6 A;  1MNE A;  5DQZ A;  3EQL F;  5COM A;  4WGZ A;  2G62 A;  2JPU A;  3VYW A;  2H7O A;  3U2L A;  4PJN A;  3CZ6 A;  1Y4C A;  2XLE A;  1VTM P;  1U0B B;  4DVY P;  2Q9C A;  4XEF A;  4DXW A;  1WGW A;  2Q7R A;  3ASN C;  3EFO B;  4P6I C;  1LS1 A;  2VCB A;  1Z63 A;  1KU2 A;  1AVO B;  2D5R B;  1TWH A;  3HNI A;  3PCV A;  3A9C A;  2IXN A;  4X0R A;  1LS4 A;  3SXZ A;  1VMA A;  3B9Q A;  3DAG A;  1PV3 A;  3M4B A;  3JCU Q;  3KH2 A;  3OEO A;  3MYF A;  3O6X A;  4CX9 A;  1GGQ A;  3B0U X;  2CGE A;  2NUP A;  1CGM E;  3GM1 A;  1PD0 A;  3WHN A;  4YT5 A;  1L3P A;  3KYJ A;  4FAP B;  2B0J A;  1LPE A;  2HUJ A;  2JX0 A;  2C03 A;  3C63 A;  4RDA A;  3HNK A;  4JJF A;  2DYR C;  3LNM B;  3T4R A;  3MX3 A;  2LD6 A;  2ZXW C;  4IWB A;  2DI3 A;  4OIP F;  1LI5 A;  4G7O F;  1TWA A;  2Q00 A;  1RCP A;  2BL2 A;  4O6Y A;  5DLJ A;  3NYM A;  3R2P A;  1YAR O;  4BJ5 C;  3B0P A;  2J7P A;  5AGF A;  1NSG B;  4AE4 A;  4L6R A;  2CCY A;  4XLP F;  3JRM O;  2GFH A;  3DD7 A;  4KNV A;  5KYU B;  1ZU5 A;  3GOR A;  2V3C C;  3ZQV A;  3HNJ A;  5L0G A;  2UUH A;  2WZL A;  2Y3D A;  1CGO A;  3K1H A;  1O87 A;  2NUT B;  3TUL A;  3VAY A;  1G8X A;  3N2Z B;  4EBB A;  4IJJ A;  1OR2 A;  2LFD A;  2JD3 A;  3B29 A;  4AL0 A;  3O39 A;  1RJ9 A;  1LM3 B;  3ASO C;  2HV6 A;  1HW1 A;  3BEH A;  1Z3I X;  4XQ1 A;  3NRH A;  4K7B A;  1LI7 A;  2H8A A;  1R5I D;  3W2W A;  3L1M A;  3IQ5 A;  1SYQ A;  4R32 A;  1EA8 A;  3T6J A;  4I1O B;  4BEM J;  4ANJ A;  4KI2 A;  3NMJ A;  4JEB A;  2L6F A;  3K33 A;  3NYL A;  5JUA A;  2MYS A;  5A6B A;  3B0V C;  2HV7 A;  3ZG1 A;  3Q6N A;  3JRT A;  4HFK B;  1ZZP A;  5E33 A;  4WGY A;  2A0B A;  3JSE O;  2EIJ C;  3QVZ A;  2J7P D;  3K1I C;  4W8P A;  4XWJ A;  2MWQ A;  5COG A;  4MND A;  1HMO A;  1CPR A;  3I4U A;  2W4B A;  3FOP A;  4HEA J;  5L0I A;  3DZA A;  2NPU A;  2Q9B A;  5FZT A;  5JLI A;  4P9T A;  2Z15 A;  2WZF A;  3EH1 A;  3JT1 A;  3V5Y A;  4C3B A;  1BR2 A;  2R7R A;  5BUO A;  5E3A A;  5BQH A;  4WJ0 A;  4O6M A;  1EI7 A;  2VCA A;  4I1M A;  5CI9 A;  5JVE A;  4LLC A;  3RIP A;  4ZLC A;  4G78 A;  3TOL A;  3E9V A;  3ZSU A;  5KYX B;  2VC9 A;  4BJ6 A;  3A11 A;  4IAQ A;  2OU6 A;  3DXJ F;  4YK5 A;  3MLG A;  3VRC A;  1D1A A;  4XEK A;  2J0W A;  2QY9 A;  2J8W A;  2YL7 A;  3DI5 A;  1M2V B;  4YL0 A;  1CPQ A;  4E18 A;  4DBQ A;  4F4B A;  3C8G B;  3ZC4 A;  1ST6 A;  3NYJ A;  4MVZ A;  1HE9 A;  5F5F A;  4CS8 C;  3FDQ A;  1O3U A;  2ZXR A;  2YHS A;  3U9J A;  5L0J A;  1EKY A;  3EFO A;  3OA1 A;  2VCC A;  1UG7 A;  3GM2 A;  4YN0 B;  5A6B D;  1E85 A;  3S90 A;  4KBL A;  3S27 A;  5FCL A;  1M56 C;  5HV9 A;  1G5Z A;  3EGD B;  3AQB A;  3VF0 A;  1GQA A;  1W2W A;  3M1C B;  5DS6 A;  2HMZ A;  1V74 B;  1BR1 A;  3ZWI A;  5EGY A;  2PBE A;  2PX3 A;  2HZ8 A;  2LSE A;  4JKV A;  4MVM A;  3T6G B;  1YA7 O;  5JS5 A;  4YT4 A;  3IQT A;  4BJ5 A;  2P0N A;  4RBN A;  3ABK C;  4O79 A;  5KYN A;  2IBF A;  3EG9 B;  1NLX A;  2LFF A;  3ITF A;  2CDQ A;  1YYX A;  2Q9A A;  4E0I A;  4C7O B;  1HE1 A;  2VB6 A;  3SYN A;  2XL6 A;  3W2V A;  4WAB A;  2J9U A;  2WL8 A;  4Z9J A;  3RVY A;  2HJM A;  1TKN A;  4EBJ A;  3PHF 2;  1C03 A;  1QZX A;  4N6C A;  3SEO A;  1ZHT A;  2OOC A;  4YL3 A;  4HFF B;  4NY3 A;  3K7D A;  3E70 C;  1FTS A;  1WWP A;  1Q0G A;  1A7V A;  1ZHZ A;  1LE2 A;  1RMV A;  1ZHW A;  5CI8 A;  4MVQ A;  3JSZ A;  1S05 A;  1ZHX A;  1FMV A;  1K05 A;  2L81 A;  1YAU O;  2Q3T A;  1MMN A;  4CIH A;  1PD1 A;  2LP4 A;  3UMK A;  1Q0M A;  4Q7C A;  5JSL A;  4KC9 A;  3US6 A;  4DJ9 A;  3K1I A;  1ZHY A;  5T3W A;  1V54 C;  1WTY A;  1A41 A;  3U3B A;  2AP3 A;  3GM3 A;  2EIL C;  3KMI A;  2AU5 A;  2YWA A;  4I3M A;  4EBK A;  4CS9 C;  3CEX A;  3AQC A;  3ECS A;  3KYI A;  5T3T A;  5CIV A;  5EHH A;  3RVZ A;  1YZA A;  2KYH A;  3U8P A;  2X51 A;  4RD9 A;  3SXY A;  4CIP A;  2OG2 A;  1QKR A;  2F22 A;  2GA0 A;  2ZD9 A;  2G3V A;  2KNH A;  1OQC A;  2IXO A;  3AG1 C;  1H9G A;  2ASR A;  3EGD A;  3ZDL A;  5IY5 C;  3L34 A;  1ORJ A;  2PFD A;  3DE9 A;  4JCH A;  4LDK A;  1G4U S;  1HMD A;  1KTM A;  2J45 A;  2QE9 A;  3LLI A;  2Q4F A;  3S84 A;  1WAT A;  4Q4Z F;  3EH2 A;  2NSG A;  2D4U A;  3RKO F;  1E2X A;  4CS8 A;  5KYW B;  1T9K A;  3JYH A;  1NG1 A;  1IZM A;  3R7C A;  1VB5 A;  3QW0 A;  4AX2 A;  3LNR A;  1FMW A;  3N24 A;  3U8V A;  4OIQ F;  3EGX A;  1DOV A;  1NU9 C;  3Q7L A;  4U5C E;  4E0H A;  2YKZ A;  3C8G A;  4DRI B;  3L8J A;  4YL1 A;  1DOW A;  2XLV A;  4I44 A;  2W9Y A;  3WOD F;  1Z23 A;  2DYS C;  2HSQ A;  2XLD A;  1T01 A;  4U5F E;  4MVR A;  2YLD A;  3FVY A;  3K66 A;  2Y3G A;  3K6B A;  4DRH B;  2J9W A;  2M4E A;  3TJ6 A;  4JW1 A;  1NZE A;  1TR2 A;  1OCC C;  1VLT A;  2XLO A;  3IQC A;  3U5S A;  5L0F A;  2HFI A;  2OKU A;  3DE8 A;  2TMV P;  2KGO A;  2R05 A;  3L8I A;  1E83 A;  1GM5 A;  2WVN A;  3ZQY A;  2XLW A;  4XPW A;  1ZW3 A;  3NG1 A;  3EHM A;  3HLZ A;  1N1C A;  3I5Q A;  4MQ9 F;  3CSK A;  4C7O A;  1MQV A;  1VYI A;  2A69 F;  5A6J A;  2YL1 A;  3M4C A;  5AC5 A;  3GWN A;  4KNW A;  2KSF A;  1NU7 D;  4JTD B;  3C8G D;  1M6T A;  2R7W A;  2YQY A;  1Z5Z A;  1XZQ A;  1I4Y A;  1M57 C;  3Q6M A;  1U6H A;  4QDL A;  3NMK A;  1HY5 A;  1XZP A;  1FFT C;  4D4X A;  1LIH A;  3NKD A;  3H65 A;  1ZYR F;  2OCC C;  2W4M A;  1G4W R;  1APC A;  3AOU A;  3NMI A;  4JVS A;  1JAF A;  1U89 A;  1A0B A;  3O10 A;  3V5X A;  2J0X A;  2A6E F;  3RYL A;  4QI0 A;  2P61 A;  4PFP A;  3GEE A;  3GEI A;  3C18 A;  5HSW A;  2I8B A;  4PJM A;  4P9F A;  2EPN A;  4CS9 A;  3SP1 A;  3CAX A;  3X2Q C;  1QQ3 A;  2NG1 A;  2XLH A;  3LS1 A;  3UGO A;  2YVK A;  2QLA A;  3UNG C;  3RF3 A;  1D0Y A;  2GDC A;  3CQZ A;  3FXH A;  1QLE C;  3AG2 C;  4FWV A;  2I15 A;  4YT8 A;  5L3V A;  2RD9 A;  4LDQ A;  1T6U A;  3IPM O;  4JEA A;  1Z6A A;  4E7S A;  5TJ5 E;  3C62 A;  1VOM A;  3ABL C;  3PDM P;  5L0C A;  1E84 A;  3IEE A;  1NFO A;  2WB7 A;  4CDA A;  4C3D A;  3NDB B;  2AWY A;  4A2N B;  4U5G A;  4DBR A;  3S28 A;  3LEV A;  1SF8 A;  4YWQ A;  1BZ4 A;  1BBH A;  5JRA A;  2WVQ A;  2R25 A;  1JPN A;  2VH3 A;  5KYW A;  3FAP B;  5JP7 A;  2XM0 A;  2R7T A;  3FHD A;  1D1C A;  2P1A A;  4QI2 A;  3RQG A;  1YZC A;  2XS1 A;  3GWL A;  3ZTM A;  1OW7 A;  2LQG A;  1HW2 A;  2DB4 A;  2L7A A;  2KC3 A;  3LJB A;  4NC3 A;  4MS2 A;  1I4Z A;  3SXK A;  5A6A A;  1BR4 A;  4MW8 A;  4EHP A;  4HE8 D;  1OXK A;  1PCX A;  4K1O A;  1NFN A;  4N4W A;  2YEV A;  2PX0 A;  4JTA B;  4ER9 A;  3FAJ A;  4NQF A;  5KYU A;  4MTG A;  3M79 A;  1WAS A;  2YLG A;  1MMA A;  4AE4 B;  2C04 A;  3JTL O;  4JC7 A;  4XLN F;  3DAF A;  3V7O A;  3WAQ A;  4D4N A;  1OCO C;  2NUT A;  2KJG A;  2PF4 E;  4MTF A;  1Q0D A;  2OEX A;  3TQO A;  4MTO A;  3MYI A;  2IXP A;  1TWG A;  1T6I A;  1VYK A;  2EPO A;  5GPG B;  4OD4 A;  3DMD A;  1MMG A;  1Y6D A;  5B1A C;  1FNT c;  1H6G A;  2R7O A;  3QW1 A;  4C3E A;  3N0T A;  2UUI A;  2Y3H A;  3DJN B;  1V55 C;  3ZIB A;  5L3Q A;  3RH3 A;  2LIG A;  2Y69 C;  4J7Y A;  3EPV A;  4E7Z A;  1Q0K A;  2HSB A;  2IXM A;  256B A;  3F46 A;  3H2V A;  2B0H A;  2CW0 F;  2KW3 C;  1YA9 A;  1L7C A;  2WVO A;  1K40 A;  2IYL D;  3B71 A;  3DM5 A;  3KL4 A;  1YJG A;  4DVZ A;  2E87 A;  3AJM A;  2L6G A;  3SZR A;  2FFH A;  2YL3 A;  4JRZ A;  4IRU A;  3LUT B;  3QZC A;  1ZU4 A;  2H7B A;  3AG4 C;  3FMS A;  2CYD A;  4YJW A;  3X1O A;  5KYX A;  4XTK A;  2ZXP A;  5KYY B;  1WN0 A;  3UR3 C;  1OKK A;  2M64 A;  1JOG A;  4E17 A;  4EUK B;  4U5D E;  1VK5 A;  1WOL A;  4BJ1 A;  1D1B A;  1M2V A;  1T5O A;  3DWW A;  4AL1 A;  4GYT A;  3ATP A;  2R7V A;  1RKE B;  3I5P A;  2R03 A;  2RSE B;  2QUP A;  3EJN A;  4Z9H A;  3RFY A;  3W8H A;  4BJ6 C;  4O6N A;  1K04 A;  1E86 A;  1YVI A;  2J9B A;  2BE5 F;  5T1D B;  1TWC A;  3HTK C;  3SNH A;  4OD5 A;  2G3K A;  4GQH A;  4PK4 A;  2HJ3 A;  1YDI A;  1QSP A;  4CSA C;  4NTB A;  1V4A A;  3IQ6 A;  1BDJ B;  2BC5 A;  2EPM X;  2HMQ A;  3IHU A;  3TOM A;  3EZI A;  1J8Y F;  2GAQ A;  5DS5 A;  3LEO A;  4XPY A;  4CS7 A;  2VAS A;  5E2Q A;  1S7Z A;  1H7I A;  3T9O A;  3HJC A;  1TQG A;  3GOD A;  3JYY A;  2X0C A;  4G0H A;  1KNY A;  5AC4 A;  3EG9 A;  5D91 A;  1SMY F;  1T6Q A;  1SZI A;  2FAP B;  4B6I A;  3U2M A;  1M2O A;  5A6K A;  2OJQ A;  4GEH A;  2XL8 A;  1OKK D;  4JTC B;  3NKE A;  3S9O A;  1OR3 A;  4PJJ A;  4FES A;  1AEP A;  4IGG A;  3M15 A;  5JT4 A;  1F1M A;  2A1D D;  4LAC B;  4OIO F;  4NTA A;  3J06 A;  3AGT A;  3DJU B;  3TD7 A;  3UGP A;  4U5E E;  4CJG A;  2XXA B;  1LKX A;  2KQ9 A;  4JJG A;  3EHN A;  1J8M F;  2OJE D;  3RW0 A;  2YL0 A;  2NSF A;  2XM4 A;  2QNL A;  4J7T A;  1JMW A;  2R7Q A;  5F28 E;  1C17 M;  4JE9 A;  4JCZ A;  4Z9I A;  4MVO A;  3ZVR A;  3H2U A;  3U0C A;  1FR0 A;  4G7Z F;  4G7H F;  2OQM A;  3RQF A;  2R7U A;  1Q0F A;  1O5H A;  3G4X A;  1CGN A;  3T6B A;  2YZS A;  4LDR A;  3QVY A;  4PFO A;  1MND A;  2V26 A;  2EPL X;  2IM8 A;  4PR9 A;  2IOQ A;  4MVU A;  3GEH A;  4ULV A;  4O7G A;  4U9E A;  2L9J A;  5DQT A;  1ZVZ A;  4CDY A;  4IAR A;  1RKC A;  5DS4 A;  5A69 A;  2A68 F;  4IAO A;  4BPM A;  2EIK C;  3WG7 C;  4JUR I;  3C8Z A;  2LCH A;  4XPX A;  3LES A;  3ABM C;  4DRJ B;  1OXB A;  1H9T A;  1OCR C;  2R9R B;  1ORY A; 
#chains in the Genus database with same CATH homology
 4Q5S F;  3AG3 C;  4J30 B;  2QTV A;  5KYY A;  2WZG A;  3Q7G A;  4YT2 A;  2H7V C;  2Y3B A;  3S0X A;  2FGY A;  2NUP B;  3UMI A;  4OIR F;  3EGX B;  4JZA A;  2CNW A;  4CSA A;  4DOZ A;  4K0D A;  2A6H F;  3PMR A;  4N06 A;  1FFH A;  2P6V A;  3DM9 B;  5F5H A;  4U5B E;  4Q4Z F;  2ZXO A;  1LVK A;  5D92 A;  1D0Z A;  4H4K C;  2XRH A;  3OWT A;  4M63 A;  4CBE A;  4ULW A;  5DVW A;  1IW7 F;  2EIM C;  2XSE A;  4BJT A;  4ZLD A;  2R7X A;  3LLK A;  5B1B C;  3W8I A;  3F47 A;  2J46 A;  2R7S A;  3UMH A;  1OCZ C;  2DGJ A;  3EZH A;  4W8K A;  1RJ9 B;  4AK9 A;  3S29 A;  4EWC A;  2XXA A;  2Y39 A;  5B3S C;  2CNW D;  4OIN F;  3KKB A;  4LLE A;  4LER A;  4U5H A;  4BG0 A;  1JPJ A;  3LAY A;  2PP4 A;  1D0X A;  4J32 B;  4FX5 A;  4PJL A;  2J9V A;  3POV A;  5E3C A;  2P7V A;  2ZPA A;  1MMD A;  2O9X A;  2EIN C;  3L0I A;  3QMK A;  2XL4 A;  3GAN A;  3LS0 A;  2W45 A;  1MNE A;  5DQZ A;  3EQL F;  3VYW A;  2G62 A;  2H7O A;  4PJN A;  3CZ6 A;  4DVY P;  2Q9C A;  1WGW A;  3ASN C;  3EFO B;  4P6I C;  1LS1 A;  1Z63 A;  1TWH A;  1KU2 A;  2D5R B;  2IXN A;  4X0R A;  1VMA A;  3B9Q A;  3DAG A;  3OEO A;  3O6X A;  3JCU Q;  3KH2 A;  3B0U X;  2CGE A;  2NUP A;  1PD0 A;  4YT5 A;  2B0J A;  2C03 A;  4RDA A;  4JJF A;  2DYR C;  3T4R A;  3MX3 A;  4IWB A;  2ZXW C;  4OIP F;  4G7O F;  1TWA A;  5DLJ A;  4O6Y A;  3NYM A;  4BJ5 C;  3B0P A;  2J7P A;  4AE4 A;  4XLP F;  3DD7 A;  2GFH A;  4KNV A;  5KYU B;  1ZU5 A;  2V3C C;  2WZL A;  2Y3D A;  3K1H A;  1O87 A;  2NUT B;  3VAY A;  1G8X A;  3N2Z B;  4EBB A;  4IJJ A;  2JD3 A;  3O39 A;  1RJ9 A;  3ASO C;  2HV6 A;  1Z3I X;  3NRH A;  4K7B A;  3W2W A;  4KI2 A;  4ANJ A;  3T6J A;  4I1O B;  3K33 A;  3NYL A;  2MYS A;  3B0V C;  2HV7 A;  3ZG1 A;  3Q6N A;  3JRT A;  4HFK B;  5E33 A;  2EIJ C;  2J7P D;  3K1I C;  4XWJ A;  3RKO F;  2MWQ A;  4C3D A;  4MND A;  4HEA J;  3I4U A;  2W4B A;  3DZA A;  2Q9B A;  2Z15 A;  2WZF A;  3EH1 A;  3JT1 A;  4C3B A;  2R7R A;  1BR2 A;  5BUO A;  5E3A A;  4WJ0 A;  4O6M A;  5CI9 A;  4I1M A;  4LLC A;  3RIP A;  4ZLC A;  3ZSU A;  5KYX B;  3E9V A;  4BJ6 A;  3DXJ F;  3MLG A;  1D1A A;  2J0W A;  2QY9 A;  4DBQ A;  1M2V B;  4F4B A;  3ZC4 A;  1ST6 A;  3NYJ A;  5F5F A;  4CS8 C;  3FDQ A;  2ZXR A;  2YHS A;  3EFO A;  3OA1 A;  4YN0 B;  4KBL A;  3S27 A;  5FCL A;  1M56 C;  3AQB A;  1W2W A;  3M1C B;  5DS6 A;  1BR1 A;  5EGY A;  2PX3 A;  2LSE A;  4YT4 A;  4BJ5 A;  4RBN A;  3ABK C;  4O79 A;  5KYN A;  3EG9 B;  3ITF A;  2CDQ A;  2Q9A A;  4C7O B;  2VB6 A;  3SYN A;  3W2V A;  2J9U A;  2WL8 A;  1TKN A;  3PHF 2;  1QZX A;  3SEO A;  1ZHT A;  4HFF B;  4NY3 A;  3K7D A;  3E70 C;  1FTS A;  1ZHZ A;  1ZHW A;  5CI8 A;  4BEJ A;  3JSZ A;  1ZHX A;  1FMV A;  2L81 A;  2Q3T A;  1MMN A;  4CIH A;  1PD1 A;  3UMK A;  4Q7C A;  1ZHY A;  5T3W A;  1V54 C;  3KMI A;  2EIL C;  4I3M A;  4CS9 C;  3ECS A;  3AQC A;  5T3T A;  5EHH A;  2X51 A;  4RD9 A;  2OG2 A;  2G3V A;  2KNH A;  2IXO A;  3AG1 C;  3EGD A;  5IY5 C;  3L34 A;  2PFD A;  4JCH A;  2J45 A;  3LLI A;  3EH2 A;  5KYW B;  4CS8 A;  3JYH A;  1NG1 A;  1IZM A;  4AX2 A;  3LNR A;  1FMW A;  3N24 A;  4OIQ F;  3EGX A;  1NU9 C;  3Q7L A;  4U5C E;  4I44 A;  3WOD F;  2W9Y A;  1Z23 A;  2DYS C;  4U5F E;  3FVY A;  3K66 A;  2Y3G A;  3K6B A;  2J9W A;  2M4E A;  4JW1 A;  1NZE A;  1TR2 A;  1OCC C;  2KGO A;  2WVN A;  3NG1 A;  3EHM A;  3HLZ A;  1N1C A;  3I5Q A;  4MQ9 F;  3CSK A;  4C7O A;  2A69 F;  1VYI A;  4KNW A;  1NU7 D;  2R7W A;  1Z5Z A;  3Q6M A;  1M57 C;  4QDL A;  1FFT C;  3NKD A;  3H65 A;  1ZYR F;  2OCC C;  2W4M A;  4JVS A;  2J0X A;  2A6E F;  3RYL A;  4QI0 A;  4PFP A;  5HSW A;  2I8B A;  4PJM A;  4CS9 A;  3SP1 A;  3X2Q C;  2NG1 A;  3LS1 A;  3UGO A;  3UNG C;  1D0Y A;  5L3V A;  3CQZ A;  1QLE C;  3AG2 C;  4FWV A;  4YT8 A;  1Z6A A;  4E7S A;  1VOM A;  3ABL C;  3IEE A;  2WB7 A;  3NDB B;  4A2N B;  4U5G A;  4DBR A;  3S28 A;  3LEV A;  1SF8 A;  4YWQ A;  2WVQ A;  1JPN A;  2VH3 A;  5KYW A;  2R7T A;  3FHD A;  1D1C A;  4QI2 A;  3LJB A;  1BR4 A;  4HE8 D;  1PCX A;  2YEV A;  2PX0 A;  3FAJ A;  5KYU A;  1MMA A;  4AE4 B;  2C04 A;  4XLN F;  3DAF A;  3V7O A;  1OCO C;  2NUT A;  2KJG A;  2PF4 E;  2IXP A;  1TWG A;  1VYK A;  4OD4 A;  3DMD A;  1MMG A;  5B1A C;  2R7O A;  4C3E A;  3N0T A;  2Y3H A;  3DJN B;  1V55 C;  3ZIB A;  5L3Q A;  3RH3 A;  2Y69 C;  3EPV A;  4E7Z A;  2IXM A;  3F46 A;  2KW3 C;  2CW0 F;  3KL4 A;  2WVO A;  3DM5 A;  4DVZ A;  2IYL D;  2E87 A;  3SZR A;  2FFH A;  4IRU A;  3QZC A;  1ZU4 A;  2H7B A;  3AG4 C;  4YJW A;  3X1O A;  5KYX A;  4XTK A;  2ZXP A;  5KYY B;  3UR3 C;  1OKK A;  4U5D E;  1VK5 A;  4BJ1 A;  1D1B A;  1M2V A;  4GYT A;  2R7V A;  3I5P A;  3RFY A;  3EJN A;  3W8H A;  4BJ6 C;  4O6N A;  5T1D B;  3SNH A;  2BE5 F;  1TWC A;  3HTK C;  4OD5 A;  2G3K A;  4PK4 A;  4CSA C;  3EZI A;  1J8Y F;  5DS5 A;  4CS7 A;  2VAS A;  5E2Q A;  1S7Z A;  3HJC A;  3GOD A;  4G0H A;  3EG9 A;  5D91 A;  1SMY F;  1SZI A;  4B6I A;  1M2O A;  4GEH A;  1OKK D;  3NKE A;  4PJJ A;  4FES A;  2A1D D;  4LAC B;  4OIO F;  3DJU B;  3TD7 A;  3UGP A;  4U5E E;  2XXA B;  1LKX A;  2KQ9 A;  4JJG A;  3EHN A;  1J8M F;  2R7Q A;  3ZVR A;  4G7Z F;  4G7H F;  2R7U A;  1O5H A;  3T6B A;  2YZS A;  4PFO A;  1MND A;  2V26 A;  2IOQ A;  4O7G A;  2L9J A;  5DQT A;  5DS4 A;  2A68 F;  4IAO A;  2EIK C;  3WG7 C;  4JUR I;  3LES A;  3ABM C;  1OCR C;  3EGD B;  4KC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...