3LESA

2f5 epitope scaffold es2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
SDPVRQYLHEIGEVLELDKWAELGAAAKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAAIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRGFAFSTYATWWIRQAINRAIADQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Immune system
total genus 61
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lesA00
3WODF 4OINF 4G7OF 2A69F 1KU2A 4XLNF 4G7ZF 2A6EF 1ZYRF 3UGPA 4OIPF 4MQ9F 1IW7F 2A68F 4G7HF 3DXJF 2CW0F 4KI2A 3EQLF 2BE5F 4OIRF 3UGOA 4XLPF 4Q4ZF 3LEVA 4OIQF 4OIOF 1SMYF 3LESA 4Q5SF 2A6HF
chains in the Genus database with same CATH superfamily
4OINF 3EZIA 4N4WA 1T01A 4YT8A 3O39A 1NU9C 3U3FA 2GA0A 5EGYA 1KU2A 3LAYA 1FR0A 3HNIA 2BL2A 4QI2A 3Q6MA 1E83A 1YZCA 5D91A 1O3UA 4E18A 4IGGA 3DI5A 3RVYA 3ZTZA 4J32B 1ORSC 2KQ9A 4WABA 2LIGA 4KI2A 2OOCA 2QY9A 3EQLF 3NKDA 4I1MA 4JEAA 5CI9A 4K0DA 3EH2A 1G4US 2KNHA 1D0ZA 1G8XA 3IHUA 4P9TA 2P0NA 2A0BA 4K1OA 1DOWA 1XZQA 4ULWA 1D1BA 2WVNA 5KYWA 2V3CC 3NDBB 3QMKA 3UMIA 3ECSA 1FAPB 4U5GA 3KH2A 2KC3A 3GM2A 2KW3C 1TWHA 3NKEA 3SZRA 3HNLA 2XLMA 2UUIA 4N06A 1LS1A 1M56C 2WL8A 2A6HF 3AG3C 5JP7A 2M4EA 1NBBA 1Q0KA 3ZIBA 3PHF2 3FVYA 4YN0B 2P1AA 2MHRA 1E2XA 3ABLC 5KYWB 5AGFA 4NTFA 3K6BA 3U0CA 2XRHA 4NC3A 2KGOA 1LVKA 3LNMB 3ZVRA 2GAQA 2Y3BA 2VH3A 2I15A 3TJ5A 2OEVA 3W4YA 3JT1A 4MTFA 4YJWA 2EPNA 3L1MA 3TD7A 4AL0A 1S7ZA 4U5HA 1RKCA 4BJ5C 2YRFA 3L8IA 5KYNA 4IB4A 2NPUA 2JPUA 1YVIA 2B0JA 3H2VA 2J9UA 2J7PA 3M79A 2XS1A 1OKKA 2G62A 2EPOA 3F46A 3OEOA 1LM3B 1JMWA 3UMKA 2DGJA 2OCCC 3TJ6A 3M4BA 1K40A 1JPNA 1A0BA 1JRAA 4DJ9A 1SZIA 3UNGC 2LD6A 5JLIA 2XXAB 4HE8D 2R7UA 3ASNC 3BEHA 2JD3A 3L34A 4NQFA 4R32A 5A69A 4NCQA 4YL3A 4LERA 3MYIA 3V5YA 4YL1A 2HJ3A 2IXNA 5E3AA 4RD9A 3UR3C 1EQ1A 1BR1A 1JAFA 2V26A 3U9JA 4HFKB 1EKYA 3KL4A 2W4MA 1YA7O 4XPXA 2ZPAA 2OKUA 1ZU4A 2FAPB 4Q4ZF 2UUHA 2IXOA 3Q7GA 1OCOC 3GEEA 1F1MA 1JPJA 2CNWD 5TJ5E 3C8ZA 4Z9IA 1T9KA 1VLTA 1V4AA 3R7CA 2NG1A 3RKOF 4CX9A 4DOZA 2TMVP 2HS5A 4CS8A 3SXKA 3TOMA 3EGXB 1FFHA 5E2QA 4BJ6A 4MNDA 2OEXA 1I5NA 5COMA 2YQYA 4Z9HA 5BQGA 2L81A 3L0IA 3RQGA 4AE4A 1VOMA 1ORJA 2EINC 3LJBA 4M63A 1RCPA 1PCXA 4A2NB 1ZYRF 4ZLCA 5AC5A 4DBQA 2VC9A 4DRJB 4IAQA 2J9VA 1ZHZA 2A68F 2HUJA 3DM9B 1UFBA 3V5ZA 1IZMA 4XEVA 2BC5A 2QE9A 5L0HA 1CGNA 2VCBA 2WVOA 2Y3GA 4XTKA 1VLSA 3T4RA 3QVZA 3U3BA 1LIHA 2YVKA 1MMNA 4AE4B 2YL7A 1LI7A 4JC7A 3DE8A 5B3SC 2LFDA 4MTGA 3FHDA 5DQZA 2Y3DA 2R7TA 3POVA 5FCLA 1HW1A 1WWPA 1TFKB 3PMRA 2AVKA 1ZU5A 1ZW2A 1Q0MA 2YL1A 4G0HA 4QI0A 5CI8A 4CS9C 1E86A 4U5CE 5F5FA 4LDKA 5DQTA 1O5HA 3RH3A 5L0JA 1B68A 2R7XA 3SP1A 2CCYA 3F47A 3S0XA 4XLNF 2ZD9A 3I5QA 4Z9JA 3S28A 1R5ID 2EPKX 1IW7F 1TWAA 3NRHA 3RQEA 4LLEA 1EI7A 5E33A 3S9OA 1LKXA 1G4WR 3S84A 4E0HA 2XLEA 2YKZA 4PJLA 2R03A 4EKWA 2X0CA 3DJUB 1HE1A 3JCUQ 3DWWA 1Q0FA 1CPRA 1J8YF 4OIOF 3QZCA 4LDRA 3M4CA 4PJNA 2KYHA 2R7VA 4O6MA 1FMVA 4JRZA 3SXZA 4WGYA 3DJNB 2J0XA 1V74B 3LS1A 2WZLA 5T1DB 3U8VA 5AC4A 1QZXA 4C3DA 1QSPA 4KNVA 4LDQA 4IRUA 5BQHA 2D4UA 5DVWA 4G7OF 2L9JA 1ZW3A 4I1OB 1YYXA 3UMHA 1QQ3A 2YZSA 3KKBA 3MLGA 2NUTA 2PNOA 4GYTA 4N6CA 4ER9A 2XL6A 1U89A 1TQGA 2J46A 1M57C 3NMIA 4U5BE 4OD4A 3SXMA 3V7OA 3RQFA 2PX0A 5CIVA 3DXJF 4DBRA 1GQAA 1ZHYA 4MS2A 2YHSA 4J30B 4O6YA 4DVZA 1AEPA 3T6BA 1HMDA 1OCRC 1OR2A 3NG1A 3CAXA 4PJMA 4KBLA 1TFOB 3W2WA 5DS5A 1ORYA 2W45A 1A7EA 1BBHA 2EPLX 3QW1A 4JTCB 1YZAA 5FZTA 3S29A 3LEOA 4IJJA 2NUTB 1WOLA 1Z23A 3AG4C 4OD5A 1LE2A 3JRTA 2L6HA 2P61A 2PX3A 1OXKA 4XEKA 4C7OA 1RJ9A 3C18A 3C8GD 3LNRA 3ZWIA 4G78A 4MVRA 4YL0A 4RDAA 4EHPA 5JT4A 4YT2A 3V5XA 5JUAA 3VF0A 3L8JA 2PP4A 3EGDA 3GWNA 2KJGA 5L0CA 4O79A 2XS8A 1YDIA 3B0UX 2J0WA 4LLCA 4YT4A 3C62A 1MMAA 2XM0A 2ZXRA 2GWWA 3IQTA 2XXAA 4U5FE 4OIRF 2VB6A 5L3VA 4XLPF 1LI5A 2R9RB 4C7OB 1RJ9B 1T5OA 3EZHA 4J7YA 4EWCA 3AG2C 3SEOA 2LP4A 3IEEA 4EUKB 3CSKA 5EK0A 1W2WA 3GORA 3JTLO 1BR4A 4KNWA 4Q7CA 4MVZA 4U5DE 1HE9A 3JZ0A 5L0IA 3EGDB 4IAOA 2A1DD 2RSEB 2ETSA 2VASA 3QW0A 4NTAA 5B1AC 3EJNA 3ZSUA 4CS8C 4CIPA 5EHHA 1FNTc 2J9BA 4H4KC 3WODF 4U9EA 3G4XA 4BJ6C 4C3BA 4FESA 4E7SA 4ONSA 4DRHB 1KTMA 1MQVA 5A6KA 3GEHA 2W9YA 4WGZA 5A6BD 3N24A 5DS4A 4HEAJ 1Y6DA 5DS6A 1OCZC 2HSBA 1T6IA 3ABKC 4D4NA 1OXBA 3K33A 4CSAA 4OIPF 3U5SA 1HY5A 3JYHA 3EGXA 3IQ6A 1WN0A 3DZAA 2YEVA 2IXMA 1D0XA 1OQCA 3EHMA 1S05A 1JOGA 3C7JA 1FTSA 2O9XA 3DD7A 4I44A 2PFDA 3JSEO 2HFIA 1LE4A 2OJED 3S27A 3WG7C 2ICWG 5BUOA 1TKNA 1ZHWA 3DMDA 1HW2A 3HTKC 4XPYA 4PFPA 4C3EA 2HJMA 2Q3TA 3I4UA 4CS7A 4DVYP 4E7ZA 5IY5C 3N2ZB 4PJJA 1VB5A 3W8HA 3B9QA 2ZXWC 3B71A 1QLEC 4JJGA 1XWJA 2VCCA 3NMJA 1U6HA 1YLMA 2AU5A 2X51A 3A9CA 3CZ6A 5F28E 3K1IA 4PK4A 1VK5A 1BR2A 4H54A 3AG1C 4CBEA 2CYDA 1CPQA 3HKKA 3FDQA 4O7GA 2YLIA 2LK4A 1LS4A 1SF8A 2DB4A 4BJ1A 5A6JA 4UDVA 3E9VA 5BQIA 1Y4CA 2XM4A 3T9OA 1PV3A 3AJMA 3AQCA 1FFTC 1C17M 3U9MA 5B3IA 3B0PA 1H9GA 2MWQA 2NSFA 3DKAA 4A4AA 4E0IA 5T3WA 1E85A 1SYQA 1O87A 4P6IC 4JW1A 3SYNA 4IARA 3US6A 4CDVA 2IOQA 4NY3A 2HSQA 1LPEA 1NG1A 2YL3A 1WTYA 3X1OA 3ZTMA 5E3CA 3LUTB 2IYLD 1M2VA 2YLDA 1YA9A 3NYLA 4CJGA 3TULA 1M2OA 2OQMA 3GM1A 4K7BA 2L6FA 2Q9BA 3SXYA 1YARO 2Q7RA 4G7HF 1C03A 3DAGA 4BG0A 2CW0F 2Z15A 3KYIA 2R7WA 4F4BA 3WAQA 5KYXA 3BRJA 2IM8A 3W8IA 1I4YA 4JEBA 2XLVA 1Q0GA 1VYIA 1VYKA 2VCAA 4YK5A 3U8PA 3AGUA 3EHNA 5D92A 2EIKC 3HJCA 2QLAA 4EBKA 2NUPA 2XLDA 1M2VB 1QKRA 1TR2A 5GPGB 2P6VA 4JTDB 2EIJC 3RVZA 2OJQA 3K7DA 3HNJA 1RXQA 2QTVA 3O55A 4B6IA 3FAPB 4BEMJ 3C63A 5KYXB 4DRIB 3T6GB 4PFOA 1GS9A 1Z5ZA 1NSGB 3GANA 4KC9A 3Q7LA 1VMAA 1EA8A 1WASA 3AQBA 1OW7A 2NUPB 2B0HA 3IQ5A 3QVYA 4BPMA 4CJOA 1L7CA 4EBJA 2RD9A 4W8PA 5COFA 2Q9CA 3DM5A 4U5EE 3UGOA 2HV6A 5F5HA 2A0UA 3LLIA 3K1HA 4AK9A 2KK1A 1RKEA 4RBNA 3B0VC 3JSZA 3MYFA 2IXPA 4E17A 2R02A 1T6UA 5JSLA 3ZC4A 4MW8A 2C04A 3FAJA 3ABMC 2R7QA 1KNYA 1DOVA 1A7DA 4BJTA 2FFHA 2ASRA 1M6TA 3NYJA 1D1CA 2R7OA 1NZEA 2YL0A 2GDCA 5JRAA 2ZXOA 3VRCA 1RKEB 4MQ9F 4MVQA 1VTMP 4CSAC 4PR9A 2P7VA 3EG9A 3EH1A 2Q00A 3Q6NA 3DE9A 1V54C 5A6AA 3G4ZA 3HLZA 3R2PA 4W8KA 4MVSA 3SNHA 2CDQA 3ASOC 2F22A 1V55C 2J7PD 1OKKD 4FWVA 4XWJA 4AL1A 3ZQYA 5B1BC 3J06A 2WZGA 3GM3A 3FXHA 4JURI 1QPUA 2PBEA 4XQ1A 1C02A 3CQZA 4I3MA 1TWCA 3C8GA 3EG9B 1E84A 4O6NA 1OW8A 1BZ4A 2XL4A 4HFFB 4XPWA 2C03A 3H2UA 1JR8A 3T6JA 3TQOA 4AX2A 5L0GA 1NLXA 2J8WA 1WGWA 1NU7D 5HV9A 3VM6A 1H9TA 4U9DA 2YLGA 1D1AA 3K1IC 3MBGA 4GEHA 1HMOA 2AWCA 3FMSA 2DYRC 2EILC 2CGEA 2H8AA 3I5PA 2Y69C 2R7RA 1AVOB 1I4ZA 4PACA 5L0FA 2Q9AA 1XZPA 1Z7Qc 4YWQA 1CGOA 4MVUA 3AOUA 4EIYA 3O6XA 3C8GB 3TK0A 3U2MA 4ZLDA 1OR3A 1YAUO 4MTOA 1QVXA 2LSEA 4JKVA 2LQGA 4JCZA 3B29A 1GM5A 1MNDA 3GEIA 4QDLA 2HV7A 1R4TA 1Z6AA 2HZ8A 3CEXA 4JE9A 2HMQA 3W2VA 5A6BA 1G5ZA 3ZQVA 1APCA 2G3VA 2A6EF 3WHNA 3DAFA 2IBFA 1OW6A 1Z3IX 5DLJA 3IPMO 1GGQA 1PD1A 2EIMC 2Y39A 1FMWA 3RFYA 3NYMA 3LLKA 4FAPB 3M1CB 2PF4E 3FOOA 4JIOA 2Y3HA 2BE5F 4YT5A 4BJ5A 2I8BA 3OA1A 5K0IA 2J45A 5JS5A 1MMGA 1ZZPA 3VAYA 4XEFA 1PD0A 3PDMP 4DXWA 3TOLA 5HSWA 2R7SA 3E70C 3IQCA 1D0YA 2W4BA 3JRMO 2H7OA 2CNWA 2ZXPA 2LFFA 3ZDLA 2M64A 1MMDA 1MNEA 3HNKA 1H7IA 1A41A 3KPHA 3MX3A 5KYUA 1SR2A 5T3TA 2AWYA 4L6RA 1NFOA 2AP3A 4CDYA 4Q5SF 2D5RB 1ZHXA 1YYJA 2J9WA 3VYWA 2R25A 2XL8A 2XLOA 3RYLA 2XSEA 2HMZA 4LACB 1YJGA 2QUPA 4J7TA 3RF3A 1CGME 4X0RA 3O10A 4G7ZF 3RW0A 2YWAA 1RMVA 1N1CA 4IWBA 1UG7A 3G50A 5KYYA 2XLHA 2GFHA 5L3QA 4CS9A 1L3PA 5COGA 3U2LA 4JZAA 1TWGA 2WZFA 3M15A 4JJFA 3RIPA 5KYUB 2E87A 2OU6A 2WB7A 3FOPA 4JVSA 2NSGA 3LEVA 2H7VC 4JTAB 1A7VA 4P9FA 1Z63A 2Q4FA 2QNLA 1ZHTA 3QTHA 3GODA 3K66A 3LESA 4NTBA 5L0DA 1T6QA 1U0BB 1H6GA 3KMIA 4MVMA 5JVEA 4GQHA 4MW3A 3KYJA 1WATA 3AGTA 3NMKA 3PCVA 256BA 5KYYB 3EPVA 4JCHA 2R05A 2OG2A 3EFOA 3N0TA 3OWTA 1AUEA 1ST6A 2DI3A 2HKVA 2L6GA 4EBBA 2A69F 4BEJA 2KSFA 4FX5A 2EPMX 2G3KA 3LS0A 2H7BA 3UGPA 4ULVA 2MYSA 2JX0A 4N6HA 4D4XA 3A11A 2WVQA 3ITFA 3MFNA 1ZVZA 1K05A 1NFNA 1Q0DA 4OIQF 1SMYF 3EFOB 3JYYA 3S90A 2L7AA 2LCHA 3H65A 1OCCC 3X2QC 3ZG1A 4CIHA 2XLWA 3ATPA 3GWLA 4CDAA 1J8MF 2FGYA 1BDJB 4MVOA 1K04A 2DYSC 4ANJA 4WJ0A
chains in the Genus database with same CATH topology
4OINF 3EZIA 4YT8A 3O39A 1NU9C 5EGYA 1KU2A 3LAYA 3Q6MA 5D91A 4J32B 2KQ9A 4KI2A 2QY9A 3EQLF 3NKDA 4I1MA 5CI9A 4K0DA 3EH2A 2KNHA 1D0ZA 1G8XA 4ULWA 5KYWA 2V3CC 3NDBB 1D1BA 2WVNA 3QMKA 3UMIA 3ECSA 4U5GA 3KH2A 2KW3C 1TWHA 3NKEA 3SZRA 4N06A 1LS1A 1M56C 2WL8A 2A6HF 3AG3C 2M4EA 3ZIBA 3PHF2 3FVYA 4YN0B 3ABLC 5KYWB 3K6BA 2XRHA 2KGOA 1LVKA 3ZVRA 2Y3BA 2VH3A 3JT1A 4YJWA 3TD7A 1S7ZA 4U5HA 4BJ5C 5KYNA 2B0JA 2J7PA 1OKKA 2G62A 3F46A 3OEOA 3UMKA 2DGJA 2OCCC 1JPNA 1SZIA 3UNGC 2XXAB 4HE8D 2R7UA 3ASNC 2JD3A 3L34A 4LERA 5E3AA 3UR3C 2IXNA 4RD9A 1BR1A 2V26A 4HFKB 3KL4A 2W4MA 2ZPAA 1ZU4A 4Q4ZF 2IXOA 3Q7GA 1OCOC 1JPJA 2CNWD 3RKOF 2NG1A 4DOZA 4CS8A 3EGXB 1FFHA 5E2QA 4BJ6A 4MNDA 2L81A 3L0IA 4AE4A 1VOMA 2EINC 3LJBA 4M63A 1PCXA 4A2NB 1ZYRF 4ZLCA 4DBQA 2J9VA 1ZHZA 2A68F 3DM9B 1IZMA 2WVOA 2Y3GA 4XTKA 3T4RA 4AE4B 1MMNA 5B3SC 3FHDA 5DQZA 2Y3DA 2R7TA 3POVA 5FCLA 3PMRA 1ZU5A 4QI0A 4G0HA 5CI8A 4CS9C 4U5CE 5F5FA 5DQTA 1O5HA 3RH3A 2R7XA 3SP1A 3F47A 3S0XA 4XLNF 3I5QA 3S28A 1IW7F 1TWAA 3NRHA 4LLEA 5E33A 1LKXA 4PJLA 3DJUB 3JCUQ 1J8YF 4OIOF 3QZCA 4PJNA 2R7VA 4O6MA 1FMVA 3DJNB 2J0XA 3LS1A 2WZLA 5T1DB 1QZXA 4C3DA 4KNVA 4IRUA 5DVWA 4G7OF 2L9JA 4I1OB 3UMHA 4QI2A 3KKBA 2YZSA 3MLGA 2NUTA 4GYTA 4U5BE 2J46A 1M57C 3V7OA 4OD4A 2PX0A 3DXJF 4DBRA 1ZHYA 2YHSA 4J30B 4O6YA 4DVZA 3T6BA 1OCRC 3NG1A 5DS5A 4PJMA 4KBLA 3W2WA 2W45A 3S29A 4IJJA 2NUTB 1Z23A 3AG4C 4OD5A 3JRTA 2PX3A 4C7OA 1RJ9A 3LNRA 4RDAA 4YT2A 2PP4A 3EGDA 2KJGA 4O79A 3B0UX 2J0WA 4LLCA 4YT4A 1MMAA 2ZXRA 2XXAA 4U5FE 4OIRF 2VB6A 5L3VA 4XLPF 4C7OB 1RJ9B 4EWCA 3EZHA 3AG2C 3SEOA 3IEEA 3CSKA 1W2WA 4KNWA 1BR4A 4Q7CA 4U5DE 3EGDB 4IAOA 2A1DD 2VASA 5EHHA 5B1AC 3EJNA 3ZSUA 4CS8C 4H4KC 3WODF 4BJ6C 4C3BA 4FESA 4E7SA 2W9YA 3N24A 5DS4A 4HEAJ 5DS6A 1OCZC 3ABKC 3K33A 4CSAA 4OIPF 3JYHA 3EGXA 3DZAA 2YEVA 2IXMA 1D0XA 3EHMA 3DD7A 4I44A 1FTSA 2O9XA 2PFDA 3S27A 3WG7C 5BUOA 1TKNA 1ZHWA 3DMDA 3HTKC 4PFPA 4C3EA 3I4UA 2Q3TA 4CS7A 4DVYP 4E7ZA 5IY5C 3N2ZB 4PJJA 3W8HA 3B9QA 2ZXWC 1QLEC 4JJGA 2X51A 3CZ6A 4PK4A 1VK5A 1BR2A 4CBEA 3AG1C 3FDQA 4O7GA 1SF8A 4BJ1A 3E9VA 3AQCA 1FFTC 3B0PA 2MWQA 5T3WA 1O87A 4P6IC 4JW1A 3SYNA 2IOQA 4NY3A 1NG1A 3X1OA 5E3CA 2IYLD 1M2VA 3NYLA 1M2OA 4K7BA 2Q9BA 4G7HF 3DAGA 4BG0A 2CW0F 2Z15A 2R7WA 4F4BA 5KYXA 3W8IA 1VYIA 1VYKA 5D92A 3EHNA 2EIKC 3HJCA 2NUPA 1M2VB 1TR2A 2P6VA 2EIJC 3K7DA 2QTVA 4B6IA 5KYXB 4PFOA 1Z5ZA 3GANA 4KC9A 3Q7LA 1VMAA 3AQBA 2NUPB 2Q9CA 3DM5A 4U5EE 3UGOA 2HV6A 5F5HA 3LLIA 3K1HA 4AK9A 4RBNA 3B0VC 3JSZA 2IXPA 3ZC4A 2C04A 3FAJA 3ABMC 2R7QA 4BJTA 2FFHA 3NYJA 1D1CA 2R7OA 1NZEA 2ZXOA 4MQ9F 4CSAC 2P7VA 3EG9A 3EH1A 3Q6NA 1V54C 3HLZA 4W8KA 3SNHA 2CDQA 3ASOC 1V55C 2J7PD 1OKKD 4FWVA 4XWJA 5B1BC 2WZGA 4JURI 3CQZA 4I3MA 1TWCA 3EG9B 4O6NA 2XL4A 4HFFB 3T6JA 2C03A 4AX2A 1WGWA 1NU7D 1D1AA 3K1IC 4GEHA 3I5PA 2DYRC 2EILC 2CGEA 2Y69C 2R7RA 2Q9AA 4YWQA 3O6XA 4ZLDA 2LSEA 1MNDA 4QDLA 2HV7A 1Z6AA 3W2VA 2G3VA 2A6EF 3DAFA 5DLJA 1Z3IX 1PD1A 2Y39A 2EIMC 3RFYA 1FMWA 3NYMA 3LLKA 3M1CB 2PF4E 4YT5A 2Y3HA 2BE5F 4BJ5A 2I8BA 3OA1A 2J45A 1MMGA 3VAYA 1PD0A 5HSWA 2R7SA 3E70C 1D0YA 2W4BA 2H7OA 2CNWA 2ZXPA 1MMDA 1MNEA 5KYUA 3MX3A 5T3TA 4Q5SF 2D5RB 1ZHXA 2J9WA 3VYWA 3RYLA 2XSEA 4LACB 4X0RA 4G7ZF 1N1CA 4IWBA 5KYYA 5L3QA 2GFHA 4CS9A 5KYUB 4JZAA 1TWGA 2WZFA 4JJFA 3RIPA 2E87A 2WB7A 4JVSA 3LEVA 2H7VC 1Z63A 1ZHTA 3GODA 3K66A 3LESA 3KMIA 5KYYB 3EPVA 4JCHA 2OG2A 3EFOA 3N0TA 3OWTA 1ST6A 4EBBA 2A69F 4BEJA 4FX5A 2G3KA 3LS0A 2H7BA 3UGPA 2MYSA 2WVQA 3ITFA 4OIQF 1SMYF 3EFOB 3H65A 1OCCC 3X2QC 3ZG1A 4CIHA 1J8MF 2FGYA 2J9UA 2DYSC 4ANJA 4WJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD F;  4OIN F;  4G7O F;  2A69 F;  1KU2 A;  4XLN F;  4G7Z F;  2A6E F;  1ZYR F;  3UGP A;  4OIP F;  4MQ9 F;  1IW7 F;  2A68 F;  4G7H F;  3DXJ F;  2CW0 F;  4KI2 A;  3EQL F;  2BE5 F;  4OIR F;  3UGO A;  4XLP F;  4Q4Z F;  3LEV A;  4OIQ F;  4OIO F;  1SMY F;  3LES A;  4Q5S F;  2A6H F; 
#chains in the Genus database with same CATH topology
 4OIN F;  3EZI A;  4N4W A;  1T01 A;  4YT8 A;  3O39 A;  1NU9 C;  3U3F A;  2GA0 A;  5EGY A;  1KU2 A;  3LAY A;  1FR0 A;  3HNI A;  2BL2 A;  4QI2 A;  3Q6M A;  1E83 A;  1YZC A;  5D91 A;  1O3U A;  4E18 A;  4IGG A;  3DI5 A;  3RVY A;  3ZTZ A;  4J32 B;  1ORS C;  2KQ9 A;  4WAB A;  2LIG A;  4KI2 A;  2OOC A;  2QY9 A;  3EQL F;  3NKD A;  4I1M A;  4JEA A;  5CI9 A;  4K0D A;  3EH2 A;  1G4U S;  2KNH A;  1D0Z A;  1G8X A;  3IHU A;  4P9T A;  2P0N A;  2A0B A;  4K1O A;  1DOW A;  1XZQ A;  4ULW A;  1D1B A;  2WVN A;  5KYW A;  2V3C C;  3NDB B;  3QMK A;  3UMI A;  3ECS A;  1FAP B;  4U5G A;  3KH2 A;  2KC3 A;  3GM2 A;  2KW3 C;  1TWH A;  3NKE A;  3SZR A;  3HNL A;  2XLM A;  2UUI A;  4N06 A;  1LS1 A;  1M56 C;  2WL8 A;  2A6H F;  3AG3 C;  5JP7 A;  2M4E A;  1NBB A;  1Q0K A;  3ZIB A;  3PHF 2;  3FVY A;  4YN0 B;  2P1A A;  2MHR A;  1E2X A;  3ABL C;  5KYW B;  5AGF A;  4NTF A;  3K6B A;  3U0C A;  2XRH A;  4NC3 A;  2KGO A;  1LVK A;  3LNM B;  3ZVR A;  2GAQ A;  2Y3B A;  2VH3 A;  2I15 A;  3TJ5 A;  2OEV A;  3W4Y A;  3JT1 A;  4MTF A;  4YJW A;  2EPN A;  3L1M A;  3TD7 A;  4AL0 A;  1S7Z A;  4U5H A;  1RKC A;  4BJ5 C;  2YRF A;  3L8I A;  5KYN A;  4IB4 A;  2NPU A;  2JPU A;  1YVI A;  2B0J A;  3H2V A;  2J9U A;  2J7P A;  3M79 A;  2XS1 A;  1OKK A;  2G62 A;  2EPO A;  3F46 A;  3OEO A;  1LM3 B;  1JMW A;  3UMK A;  2DGJ A;  2OCC C;  3TJ6 A;  3M4B A;  1K40 A;  1JPN A;  1A0B A;  1JRA A;  4DJ9 A;  1SZI A;  3UNG C;  2LD6 A;  5JLI A;  2XXA B;  4HE8 D;  2R7U A;  3ASN C;  3BEH A;  2JD3 A;  3L34 A;  4NQF A;  4R32 A;  5A69 A;  4NCQ A;  4YL3 A;  4LER A;  3MYI A;  3V5Y A;  4YL1 A;  2HJ3 A;  2IXN A;  5E3A A;  4RD9 A;  3UR3 C;  1EQ1 A;  1BR1 A;  1JAF A;  2V26 A;  3U9J A;  4HFK B;  1EKY A;  3KL4 A;  2W4M A;  1YA7 O;  4XPX A;  2ZPA A;  2OKU A;  1ZU4 A;  2FAP B;  4Q4Z F;  2UUH A;  2IXO A;  3Q7G A;  1OCO C;  3GEE A;  1F1M A;  1JPJ A;  2CNW D;  5TJ5 E;  3C8Z A;  4Z9I A;  1T9K A;  1VLT A;  1V4A A;  3R7C A;  2NG1 A;  3RKO F;  4CX9 A;  4DOZ A;  2TMV P;  2HS5 A;  4CS8 A;  3SXK A;  3TOM A;  3EGX B;  1FFH A;  5E2Q A;  4BJ6 A;  4MND A;  2OEX A;  1I5N A;  5COM A;  2YQY A;  4Z9H A;  5BQG A;  2L81 A;  3L0I A;  3RQG A;  4AE4 A;  1VOM A;  1ORJ A;  2EIN C;  3LJB A;  4M63 A;  1RCP A;  1PCX A;  4A2N B;  1ZYR F;  4ZLC A;  5AC5 A;  4DBQ A;  2VC9 A;  4DRJ B;  4IAQ A;  2J9V A;  1ZHZ A;  2A68 F;  2HUJ A;  3DM9 B;  1UFB A;  3V5Z A;  1IZM A;  4XEV A;  2BC5 A;  2QE9 A;  5L0H A;  1CGN A;  2VCB A;  2WVO A;  2Y3G A;  4XTK A;  1VLS A;  3T4R A;  3QVZ A;  3U3B A;  1LIH A;  2YVK A;  1MMN A;  4AE4 B;  2YL7 A;  1LI7 A;  4JC7 A;  3DE8 A;  5B3S C;  2LFD A;  4MTG A;  3FHD A;  5DQZ A;  2Y3D A;  2R7T A;  3POV A;  5FCL A;  1HW1 A;  1WWP A;  1TFK B;  3PMR A;  2AVK A;  1ZU5 A;  1ZW2 A;  1Q0M A;  2YL1 A;  4G0H A;  4QI0 A;  5CI8 A;  4CS9 C;  1E86 A;  4U5C E;  5F5F A;  4LDK A;  5DQT A;  1O5H A;  3RH3 A;  5L0J A;  1B68 A;  2R7X A;  3SP1 A;  2CCY A;  3F47 A;  3S0X A;  4XLN F;  2ZD9 A;  3I5Q A;  4Z9J A;  3S28 A;  1R5I D;  2EPK X;  1IW7 F;  1TWA A;  3NRH A;  3RQE A;  4LLE A;  1EI7 A;  5E33 A;  3S9O A;  1LKX A;  1G4W R;  3S84 A;  4E0H A;  2XLE A;  2YKZ A;  4PJL A;  2R03 A;  4EKW A;  2X0C A;  3DJU B;  1HE1 A;  3JCU Q;  3DWW A;  1Q0F A;  1CPR A;  1J8Y F;  4OIO F;  3QZC A;  4LDR A;  3M4C A;  4PJN A;  2KYH A;  2R7V A;  4O6M A;  1FMV A;  4JRZ A;  3SXZ A;  4WGY A;  3DJN B;  2J0X A;  1V74 B;  3LS1 A;  2WZL A;  5T1D B;  3U8V A;  5AC4 A;  1QZX A;  4C3D A;  1QSP A;  4KNV A;  4LDQ A;  4IRU A;  5BQH A;  2D4U A;  5DVW A;  4G7O F;  2L9J A;  1ZW3 A;  4I1O B;  1YYX A;  3UMH A;  1QQ3 A;  2YZS A;  3KKB A;  3MLG A;  2NUT A;  2PNO A;  4GYT A;  4N6C A;  4ER9 A;  2XL6 A;  1U89 A;  1TQG A;  2J46 A;  1M57 C;  3NMI A;  4U5B E;  4OD4 A;  3SXM A;  3V7O A;  3RQF A;  2PX0 A;  5CIV A;  3DXJ F;  4DBR A;  1GQA A;  1ZHY A;  4MS2 A;  2YHS A;  4J30 B;  4O6Y A;  4DVZ A;  1AEP A;  3T6B A;  1HMD A;  1OCR C;  1OR2 A;  3NG1 A;  3CAX A;  4PJM A;  4KBL A;  1TFO B;  3W2W A;  5DS5 A;  1ORY A;  2W45 A;  1A7E A;  1BBH A;  2EPL X;  3QW1 A;  4JTC B;  1YZA A;  5FZT A;  3S29 A;  3LEO A;  4IJJ A;  2NUT B;  1WOL A;  1Z23 A;  3AG4 C;  4OD5 A;  1LE2 A;  3JRT A;  2L6H A;  2P61 A;  2PX3 A;  1OXK A;  4XEK A;  4C7O A;  1RJ9 A;  3C18 A;  3C8G D;  3LNR A;  3ZWI A;  4G78 A;  4MVR A;  4YL0 A;  4RDA A;  4EHP A;  5JT4 A;  4YT2 A;  3V5X A;  5JUA A;  3VF0 A;  3L8J A;  2PP4 A;  3EGD A;  3GWN A;  2KJG A;  5L0C A;  4O79 A;  2XS8 A;  1YDI A;  3B0U X;  2J0W A;  4LLC A;  4YT4 A;  3C62 A;  1MMA A;  2XM0 A;  2ZXR A;  2GWW A;  3IQT A;  2XXA A;  4U5F E;  4OIR F;  2VB6 A;  5L3V A;  4XLP F;  1LI5 A;  2R9R B;  4C7O B;  1RJ9 B;  1T5O A;  3EZH A;  4J7Y A;  4EWC A;  3AG2 C;  3SEO A;  2LP4 A;  3IEE A;  4EUK B;  3CSK A;  5EK0 A;  1W2W A;  3GOR A;  3JTL O;  1BR4 A;  4KNW A;  4Q7C A;  4MVZ A;  4U5D E;  1HE9 A;  3JZ0 A;  5L0I A;  3EGD B;  4IAO A;  2A1D D;  2RSE B;  2ETS A;  2VAS A;  3QW0 A;  4NTA A;  5B1A C;  3EJN A;  3ZSU A;  4CS8 C;  4CIP A;  5EHH A;  1FNT c;  2J9B A;  4H4K C;  3WOD F;  4U9E A;  3G4X A;  4BJ6 C;  4C3B A;  4FES A;  4E7S A;  4ONS A;  4DRH B;  1KTM A;  1MQV A;  5A6K A;  3GEH A;  2W9Y A;  4WGZ A;  5A6B D;  3N24 A;  5DS4 A;  4HEA J;  1Y6D A;  5DS6 A;  1OCZ C;  2HSB A;  1T6I A;  3ABK C;  4D4N A;  1OXB A;  3K33 A;  4CSA A;  4OIP F;  3U5S A;  1HY5 A;  3JYH A;  3EGX A;  3IQ6 A;  1WN0 A;  3DZA A;  2YEV A;  2IXM A;  1D0X A;  1OQC A;  3EHM A;  1S05 A;  1JOG A;  3C7J A;  1FTS A;  2O9X A;  3DD7 A;  4I44 A;  2PFD A;  3JSE O;  2HFI A;  1LE4 A;  2OJE D;  3S27 A;  3WG7 C;  2ICW G;  5BUO A;  1TKN A;  1ZHW A;  3DMD A;  1HW2 A;  3HTK C;  4XPY A;  4PFP A;  4C3E A;  2HJM A;  2Q3T A;  3I4U A;  4CS7 A;  4DVY P;  4E7Z A;  5IY5 C;  3N2Z B;  4PJJ A;  1VB5 A;  3W8H A;  3B9Q A;  2ZXW C;  3B71 A;  1QLE C;  4JJG A;  1XWJ A;  2VCC A;  3NMJ A;  1U6H A;  1YLM A;  2AU5 A;  2X51 A;  3A9C A;  3CZ6 A;  5F28 E;  3K1I A;  4PK4 A;  1VK5 A;  1BR2 A;  4H54 A;  3AG1 C;  4CBE A;  2CYD A;  1CPQ A;  3HKK A;  3FDQ A;  4O7G A;  2YLI A;  2LK4 A;  1LS4 A;  1SF8 A;  2DB4 A;  4BJ1 A;  5A6J A;  4UDV A;  3E9V A;  5BQI A;  1Y4C A;  2XM4 A;  3T9O A;  1PV3 A;  3AJM A;  3AQC A;  1FFT C;  1C17 M;  3U9M A;  5B3I A;  3B0P A;  1H9G A;  2MWQ A;  2NSF A;  3DKA A;  4A4A A;  4E0I A;  5T3W A;  1E85 A;  1SYQ A;  1O87 A;  4P6I C;  4JW1 A;  3SYN A;  4IAR A;  3US6 A;  4CDV A;  2IOQ A;  4NY3 A;  2HSQ A;  1LPE A;  1NG1 A;  2YL3 A;  1WTY A;  3X1O A;  3ZTM A;  5E3C A;  3LUT B;  2IYL D;  1M2V A;  2YLD A;  1YA9 A;  3NYL A;  4CJG A;  3TUL A;  1M2O A;  2OQM A;  3GM1 A;  4K7B A;  2L6F A;  2Q9B A;  3SXY A;  1YAR O;  2Q7R A;  4G7H F;  1C03 A;  3DAG A;  4BG0 A;  2CW0 F;  2Z15 A;  3KYI A;  2R7W A;  4F4B A;  3WAQ A;  5KYX A;  3BRJ A;  2IM8 A;  3W8I A;  1I4Y A;  4JEB A;  2XLV A;  1Q0G A;  1VYI A;  1VYK A;  2VCA A;  4YK5 A;  3U8P A;  3AGU A;  3EHN A;  5D92 A;  2EIK C;  3HJC A;  2QLA A;  4EBK A;  2NUP A;  2XLD A;  1M2V B;  1QKR A;  1TR2 A;  5GPG B;  2P6V A;  4JTD B;  2EIJ C;  3RVZ A;  2OJQ A;  3K7D A;  3HNJ A;  1RXQ A;  2QTV A;  3O55 A;  4B6I A;  3FAP B;  4BEM J;  3C63 A;  5KYX B;  4DRI B;  3T6G B;  4PFO A;  1GS9 A;  1Z5Z A;  1NSG B;  3GAN A;  4KC9 A;  3Q7L A;  1VMA A;  1EA8 A;  1WAS A;  3AQB A;  1OW7 A;  2NUP B;  2B0H A;  3IQ5 A;  3QVY A;  4BPM A;  4CJO A;  1L7C A;  4EBJ A;  2RD9 A;  4W8P A;  5COF A;  2Q9C A;  3DM5 A;  4U5E E;  3UGO A;  2HV6 A;  5F5H A;  2A0U A;  3LLI A;  3K1H A;  4AK9 A;  2KK1 A;  1RKE A;  4RBN A;  3B0V C;  3JSZ A;  3MYF A;  2IXP A;  4E17 A;  2R02 A;  1T6U A;  5JSL A;  3ZC4 A;  4MW8 A;  2C04 A;  3FAJ A;  3ABM C;  2R7Q A;  1KNY A;  1DOV A;  1A7D A;  4BJT A;  2FFH A;  2ASR A;  1M6T A;  3NYJ A;  1D1C A;  2R7O A;  1NZE A;  2YL0 A;  2GDC A;  5JRA A;  2ZXO A;  3VRC A;  1RKE B;  4MQ9 F;  4MVQ A;  1VTM P;  4CSA C;  4PR9 A;  2P7V A;  3EG9 A;  3EH1 A;  2Q00 A;  3Q6N A;  3DE9 A;  1V54 C;  5A6A A;  3G4Z A;  3HLZ A;  3R2P A;  4W8K A;  4MVS A;  3SNH A;  2CDQ A;  3ASO C;  2F22 A;  1V55 C;  2J7P D;  1OKK D;  4FWV A;  4XWJ A;  4AL1 A;  3ZQY A;  5B1B C;  3J06 A;  2WZG A;  3GM3 A;  3FXH A;  4JUR I;  1QPU A;  2PBE A;  4XQ1 A;  1C02 A;  3CQZ A;  4I3M A;  1TWC A;  3C8G A;  3EG9 B;  1E84 A;  4O6N A;  1OW8 A;  1BZ4 A;  2XL4 A;  4HFF B;  4XPW A;  2C03 A;  3H2U A;  1JR8 A;  3T6J A;  3TQO A;  4AX2 A;  5L0G A;  1NLX A;  2J8W A;  1WGW A;  1NU7 D;  5HV9 A;  3VM6 A;  1H9T A;  4U9D A;  2YLG A;  1D1A A;  3K1I C;  3MBG A;  4GEH A;  1HMO A;  2AWC A;  3FMS A;  2DYR C;  2EIL C;  2CGE A;  2H8A A;  3I5P A;  2Y69 C;  2R7R A;  1AVO B;  1I4Z A;  4PAC A;  5L0F A;  2Q9A A;  1XZP A;  1Z7Q c;  4YWQ A;  1CGO A;  4MVU A;  3AOU A;  4EIY A;  3O6X A;  3C8G B;  3TK0 A;  3U2M A;  4ZLD A;  1OR3 A;  1YAU O;  4MTO A;  1QVX A;  2LSE A;  4JKV A;  2LQG A;  4JCZ A;  3B29 A;  1GM5 A;  1MND A;  3GEI A;  4QDL A;  2HV7 A;  1R4T A;  1Z6A A;  2HZ8 A;  3CEX A;  4JE9 A;  2HMQ A;  3W2V A;  5A6B A;  1G5Z A;  3ZQV A;  1APC A;  2G3V A;  2A6E F;  3WHN A;  3DAF A;  2IBF A;  1OW6 A;  1Z3I X;  5DLJ A;  3IPM O;  1GGQ A;  1PD1 A;  2EIM C;  2Y39 A;  1FMW A;  3RFY A;  3NYM A;  3LLK A;  4FAP B;  3M1C B;  2PF4 E;  3FOO A;  4JIO A;  2Y3H A;  2BE5 F;  4YT5 A;  4BJ5 A;  2I8B A;  3OA1 A;  5K0I A;  2J45 A;  5JS5 A;  1MMG A;  1ZZP A;  3VAY A;  4XEF A;  1PD0 A;  3PDM P;  4DXW A;  3TOL A;  5HSW A;  2R7S A;  3E70 C;  3IQC A;  1D0Y A;  2W4B A;  3JRM O;  2H7O A;  2CNW A;  2ZXP A;  2LFF A;  3ZDL A;  2M64 A;  1MMD A;  1MNE A;  3HNK A;  1H7I A;  1A41 A;  3KPH A;  3MX3 A;  5KYU A;  1SR2 A;  5T3T A;  2AWY A;  4L6R A;  1NFO A;  2AP3 A;  4CDY A;  4Q5S F;  2D5R B;  1ZHX A;  1YYJ A;  2J9W A;  3VYW A;  2R25 A;  2XL8 A;  2XLO A;  3RYL A;  2XSE A;  2HMZ A;  4LAC B;  1YJG A;  2QUP A;  4J7T A;  3RF3 A;  1CGM E;  4X0R A;  3O10 A;  4G7Z F;  3RW0 A;  2YWA A;  1RMV A;  1N1C A;  4IWB A;  1UG7 A;  3G50 A;  5KYY A;  2XLH A;  2GFH A;  5L3Q A;  4CS9 A;  1L3P A;  5COG A;  3U2L A;  4JZA A;  1TWG A;  2WZF A;  3M15 A;  4JJF A;  3RIP A;  5KYU B;  2E87 A;  2OU6 A;  2WB7 A;  3FOP A;  4JVS A;  2NSG A;  3LEV A;  2H7V C;  4JTA B;  1A7V A;  4P9F A;  1Z63 A;  2Q4F A;  2QNL A;  1ZHT A;  3QTH A;  3GOD A;  3K66 A;  3LES A;  4NTB A;  5L0D A;  1T6Q A;  1U0B B;  1H6G A;  3KMI A;  4MVM A;  5JVE A;  4GQH A;  4MW3 A;  3KYJ A;  1WAT A;  3AGT A;  3NMK A;  3PCV A;  256B A;  5KYY B;  3EPV A;  4JCH A;  2R05 A;  2OG2 A;  3EFO A;  3N0T A;  3OWT A;  1AUE A;  1ST6 A;  2DI3 A;  2HKV A;  2L6G A;  4EBB A;  2A69 F;  4BEJ A;  2KSF A;  4FX5 A;  2EPM X;  2G3K A;  3LS0 A;  2H7B A;  3UGP A;  4ULV A;  2MYS A;  2JX0 A;  4N6H A;  4D4X A;  3A11 A;  2WVQ A;  3ITF A;  3MFN A;  1ZVZ A;  1K05 A;  1NFN A;  1Q0D A;  4OIQ F;  1SMY F;  3EFO B;  3JYY A;  3S90 A;  2L7A A;  2LCH A;  3H65 A;  1OCC C;  3X2Q C;  3ZG1 A;  4CIH A;  2XLW A;  3ATP A;  3GWL A;  4CDA A;  1J8M F;  2FGY A;  1BDJ B;  4MVO A;  1K04 A;  2DYS C;  4ANJ A;  4WJ0 A; 
#chains in the Genus database with same CATH homology
 4OIN F;  3EZI A;  4YT8 A;  3O39 A;  1NU9 C;  5EGY A;  1KU2 A;  3LAY A;  3Q6M A;  5D91 A;  4J32 B;  2KQ9 A;  4KI2 A;  2QY9 A;  3EQL F;  3NKD A;  4I1M A;  5CI9 A;  4K0D A;  3EH2 A;  2KNH A;  1D0Z A;  1G8X A;  4ULW A;  5KYW A;  2V3C C;  3NDB B;  1D1B A;  2WVN A;  3QMK A;  3UMI A;  3ECS A;  4U5G A;  3KH2 A;  2KW3 C;  1TWH A;  3NKE A;  3SZR A;  4N06 A;  1LS1 A;  1M56 C;  2WL8 A;  2A6H F;  3AG3 C;  2M4E A;  3ZIB A;  3PHF 2;  3FVY A;  4YN0 B;  3ABL C;  5KYW B;  3K6B A;  2XRH A;  2KGO A;  1LVK A;  3ZVR A;  2Y3B A;  2VH3 A;  3JT1 A;  4YJW A;  3TD7 A;  1S7Z A;  4U5H A;  4BJ5 C;  5KYN A;  2B0J A;  2J7P A;  1OKK A;  2G62 A;  3F46 A;  3OEO A;  3UMK A;  2DGJ A;  2OCC C;  1JPN A;  1SZI A;  3UNG C;  2XXA B;  4HE8 D;  2R7U A;  3ASN C;  2JD3 A;  3L34 A;  4LER A;  5E3A A;  3UR3 C;  2IXN A;  4RD9 A;  1BR1 A;  2V26 A;  4HFK B;  3KL4 A;  2W4M A;  2ZPA A;  1ZU4 A;  4Q4Z F;  2IXO A;  3Q7G A;  1OCO C;  1JPJ A;  2CNW D;  3RKO F;  2NG1 A;  4DOZ A;  4CS8 A;  3EGX B;  1FFH A;  5E2Q A;  4BJ6 A;  4MND A;  2L81 A;  3L0I A;  4AE4 A;  1VOM A;  2EIN C;  3LJB A;  4M63 A;  1PCX A;  4A2N B;  1ZYR F;  4ZLC A;  4DBQ A;  2J9V A;  1ZHZ A;  2A68 F;  3DM9 B;  1IZM A;  2WVO A;  2Y3G A;  4XTK A;  3T4R A;  4AE4 B;  1MMN A;  5B3S C;  3FHD A;  5DQZ A;  2Y3D A;  2R7T A;  3POV A;  5FCL A;  3PMR A;  1ZU5 A;  4QI0 A;  4G0H A;  5CI8 A;  4CS9 C;  4U5C E;  5F5F A;  5DQT A;  1O5H A;  3RH3 A;  2R7X A;  3SP1 A;  3F47 A;  3S0X A;  4XLN F;  3I5Q A;  3S28 A;  1IW7 F;  1TWA A;  3NRH A;  4LLE A;  5E33 A;  1LKX A;  4PJL A;  3DJU B;  3JCU Q;  1J8Y F;  4OIO F;  3QZC A;  4PJN A;  2R7V A;  4O6M A;  1FMV A;  3DJN B;  2J0X A;  3LS1 A;  2WZL A;  5T1D B;  1QZX A;  4C3D A;  4KNV A;  4IRU A;  5DVW A;  4G7O F;  2L9J A;  4I1O B;  3UMH A;  4QI2 A;  3KKB A;  2YZS A;  3MLG A;  2NUT A;  4GYT A;  4U5B E;  2J46 A;  1M57 C;  3V7O A;  4OD4 A;  2PX0 A;  3DXJ F;  4DBR A;  1ZHY A;  2YHS A;  4J30 B;  4O6Y A;  4DVZ A;  3T6B A;  1OCR C;  3NG1 A;  5DS5 A;  4PJM A;  4KBL A;  3W2W A;  2W45 A;  3S29 A;  4IJJ A;  2NUT B;  1Z23 A;  3AG4 C;  4OD5 A;  3JRT A;  2PX3 A;  4C7O A;  1RJ9 A;  3LNR A;  4RDA A;  4YT2 A;  2PP4 A;  3EGD A;  2KJG A;  4O79 A;  3B0U X;  2J0W A;  4LLC A;  4YT4 A;  1MMA A;  2ZXR A;  2XXA A;  4U5F E;  4OIR F;  2VB6 A;  5L3V A;  4XLP F;  4C7O B;  1RJ9 B;  4EWC A;  3EZH A;  3AG2 C;  3SEO A;  3IEE A;  3CSK A;  1W2W A;  4KNW A;  1BR4 A;  4Q7C A;  4U5D E;  3EGD B;  4IAO A;  2A1D D;  2VAS A;  5EHH A;  5B1A C;  3EJN A;  3ZSU A;  4CS8 C;  4H4K C;  3WOD F;  4BJ6 C;  4C3B A;  4FES A;  4E7S A;  2W9Y A;  3N24 A;  5DS4 A;  4HEA J;  5DS6 A;  1OCZ C;  3ABK C;  3K33 A;  4CSA A;  4OIP F;  3JYH A;  3EGX A;  3DZA A;  2YEV A;  2IXM A;  1D0X A;  3EHM A;  3DD7 A;  4I44 A;  1FTS A;  2O9X A;  2PFD A;  3S27 A;  3WG7 C;  5BUO A;  1TKN A;  1ZHW A;  3DMD A;  3HTK C;  4PFP A;  4C3E A;  3I4U A;  2Q3T A;  4CS7 A;  4DVY P;  4E7Z A;  5IY5 C;  3N2Z B;  4PJJ A;  3W8H A;  3B9Q A;  2ZXW C;  1QLE C;  4JJG A;  2X51 A;  3CZ6 A;  4PK4 A;  1VK5 A;  1BR2 A;  4CBE A;  3AG1 C;  3FDQ A;  4O7G A;  1SF8 A;  4BJ1 A;  3E9V A;  3AQC A;  1FFT C;  3B0P A;  2MWQ A;  5T3W A;  1O87 A;  4P6I C;  4JW1 A;  3SYN A;  2IOQ A;  4NY3 A;  1NG1 A;  3X1O A;  5E3C A;  2IYL D;  1M2V A;  3NYL A;  1M2O A;  4K7B A;  2Q9B A;  4G7H F;  3DAG A;  4BG0 A;  2CW0 F;  2Z15 A;  2R7W A;  4F4B A;  5KYX A;  3W8I A;  1VYI A;  1VYK A;  5D92 A;  3EHN A;  2EIK C;  3HJC A;  2NUP A;  1M2V B;  1TR2 A;  2P6V A;  2EIJ C;  3K7D A;  2QTV A;  4B6I A;  5KYX B;  4PFO A;  1Z5Z A;  3GAN A;  4KC9 A;  3Q7L A;  1VMA A;  3AQB A;  2NUP B;  2Q9C A;  3DM5 A;  4U5E E;  3UGO A;  2HV6 A;  5F5H A;  3LLI A;  3K1H A;  4AK9 A;  4RBN A;  3B0V C;  3JSZ A;  2IXP A;  3ZC4 A;  2C04 A;  3FAJ A;  3ABM C;  2R7Q A;  4BJT A;  2FFH A;  3NYJ A;  1D1C A;  2R7O A;  1NZE A;  2ZXO A;  4MQ9 F;  4CSA C;  2P7V A;  3EG9 A;  3EH1 A;  3Q6N A;  1V54 C;  3HLZ A;  4W8K A;  3SNH A;  2CDQ A;  3ASO C;  1V55 C;  2J7P D;  1OKK D;  4FWV A;  4XWJ A;  5B1B C;  2WZG A;  4JUR I;  3CQZ A;  4I3M A;  1TWC A;  3EG9 B;  4O6N A;  2XL4 A;  4HFF B;  3T6J A;  2C03 A;  4AX2 A;  1WGW A;  1NU7 D;  1D1A A;  3K1I C;  4GEH A;  3I5P A;  2DYR C;  2EIL C;  2CGE A;  2Y69 C;  2R7R A;  2Q9A A;  4YWQ A;  3O6X A;  4ZLD A;  2LSE A;  1MND A;  4QDL A;  2HV7 A;  1Z6A A;  3W2V A;  2G3V A;  2A6E F;  3DAF A;  5DLJ A;  1Z3I X;  1PD1 A;  2Y39 A;  2EIM C;  3RFY A;  1FMW A;  3NYM A;  3LLK A;  3M1C B;  2PF4 E;  4YT5 A;  2Y3H A;  2BE5 F;  4BJ5 A;  2I8B A;  3OA1 A;  2J45 A;  1MMG A;  3VAY A;  1PD0 A;  5HSW A;  2R7S A;  3E70 C;  1D0Y A;  2W4B A;  2H7O A;  2CNW A;  2ZXP A;  1MMD A;  1MNE A;  5KYU A;  3MX3 A;  5T3T A;  4Q5S F;  2D5R B;  1ZHX A;  2J9W A;  3VYW A;  3RYL A;  2XSE A;  4LAC B;  4X0R A;  4G7Z F;  1N1C A;  4IWB A;  5KYY A;  5L3Q A;  2GFH A;  4CS9 A;  5KYU B;  4JZA A;  1TWG A;  2WZF A;  4JJF A;  3RIP A;  2E87 A;  2WB7 A;  4JVS A;  3LEV A;  2H7V C;  1Z63 A;  1ZHT A;  3GOD A;  3K66 A;  3LES A;  3KMI A;  5KYY B;  3EPV A;  4JCH A;  2OG2 A;  3EFO A;  3N0T A;  3OWT A;  1ST6 A;  4EBB A;  2A69 F;  4BEJ A;  4FX5 A;  2G3K A;  3LS0 A;  2H7B A;  3UGP A;  2MYS A;  2WVQ A;  3ITF A;  4OIQ F;  1SMY F;  3EFO B;  3H65 A;  1OCC C;  3X2Q C;  3ZG1 A;  4CIH A;  1J8M F;  2FGY A;  2J9U A;  2DYS C;  4ANJ A;  4WJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...