3LETA

Crystal structure of fic domain containing ampylator, vops
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
302
structure length
302
Chain Sequence
GQAQRLQTSSSVEHGQMLFKDANLKTPSDVLNAFAKLDSKMVKSHAAELSQLAERAMTEVMLETDSGKNLKALIGDDAVKSLAVRVVKDYGGGVAAAQKNPEVRINQMQAVFDMEVMHLKAAQRHIEGLASTDLNQGVYAEGLPEDAFNKAGVTNNVERAAAWIINASNSKGNDAENITSLLKEYATNGKDLLNMDNLKELHARLVPNVERDYRGPNISGGTLPSSIGGEGMLKQHIEGFLKENPVADKDLGKHLFAGVIGYHGFTDGNGRMGRMLYAIAELRNDSFNPLAMNAENSLHGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Analysis of VopS with Fic Domain Supports a Direct Transfer Mechanism for AMPylation
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase vopS
total genus 107
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 3letA00
5JFFA 4N67A 4X2DA 5JJ6A 3LETA 4NPSA 4M16A 4PY3A 5EU0A 4U0ZA 3ZC7A 4ITRA 4WGJA 3SE5A 2VZAA 4U0SA 4XI8A 5CMTA 5CKLA 3S6AA 5JJ7A 4U07A 2VY3A 3SN9A 4X2CA 3ZCBA 2JK8A 2F6SA 3N3UA 3ZLMA 2G03A 5JFZA 4U04A 4X2EA 4LU4A 5CGLA 3CUCA 3SHGA 4U0UA
chains in the Genus database with same CATH superfamily
5JFFA 4N67A 4X2DA 5JJ6A 3LETA 4NPSA 4M16A 4PY3A 5EU0A 4U0ZA 3ZC7A 4ITRA 4WGJA 3SE5A 2VZAA 4U0SA 4XI8A 5CMTA 5CKLA 3S6AA 5JJ7A 4U07A 1NH1A 2NUDA 2VY3A 3SN9A 4X2CA 3ZCBA 2NUNA 2JK8A 2F6SA 3N3UA 3ZLMA 2G03A 5JFZA 4U04A 4X2EA 4LU4A 5CGLA 3CUCA 3SHGA 4U0UA
chains in the Genus database with same CATH topology
5JFFA 4N67A 4X2DA 5JJ6A 3LETA 4NPSA 4M16A 4PY3A 5EU0A 4U0ZA 3ZC7A 4ITRA 4WGJA 3SE5A 2VZAA 4U0SA 4XI8A 5CMTA 5CKLA 3S6AA 5JJ7A 4U07A 2VY3A 3SN9A 4X2CA 3ZCBA 2JK8A 2F6SA 3N3UA 3ZLMA 2G03A 5JFZA 4U04A 4X2EA 4LU4A 5CGLA 3CUCA 3SHGA 4U0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFF A;  4N67 A;  4X2D A;  5JJ6 A;  3LET A;  4NPS A;  4M16 A;  4PY3 A;  5EU0 A;  4U0Z A;  3ZC7 A;  4ITR A;  4WGJ A;  3SE5 A;  2VZA A;  4U0S A;  4XI8 A;  5CMT A;  5CKL A;  3S6A A;  5JJ7 A;  4U07 A;  2VY3 A;  3SN9 A;  4X2C A;  3ZCB A;  2JK8 A;  2F6S A;  3N3U A;  3ZLM A;  2G03 A;  5JFZ A;  4U04 A;  4X2E A;  4LU4 A;  5CGL A;  3CUC A;  3SHG A;  4U0U A; 
#chains in the Genus database with same CATH topology
 5JFF A;  4N67 A;  4X2D A;  5JJ6 A;  3LET A;  4NPS A;  4M16 A;  4PY3 A;  5EU0 A;  4U0Z A;  3ZC7 A;  4ITR A;  4WGJ A;  3SE5 A;  2VZA A;  4U0S A;  4XI8 A;  5CMT A;  5CKL A;  3S6A A;  5JJ7 A;  4U07 A;  1NH1 A;  2NUD A;  2VY3 A;  3SN9 A;  4X2C A;  3ZCB A;  2NUN A;  2JK8 A;  2F6S A;  3N3U A;  3ZLM A;  2G03 A;  5JFZ A;  4U04 A;  4X2E A;  4LU4 A;  5CGL A;  3CUC A;  3SHG A;  4U0U A; 
#chains in the Genus database with same CATH homology
 5JFF A;  4N67 A;  4X2D A;  5JJ6 A;  3LET A;  4NPS A;  4M16 A;  4PY3 A;  5EU0 A;  4U0Z A;  3ZC7 A;  4ITR A;  4WGJ A;  3SE5 A;  2VZA A;  4U0S A;  4XI8 A;  5CMT A;  5CKL A;  3S6A A;  5JJ7 A;  4U07 A;  2VY3 A;  3SN9 A;  4X2C A;  3ZCB A;  2JK8 A;  2F6S A;  3N3U A;  3ZLM A;  2G03 A;  5JFZ A;  4U04 A;  4X2E A;  4LU4 A;  5CGL A;  3CUC A;  3SHG A;  4U0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...