3LEXA

2f5 epitope scaffold elicited anti-hiv-1 monoclonal antibody 11f10 in complex with hiv-1 gp41
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
212
Chain Sequence
b'DVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWSWIRQFPGNKLEWMGYINYSGYTSYNPSLKSRISITRDTSENQFFLQLHSVTPEDTATYFCAYGNYLPAYWGQGTLVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11f10 Antibody Heavy Chain
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 212
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lexA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lexA01
4OUOA 2RB8A 4X4YB 5IESL 4PREB 2J8OA 4RAUB 1FFQA 4OD3L 3MRLB 4PJAF 4DKEH 5D96B 3DWTA 4OI7A 3SKMB 3VXMB 1FHGA 1HOCA 1MCSA 3B9EA 4YR6B 1KJVA 1OPGL 4HJJH 5HHQA 4GKSB 4X6CE 3GBLA 1E4WL 1IJ9A 1MCIA 1CK0L 3DMMD 5BXFA 3CCHB 2FEDC 1S7RB 4BUHA 1AE6H 5FGRA 5C3LD 2E6JA 2EH7H 1QPPA 1FPTL 1URLA 3ILPB 4HT1L 2ADJA 1KYOK 1EXUA 2R0LH 4NOFA 1DLFH 4J3VA 4L3CB 4WUKL 3I6KB 5FUZL 3CDCA 4M9OA 3QNXB 3FOMA 2ITDB 3RTQB 1A0QH 4Z7OE 2GY5A 4S0SD 1CIDA 4Z0BH 2D3VA 5D2NC 1S9YB 2AVGA 3ORJA 4FQIH 2IBBA 3GMNB 1G9MC 1SYSB 2WUBH 3TZVD 1OGAB 3I75B 3QIBA 3E6HA 1HINH 3QEHB 3IS1X 4PTTA 5I1CH 1B6DA 4MWFB 4ZS6D 3DPBA 4NM4H 4OLWL 4LCCA 4YBLC 15C8L 4R0LC 1TZGL 3S3PA 1FFNA 1XGPA 5DDHA 1A22B 5KANG 5FGSA 3LDBC 2HFGL 4ETQA 3NACH 1CICC 3RUGE 3T2QA 1EFXA 2DQUH 2E7MA 3ILQC 4RDQG 1FBIL 1KLGA 5FYKL 1OSPL 4M1CD 4HF5H 3TH3T 4HPYL 2B4CL 1U8LB 4O2FA 4LARL 1E27A 3LIZL 4ZQKB 2AK4B 3RZCD 3HC0B 5E8PA 5KOMC 1FL5B 3L3DA 3QEQD 5DLMH 1DJSA 5C9KA 1EVUA 1ZLWH 1BEYH 5MP6L 4YGVB 3O45B 4P5MA 4U6HB 1A4KB 5GS0L 3QQ4A 4OI9A 3KPRD 5I1KH 1DANT 3P4MB 3GSNA 4KKCD 4S2SB 4LAQH 5HHMB 5EOCH 3SCMA 4JO2L 4XTRC 2QSCL 3DI3B 4PJCB 5D2NB 5KS9F 3TCLA 5F88B 5L2KE 5HYSA 2DLEA 3L7FB 4U1KB 5JLZA 1JV5B 1WFTA 5IBUB 3MNWB 1YECH 3IDXL 5C2BL 4OLXH 1GZQB 4WFGD 4UIKL 3MLYL 5F70A 5DSCB 3V6BR 5EH1A 1GGIL 1NBZA 3T0BA 3WUZA 4XWGH 4Z5RB 1X5IA 4ZDHB 1U93B 5GGTL 4YBLB 4KZEH 4JY4A 1QLFB 4KKLD 3P0YH 1HK6A 5HHPA 4RMRA 1JJUA 2BSTA 2EZ0D 4X7FC 3KPMB 3ZYOA 5C1MB 3V4VH 3LDBB 3MMEB 1A6AB 5C70A 4L4VA 3CZFA 3Q6FB 4KKAC 3CVHL 2GTWA 4ZPVA 4XPBH 4Z8FH 4PJ9C 1HXMB 1INEH 1QG3A 2P24B 1AXSB 5ACZB 3REVB 3OKOB 4PGCB 2XA3A 1HYSC 3LSOA 4KQ3L 5C0DB 5EZIH 3JVGA 5LXGH 1J0JA 4NQTA 3ZKMC 3NFSL 4G3YL 1KTDA 2AV1A 1NCBH 1V3LA 4G42B 1RU9H 3EOAB 3GMLB 2C26A 3O11B 5J06A 3FB7B 1FNSL 4QY8B 4FQLL 1T83C 2B39A 4R7NB 4Y5YC 2ZSVB 4WW2F 4NDMA 4GBXC 1EEYA 2GJZB 1FVCB 4OCWH 43CAB 3X3GH 1UYWL 4ZYKA 5J1AB 2DLFL 2UYLB 3LQZA 4Y2DD 4LFHG 4OJFL 1KTKE 4HZAA 4K8RH 1NSNL 3DGGA 4UOW1 1TJGL 1NMAH 4PRPB 4P5TC 1HDMA 1LE5B 4G9DB 4V1DD 5TH2B 4X6EA 4PJ8B 5C7XH 5I8CB 4FOMA 4QGYA 2DF3A 3MJGX 1N3NB 5C0GB 3FHAA 3D3VD 4I9WD 1D5ZB 5FYJD 2X4SB 4WV1C 5F9JA 1G7MA 1EHXA 4JAMA 3CFEB 4KWUA 3OB8A 4FTVB 1E4JA 5KAQG 4HJ0C 1RIHH 4CN4A 1M05A 2WLZA 3L9RA 4HKXA 3FO1B 1I1FB 4I48A 5SWZB 3JBG7 4J4PA 4JFOB 1FE8H 5F9OL 3DVGB 5GGQL 3RBSA 2HT4D 1NPUA 2ZCKH 4G6AD 1UWEH 2YWYA 3T77B 1ZGLB 4XP6H 3ZL4L 3PP3H 1YEDA 2YPVH 5F3BB 4MSWA 2YA0A 1S5HB 2QR0B 4EI5A 2R69H 4H8WC 4MB3A 2V7NA 3EBAA 1JNLL 3HG1D 3LS5H 5IK3A 3WEXA 3CFDB 3KPQB 3KPSD 3EOTL 4FQXB 3VFVA 1NEUA 4YJZL 5FM8A 3RX8A 4Y5YB 1KPRB 5FYKE 3QO0B 4PREA 4RAUA 2OXHA 5JNYB 5IQ9A 2UWEF 4F3FB 2J88H 1EO7A 3SKMA 2H6PA 5J56B 4JY5L 5E94A 2DMCA 3O4OC 3I6GA 5GS1C 1FL6B 3UP1A 3UYRL 4DFHA 2NW3A 3RRQA 5DURD 3CCHA 4JHBA 1N8ZB 1S7RA 4P5TB 3VFUA 3G6JE 3T1FA 1F4XH 4JREB 4G8GB 5ID0B 5CILL 1FYHB 4IEFB 2PR4H 5CJXC 5HI4C 1UM6H 3RVVC 1DQLL 4MAYA 3I3BA 5CBAA 4XPTL 2DQCL 2ITDA 4C58B 3OL2A 1MRDL 4UINH 3RTQA 1J10A 4E42A 3IFPA 3W0WE 1J9CT 1G9ML 5D71H 3PGCB 5DI8B 1X5ZA 2A9ML 4XVUD 3GMNA 3TFKD 3MLZH 3SE9L 2ICEA 4DW2H 5CP7A 1SYSA 3P4OB 2NYYD 1YC8A 3L5HA 2ED7A 2ZZUT 2R29H 4Y4HA 3TJHD 3QCVH 3SGKA 5DQ9B 2PYEB 4DUVA 3O6FD 2C3WA 2F53D 3NPZB 1S3KL 1XT5A 2CLVB 5JORA 3B5TA 1A1NA 5IT2L 1CFSA 5F97E 4HH8A 3X13B 5CJ8A 3FONA 2XZCH 2B1HL 1TJHL 2W92A 5E9DB 5DJDA 5SX5K 2FX7L 3V6ZA 1FC2D 2Y36L 3GUTB 1BWWA 3UTSA 4YDVB 5FO7B 1CBVL 1EERB 2W38A 4Y5XC 3O4OB 1MCWW 2V7HB 4Z95L 4ZQKA 3X12B 2VZSA 4GSDH 1FYTD 1YZZA 2X42A 3VFRB 2J2ZA 4LPTA 4XBEH 1NKOA 2A77L 2FATH 4KAQH 3VFTA 3VXME 2OXGA 3K2MC 3MRRB 1QSFA 5T1LD 1NANI 2F54B 3V0VB 1A4KA 4HQQL 5IVZB 3BZFB 5C0BA 3WE6B 4N9GB 5C0IB 4M7LH 4RGND 3TYGL 3OKYA 5I66A 3QEUB 4OSUH 3TO4D 3OHXA 2Y4SA 5D7IA 3ZE0E 2GY7B 1XF5B 3IGAB 3FAWA 4G6KH 2OCFD 4OBSA 4W70A 5F3HA 4MNQB 1MIEL 1CVRA 4PTUA 1JV5A 5JR1H 4WI7A 2XQYG 1ROWA 1UWGH 3AS2A 3ZLQC 1ZLSL 3GMRB 1CG9A 3QG6B 2V2WB 5D7KE 1CD1A 4ZDHA 2FECI 1JHTB 5IFAL 3WMSA 2BNRA 5HVWA 1IZKA 2NY2B 3OXRB 3S4SG 1JZ6A 5K9OA 5L6YH 1TQBC 2NY1C 4JDTL 1OGAE 4OZ4A 1ORQB 2OR7A 4YHNA 2JIXD 3RVUD 2VLRB 4TUOA 2YA1A 3OJDA 1YEFH 2P24A 3BXNA 3RU8H 3EUUA 4YDJA 4P2QB 1EEQA 3REVA 4AM0A 2KZWA 2DICA 2CR3A 4Y5XB 5ESAB 3E2HB 5C0DA 3X3FL 2EKSB 1DP0A 1T03L 5DTFA 2FH8A 1KCUL 4PJDB 1CDBA 5IV2B 3HNSL 3CSGA 4JM2F 1FLTX 3GMLA 1CGSL 3O11A 2X7LA 5BVPL 2OL3A 4POUB 1GC1L 1U8NA 3SGEI 3UTSE 3UC0H 5MEND 1MVFA 3AM8A 5JOPD 2X44D 3FQTB 2YD5A 5DJYB 3S37X 3SQBA 2AK4E 4Y1AB 1TTFA 3NMEA 1SBSH 2APWA 2FEEL 3WLBB 3O3BB 4I0CC 2IPKB 4RMVA 4Z7UF 5AWNH 3RJQB 2D9QB 4FNLL 4NQCB 1GH7A 1A1MA 1AGBA 2DWEB 4FN0A 3HUJB 1LE5A 3QDGA 3QRGL 2FHCA 2JB6A 4NJAL 4K3GA 3BMVA 1NJ9B 3W9EB 3K2UH 4GT7A 4MA7L 5IMKA 5HHME 1T89C 4P46B 3GSRB 3V79C 4HUUA 4P9HH 4QRPD 4AG4H 2F8VA 4PJCE 3E8UH 1R24B 3K7UA 3INUL 4GW5A 4WWKB 3PDOA 1TQBB 2WP3T 4I3GA 2YD1A 1H3TA 2AJUL 5SWZA 4GKNB 1JN6B 3HNTL 1W0VB 3O8XD 5AZ2L 1QA9A 2CJUL 2DLTA 3IYLW 3TJEL 3B2UC 3I9GL 3ZKQD 2FL5B 1HILB 4R2GD 4M6NH 1ZVSA 5IHLB 1JHLH 1WZLA 4X8XA 3SGDH 2VZVA 3VXUA 3KGRA 5DMKA 2DQTH 2Z31A 4TYUA 2HVJA 4NQSA 4G7VL 1BLNB 3ARFC 4N0YH 1KCKA 4KMQA 1DBKH 2QQNL 5JNYA 2Q6WB 3AROA 2DQGL 2R0WH 1DE4B 3EHBC 2G60L 1J1OH 1IEHA 1KV3A 12E8H 4OB5L 3WS6C 1H5BA 1K5NB 2QLVB 1OGTB 4IMKC 2PW1B 2BSRA 2VOTA 5LVEA 1KCRH 1JRHL 2I07B 1OQOA 3HZYA 1L9MA 5EC1A 3JV5A 3RI5F 1MJ8H 1AGCB 5B38G 1N0LA 1ZHLB 3HI5H 1FZOB 4OLVL 1JUFB 4HW6A 2JF1A 2I60H 1X5YA 2EDWA 2DQDH 5C0FB 2RR3A 3PXJA 4PRPE 5I74C 4KMTL 1T2JA 3PWPA 3ES6A 4X7TB 5DJ6A 2IBZY 3D0VB 5ESVB 5C0RH 5DI8A 3WFHB 3ZKND 4QNPE 1VHPA 2HTLD 4MGXA 2O61A 1UH2A 2Q7YA 4NNYB 1HQRA 2X10A 3X14B 4HDIA 1V7MH 4FS0A 3G5YB 3WSQH 4YDKL 5FYLL 1NAMH 4FTVE 4JG0L 3DGCR 3QUXD 3GSWA 1VFMA 1NCAL 4OF0A 3NZ8A 5SWZE 1T1ZB 5C09B 4OFYD 3WLWD 4HIXL 1JE6A 3T0ED 4N5EC 5IB2A 2AEPL 2VDML 3OAYK 4JFEA 1N2RB 1S7SB 4JLRB 1AHWA 4YDVA 4KJYB 1J0HA 2FBJH 1C7SA 4PJGF 4J8RB 4JKPH 1G6RH 1WCBB 4UQ3A 3UJIH 1PGRB 4DGYL 2YPLD 3GB7A 5BS0D 1G9NH 5ELIA 1F4WL 1KCVH 1U6AL 2HLAB 3KLAA 9CGTA 5MEQA 4QXGL 4AIZA 5F89A 1ZTXH 1NKRA 5ECJE 3E0GA 1MI5D 5ADPL 3FRPG 1NC2A 3MRRA 5F7DB 3ZDYF 7FABH 3N1GC 4GJTB 4KROC 3Q48A 4G8IB 5F1KC 3V0VA 3GO1L 1Q9LA 1K6QH 4L5FH 1JNHB 4O4YH 4I0PC 2NZ9C 4N8PA 2FR4B 1CS6A 4U7MA 1JVKA 1GXEA 4MHHG 5GISH 4YEEA 4F9LC 4JCMA 3IGAA 1UA6L 1QLEL 1YMHB 3U4BL 2VDNH 1CFNB 1ES0B 4RZCA 1NCWL 4DK3A 1E4XH 3NFPA 4GMTL 1CDIA 4NQVB 1KIRA 5I9QC 5J9PA 4NGHH 3GMRA 4OF5A 3C2AH 3DVNA 4PV9A 4R26L 2V2WA 5EA0H 4F8TA 4N1EA 2APVA 2DTMH 3GMQA 3MJ8A 4HUXB 1I7TB 5IB3B 1TCRA 4L29B 3T3PF 3VXQB 3OXRA 3R0NA 2EC8A 3N1MC 2AV7B 3K80A 3DI2B 3LB6D 3PIQA 1LO0H 1ORQA 3HE6A 3PJSB 3WJJA 1A9BA 5E8EB 5KVMC 3EYFB 5ACMA 2PYEE 4O02H 4BQ9A 5A2IH 5E2TL 4PJ5D 5IM7A 2MCG1 1N6VA 2GJ6D 3SE8H 4KK9C 3TIEA 4F7MA 5E9DE 3A6CH 2W0KA 3CLEL 3DX7B 1KCSL 1MQKL 5D7JA 5DJZA 3F7QA 4Y4KD 3WFCL 3QWRD 5HGAB 4H88L 5C08D 1BZ9A 2BFVL 5E6ID 1ZWIB 3B3IB 3FQTA 5FK9A 4X6CF 2RGSA 1QTYT 5DJYA 4KROB 2J1KA 1TPXC 2X4PA 3GSXB 5KVEH 3VXRB 4AMKL 3ZHKA 3U46B 2BC4B 2WZPD 1EO8H 2A9NH 4BFBD 3DMMB 1FDLL 2Z92A 3QEGH 4PLJD 2C7UA 3SO3C 3WLBA 2KQNA 1UXSA 3S4SB 4UZGA 3BIAX 4J12A 3MRKB 4UOJA 1SJHA 1N6QL 1N59A 2E7LC 1HWHB 2UUDK 3UPRB 3H0TB 1NGWB 2F54E 1WT5C 5DQDL 3SJVD 2ZPKH 1JWUB 1WC7A 2HMIC 5EUOB 4P46A 4Z7OF 3BJLA 3V4UH 4EXPX 4AZ8A 2ED8A 4KRPC 1Q9WB 4OIAA 4MAUL 2F19L 4MNQE 3B4NA 2IAMC 3HR5A 4RMQA 4HIIA 4XCNA 4PV8B 4RFEB 3TZVB 3JV4B 2AJYL 1HWGB 3GSNH 4GKNA 3NBNA 5SWQA 1AY1H 5DJ0A 2BNQD 4QHKJ 5FYLE 4HWEL 2XWTA 1X4YA 3LKSB 2DYPA 4WEMB 4LU5L 4UAOB 1A7PH 1TITA 4LNVA 4TNWF 5FHAH 4LHQB 2Z8SA 4ZUWA 5F71A 3RUGF 4EXKA 3FFDB 2FL5A 1HILA 4MCZA 4NO3A 2FIRT 3MBED 2VLRE 1S7VB 5FA4A 1MHCA 3DECA 4P2QE 4ZS7H 3OKLB 5L7XH 4K94H 2HWZL 4GS7C 5FF6B 3BKJH 2IQ9H 3ZDXE 2O5ZH 3LN5B 3RZCB 1Z0NA 4IM8A 3M8OH 4PJDE 4KTYA 3NN8B 3OB0H 2WK2A 1OWRM 4HPOH 5EBLB 3ULUD 4JRXB 4O51B 3HLAA 3HRZA 2GSGB 2LV4A 1WFOA 5HXMA 3O3AB 3C60A 4A6YL 4TRPH 3MREB 4X6BA 3KPRB 4Y1AE 5DHYB 5FYJU 1S7TB 4BK4A 3QDAA 4KRPB 1L7TH 4KDTA 3HB3D 5ALBL 4HKJA 1F97A 5KJRL 2LVEA 1QQDA 3VFMA 3O9WA 5JDSB 2IAMB 4NQCE 4YXHL 5C0JA 4HK0B 2W0FA 2BHYA 1W72B 2WBJD 3C5ZA 4OFDA 4NRZB 2D0GA 3OKKB 5HYJD 3CMOH 4MJID 1RJYB 4OBRA 4NJ9H 4EOWH 1QVOB 2NW2A 4JY6B 4JHWL 1D7FA 2H26A 4I5BB 1MVUB 1I75A 1CU4L 1W0WB 2CUMA 3SDYL 1XF2A 3VWKD 3WD5L 3VDAA 1I1YB 3Q6GH 4UB0H 1IC4H 5MI0C 2XN9D 1E6OH 3D0LA 2EYRA 2XWJA 4BSWA 2HJLA 4FZEL 4BFIB 4IDLA 5GZOD 1BGXH 4FQQB 3C8KB 3O3DB 2R1WB 3FFCD 3U4EA 2FZ3B 3CX2A 4U1JB 4J8RA 1IAIM 1MFCH 3WO4B 5ERWA 3ARDA 5SV4A 3JWOC 1I9IL 1NLDL 5IKCB 4U2YA 2NY4D 4UMGA 4LLMB 1OTTC 4XNYL 2DKMA 4QTIH 5GXBB 3ZSTA 1A7OL 4CMMA 5I8OL 2ZSWA 3RL1A 4CU8A 1OF2B 4JG1H 1JPGB 3TWCH 3QPXH 4JKMA 3MZGB 1INQB 3CX5J 2Y07L 3MOBH 4GRLC 5D1XD 3B9KC 1P4IH 5HHOA 1YMHA 5DD3H 3CFBB 4NT6B 1OARH 1F5WA 2QBWA 1YEKL 3NAAL 3GZKA 2NTFB 3D3VB 2HAZA 5HBBA 5IBLC 4ODVH 3TC9A 1NCCL 3LN4B 1KXVC 2MQ3A 3SO5A 3MFFA 1XGYH 1IL1B 4YQXH 4HUXA 4XP4L 5JW3H 3PGFL 2XWBA 4L29A 3VXQA 1FJ1B 4PJFA 3EYOB 2R2BB 2D03L 1YY8A 4OCXH 3WHXB 2FGWH 1RAMA 2VDLH 5GJTL 5MI0B 1DDHB 2OP4H 2YD9A 2YRLA 3G5VA 3SBWA 1FN4B 3D5OF 3GDBA 5HSFA 1R3LB 1R5IA 2ARWA 5HYFA 5CEXA 1DQMH 3WNMA 5I1JL 3W9DB 4OV5B 1YNLH 2MNUA 4JPIA 4M43H 4NQUA 3KPSB 5E08L 3TN0C 3ARWA 3VGAB 5BVJA 4HK3J 3U1SH 1GAFL 1J12A 2IWGA 3GI9H 5FHBL 1A14L 4JRWA 4NCC2 2VE6A 1Q0XH 5F6HJ 4H25B 4AEHL 1CF8L 4PS4H 1JNNH 4YO0B 1WZ1H 5CGMA 1JTTA 1OCWH 3DV4A 3QCUL 3C6LD 1XGRB 3G6JF 5EOTA 3MCLL 3LZFL 1J0ZA 4GRLB 4XXDA 3B9KB 1UWXH 2YPKB 5EZLA 3RPIB 5GGSB 3KPNB 4ZUSB 1WSST 1WTLA 1GGCL 2VQ1A 3QUZA 2GFBB 3H7LA 4UV7H 4AENA 1PSKL 4KPHH 2AABH 5EUOA 3QUKB 2RCSL 1FG9C 4OGAC 1X7QA 2VR4A 3DBXA 1DUZA 4LPVA 3PL6A 2Y9RT 1W72L 4TUJA 5E99L 3IDUA 4MQ7B 2B7DT 4G8FB 3OAUH 3RWGB 3V6FB 4PV8A 4P5KB 1S9WA 2EE9A 3V7MA 4NKMA 4LCYB 3O6FB 2YN5A 2CKBH 4LSTH 4BZ2H 1WICA 3L95A 4KC3B 3F7YA 5DC0A 4PJFE 5BW7C 4LPUA 2ZKHH 4NO5B 4P57A 3KHQA 3BW9B 3TT1H 3MODL 4NC1C 3ISWA 5TDPB 1EA9C 5L88H 4IRJC 3RDTC 4LEXL 3EFDL 4P4KA 2O5XL 1M71A 1WBXA 1KT2B 3OZ9L 4N8VB 1BFVH 4B0MM 1VADA 3HI6H 1G7IB 4KK8D 2WWMC 1IQDA 3RZCA 1RZIA 1FGNL 5AEAA 4CDGC 1JI1A 3KNBB 1RIVL 4O5LL 3QEQA 1R0AL 1U41A 3O41A 4JFXB 3O0RH 3FQNA 4ZTOL 4O2EB 4MA1C 2IALB 3T04D 1PJ9A 3T0XA 1KJMB 5T1LB 3T8XB 1U92A 1HE7A 4J3SA 1XGUB 3QCTH 4QHLA 3VXRE 3BWAA 4GQ9H 4DN4L 3MREA 3KPRA 5DHYA 1FAIL 4RGNB 5TPWH 4Z76B 3ZE0F 3P9LB 4EIGB 4XVJL 5EU3B 5FB8B 2OL3H 4H20H 1KEGH 2J8UA 3BD4A 1U8KB 5AZEL 5IFJA 2DM2A 4HFWA 4MNGB 3SDCC 4EVNB 5CCKL 4P9ML 4UQ2A 4KJQD 2HT2C 4B41A 5EUOE 1GVIA 1ZSDB 3OKKA 5EORL 2QHRH 1U8QB 1QVOA 3QUYC 5DMGC 3UDWC 5TE6H 3S97C 4NO0D 4Q6YA 4GAGH 1CZ8L 3W81A 1QACA 3DYOA 2GYSA 3N85L 3DX6B 2DN7A 3WNLA 2JIXB 5K59E 4NUGH 1JYVA 2R15A 4NNXB 1KB9K 4CL7A 5LJYH 4QOKD 5FUOL 3RY6A 4BFIA 1UM4H 5B38A 4EQ2A 3ECBB 5KVGH 5D9SB 3JWOL 3TNNB 3BUTA 1N5YH 4U1JA 2BCKB 1SM3L 1YY9C 1VKXB 2OMBA 2HKHH 1H0DA 4I77H 1MFDH 5DRNB 4NQDB 3FT3A 3QXWA 4MD4B 4YWGL 1KFAH 5MENB 2KBGA 3FRUB 1AQKL 2YXFA 1ULVA 4JPWH 3EOYG 3MLSL 1ZEAH 5IMOB 1ODAA 5J7CC 4XRCA 5EG6C 4Y2DA 4NHCL 3VCLB 2XYCA 1A5FH 4Z7NE 2Z8VC 1RUPL 4JRXE 4WFED 3QISA 1IEBB 1INQA 1NDMB 1DL7L 1FO0B 3SDCB 5TDOB 2JLLA 1W8OA 5DHVA 3C9NA 1XGQB 2MHAA 4HGWA 5T5FL 3RIAF 4V1DA 3CXHJ 3ZKXC 3KPRE 1OM3L 4YC2C 25C8L 4PJCF 3QI9D 2VLJA 4AH2B 1ITBB 2NTFA 4CRPA 3RWHB 5CJ5A 4X8JB 2J8UE 2NR6C 4QRPB 1LDPL 3B6SA 3EO9L 1VEOA 2DB8A 3QFJA 1YUHB 4ZFOA 3PWJB 4HIEA 2R39A 3EYOA 1MFEH 2MTPA 4HS8L 4MQTB 3FN9A 3O8XB 2BY1A 3G5ZB 3MGAA 3DSFL 1KXTB 2NY6C 4ZTPH 2F58H 3MRFB 2G2RB 2P7TB 1R3LA 4MMZC 2WUCH 3HG1A 3LKNA 4LNRA 4R2GB 3W9DA 2H3NB 3BHBB 2DQIH 3ARUA 3FKUS 4GXVH 1LP9B 1MHEA 3I6LE 1MCCA 5DHXB 2IPTL 5D1QC 1BX2B 5CBEA 5LGHL 1S78C 1BJ1J 2YEZB 2CGRH 1EEUA 4XNQA 1BZ7B 4H25A 3STLA 4JCLA 1NGYB 3HPJB 3MXVH 4E9LA 3K3QA 2D0FA 4F58H 4DGVH 3PABA 3SKJH 4E41A 3FB5B 4F80A 5IWLA 4O00A 2RFXB 1PDKA 2MQCA 2HLFD 3QUMA 5E8NA 3EYSL 3ZKXB 4J6RL 4YC2B 3HCVB 4MD5B 4G6JL 2YRZA 4U4BA 2GFBA 2O93L 2WV3A 4I3SL 2VLKD 1XZ0B 3MNZB 1NGPL 2DOCA 2YC1A 2OTWB 3LEYL 3BESR 3QG7H 4OLYL 3WXWL 4EBQL 1RHHA 2EDRA 4PRID 2B1AH 2W91A 2QQKL 4QNPF 2VB5A 4DN3H 5ISZA 3TESA 4PB9L 4QRQA 1Z9MA 3TVMC 4F8QA 1KTLB 3VJ6B 1T66C 4CBPA 4RIRA 2VISA 1IC7L 5I73B 3WFBH 3RWIB 4JHAH 1PX3A 3RWGA 3D3VE 3U9UB 1I85C 1TZHA 4I9WE 3VRLF 5CAYB 5FYJE 2NY6B 5I1IH 5GRUL 1NQBA 3MV9A 1NEZG 4XH2A 3ARGC 4F2MB 1NUDA 1A6WH 2F53A 3SKOB 1T5XB 5C6TH 1VB9A 3MRBB 5L2JA 4PJIA 5TDPA 5F7HA 4OZHB 3BYTA 3FQRA 3P0GB 2EIEA 4Q0XL 3DSNA 5KVDL 4C56D 1BHGA 1BOGB 5ACLA 4EDWH 1KT2A 3L3JA 2CUHA 2Q3ZA 3UXFA 2YPLB 5BS0B 3MUJA 2X4OB 3GM0A 3KPSE 1QOKA 5IVXB 3P73A 1AI1L 5HGGS 1FYTA 4O58L 2ADFL 3HC4L 2OLDA 3ULVH 4MZ3A 1FFOB 1BQHG 4G7YL 4BH8A 4LSQH 4JEGB 4PPTA 1IGFL 3M17A 2IALA 4ZAKC 1CFVH 2X09A 4NN5C 1KN4L 3D2UA 3SPVA 1KULA 5T3ZH 4XB7A 3DTXB 1AR1C 2YKLH 3ARXA 3GJFB 4Z77B 4LLYB 3P9LA 3TO4A 1P7HL 1SJXA 3HMWH 1FO0L 1UM5L 3RWJB 1A2YB 1IAOB 2I24N 3KYMB 1A6UL 3DETC 4K7PX 3WNPA 3BZ4B 1Z0MA 4ZFFB 3D69B 4Q58C 4F7TA 5I19L 2FJGA 3B9DA 4EEEA 4A2LA 4GRWB 4UU9A 4LDOB 3BP5B 3D39D 3EYUH 2BX5A 3EZ8A 1ZSDA 2GUOA 3G5XB 4QRRD 3ROLA 2GQHA 2YBRB 3ARGB 4LVOC 2O26U 3KYKL 1IE5A 3CK0L 1Q94B 1QO3B 5FKAB 43C9A 3H9HA 4FQ1L 4M7KH 3S36H 1IILE 1E28B 3VFNB 4R8WL 1WGOA 1UB6B 5GRZA 3DX6A 1FV1A 4OGYH 1U3HD 2PW2B 3IJSB 3MV8B 5BO1L 1ZLUK 1YYLL 4G80B 4PY8J 1UG9A 2A6IA 5EBMA 3MXWH 4TUKL 2C4FU 5ID1A 4WI6A 5CUSL 4HFUL 2GJ6B 3ECBA 2XFXB 2X2YA 1F6AB 3TNNA 4F37K 4I18B 3MRPA 1I7ZB 4ZO6A 1VKXA 1JZ2A 1VERA 3QQNA 5LGJB 2JJSA 1YN7B 4Y4KB 2IG2H 1D5BB 2FHBA 2VDPH 4MD4A 1Z9SA 2IANB 3RWEB 5E6IB 5MENA 3B8YA 4R3SA 4ZAKB 1E6JH 4K9EL 3RHWF 4NN5B 1N0XL 4FXLA 3H9SB 2AKRB 3DX9B 3U0PA 5D1ZC 2WBKA 4QO1A 3MOAH 5J6HA 5FKPB 3U9PL 4K55A 4FQHA 1FH5L 4G5ZH 4R4FL 1LEKA 4YHPA 1MCBA 3DARA 2EDXA 4X6FA 4YFLF 2HKFL 5H2BA 4YX2L 2BVYA 1ETZB 4JQVA 3OJVC 1QUNA 4Y19B 3OXSB 4IJ3C 1AC0A 3PWNB 3TN0D 1K9TA 2P5WD 1RUQL 2VLLA 3SJVB 1MPAH 5CMAA 4RGNE 4AH2A 4PJ7A 4TULH 4IOFC 4MA8H 4LSUH 2BOCA 3WHE0 2QHLA 3CSBA 5DEGA 3DRQB 4MNGE 4MXWL 4RDQF 1A3LH 5JO5A 1W8NA 2BOBA 5HVGB 5F7NC 4X7SL 2JJTC 1OSZA 3BGMB 3JV6A 3VFSA 4YHLL 1JMXA 5GGRA 5EDXA 4EUPG 1EZVY 1D9KD 4U1MB 4KI5D 3G5ZA 2G75A 2Y6SD 2VERN 1DBMH 1F11B 2LE9A 1CXKA 4P4RB 5HYQA 5CJQH 3K4ZA 2IGFH 3MUY1 3ULVF 4ODTH 1FVDA 3V0AC 3ARBD 3ARRA 4HZLA 3OGCA 3VU2A 4CAGA 3MBEB 5HHNA 4GFTB 3FT4A 4IRZH 1MUJA 3NCJL 4QXUL 1OLLA 4X5XB 1SEBA 1BX2A 1OAKH 4GQPH 4JQIL 3HI1B 3UZEA 3D9AH 3WJLC 1NFDB 1I7RB 4JM4L 4Q2ZB 4X5LA 5LGKA 3HE7C 2VWEE 3I50H 5M94B 1NGYA 3HPJA 2EDEA 3GM8A 1J5OL 4NQDE 4LCIL 3U30B 5MENE 2VXSH 2K1MA 1IM9B 3JUYA 5JOPE 3O4LD 1P4BH 2ZCLH 4HUVB 1YNKH 3ZZ1A 4XP1H 3FO9B 4PGDB 5JIKA 3RDTD 1CICA 1YEGL 3D25A 5DJXB 3QIWD 2NNAB 1P69B 4OZGB 4RAHA 3RVWD 3H3PL 1XZ0A 5DD5H 2OTWA 3I85A 5C0ND 3MLRH 4KGLA 1YN6A 2A6KB 2WBJB 3AU1A 4FQCL 1KTLA 1P7QD 1DR9A 2Q87A 3V5HB 3D85D 4C4KT 1HNGA 4U1GB 3GSUB 3UO1L 4MJIB 4F7CB 4I2XA 4QRPE 2R2EB 5AD0A 3QUXA 3QT2A 4GRMA 5GRJH 1K8IA 1BVLB 4QF1B 1YQVH 3O3EA 2AP2A 2D7TH 3B9AA 3A6BH 4OFYA 3VWKB 2XACC 4YHML 1ZANH 4UT7L 1KLUB 4XVTH 3WUWB 3T0EA 4Y4FD 2XN9B 2P1YA 4O2CB 1PKQB 3GRWA 2EDHA 2EEDA 5HPOA 1WQVT 3FQUB 2VXUL 1X5GA 2JB5L 3FFCB 4Q9RH 4KVCH 4R4ND 4RGMC 4ODXB 3QHTC 4WCYH 5F96H 1UKSA 4JANA 4HJGA 5LWYL 1IM3A 2H41A 2W65B 1B2WL 3GSVB 2E6PA 2ICWA 3F5WB 3KR3H 1JGLH 2EDTA 3IFNH 3B5GA 3L3HB 1CGVA 1PYWA 2DI7A 3QHZH 2A73A 1MI5A 1DEDA 1MRFH 4LHJB 2NX5D 4ACPA 4AT6A 4WRLA 4JFYB 2J4WL 4MS8C 4GAYA 1C5CH 2X5PA 5SX5H 5KAQF 4IRSD 1S9XB 2VH5H 3IDYC 1HQ4B 4KY1H 1RK1A 3LH2L 1J8HB 1UCBH 5JQHC 3V52H 1IC5H 3C2SA 1E4XI 3GJFA 4JKLA 4Z77A 4WTXA 4B50A 3N1QC 5I8KH 5D1XB 1XGTB 1S7WB 5F1IA 3THML 2GSIB 4JZNB 1II4E 4ZFFA 1QR1B 4FXKB 2ZJSL 4ETYA 4MNHA 1AJ7H 4L8BB 5ETUB 3RA7L 5E2UL 1T83A 5ABDE 1YYML 3T1WA 2A1WL 4GBXA 5E1AB 1PQZA 3FB6A 3FZUD 3ZE1F 3U0TB 5DMYA 1HHJB 3ZE2E 4HXAL 1JGVH 3TPKA 3ZO0A 3CFIC 4PG9A 5DJAB 4I2XE 4KK5C 5HD8C 1NGXB 4S1DC 2Z9TA 2E7CA 3IDJA 1JZ8A 2IH3A 2BVPB 1V5JA 1CXHA 4MXQC 1RK0B 4PJ5A 3L3GA 3I2CL 3T2NL 3GSOB 4WJ5B 1S9KC 5DYOB 3T0EE 1HI6B 1PG7L 4OZHE 2VL4A 5IB5B 4WV1A 4F9PC 2FB4H 1BIHA 1KC5H 3EYVA 3VXSD 4Y4KA 3QWRA 5C08A 1L0QA 4XHQA 1KLFA 3BE1H 5EU4B 4AK1A 3HZVB 5KSBB 4J7RA 3U0WL 1MH5A 3IDYB 2YPLE 2AKRA 5BS0E 3DX9A 2QKIA 1LK2B 5IVXE 5T1DL 1OAYL 3C6LB 1BD2D 2HN7A 1AGDA 5AUMB 4LHUB 3GBNH 3NTCH 2CIKB 2HYMA 3WIIL 4ZFZA 3ULUL 2IPUG 1RVFH 1VFOA 2PTTB 1NL0H 4N0FB 3TBVB 3UZVB 4APQC 1YMMD 3QXAA 1EK3A 1F2QA 1ETZA 2N56A 5CD5D 1JGUL 3A67L 3OXSA 5E2VH 1OD9A 5FDYA 5BRZD 1QBLL 1QBMH 4PP1C 2W9LA 5IQ7H 1YC7A 2ID5A 1QKZH 3PP4L 4LVNC 1FAKT 4POZD 1Y6KR 2NY7L 5CZVL 1NDGB 2YMXL 4QXWA 1QEWA 5GS1A 3KJ6L 1QFWH 3SKNB 2VDOH 1YA5A 4GRWE 5DD0H 2HJFB 4ALAL 2YWZA 5I16A 1UQSA 2BNQA 4BELD 2H1PH 4PJFF 3PE9A 1EMTH 5D7LB 1L0YA 4JRYA 4ODWB 2IQAA 2VDRH 35C8H 3T65B 4YAQB 1A7RL 1JFQL 1Z3GH 1OAZH 1WAAA 4XPGH 5DEFB 4PJAB 3LQAC 3MV8E 1YEJL 1CGWA 1HEZB 4DEPC 4K2UH 1J0YA 3UYOD 5E8OB 2EDDA 3S34L 1F58L 1UH3A 1WTGT 2GJ6E 1TTGA 3NPSB 4HCRL 2OM5A 5DEZA 2R1YB 4FQJH 3G08B 2PKDA 2OSLA 1KN2H 4XCCL 4OLUH 4APQB 4ZXBD 1N5AB 2IANE 5HVFB 4ZO7A 2PO6C 1KIUA 3S5LG 1SEQH 3B2VH 4OCNC 3MQIA 5D72H 2G5BB 4FABL 4P3WA 3FO9A 4L1HA 4KQ4L 2D4DA 4M02A 3GHEL 1SY6L 4PRHA 5DZLA 3KHOA 1IKFL 4XNMB 3GMOA 4Y19E 1HHHB 4IDJH 5DT1H 3CPLA 3WKMH 2ARJQ 5KN5A 4Y0GA 5EUOF 3SJVE 3TBTB 4OLZL 2AJXL 1SHMA 2C4FT 3ZT7A 2XT1B 5TQ2L 3QFDA 5HYJA 5CJBA 4MJIA 4DZBA 4F7CA 2Z91A 3BOVA 3HMXA 1ZOXA 1I3UA 5HGDA 1EVTC 4PJEA 4ZD3H 5B8CA 5DHVH 2NXYD 3EJYD 1AXTH 4U7KA 4J2XA 2DTSA 4CKVX 1WBZB 4J3TA 1INDL 4F7EA 1NH6A 5K59F 4MJ6B 2A83B 3MRCB 4D3CL 3WFEH 4ERSL 3VWKA 5CZXD 1A47A 1AGFA 2ARJA 4JB9H 4PR5B 2ICCA 1HHIB 5FYJH 4O2CA 3K46A 1S7UB 4M1DH 4QOKB 4X80H 1RUKH 3SDDD 4TSAL 4N1HB 4CNIB 1AIFA 3LEXA 8FABB 1Z9LA 2DQHH 3LKRA 5AAWA 2FD6L 1QRKA 1NCNA 1U95B 1PY4A 2XKSA 2J5LC 1X9QA 2BSSA 4KU1A 1I9RH 3F5WA 3IT8D 4GXUN 3CVIL 4QKXB 1MSPA 1R5VB 4IIQA 4YFDB 5F7KC 4NKDA 4TTDD 1I3RB 4AL8H 1XIWC 4P23C 4JO3H 3AY4A 2NCMA 4Z7NF 1NFDE 2AAVA 1NC4A 1X3DA 3OAYH 4JPKL 5F9WB 1NEZA 3I02A 4OUUA 4RFOH 4DKFH 3ULUE 3JWDH 5CIPB 2XKNA 2P48B 4OTXL 1NBYB 4WFHD 3K8KA 4EN3D 5I1GL 1BBDH 1T21A 2CLRA 5D1XA 1CFBA 5DK2A 5E24E 2GSIA 4TVPD 4MCYB 1MFBH 2AJ3B 4XC3H 2J8UF 1YJDH 4TSBL 3VD9A 4AQ1B 4OZGE 4K3JL 5E00B 3VG0L 5CJOL 5D4QA 1QHPA 2Y7QB 4XVSH 1A3RL 3TNMB 1QZ1A 3ZTJH 2HRPH 5E1AA 5DD6A 2YD7A 3QUMH 1FLRH 2ZCHH 2XY2A 4NSKB 1B0WA 3GBMH 4GMSH 5I2IA 3KPOA 4C59B 5HYJE 4KTEH 4OIIL 1HIMH 4MJIE 5DJAA 1F45A 1BQHA 5GRVK 1KJ2A 3H42L 1B4JL 4XMKH 5FO8B 3TV3L 3U48A 2DWDB 2XRAL 3SN6N 3MJ9L 4Y16C 1P4LB 3ZT5A 4L8CB 1ZGLM 1OQXA 4PRNA 1T89A 4XP5L 2NLJB 4PGEA 1ZHBB 1NMBL 3VW3L 4K23L 1I1AD 2K7PA 1U58A 2XN9E 4ZO8A 5ILTL 1PKQE 2FX9H 3SQOL 3FFCE 4DQOL 5E56A 3KS0J 4LBEA 4M8QA 4F57L 3HPLA 3OX8B 3RGHA 1ZA6A 5GPRA 5C0EB 4CW1B 4QCIA 4WI5A 3S88H 3C6LA 4D0BB 4WY7L 4Z0XB 1MREL 1RUML 1G0YR 2PTTA 3NIFE 4CGTA 2YA2A 3BT2H 4E0RA 3BEVA 2ADGA 3LHPH 3S37H 3IDMB 4XXCC 2VDKL 2X4NB 3BZDA 2MCPH 1PBYA 5K9QI 1RZGA 2A2QT 4U1LA 2VLKB 3BPCB 5D7SH 3RKDD 3E3QE 2HTKC 5JXEC 2W9DL 2HT3C 3QHFH 2GCYB 4DCQA 1U8MA 3MRQA 3WIFB 3TBSA 5B21A 3EJJX 4QYOB 1T1YA 2VSDA 1UB5A 3MGTA 4RQQB 1NMCC 3HZKA 1R5WA 4IMLA 2H32B 3QDMA 4H26A 2HJFA 4L4VD 3IKCA 4M5ZH 3QZWA 3V7AG 2UUDH 4H0IA 4I4WA 4PRDB 1MEXL 4O9HL 1H3UA 3QH3B 4KKBD 5IHUL 4YAQA 3LQAL 2YHGA 3VXNA 3UEZA 4POYA 3VD5A 3FQWA 4P2CG 4YZFE 6FABL 4NQEB 3SOBL 4L8SB 5ALCL 4K8RC 3KPLA 2MPAH 5I1HL 4WENB 2J8HA 4OFPA 1HHKB 4UIMA 4X98A 5BMFH 1RULL 3P9MA 4KFZC 1ACZA 3VFPB 5F7FA 1KBGL 3HC3H 5J57B 5KSBE 4Q6IB 4OM0H 2AEIT 4LCWB 4EUPA 4HIJA 5DZNA 3P9WB 2VIRA 2B0SL 4DVBA 2WNGA 5DO2D 3Q1SH 1F90H 1YPZA 1MF2L 1GPOH 1LNUB 2WSKA 1NMCB 4MVBD 2QADD 4U1IB 3O6LH 3WL9B 1AFVL 3OKDB 5F44A 1DN0A 2CK0H 4WIQA 3TBTA 5F1NB 3D39B 4LSPH 1MIML 2D9CA 3FO0H 4QRRB 4QXTA 1YEHL 2G5RA 3QJFA 4NM8H 3ZYZA 3IU3B 1NUGA 5CEZH 3T4YA 4RRPG 1LEIB 4NO0A 5SWSA 1MELA 1WBZA 4KK6C 2P45B 4OZFG 4LPXA 4DKEL 4R6UA 4I0PA 5JZ7D 3QAZC 4OM1H 3BZEB 2FJFA 2C3HA 4R4BB 5ICYB 1ED3B 1PLGH 4HJJL 1U3HB 4R7DA 2AXJA 4F9LA 1ONQA 5GHWH 3O2WH 3QQ9D 3V5DA 3EOBB 5D7LE 1AE6L 2EH7L 4UILH 3VWJC 2DI8A 4JM2C 1U8JB 4JZJB 2R0LL 1CXIA 1EIBA 1DLFL 4PJAE 2R9HD 1WWWX 4FQPA 4OCMC 1YDPA 3EYQC 2NMSA 5SX4H 4KJWD 5HI3C 4JVUA 3JTTA 5FM5O 1A0QL 4OF7A 2CLZA 1I3RA 4U6XA 4Z0BL 4IOIA 1IKNA 1H3PH 1KELH 1LDSA 4FQIL 4U1HA 1CLOH 2EDNA 4G9FD 4FA8A 2KKQA 2WUBL 1HINL 1NBYA 4ZUTB 1GIGH 5I1CL 5DJCB 4LSSH 1Z6JT 4NM4L 2GITB 1BFOA 2APBA 4G6FB 4L8DB 2H8PA 1I7UB 3QI9A 3TCXA 2X4QA 4JFFB 3NACL 2UVEA 3CX5K 4NKIH 2DQUL 3QWQB 1B90A 5J4MA 4KDWA 2V6HA 1XCQB 1CDUA 1Z5LA 3QAZB 4HF5L 3PV6A 2FO4A 1G1YA 1F3DH 1AXIB 2VITA 5EPMA 1CFTB 3QNYB 5FO8A 1SJEB 3C09C 5F7YC 5DLML 1WT5A 4DGIH 5DFTA 3VH8B 1J11A 1KNOA 3TGXA 1BEYL 1RZJH 5BV7B 5EBWA 4P2RB 1QRND 1ZHBA 5EFIA 5ICZB 1ZA3A 5KW9H 4ELMB 1OTUD 3VGDA 3VMPA 5I1KL 1CD9B 3KPPB 4UBDC 4NKOB 4LAQL 4HUWB 4EI6B 5EOCL 4LEOB 4QOKE 2P5ED 2R8SH 4JDVA 2V9QA 3H2WA 4WHTA 2B2XH 1FCCA 3ARTA 2FSEA 4PD4J 3V6OC 3OX8A 1ORSB 1V3JA 1QSFD 2VSCA 3MA9H 4CW1A 3CSYA 3IXAB 3FN3A 2CXGA 1YECL 5D93B 4OLXL 5C0BD 3MUGA 3GRWH 3U2SB 1HKLH 4XWGL 4WI8A 1JRHI 4H5SB 4KZEL 3P0YL 4YFLI 3G6AB 3QIWB 2WWKT 3OKEB 3V4VL 1CXFA 3P30H 4BH7B 3HNVH 4WFEE 1FZJB 1MHHA 2CK2A 2JJVA 2VLKA 4RGOH 2KZ1B 3P4NB 1XFPA 1NGZB 3EGSB 5IMMB 5IW3A 4XPBL 4PRIA 4ZNCD 4Z8FL 4OZIB 1INEL 1K4CB 3FQXA 4LRNH 2YSSA 4XPFH 3CC5B 3NFNA 4UT6H 4FFWC 1P7QB 3D85B 4LQFH 4PJ7F 1NBVH 2DBLH 2H9GB 5J13B 4HWZB 5LXGL 1AKJD 2K9UA 3EO0B 1EPFA 2H32A 1S9VB 3GJFH 3WN5C 2OR9H 4J1UA 1NCBL 1KPVB 1D6VH 3LPWA 3C09B 1RU9L 1FL3B 4LDLB 1WIOA 1FNEB 5TE4H 2DLGA 2M1KA 3EDDA 3QPQD 1T03H 3SHSA 1T1XB 3P0VH 1C12B 1OP5H 1EFQA 2IBGA 1SBBA 4GRWH 4OCWL 1VPOL 4Y4FB 3X3GL 2P8PA 3LRGA 4FFVD 1A6TA 5IMLB 5JHDB 3PNWB 1JPFA 3B83A 4C56A 4K8RL 1IGMH 4QHUB 1S8DA 1NMAL 4XNZB 1LE9A 5T1KB 4M1GH 1I8KA 4ONHA 5C7XL 5MEOA 4QWWD 1UJ3B 3R8BB 4N90D 3W5MA 2EXYD 4U6YB 5F1OB 1J0KA 2J3SA 4HX1B 4WU7A 3MNVA 1FIGH 3UMTA 5ENWA 3MRMA 4P9HC 3RWDA 4IRSB 1RIHL 1EEZA 3CH1A 1WEJH 4NYLA 4YHZH 5C6PB 3BN3B 1M7IA 4D0CA 1FE8L 1NFIB 3EO1A 4XBPB 2ZCKL 1UWEL 3SDAC 4XP6L 1VFAA 4W6XB 1RSFA 2YPVL 4ZSOB 4J23A 2R69L 2RQ8A 1U8PB 3LS5L 1T3FB 1AP2B 2VLKE 2CJUH 2BVEA 4H8WH 4UOW0 4XWOC 1XIWD 3ZE2F 4XCEA 1JF6A 2Y06H 3MRJB 1LEIA 2I5YH 1CXLA 2VL5A 3IFOB 5DMIH 2ZNXA 4OQ1A 3V8CA 3MGOB 3BP4B 3CJJA 4KTDH 2J88L 3BQUC 1N6UA 3NCCB 3S5LA 4HULB 4KJPC 1H3XA 3L3KB 3DV6A 4Y8DC 3REWB 4LSRH 2ATKA 3EOBA 1EHLH 3BO8B 2AGJH 3CH8A 4OZHF 1X5JA 3LD8C 4C4KO 4NO2B 4XI5D 4H1LG 1F4XL 1U8JA 4JFQB 1BZQK 2PR4L 4QRTA 3VXSB 3BD5A 3BI9X 1UM6L 4G43A 5DJ8A 4X99A 4NQEE 4D9QD 3G6DH 2XTJD 2OTUA 4UINL 4JFPA 4XAKD 2FYYB 4HS6A 4BM7A 3OR6A 5D71L 1U3YA 2W60A 4CN6A 2DM4A 3MLZL 4DW2L 3SDAB 5GGSY 4Z18A 2R29L 3CFCH 3Q3GB 2EDQA 3QCVL 4X7DC 2P8LA 3MROB 3PWPD 3TN0A 2AJSL 2GAZA 2P5WA 5CS7A 1FP5A 1WIUA 1PX4A 5CLWA 5I6XC 2BRRH 2VMFA 2XZCL 1L7IH 1K85A 1VGKB 3MRDB 1HZHH 3JXAA 4P2OC 3MV7D 4R96B 4PG2C 2CQVA 5E4IA 4ONGH 2VLMD 1K8DA 4GRWF 3LQMA 2NY0C 5GZNC 4ISVA 1T1WA 3MLWH 1KIPA 3D39E 4Y5VB 4QRRE 1D9KA 3ZTNH 1ZS8A 5IW1B 1CFTA 3QNYA 2ZOKA 4GSDL 2VXVH 4OD1H 4JFED 2FATL 4KAQL 1DVFD 4P59H 1F3JA 1UXWB 4X6DB 4MX7A 3NCBB 3RGVD 3ARBA 4LSVH 3K81A 5F8QC 5DR5H 4ELMA 5IB4B 3HMXH 4NCC1 4HIHA 4M7LL 3RX7A 2ZOLB 3KPPA 4NKOA 4HUWA 4OSUL 4D9LH 2V5MA 4JVPA 1EO5A 2OJEB 5KSUA 2J6EA 2EYSA 4G6KL 5B39G 4BZ1H 1JTOA 5BQ7A 3QXDB 5JR1L 2AK1H 3IXAA 4X0KB 1UWGL 2PXYD 3QYCA 5F6IC 4L1DA 1IGCH 1OY3B 2Z4QB 3O4LA 1ZT7A 1D5XB 1LGVA 1KB5A 2NY5C 1NAMB 3W11C 4HWBA 3RDTA 1XR8B 5EU7C 2Q76B 3G6AA 1OTSD 3MYJB 4QHMA 4NUJB 2F74B 5L6YL 1PVHA 4P2OB 2PNDA 4D9RD 3GGWA 2C3XA 1FZJA 1SJVA 2PN5A 2NXZC 1I9JH 5EIVA 4R97B 5IMMA 1BIIB 4OZIA 1YEFL 1K4CA 5DRXA 3RU8L 1CE1H 3MRIB 2NY0B 4JR9H 4U05A 4N0UB 3D85A 3N1PC 4HAGA 1F4HA 1G6RB 3BP6B 3BP7B 4HWZA 4BSJA 1A9EB 6CGTA 3GKZA 3S3JA 4JFFE 3WFDH 2KUTA 1Q9KB 3LKPA 3ZHLA 2GT9B 1KPVA 3TBYB 3QIBC 4M62H 1FL3A 4NWUH 2NXYB 2V2XA 4GXUM 3ESUF 1NLBH 4E5XA 5L0QB 4G6MH 4M7ZC 3UC0L 5K9KB 2ICWJ 4LCCC 5ICXA 4Q9QH 3ESVF 1HSBB 1DQDH 2CO7B 3MTRA 4LF3A 4F15C 1J05B 3MLTB 4KI5E 4M93B 1SBSL 2OYPA 2EDKA 1REIA 5D7JD 1TFHA 2CIIA 3VGBA 1MCPH 3I3EA 3CLFH 5AWNL 1OHQA 1MOEA 4HS3B 4X4XA 1FGVH 1HOCB 4JZOB 5I1DB 4P2RE 3L1OH 4YNYA 1S7QA 4ELME 3DVFA 4PB0H 3UDWA 1KJVB 2WANA 3K2UL 5F6IB 5HHQB 1KJ2H 3KLHC 1A64A 1O5DT 5EO1B 1EBPA 1IBGH 4P9HL 4AG4L 1CE6A 2NX5A 4X4MA 3E8UL 3ULUF 2VRAA 3DLQR 5TGBA 1BP3B 2ADJB 3VFGH 4OCRH 1EXUB 2OTPA 4AJ0A 2AJZB 2NXZB 5CZKA 3UX9B 2XZAH 1T0PB 2P8MA 3FOMB 4M7LT 5I71C 2YK1H 3SCMC 3KPTA 4JM2D 3ARSA 4J3XA 2MQ0A 2JK5A 4WFFD 2E3VA 2X6MA 1CD0A 1AP2A 4M6NL 1JHLL 2OJZH 3FN0H 3QIBB 3E6HB 1FG2A 3UPCA 2ZUTA 4OZIE 2DQTL 1IZJA 4M7ZB 2W0LA 4N0YL 1DBKL 2DYPD 3MGOA 3BP4A 2WQ8A 2ZUUA 1FFNB 2R0WL 1XGPB 4K94C 4LFHD 4NZUH 5DDHB 5GGRY 3K4DA 2O5YH 3AS3A 4CU7A 4ETQB 1J1OL 1D5MA 12E8L 2VO5A 3O6KH 5B4MD 5INDA 4QT5A 1OAUH 4DWHA 1DBBH 1KLGB 5IVOA 5HDOA 1KCRL 3BIKA 4F33A 2PYFB 2N4IA 4BA8A 4XB8A 2OZ4A 4QHNA 1MJ8L 1I1AB 5E7BA 4O2FB 1E27B 1J1XH 3HI5L 4JFHE 3BGFB 5JHDE 4LGRB 1Q9OA 2I60L 3L3DB 5LG1A 2DQDL 4JN1H 3AXLA 3C60D 2VUOA 4IOSD 4P5MB 5C0RL 3E6FA 3NIFF 1BD2A 3QQ4B 1ZLUH 2X1OA 1T04A 3DO7A 3GSNB 1YMMA 4JN2B 5ANMA 3SCMB 1V7ML 2ESVA 4OZFA 1CTNA 1BBJA 2DDQH 2NX5E 4XHJC 4X4ME 3VA2C 1KOAA 3Q3GA 3WSQL 4YHYB 1NAML 3TCLB 1QLRA 1T7WA 3F62A 3NCMA 3O9WD 2VDQH 5BRZA 5HYSB 5JLZB 3V7AE 1QFWI 4YBHA 5T1MA 4YEFA 4Z7VA 4FFYH 5CKAA 2R4RH 5D1QA 2VXTH 4OQTA 3S36X 3NZHH 3VFWB 1NBZB 1OVZA 1L6XA 1UC6A 1KB9J 3KXFD 4ZSOE 1U8OB 2BSTB 4QEGA 4EUPH 3HZMA 1TVBA 2FBJL 3C5SB 4JKPL 1G6RL 4RWYH 3UJIL 4XGZA 1NGQH 4L4VB 1G9NL 5F7UA 3QULA 1KCVL 2GTWB 2Q8BH 5LCVH 4CMHB 4Y8AA 4UNTA 2CH8A 3BRFA 2VR9A 1ZTXL 4M61A 4K3DH 4NBYB 1UXWA 3LSOB 3O6MH 4EI5C 2NY3D 4ODSH 4BJLA 3ALXA 7FABL 3KLDA 1D5IH 2P49B 3VFOB 3ARDD 1KTDB 3TA3C 4U1NA 3IJHA 1K6QL 1WWBX 5JIHA 5IB4A 4L5FL 4O4YL 5FECA 3BDYH 3TVMA 3RY5A 2A0LC 5C0CD 5GISL 1SQ2N 1EV2E 4NDMB 4RX4A 1EEYB 5D96C 2VDNL 1QSED 3VXSE 4ZYKB 5EN2A 2EYTA 3LQZB 3BMWA 5KSBF 1E4XL 3DUSA 4ZXBA 3LAFA 3ZDYE 2NY5L 4NGHL 3C2AL 3RVXC 3DGGB 1D5XA 5EA0L 5CEYA 1B3JA 4JVWA 2DTML 1B6UA 2CDFA 5HHOD 2CSPA 3CXDH 4X6EB 4EQ3A 2F74A 1WFNA 1LO0L 2XG5A 1R3JA 5F9AC 5J11B 1PFCA 3CFJA 2AXFB 2CRZA 4MAYC 4PLKC 4L3ED 5F9JB 4JAMB 4O02L 3RTQC 2QADB 4WTZG 3ZHDA 4LCUB 1M05B 3I3DA 3EDFA 3L9RB 3BKMH 1A6ZA 3SE8L 2E9WA 2ZUQB 4HKXB 4NZTH 4I48B 3RAJH 4FRWA 3A6CL 1NBQA 3T3PE 2PUQT 5B39B 4Y4HC 1YEDB 4MSWB 4WVRA 3SGKC 2V7NB 3OAZK 2DJUA 4W4OC 3U36B 1HSBA 5IK3B 5KVEL 3WEXB 1MRCH 1GAFH 5E95B 3K8LA 4RMTA 1EO8L 2A9NL 4OIBA 3U7YL 3VFVB 5J3HC 1MQ8A 3QEGL 4GH7B 2DIAA 3SDDA 4NBZB 4HS3A 5IQ9B 1P9MA 4X6DE 5I1DA 4JZOA 2H6PB 4LLVA 5E94B 1U91A 2CDEA 2ZPKL 4MHHI 4WI4A 3I6GB 5EU6D 2MSPA 3PDGA 1UADC 5E5MB 2NW3B 5J1SC 3V4UL 5EO1A 1LQSR 3VFUB 5KZCD 1DQQA 3T1FB 2EXWD 3FT2A 1JPTL 1WUNT 2R0ZH 3QUZD 2AJZA 4MQXC 3GSNL 5GGVH 4MAYB 4YIQA 3PWUA 4EN3A 5CBAB 1AY1L 2UY7A 3K0WA 1CGXA 2IC2A 2Z35A 4E42B 5DUMH 3IFPB 4J3UA 5HDBE 1F42A 4MB4A 1A7PL 3PL6D 5FHAL 1WWAX 1YPZF 2H2SC 3VD7A 2WINA 2AQ1A 3DURA 2ICEB 5CP7B 3AMKA 1IGIH 4ZPTA 3IJYA 1G0XA 5F72S 4K7PH 2VC2H 4Y4HB 3NABH 4TNVF 1LO2H 5D1ZA 5JTWA 4ZS7L 4N0UE 5H35B 5L7XL 2K7QA 3LV3B 4K94L 1A1NB 4LKXA 4ONFH 5JORB 2W0PA 1CFSB 3OMZA 5DJ2B 2IQ9L 3V9FA 3FONB 2O5ZL 1T7VA 1I3GH 3M8OL 4U6VH 4UDUA 4U31A 5DJDB 4HPOL 3DXAD 5DFWH 1GL4B 1DLHA 3V6ZB 4P4KD 3UTSB 1EGJA 2PYFA 3MJ7A 1QRNB 1DFBH 2H32H 1I1AA 4Q97A 2BXZA 5JW5A 3MLXH 4OGXH 4MJ5A 1L7TL 4LKCA 2P5EB 3PQYA 1BQUA 2JJTA 2KDGA 4NN6B 3VFTB 4X9HA 2EDYA 3AM8C 3RVTC 1QSFB 1C08A 2BMKA 4FG6D 3Q5OA 5C0BB 5E2WH 5I30H 5I66B 3CMOL 4JN2A 4CU6A 1T22A 4TSCH 5MERA 2P4AB 4NJ9L 4EOWL 3OHXB 5D7IB 3F7VB 1M4KA 1C8PA 5EU7E 4PRAA 2EICA 4M6ML 4HLZG 5JIIA 2CKBB 3L3IA 5F3HB 3SE4A 4PTUB 2HG5A 4PJBA 3FB8B 4U49A 3VRJA 4GUPA 2XXMB 5DD1H 4PJ8C 2DQFB 3Q6GL 1IC4L 2YOCA 1CG9B 4HGMA 3OSKA 4UB0L 5DFVD 3VFWA 1E6OL 1HCVA 5JXAH 1CD1B 4H1LA 2DLHA 4QTHA 4GO6B 5HI5C 2BNRB 3HE7A 3FMGH 1Q0YH 1BGXL 1U8OA 1WBYA 2IH1A 1BPVA 1X5FA 2BP3A 3C5SA 4KMLB 5K9OB 1MFCL 3IXTA 4OZ4B 3UJJH 4YHNB 4L4JA 3VE0A 3VGGA 4PRBA 4TUOB 3CDYA 3ARED 3OJDB 5IEKA 3BXNB 1T4KA 3MPCA 2V2TA 2DAVA 4WU5B 4YDJB 4AM0B 4QTIL 1MLCA 4LPWA 4PP2A 3FO2A 5DTFB 4FP8L 3VFOA 4JG1L 3TWCL 1T6VN 3QPXL 4FQXC 2X7LB 2OL3B 1QP1A 2Z31C 1U8NB 3MOBL 1W0YT 2X4TA 2XPGA 2Q8AH 1GC1C 1P4IL 5DD3L 2V17H 2FH6A 1OARL 4XC1H 4LLWA 2F5BH 3DROA 3V0WH 3ETBF 4ODVL 1XCTA 2E8YA 3FTGB 1KGCD 2BHZA 1RY7B 1XGYL 1A1MB 1AGBB 4YQXL 4BKLA 3R06A 4OCLC 3QDGB 2VN7A 1G7PA 2QSQA 1CGYA 3P77B 2JB6B 4LLDA 3HS0A 4JREC 4OCXL 5IMKB 2FGWL 1MHPH 2VDLL 2VLJD 4HUUB 4NN7C 2AXFA 2OP4L 3QSKB 2JELH 4G8EA 3QBTB 3MA7A 5A2JH 4D0DA 2D2OA 3VXPA 1UKTA 2VKXA 3QFJD 4LCUA 4GW5B 3PDOB 1DQML 5CINH 1YNLL 4M43L 3LMJH 1T20A 2C1PB 2V9TA 4YDIL 1F13A 2H2PD 3QQ3A 4XCYB 3U1SL 4M4PA 5B39A 4DTGH 1QA9B 3RI5K 2FNBA 3GI9L 4W4NA 3JTSA 3DRTA 1Q0XL 3RQ3A 3ABZA 3CUPB 2YZ8A 3U36A 1MNUH 1U8HA 1ZVSB 4PS4L 4L4VE 1JNNL 4AEFA 1WZ1L 5CGYD 2VZ3A 1OCWL 3VXUB 5EZJB 5LGHH 3HAEG 5DMKB 2Z31B 4JFZH 1F6LL 5MEPA 5J1TC 2HVJB 4JQXC 1UVQA 4NQSB 5SX4I 2JJUA 4K7FA 4U1SA 3AVEA 4DJMA 1MJJA 1AHWC 1RPQA 1AGEA 4UV7L 3KYAA 3OGOE 4ENEC 3F12A 1P1ZA 2ITCA 1WIPA 4KPHL 2AABL 2P42B 1H5BB 5E5MA 4JPVH 2XTJB 4E41D 2BSRB 4LVEA 4B53A 5TF0A 1N7MH 3HZYB 5IF0B 1RZFH 5EC1B 5BJTB 2ENSA 5HJ3A 4K71B 5BV7H 1JYWA 4G9FA 5INCA 3PGDA 3KYOA 3OAUL 3WXWH 4PBXA 4U2ZA 1OB1A 2E7BA 1HHGA 4NN7B 1IEAB 4XBGA 3PHQA 5GS3A 3P11H 4HH9A 4WO4D 3QIUD 1DBJH 3HKFA 4YXLH 2J6EH 3PWPB 3ES6B 4L9LB 5DJ6B 5ISZD 4LSTL 1SVZA 4BZ2L 5I8EA 1I4FA 2BERA 5E5UB 2ZKHL 4DKAA 5KSAD 3TT1L 2C3VA 5GRUH 2O61B 2Q7YB 1LO3H 5L88L 1HQRB 1P2CA 3UAJD 4HDIB 4HUKB 4MJ4A 3KVQA 1KB5H 3MV9D 5DC9B 5AYUH 3GSWB 1LEGA 4HWBH 1BF2A 2AW2A 5BZWA 5H35A 3LV3A 1BFVL 5GS0D 3NZ8B 5DJ2A 2NY2C 3HI6L 1PG7W 4XCFH 3GMMA 3ULSA 5IB2B 4C57C 4YUEH 1CTOA 2XA8H 2GI7A 3HE6C 3WJJC 4JFEB 4AEIH 3IF1A 3ULVC 3W0WD 3O0RL 1AHWB 4DZ8A 2MJWA 3HRPA 3QCTL 4UQ3B 1QRNA 4GQ9L 4HV8A 4D8PA 3GB7B 4JFDA 3E2HC 3N9GH 4HKBB 4YK4C 5TPWL 3UTTA 3WDIA 3KLAB 5MEQB 2P5EA 2OL3L 4AIZB 5F89B 4H20L 1KEGL 4AEEA 4KH2A 2OK0H 2VAAA 2SEBA 1FNFA 1NC2B 2FX8H 2EEAA 1N4XH 3D2UD 4L4TA 3Q5TA 1Q9LB 1Q38A 4ELKA 2QHRL 2F15A 2ZG3A 3F7VA 5IIEA 1BFSA 5TE6L 2CKBA 4GAGL 1UEMA 2GKIA 1OLZA 4RZCB 1K4DA 3FB8A 1GOHA 1JZ4A 3NFPB 1JCKA 1KIRB 5CSZA 5J9PB 2DQFA 4P46C 3DVNB 4PV9B 3OR7A 1EBAA 3GMQB 2X9XA 3MJ8B 1UM4L 1DUYA 1TCRB 4KHXH 2R56H 4HXBH 5KVGL 5FDWB 1AKJA 1N5YL 3B8SA 4WWKC 2RAMA 3PIQB 2MKLC 2HKHL 3HE6B 4I77L 1A9BB 4YBQD 1MFDL 1IT9H 4WWID 1KFAL 5DF0A 4I0KA 1MJUH 4WU5A 1DN2A 4JPWL 5IM7B 5GGUB 4KI5F 1ZEAL 4YK4B 1KEMH 2ZG2A 3R8QA 3TIEB 4F7MB 1RZ8A 2DQJH 1A5FL 4PFEA 5D7JB 5DJZB 1R6VA 2KPNA 3EDEA 4LLQA 3QWOA 1BZ9B 5E8DH 1JYXA 4ELMF 5D2LA 5FK9B 1QRNE 1ZHKB 1FVEB 2X4PB 3BN9D 3TM6A 4LOUC 3T09A 1OGAD 3ARVA 2Z92B 1H8OA 3IDIA 1UZ6E 2P5EE 1JF1A 2C7UB 3DUHA 4TNWK 4CVUA 1UXSB 3WFZA 3W82A 5CEZD 3FTGA 1CGTA 1SJHB 1N59B 3L5JA 1CDYA 1QSFE 2OZ4H 3WS3A 5C0BE 3P77A 1AD0A 2CDGA 4IS6A 1WC7B 1MFEL 2PTVA 2IMMA 3O2DA 1PW3A 3STZA 5D7IE 4OKVA 4ZODA 5C92A 5EWIH 5HYEA 5EC2B 2F58L 2VKWA 4ZTPL 2VN4A 3L5XH 5KTEH 3BVNA 5DUBA 3HR5B 1MY7A 2DI9A 2JCCB 1U8IA 4HIIB 1JHKH 1T0NA 2WUCL 4WW2A 4OZIF 2AK4D 4XCNB 2HFEA 2DQIL 3C5ZC 2FEDD 2C1PA 4GXVL 4ZFGH 5SWQB 2QSTA 1VEMA 4OZFH 1XIWA 4P23A 4OCSH 3NIDE 4XCYA 5DJ0B 5E4EC 4C55A 1VACA 3P2TA 1KXQE 2XWTB 2BNRE 1A7QH 2DYPB 1CDJA 3ZYIA 1ADQA 2CGRL 3FCTA 4UUJB 3CUPA 2PCPA 4ZUWB 1EDQA 4MQXD 1IGYA 1JGEA 4OQTH 3JZ7A 4MCZB 2ZWLT 4NO3B 3MXVL 5EZJA 5D8JH 4KVNH 3ROOA 4DGVL 3IB4A 3SKJL 5FA4B 4F58L 1MHCB 1WF5A 4X5WB 2YS4A 1G7QA 4QGTA 4KKNA 1EX0A 3HFMH 4QRSA 3MLUH 3C08H 1TETH 2RHEA 1G7HA 4LIQE 1T2QH 5GGVY 4WTZA 1AO7D 3QG7L 5JW4M 3HLAB 1FRGH 3HRZB 2B1AL 4PY7A 5D2LE 1TDQA 3MRHA 4DN3L 4RA3A 5IF0A 4FXGA 3C60B 4QLRA 5BJTA 4X6BB 5H94A 3WFBL 1CICD 1A8JH 4JHAL 1BAFH 1F4AA 3ILQD 4YE4H 5KVFH 2R4SH 3U82B 1A6VH 4HKJB 4Y16A 3WO3B 4K7PY 1IEAA 1OW0C 5I1IL 4RBPK 4ODBD 1QQDB 2XOTA 3VFMB 3GFUA 3O9WB 5C0JB 1T7ZA 4L9LA 5D6DA 1A6WL 1A1OA 2W0FB 2XIDA 3GKWH 4KZDH 2MMXA 3QDGE 1CT8A 5C6TL 5TDNA 3C5ZB 2DIBA 3P40A 2DL9A 2UWEA 3RZWA 3IU4H 4LQ1A 3TEUA 3MV7A 5E4EB 4I13B 2FGZA 2NW2B 1EUTA 2H26B 4ZMAT 3VRLE 4NRXA 5IROA 2JTDA 4EDWL 4Z9KB 3BPLB 1P5VA 1XF2B 2FCBA 4FQ2H 4U7SA 4XTRD 5FGBA 3CMGA 3U7AA 3D0LB 4XXCA 1I8MA 3PV7A 3ULVL 4DOHB 2EYRB 2XWJB 2B20A 4BSWB 2HJLB 4FFZL 1V05A 1DVFA 4LSQL 1RJZA 5I1EH 4N0CC 1QSZA 1AD9A 1CFVL 3U4EB 4P48A 3RGVA 5ERWB 3ARDB 1J7VR 2D31A 5T3ZL 3VXUE 4HKBA 1N64H 1MCRA 2YKLL 4Q9CA 1OT2A 3LKOA 1B88A 2ILLA 3HMWL 3MACH 3VXOA 1Q72H 4CMMB 5ADOH 2ZSWB 1VFUA 1K3ZA 1RV6X 1QSEB 4KKAD 3RL1B 4PJ9D 2GK2A 2AXGA 2OI9B 2PXYA 3EYUL 3M1BB 3TO2A 1YEEH 1WK0A 2Q20A 1SMOA 2XTJE 4GKOA 3DMMC 2BVQA 4KUZH 2LABA 1HYSD 4NHUA 4JDZA 3ZKMD 5HHOB 4PD4K 4M7KL 3WIHA 5IB1A 3S36L 1HH9A 1RIUH 3DHMA 3PHOA 5GJSH 2YRPA 4OGYL 5IOPB 1AQDA 1QBAA 3GIVA 1ZHNA 5I18H 4GBXD 3U4AA 1HH6A 3PWPE 3MFFB 3MXWL 2GTZA 2XWBB 5TQ0H 4PJFB 3ZTJG 1VA9A 5FDWA 5JQ6H 1YY8B 5MHSD 3DX8B 1FSKC 1F4YH 3TZVC 2VLME 2IG2L 4P5TD 2VDPL 2COQA 3MR9A 4MDJB 2GHWB 3G5VB 4TVPH 4ZS6C 4RISH 1E6JL 3ARPA 1R5IB 5CEXB 4G8GD 5GGUA 4UAOC 1WZMA 4JPIB 3MOAL 1GZPA 4N68A 5BVJB 4C83A 4G5ZL 4JFEE 2VAJA 4JKKA 4X6DF 3NCYS 4HJ0D 4AIOA 1JWSA 2HVKA 4KXZH 3MO1A 4ONOA 4MQSB 5T1DH 3BISA 2VE6B 1OD7A 4M1CC 1Q1JH 1ZHKA 1FVEA 4ZUUA 1MPAL 2WBWB 3DV4B 4KRMB 3LY6A 2BNUA 3RZCC 4HKZA 1JYNA 5EOTB 4XXDB 3K74B 5FCSH 1TNNA 4TULL 1X44A 2FWOA 4MA8L 5EZLB 2PYED 4LSUL 2Y5EA 2ZUXA 1EGJH 4NBXB 1A3LL 2KH2B 3WNNA 1JGDA 2VQ1B 5DMJB 4JO4H 3QUZB 3BAEH 2D7PA 5IJKC 5IR1B 3EFFA 1WV7T 3PXHA 4AENB 1IGJB 2HRLA 5HDBF 4BYHA 4KKCC 3Q0HA 3VWJA 4EDXB 1GCFA 1X7QB 4JM2A 1DBML 3DBXB 1DUZB 4ZOCA 5EC2A 4GG8A 1Y6NR 3PL6B 1BM3H 3UJTH 1TQCB 4TUJB 5CJQL 2IGFL 2JCCA 4D9RE 1FSKB 4ODTL 3NA9H 1S9WB 2F8XC 1QFPA 4F7PA 1J1PH 5L9DH 3TH4T 4IRZL 1L6ZA 4NKMB 3CDFA 1NCDH 4WEBH 1H3WM 3O2VH 4P2YA 2QL1A 4KKLC 1OAKL 5KSVA 3L95B 1H15A 1G1CA 3F7YB 4JRYD 4Z7UA 2F54D 2EZ0C 3D9AL 4UUJA 2BZDA 4HK3N 4P57B 5HI4D 4UV4H 3RVVD 4PJHB 2K3TA 4NZJA 3I50L 3NGBB 1D6EA 3SGJC 1WISA 2E27H 4P4KB 3ULVE 4H1LH 5DWUH 5C6WH 4I3RH 2VXSL 4LMQI 4X5WA 1M71B 1P4BL 5IUSA 1WBXB 4Z7WA 4MNQD 2ZCLL 3I84A 3RY6C 2MFNA 1YNKL 3PWVB 4XP1L 1VADB 5T3ZE 1IQDB 4AQOA 1RZIB 3WO4C 1UKQA 5HGBA 5DK0A 1SYVB 5F93C 4M3JA 3MX0A 5DD5L 3QEQB 3O41B 3FQNB 4CN1A 3MLRL 4Z6AT 1U92B 4QHLB 3BWAB 3QDHA 2OS7A 2VLRD 4Y2DC 3W39A 1Y18A 1MCOH 4PRHD 2J8UB 2IADA 4ZUVA 5IFJB 4HFWB 1YEIH 1UZ8B 5GRJL 4S1QH 4UQ2B 1YQVL 2DS4A 1F8TH 1CL7H 1PZ5B 3HAEA 4XPHL 2D7TL 1DQJA 2V5SA 3A6BL 1ZANL 3BH9A 4XVTL 1CXEA 4CVXA 1DBAH 3FAXA 5IG7A 3BDBA 3TIDA 2DRUA 1UCTA 3LKQA 4NNPH 1MAMH 5HDQH 4JO1H 3KXFA 3UTPD 4NFBA 4PJXB 4HC1A 4WFFE 4Q9RL 1RD6A 2JCCE 4KVCL 4Y1AD 1QFHA 4NWTH 4WCYL 5F96L 4URTB 3EIFA 3KR3L 4GAFB 1JGLL 3RIAK 2HT4C 3IFNL 4G6AC 5CD3A 5I75C 4NQCD 4M6OH 3QHZL 2BDNL 1MRFL 3U6RA 5B38B 1C5CL 4LP5A 32C2A 2VH5L 5C0AD 4KY1L 4YPGA 3TLRA 3CVIH 1UCBL 3LOWA 1H0DB 1IC5L 3ELAT 2AI0H 3FT3B 3MBXH 3JWDC 3VGAC 4P3DA 5I8KL 5C0CA 2I9LA 2ICES 3KLSA 1Y0LA 2NY1D 1QSEA 1GHFL 1GRWA 1NC4D 4XRCB 3KDMA 1AJ7L 4Y2DB 5K9QG 3MJ6A 3MV11 4OFIA 1YJDC 3M1BA 3WXVH 5IWLC 5DHVB 3C9NB 3O81A 2MHAB 5CHNB 3DOSA 4HGWB 4X9GA 4UTBH 3TYFA 4V1DB 4XZUA 1JGVL 3DUUA 3F58H 4PJGA 5FOBA 2VLJB 5IOPA 3TT3H 3RWFA 4L3EA 1F02I 3B6SB 5DZOA 3AAZB 4LOUD 5CFHA 3QFJB 2VQUA 4ODHH 1YQ2A 2LTQB 4ZFOB 4EJ1C 4HIEB 3WNKA 4JGUA 2WIIA 4XVUC 4OD2A 3ZE1E 3TFKC 3OG6B 5LAXA 3VXTA 3DX8A 1BJ1H 2FB4L 5KG9A 2NYYC 1KC5L 5I75B 3WCYA 3TJHC 3M45A 1EH9A 4MDJA 5JPMA 3BE1L 3O6FC 3HG1B 3LKNB 4LNRB 1MY5A 1DCLA 4LPYA 3CDGB 4WNQB 1MHEB 3GBNL 3NTCL 2VTFA 1RVFL 1NL0L 4DOHE 1FFPA 3IDGA 3VI4E 5CBEB 3BH8A 3KYNA 2ZNWA 3U83A 3VGFA 2APTA 2L0DA 4XNQB 1T2XA 5E2VL 5LQBH 1DSFH 3STLB 4KGJA 4AY0A 1QBML 1MJ7H 5EU6A 5DS8A 5IQ7L 3OKNA 1QKZL 5DURB 3PABB 3GIZH 4E41B 4TOYH 2IF7A 4RFNC 2X4UA 3B2UD 1QHOA 3N0PB 3BQUA 3QUMB 2HH0H 5E8NB 5A1AA 1KSRA 5CWSA 4YHIA 2R23A 4FHBD 1QSEE 2DKSA 3EKCA 1QYGH 1QFWL 3BD3A 5C09D 4YXKH 2VDOL 5DD0L 4EZMA 1EJOH 3RNKA 5IR1A 1JTPA 1LVEA 1QPXA 3ARFD 4RGNC 1IGJA 2YC1B 3BKCH 1RHHB 2H1PL 4EDXA 1CDCA 5DA4A 3TO4C 4LGPB 5ISZB 3GJEA 3KWWA 1EMTL 4QRQB 2RJMA 5HHOE 3CU7A 3L7EA 3EHBD 4RIRB 2VISB 2VDRL 35C8L 3X11A 1I8IA 1Z3GL 4JJ5A 3BKYH 4X6CA 2OBGA 1OAZL 5FA3A 4XPGL 3QDMD 1TZHB 2W59A 4BZYA 3MV9B 3VI3E 4XH2B 4K2UL 3OKMA 3GHBH 2F53B 2X41A 4Q7DA 4OT1H 3F6IA 1RUAH 5L2JB 4PJIB 1BJMA 4FQJL 5I1AB 5EZOH 4PJHA 1KN2L 5IEHB 4OLUL 3FQRB 1B0RA 3DXAA 3RVUC 4YHOH 2CRIA 4K3HA 1SEQL 3B2VL 1TXKA 3QA3A 5D72L 5E0QA 3L3JB 3R1GH 4LK4A 4WW1A 3PWVA 2HFFA 3BPNC 4RMWA 4Z7QE 1UACH 3P73B 4UI2A 1BJ8A 1FYTB 3UTZA 2A6JA 2VWEC 1SYVA 2DLIA 4RFNB 3MRGB 2R0KH 1H8NA 4BH8B 4IDJL 3M17B 5DT1L 3MCKA 3WKML 4MXVE 3D2UB 3SPVB 4N5ED 4LIQH 5EU6E 3CVHB 3RUGA 1LMKA 2I27N 1MWAA 1MAKA 3TO4B 4ZD3L 5D5MB 2X4RA 1AXTL 5A3IC 4JQVC 1UZ8A 1L0XA 4FMKA 2VZ1A 5I15H 4LLUB 3VA6A 1C5BH 4F7TB 1KIQB 5C9JB 2FJGB 1PZ5A 3GI8H 4UU9B 3WFEL 2AEQH 3X17A 2GUOB 4JB9L 3RHWK 4X7EC 4U0RC 3ROLB 4B5EA 5FYJL 4CDHA 3S6CA 3L3OA 3L5WA 4M1DL 4X80L 43C9B 1RUKL 4PJXA 4YLQT 3H9HB 4KROD 5SWSD 4ZFOL 4HSQA 3VXRD 2DQHL 4I0PD 2NZ9D 3O2DH 2AS5M 1FV1B 5E5RB 4HLJA 1I9RL 3AREA 3TPUA 3F8UB 4NRYA 2D7QA 1WFUA 3O8XC 3D18A 5EBMB 2A6IB 2Z93A 5ID1B 4GW4A 1B0GA 5L2KA 3ZT6A 4AL8L 4JO3L 3BPNB 1E4KA 2VABB 1ZT1A 3SY0A 1D3CA 4PJHE 3MRPB 1RZKH 3AS0A 5HHXH 3LVEA 4R2GC 4DKFL 4RFOL 3DXAE 5I0ZA 3JWDL 2X70A 2IFFH 1BBDL 1LO4H 5B3JE 4R3SB 2CD0A 5EU5A 1ADQH 5ITBH 1G7LB 4K9EC 3U0PB 1MFBL 1UZ6F 4XC3L 5J6HB 1A7NH 1YJDL 1TMCB 4HBQA 4FQHB 1K2DA 1BQSA 1Z9OA 1LEKB 4YHPB 5A16A 1OAXH 1CR9H 4X6FB 3QEQE 2ATPA 2YUVA 1P6AB 4XVSL 1JPSH 5H2BB 1YNTA 2HRPL 2F5AH 3LRSA 4PGBB 3QUML 3T4AA 2YUZA 1FLRL 4KK9D 5CHNA 5IFHH 2ZCHL 1F2XK 2VLLB 3GBML 4GMSL 5CMAB 5D7IF 4KTEL 1HIML 5BZDB 4U0RB 4RNRA 4XAWH 5JA9A 1ZT4A 4R90H 1I9EA 4PJ7B 3D6GA 2BVOA 5C8JB 1NFKA 4XMKL 2BOCB 2EO9A 1PEWA 5DEGB 3AAZA 5JO5B 2CMRH 1SMAA 1CN4A 2BOBB 3DIFA 1OSZB 1RZ7H 3VFSB 1GGBH 3JV6B 3ZKNC 3NIDF 4MA3A 4WFGE 3AUVA 5I73C 5GGRB 2HTLC 1RZJC 4JRXD 1IAIH 2G75B 3BIBX 5ITFB 4PJXE 2FX9L 3WBDA 3QUXC 5HYQB 3C6SA 5JPNA 1MCDA 3MZTA 2HMID 3IAQA 1FVDB 4HZLB 3CDGA 3OGCB 4KRPD 4WNQA 2W9EH 5HHNB 3S88L 3WLWC 2P44B 3FT4B 1MUJB 3T0EC 3IDNA 4P0DA 1SEBB 2X05A 2IAMD 4NQXA 2OQJA 3BT2L 4WHYG 2WM0A 3LHPL 3S37L 5DXWA 5HGHA 2HFTA 2VUYA 4NOBA 1J87A 3WDJA 2MCPL 4XNUH 4TQEH 1WLHA 4OF3A 2XNAA 4BFEA 5D2LF 1HXYA 1AO7B 5D7SL 5F7EH 3OAZH 4K3EL 4S11A 4R0LB 1ITCA 3QHFL 5IJVB 3ARYA 1CD8A 4RMUA 3CFKA 5DQJA 1CICB 3D25B 1FORH 4NZRH 1OOAA 3GSQA 3I6LD 1V3MA 3QO1A 4M5ZL 1A02N 1CDGA 4WO4A 3QIUA 1KGCE 3MCG1 4L3AA 1YN6B 4V1DE 3AU1B 3IFLH 2DM3A 5K33A 3U7WH 5KSAA 5EUKA 4M03A 5F7MC 2YD6A 2VLJE 4OLEA 4I2XB 5LBSH 4Y7MA 5JOFA 4YHKH 2YD3A 5EIIA 5AD0B 3B5HA 3G6JA 4M5YH 3QUXB 1NUFA 4GRMB 3QFJE 1K8IB 2L4OA 1VPOH 3WIHH 2FJHB 2MPAL 3O3EB 4ZOEA 1TJIH 1XF3A 5DRWB 1EHAA 1LILA 5I1AA 3T0EB 5IEHA 3LB6C 5BMFL 2HA1A 2X1PA 2BY3A 2ED9A 3W0WA 5JUEH 3HC3L 3T2OA 1WJ3A 5FO9A 3HG1E 4OM0L 4RWHA 1UH4A 2WP3O 1VENA 3MRNB 4JANB 1CQKA 4HJGB 4I18C 1IM3B 1HSAA 1RJCA 2ICWB 3EJZC 5GGTA 3Q1SL 1F90L 1JMZA 4Y4KC 1GPOL 3MRGA 5EO9A 1PYWB 2A73B 1MI5B 4JGJA 4AT6B 5E6IC 4LASH 4GAYB 5TE7H 1VDGA 3O6LL 1LD9A 2DD8H 4PJ9B 1RK1B 2CK0L 1MLBB 3CVHA 2N1KA 4LSPL 4HLZH 3FO0L 4E41E 4NM8L 4D2NA 4PLJC 5CEZL 4A2MA 5DUPH 5F1IB 4CADA 5D5MA 2EH8H 4XP9H 3TA3A 3RNQA 3FOLA 4LLUA 4MNHB 4OM1L 1KIQA 5C9JA 4Z78A 4JKWA 1EHNA 1MCNA 1PLGL 1OTTD 2Q3AA 4X4YA 4LAJH 3BYYA 4GBXB 3MRLA 3O2WL 1PQZB 3FB6B 2P47B 5GHWL 5ISZE 3VXMA 4UILL 1GOGA 2XQBH 4YR6A 4GKSA 4PG9B 4MLSA 3R0MA 4J3OC 4OF8A 1BQLH 2QTEA 4GRLD 3B9KD 3MV9E 3HN3A 3IDJB 4NFDA 3GNMH 3JSSA 2BRQA 2IH3B 3ILPA 2F53E 2EC9U 4PJ5B 1FZMB 3L3GB 1B9ZA 1QNZH 1H3PL 1KELL 2VABA 4PJIE 3V5KB 4L3CA 2QQLH 1A6PA 3I6KA 1CLOL 5IBLD 3QNXA 4WV1B 4WI9A 3EYVB 1CWVA 3MBEC 5K9JH 4ZOAA 5C08B 1CGUA 1GIGL 5I0DA 1S9YA 4HWNA 4LSSL 4LGSB 3QZWG 1MH5B 1Q8MA 1VESA 1G7LA 2QKIB 4TPRH 1OGAA 1GGUA 3I75A 4QHKI 2EDFA 2HN7B 1AGDB 3QEHA 1FYTE 4KDVA 4ZFZB 5T3XH 4MWFA 3ULUC 5IVNA 2Z8WC 1IAKB 3QXAB 4NKIL 2AJSH 4W4OA 5E7FA 3LEVH 3U30C 4B7IA 4PGBA 3BSZH 1R3IH 2ORBH 1OAQH 2BJMH 4PUBH 2MOVA 5BZDA 2APFA 4N5UA 4S1SH 5C8JA 3HB3C 3PF2A 5D5ME 3G04B 3QJHB 2CO6B 4DGIL 5TFSH 1U8LA 1QEWB 1VSCA 5GS1B 5M95B 4WTWA 2XQYK 5DGQA 2AK4A 2WBJC 1RZJL 3HC0A 1FL5A 4U1GC 2Y25A 5KW9L 5I16B 3SGDI 3UBXG 3MLVH 4FZ8H 1UQSB 2BNQB 5C71A 2PETA 1GOFA 2R8SL 5ITFA 5B8CC 4YGVA 3O45A 2B2XL 4JRYB 2IQAB 5HHVH 4U6HA 1Y6MR 3HAEH 3P4MA 1MCWM 3MA9L 4S2SA 3VWKC 4OGAD 3C8HA 3C87A 1V7NH 4PJCA 3H3KA 3GRWL 5D2NA 1HKLL 4HC1H 5F88A 2UVFA 3L7FA 4U1KA 5GZOC 1KPUB 3MNWA 5E03A 2VXQH 1GZQA 4UTAH 2OSLB 5DSCA 3P30L 4XPAH 5GQBA 3SE3C 3LPFA 3HNVL 4RGOL 4Z5RA 2LQRA 1AO7A 1U93A 2Q7NA 3NH7H 1QLFA 5HDLA 2NY4C 4R0LA 4LRNL 5IJVA 4XPFL 3KPMA 2CUIA 4M7JH 5EOCJ 4UT6L 4IIQC