3LEXB

2f5 epitope scaffold elicited anti-hiv-1 monoclonal antibody 11f10 in complex with hiv-1 gp41
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLASGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPWTFGGYTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 11f10 Antibody Heavy Chain
total genus 50
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lexB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lexB01
1T5XA 1HWHB 4C56E 1FG2B 4I3RL 3H9ZA 3TH4T 2NY5H 1EUUA 4PTUA 1U8KA 3WMSA 4X6FB 3UPCA 2HJLA 4X99A 3OF6D 4OZGB 5DD1L 5EO9B 5IM7B 5KBNC 3U4AA 4BK4A 5E8DL 4OZIF 1S7UA 5EC1A 2DTML 1SBSH 4KKLC 1X5JA 3GKZA 2VDQL 4KDTA 4A2MA 3TCLB 4N0CD 3MRKA 1JHKH 1CICD 5BRZD 3F62A 3L3DA 4ZSOA 1YJDC 3QHZH 4PJBE 4Y8DC 1CGUA 3FAWA 3H9YA 3MREB 1K4CA 1OGAB 2AQ3A 3DVNB 4LVNB 4EN3B 2ENSA 2VZ3A 1QOKA 2CUMA 4L5FL 4MNHB 1TVBA 3FTGA 4QRPB 5CJXA 1ZANH 2VLKB 4XHJD 5IBUG 1HZHH 4KKLD 3QQ9C 2IPKB 2X10A 3RWJA 2CDEB 2YPLD 4GRLD 3UX9B 4MA3A 4WDIA 4EUPB 1HIML 3HNTL 3LRHA 4N0FB 5AAWA 4IRSA 1GIGH 1RZ7L 2R4SH 3NN8B 4ZUSB 1BX2B 1RZIB 1IBGH 3ZYOA 1RULL 3OR6B 3OG6B 3OKDB 1XGTB 3BI9X 2QQLH 2D2OA 1IC4L 4AZ8A 1KG0B 5E9DB 2XKUA 4P0DA 1J0ZA 3FB6A 5EN2B 3QEQE 1FPTH 1JGDA 1V7MH 1F8TH 1MOEA 3AC0A 1NFDF 4HK3J 1Q94A 2DQHH 4RWYH 3BVNB 4ESKA 5CWSA 5DHVB 4MB4A 4QHKI 1JP5A 2F19L 4HS6B 3NIGF 4QKXB 4NM4H 3WFCL 4PLKD 4KUZH 3GDBA 5E4IA 3RIFK 2BNRD 4FG6C 3MNVA 3GSVB 2BVOA 2D7QA 3HS0A 2GK0A 3GKWH 4MXWL 5EU3A 2FLRT 1RULH 2FX7H 3KPRE 3L3KA 2CIKB 4FTVB 5GZND 1M7DB 1IEBA 1LNUA 4IRSD 5I18L 4GQ9L 1WC7A 5HHOE 2Y6SC 3B9KC 3N9GH 3AUVA 4XRCB 3RVXD 3ARBC 3CDCA 1H3TA 4QRQA 1EMTH 2VDNL 2UWEA 3O6FD 5F3BB 4K3GA 1ZVHA 4OBRA 1BQLH 3T4AB 3TFKC 1U2CA 4YAQB 1KN2H 1FGNL 3HI1B 6FABH 5IBLC 2PTTA 4W4NA 5EORH 1MHPL 3I6KA 1U6AL 1AQDB 1YPZA 3WO3B 3FRUA 4M7JL 3W82A 3HFMH 3MV7A 4N0UE 3TYFA 3CFBB 3B9KD 4XH2B 3RGVB 2D0HA 5GS2D 5I1HH 5F1IA 2QSQA 1N8ZA 1RZKL 1Y6MR 2FYYB 3FB5B 4HGWB 4Y5XB 3OGOE 3QR2A 3ARYA 4GRMB 4U31A 4FOMA 5C6WH 2J88L 1QSFD 4PJ8C 1S7RB 1UYWH 4PRIB 4CMMA 1K4CB 1Q72H 1U8MA 1ZT1A 4RISH 2N7AA 5DJAB 3MXWL 3U79A 1OAKL 2GJZA 2FATH 5IBTH 5F7LB 2W9DH 3GJEB 3NGBB 1HXMB 3M8OH 1MCJA 5D2LA 3T0AA 1U8LB 2ZOKA 3UJIH 1N7ML 2OJZL 1T2JA 4M02A 5ENWB 4ENED 4IIQC 4YQXL 5I8EB 3VXQA 1OB1B 1VACB 5CGTA 4YO0B 1MVUA 4IDLA 3WHE0 3B6SA 4G6AC 1H15B 1HCFX 1G1CA 5J57B 3TVMA 2GUOB 4NKDA 3PV6A 3IDJA 1MQ8A 2BVYA 2G9HA 2Z91A 4LPTA 3ILQD 1G6VK 1N0LA 3EOAA 3QIUD 1RZKC 3K8LA 1OAZL 2OYPA 1A7QH 1IILE 1EHLL 4ETQB 1A6WL 2ZUWA 3BP7A 1MJ8L 4F33A 3UYRH 2EIZA 2BC4A 1A9BB 1V3LA 2DQEH 1CGVA 1FH5H 3RZCC 4Q74A 4UTAH 3V6ZB 4ZAKA 2YK1H 3DRTB 3SE4A 5FYLL 4AJ0A 1C5DB 3U9PL 3QQ3A 3K0WA 3N06B 2H9GB 2OJEA 2GEEA 4F57L 5E2TH 1AD9A 4G9DB 3KPSE 4NNPH 1TJGL 1N6QH 1JGUH 2BDNH 1WZ1H 2V2WB 5FXCH 1FG9C 3CDGB 1T2XA 3P30L 3U1SL 4YHIB 5EN2A 3OSKA 4ZFGH 1YN7B 2JIXA 2X4NB 3U36B 2NXZC 1MFAL 4F7TA 1HHHB 4M4RA 3RTQD 4K7PX 1RZJL 5M7QA 1MREH 4GKZB 3NFPA 5FO8A 3L95A 4QHNB 3EYFA 5DD5H 3JV4B 3BN9D 3WNPA 1CLOL 1W0WB 2D03L 4A6YB 3H3BC 5H8DA 4EUPA 4PJCB 5C2BH 5D7LA 5C09D 2CLVB 4YPJA 1X5AA 2VQTA 1FQ9C 4R90L 5T5FH 5LBSL 4X5WB 5D2LE 4LLWB 4OCXL 5EUOE 1T03H 2DWDB 4Y2DA 3WS3B 1FN4B 3G5YB 3MV9D 3UTSB 3SDDB 3DROA 3MOAH 3ZT6A 2VUYA 1MI5E 1N4XH 1UENA 3O2VL 5CUSL 4QWWC 5IMOB 2B4CH 2VDPH 3IAQA 4MA7H 3GGWA 3UAJC 4AEEA 5ISZA 1BLNA 4WI4A 3EYOA 4H1LG 3IRPX 4E0RB 5IV2B 3IU4L 3O4LA 1JNJA 4ZPTB 1CVRA 4XGZB 3ULUH 4X7FC 5FYJL 1Q0YL 2DTSA 4I9WE 3NA4A 4UIMA 4HMEA 3WLBB 5HHNA 1RJYA 3F5WB 2VLJB 4HJGA 2MMXA 2VXSH 4D9LH 4QNPF 3VGDA 2OTWB 3RWJB 3WIHH 4GSDL 4LLYB 4QWWD 2PYEA 4JHBA 2A73B 2ICWI 2COQA 1A0QH 4MXVE 1UZ6E 2PR4H 2QKIA 2VDPL 4X7SH 2JLLA 1EGJA 4GAFB 5J11B 3OPZL 5DC9B 2RHEA 1KJMA 1CIUA 2MTPA 5FK9A 4CRPA 5BOPA 3D6GA 2YXFA 4HQQH 4LLVA 4OI9A 4EI5D 5E2VH 1G7LA 3T2NL 1LEGA 2R23A 1U3YA 3P11L 2X4QB 1JJUA 4G6KL 2R4RL 32C2B 1YECH 1TQBC 2J6EA 4N9GB 4BQ9A 3KPRD 4UDUB 3TA3C 4NUGH 1KXTB 4JM2F 3DO3A 3DYMA 3FQNA 1OQOA 5IIEB 3SDAC 3PWVB 3QEUA 4PB9H 2PXYB 2ZCLH 2PN5A 4LASH 5GS0L 2W91A 5I76B 3VXMD 5DMYA 4ZYKA 1WC7B 4F15B 3MLSL 1HSBA 2EDHA 1XGUB 5CBEA 3WDJA 2AJUH 4RFNC 2AERT 1UVQB 3MBXL 1U8LA 2ZOKB 3SKJH 2OR8A 3CH1A 4YDKL 1FH5L 4M62L 5TQ0H 1YDPA 2P7TA 4YGVA 5HPOA 4MAYA 5L6YL 2OI9C 1NGZB 4KJPC 2XZAH 3CGTA 1C5DA 2NXYD 3VG0H 4HUNB 2B1HL 3CVIH 4UAOB 3HC0A 2E6JA 3TYFB 1I9RL 3QO0B 2IMNA 4K55A 1P5UA 3MCLL 2YPVL 3KYKL 5GS3A 5KVFL 4LBEA 2Q76A 3BWAA 4JY4B 1YYML 4HGWA 4NN6B 3RPKA 5CJ8A 4LKCB 1HK6A 3D39B 5F6IB 1J86A 5HHQB 4X4MA 3JTSB 5DFWH 3CXHK 1FFNA 3HRPA 4LSSL 3U7YH 5K59F 3EYOB 2VC2H 4E0RA 2GAZB 2FX9L 4ZDHA 3O6ML 4KTDH 2J1KA 2H1PH 3BZ4B 5IVXE 1KXVC 1UH3A 4X9IA 2AKRB 3AU1B 3IKCA 3BGAA 2XXCB 5EU6D 3HMXA 1KNOB 2V2WA 3CDFA 2HT3C 1U3HC 4PV9B 2XNAB 5JW5B 3SBWA 4XWOC 2VDRH 1EJOL 4O2CB 4WHCA 4X6EA 5KN5A 1ITBB 2W60A 1AJ7H 3MLXL 5IMOA 3S35H 4PGBB 4JGJA 2C3HA 2JJSA 3LB6C 4L8SC 1C7TA 1KCUH 1RFDH 3D87B 1FZMB 4GKZA 4JRXB 5CJOL 1F4WH 2R1WA 3E6FA 3R0NA 3S36X 3QULB 1EX0A 4WFFE 1MI5D 4HK3N 3HG1D 5GJTL 1S9WB 2ESVB 3QDGE 4GG8A 4P99A 4KY1L 5D7LB 5TE6L 1G7JA 1PYWB 4IRZH 1HYSD 3MBEC 1KTLB 2OL3A 3FMGH 2R23B 3AROA 2IBBA 2VXSL 4D9LL 2FX8L 3OXRA 1JYVA 1RSFA 1QBBA 3TVMC 4XH2A 3RGVA 3C5ZC 4LHQB 1MHEB 4YEFA 4AH2B 2KL6A 4AIXA 4DGIH 2I07B 5GSRA 5DD0L 3D25A 3O9WD 4D9RD 2DM4A 3LDBC 1TJHL 4RGOH 4LMQE 1NGXB 4IOIB 4ZUVA 3BD5A 3IDJB 3BPOC 1QKZL 5D1QD 3G04A 3ZDXE 5I8CB 3RA7H 4F58L 1YEEL 4JN1L 3KWWB 1WSST 4OCSL 2Y07H 4XPGL 4FQIL 5IEHB 4WUKH 5HYEA 5I6XB 4J3VA 1MHCA 4OCXH 4ONHB 5L9DL 3MRNA 1ZLUH 3W2DL 2ZSVB 3MLRL 2BC4B 1PY4A 3FONB 3O9WC 1KCRL 3O11A 4P46D 4JZJA 4ZFZA 1CD0A 2NPLX 2X41A 1RAMA 4LMQI 3DXAA 1RUKL 1MFAH 4TUOB 4W6WB 1IC5H 2APFA 2HLFC 4PJ9D 4MJ4A 2VSCA 5IFJB 3RP1A 4MS8D 1FZKA 2WWKO 3L3OA 3PV6B 3IDGA 3QB7C 1NQBA 1CBVH 2F53A 5CSBA 4ZODA 3H7BA 2XOTA 4TULL 2D7TL 4M5YL 1TVHA 2UUDH 3BUYA 3EHBD 1WAAE 1XEDA 2A6KB 5ABDE 3EFDL 3NABL 5D1QA 1FFOB 2GYSA 2NX5A 4LQFH 2BY3A 2AEPH 4AMKL 5K9OA 4PRAB 3D2UD 1XR8B 4Z0BH 1OP9A 2P5WD 4L4JA 3RZCD 1BBDL 3JV4A 5HYQB 4J4PA 1G7QB 4A6YA 1S78D 1TCRB 2AXFA 4XZUA 3F7RA 4RWYL 2X4SB 1BJ8A 1WT5C 3J8F7 5IK3A 1YEGH 4K7PL 3FQNB 3MGOB 5IIEA 4Y4KD 2ED7A 1UJTA 1NCAH 1YEHL 3KS0H 2KPNA 3GB7A 1I8IB 4FQXD 3NGBC 2C5DC 3CDGA 5F7NC 2LU3A 3QFDA 5L2JB 1FNLA 3EFDH 2APWA 3LOWA 4LFHG 2Q20A 3MV7D 1B0WA 1LD9B 4JPWL 4JPKH 3SGEI 3VXUB 1OW0A 1J8KA 1IGYB 3LQAL 1REIA 2XT1B 1HQRA 4YBLB 2NY7H 5JHDB 1PG7W 4WWKC 1NGQL 4WO4D 4RSVA 2YEZB 3MRRB 1DBJH 5JW4R 3MLVL 1EXUA 9CGTA 5IB3B 4M6OL 4LLYA 4ZNEA 4LK4A 2DI8A 5SX4I 1DP0A 4CDHA 1WQVT 4N1HB 5IQ9B 3JTSA 3QPQC 5C92A 4R97C 2MFNA 1T66C 3M17B 3GHEH 3GJFK 2I9LA 1EZVY 4P4KD 1YEEH 2IPUK 3EZ8A 5A2FA 3X14B 3IDUA 4M8VA 3TM6A 3SDAD 2F5BH 3WLBA 5E7FA 4FFZL 4X8XA 4URTB 4WTXA 3MBEA 4OLZH 4DOHE 4L29B 2EIBA 3AAZA 4WCYH 3TYGL 2HFGL 2VDNH 4L9LC 2BNQB 1BFVH 3DV4A 2VJXA 4PJAA 2ZCHH 2DWEB 5ESVA 1OARH 4HIXL 4OFYD 4P5KB 5IEKB 1P4BH 3DRQB 4GW5B 1RMFH 2VAJA 3BDYH 3QHTC 3FFCE 4XMPL 3RA7L 5FGCB 4YC2B 2FBJL 2UV3A 4MJIB 2BRRH 1NCCH 4WUKL 4JFOA 3PQYB 3QWOA 2FX7L 4P3WA 4HKZA 5TQ2H 1NGQH 2ZUUA 4M7KL 2IPKA 3N1PC 5BV7B 2VXUH 4Z0BL 4XBGA 3HMXH 2QQNL 2OZ4A 3V6FB 3KR3H 4MX7B 5GZOC 5AWNH 1BFVL 4Y2OA 3WLWC 4IIQB 3GBML 5J9PB 4NM8L 4G6JH 4FQJL 4XNXL 2YUZA 4ODXA 2ERJB 4Y4HA 3C09C 1A4KB 4QXTB 4WHTB 4JFEA 4TSCL 4UBDD 3OKNB 1ZV5A 3WNKA 3QDJB 3QHFL 1JYNA 3VFVA 4OQTA 1TLKA 3TZVA 1SY6L 1JHLH 5AG8A 2CRZA 2AJ3A 4ELME 2XZQH 1RJZB 4PUBL 4JEGB 2DS4A 3N1QC 2GSGA 3P9LA 3L5XH 1A6TA 4YDJA 1V5JA 4M1CD 2LAAA 1UZ8A 1CGXA 4MAYB 1CE1H 4NBXB 3MNVB 5E8OB 3B43A 4DTGH 4MQXD 3UTSE 3TH3T 4LEXH 2QQKL 3CFJB 3K2UL 4L3EE 5DMJB 5I1AB 3VD5A 2VLKE 3VDBA 4YE4H 3WSQH 3MGTA 5FUOL 3QUMA 1QO3B 1VERA 3WUWG 2A9ML 4P3DB 5F96H 2DRUA 5C0DB 2X7LA 4LKCA 2BNRA 3ARBB 2XYCA 3DGCR 2EO1A 2VDQH 3SDDC 4JREB 4YHKH 4H20L 1AY1H 5DYOB 5IG7B 2ORBH 4JKKA 3C2AL 2CMRL 3I6GA 4FABL 2ATKA 1IGJA 4UIKH 2X4SA 4N5EC 2V17L 3WO4C 3GHBH 5DXWA 2Q87A 2VLKA 4QGYA 1IARB 5D7IA 3U0PB 4E42B 4OCLC 4PGDB 3VI4F 1J1PH 1HH9B 4F58H 1RVFL 5TDNB 1K9TA 5FF6B 1U3ZA 4PS4L 5LGJB 1J0JA 4CGTA 1WFNA 4I0PA 3LS4L 2H8PB 3EW3B 3T2PA 2E7LC 4FS0A 1I3VA 1MCEA 3FO2B 3L3DB 4ZSOB 1QSED 5ICXA 2BNUA 3WDIA 2ZKHL 5DJAA 1DDHB 1YQVL 2H32A 2O61A 1NUDA 1TZGL 4UOW0 3DUSB 3UTTD 2DMKA 1T03L 4U6HB 2VTFA 3CXHJ 1T22B 2DMBA 3KPRA 5LCVH 4U1NA 3D1MC 5CJBA 5F1SA 1DQMH 4OZGA 1I9JL 2ID5A 4Y4KB 5EO0A 2VITB 4ZFZB 4JRYB 5EOTB 1XF3B 4Z7NF 4DAGL 4WWID 1S7QA 3VFUB 4AIZA 1RZJH 1YYLL 5MI0B 4E41A 5AUMB 4G6KH 3O4OC 1KLGB 4KK8C 3M17A 5JR1H 3WFBH 4KRLB 4TPRH 2Y07L 1MY5A 3GIZL 3EOYG 2C4XA 4R3SB 3GSQB 2B1HH 3CVIL 3T04D 4C83A 3QA3A 4RBPK 1CDBA 2M8XA 4Z5RB 5L7XL 3MRJA 4NKOA 1NC4B 3V52L 3DGGA 1XF1A 1WBXB 4WFGD 5ETUB 1CWVA 1KEMH 4PRDB 5F7MC 4KMQA 5GGRA 3V6ZA 3GIVA 3MLTA 4NN7B 4UINH 4KZDH 1U8NA 4HEPG 12E8L 2AXFB 4XZUB 1IGYA 1BZ9B 1MLBB 3IDIB 5D1XA 3U46A 2HVJA 3ARGA 2XICA 2BVOB 1M71A 4NIKB 2ARWA 1W0YT 4KQ4H 4N0YL 1ACYL 1BOGA 1C16A 4WFHD 4ODUA 2IFFH 1LE5B 3TPUB 5E24E 5T1LB 1E27B 4JFOB 4YR6B 1RZGA 4GRMA 5DHYA 5IW6A 4E5XA 1ZA3B 1P7QA 1NUGA 2Y6SD 1FFOA 1DQDH 4RAUA 1U8MB 4B0MM 2G60L 4IRJC 3F65A 3CMOH 4GG6E 3I50H 2Q3AA 2WWMC 2ZNWA 4TVPE 2B2XH 2XTJC 2X9XA 2BNQD 2P5ED 3QNZB 4Y4KC 3EGSB 4GAGL 2VAAA 2FATL 1FL5A 4YHOH 5HHOB 4UNVA 1R5IA 1ZT7B 3DROB 3K8MA 3GB7B 1SYSA 1VACA 1IZJA 3GSUA 1W0VB 4C56A 1KCVH 2FCBA 5C86A 5CILL 4NNYB 3EBAA 4HT1H 1OW0C 4OZGE 3FQXB 5DUPH 5AG9A 5D7SH 3PGFH 1UGNA 3HZYB 1DQDL 1S7UB 2VDOH 4JREC 3MJ9L 5D6CA 4MVBD 3MJ8A 3S4SG 3X3FH 4R26H 2CJUH 4B50A 5IVNA 4U6VL 2GFBB 2ZSWA 3QWOB 2IALA 1WUNT 2YPVH 3KYKH 4PJHE 3LN9A 1EJ6A 4RX4A 5ESAA 2H3NA 4KVNH 4J6RH 3IU3B 2XACC 3HC4H 4JZOA 1Z2KA 2WUBL 2BMKA 5F1IB 4OM0H 1YY8B 5IHLB 2X7LB 1FYHB 5DF0A 5ESVB 1PX3A 3F12B 4FQLH 2AV7B 3F6LA 3MLUH 2XWBA 3C6LC 4Z9KB 4X7DC 2DD8L 1KLGA 1JF1A 4JFEE 2QQNH 4JFEB 4XP4H 5DYOA 1QSFA 3C6SA 4XCCH 4MJIE 2D7NA 4GRWB 5CGYD 5MEPB 5E99L 5BVPH 4ETQA 1Q38A 3NZHL 4JY5H 4UMGA 4PJ8A 1HHIA 3IDXH 1MHPH 1S3KH 3NA9L 1AGBB 4UB0L 4F8QA 2X4QA 3ULUL 1A6TB 3MTRA 3NTCL 5F1NA 1TJIL 4AIZB 1HQ4B 1I7ZA 4NZTL 2J8OA 3QUYB 2FR4B 3PIQB 1CE6B 1QBML 2JELH 5JNYB 4NQSA 5IMMB 5FCUH 4XHJC 2ICWA 4RISL 3AMKA 3QDJE 3TA3D 3T1WA 1X5YA 3QZWA 4MCYB 1MJ7H 3QUXD 4I3SH 2OK0H 4PRID 1OTSC 3SGKC 3RVWD 3GSXA 4Y4KA 3OKEB 5B39G 5ACMA 1VGEH 5C0JB 4NM8H 5IV2A 1IGFH 2HP4A 4O2FB 4J1UB 5FYKU 1WFTA 4NN6C 5IESL 1V7NL 4WGWB 5I71C 1VHPA 4XNQA 3SJVA 3BGMB 2D9QB 1DBML 5DR5L 1KC5L 1UACH 4CN4A 3U4EA 5JLZA 1JTTA 3MV11 4V2BA 4E42A 4PJFE 3QXAA 2WMPA 2XRAH 3PABA 1NCCL 5IF0A 3L3IB 1W0VA 3EYSL 4WUUD 5DRXB 1FDLH 1J0IA 4K8RL 3CFBA 1F45A 4K94L 4JPVL 1A2YA 5IT2H 1ZA3A 5JZ7D 4N8VA 2I24N 3JBG7 1UM4L 4KV5F 1UWEH 5E8DH 3GBMH 4W6YB 2YMXL 3RX7A 3LKRB 4LHJB 1R0AL 4LGSB 1AGDB 5DD3H 5GJSH 5H2BA 5IJKA 3DYOA 3ZL4L 4LSRH 3CSYA 3DVGB 4G43A 3ZKXC 2C3GA 1Q9LB 1INDL 2VAAB 1JWSB 1KTKE 4PRPA 2CQVA 3GI9H 1KJVB 3O6FC 3BP5B 5FYLD 3P0VH 3ZSTA 4C54A 4NPYA 1DJSA 5CD3A 4TVPD 5TE4L 2WP3O 4HWUA 1BBDH 2OK0L 1YMHB 4G6FB 3QUYC 4NOFA 3UTQB 3OBAA 1MIML 4Z7WA 1E4WH 4F7CB 2IAMB 3OAYH 4HS3A 3VGGA 1G84A 3K46A 3KYNB 5IBLD 2EDRA 1BPVA 4GKNA 1CFSB 5F7EH 2JJSC 1O0VA 3O3DA 4X8JA 5EZLB 1Y18B 4IJ3C 4PJAF 4NQCB 2DLHA 3PWUB 3OZ9L 2GT9A 3TO2A 5GS1C 4G80B 2BMKB 1XF3A 4LSUH 1F02I 2XI9A 1S5HA 2B5IC 4KDWA 1WAAF 4UZGA 3OGCB 2EIZB 4NO2B 3VI3F 4PRHE 2OXHA 2X44D 2FJHA 3AY4A 2EKSB 2J4WL 1KLFA 4WI8A 1SJVA 5H37G 1ZANL 4G8EB 2VXQL 1RIHH 3V4UL 4GW1B 5E08H 5IFHH 2OSLB 4GMSH 4JFDB 1J8HD 3O6FA 3HI6H 4ZUUB 3WNLA 2V5YA 3GSQA 1LDPH 4M61A 4TOYL 3EOTH 5CEYA 4BUGA 5ICZA 2EE6A 1T83C 3LV3B 2CLZA 5JIKA 1U92B 2H3NB 4NQEE 2ZSVA 2FD6H 1OVZA 1WV7T 4LCUB 2A74B 3UTOA 3FQRB 5IESH 3PGCA 3GBNL 4CNIA 3IAGC 2PCPB 2ARJA 5DUBB 2QEJA 4ZG1A 2DTMH 4L8BA 3ESUF 3RFZC 3KLHD 3NACL 4HS8H 4LF3B 3EO1A 3QUZA 5E1HB 3SJVE 3EYFB 1YEJH 3ARZA 2AK1L 4GUPB 4KMTH 4F2MA 3ILQC 1QLFA 1FIEA 5GS1A 4PJDB 3PHOB 4OJFL 3PF2A 4HGKC 4XP9H 4K07A 1IL1B 3VXMA 3WJJC 4MCYA 2WBJD 2ADGB 2NNAB 5B39A 1EHAA 3FQXA 3SO5A 4HHAA 3CH1B 4GXVL 5MEND 2DIAA 1S7WA 3ZKNC 2EYRB 3O81A 1JGLH 4I18C 4MA1B 2AEPL 4AMKH 5A40E 4X7TA 1ACYH 3EHBC 3TIEA 2YA0A 5DRWA 3NCMA 4NQDD 3MUY1 3O9WB 4BFEA 2OXGA 3BPLB 3MUJA 1A6PA 1IGCH 5AZEH 4ZO7A 3WJLC 4K71B 2VYRE 3WFDL 5FHAH 2YPLE 1EFQA 4JJ5A 4MB5A 1K4DA 4LEOB 5ADOH 1YJDH 4LHUD 3VXSB 4C4KT 4JRXA 3IAPA 2P8PA 2DDQL 3LCYA 2VLKD 1H3PL 1T1ZB 4S2SB 4K8RD 1OGTA 3RIAF 1VKXB 3NTCH 3EYUH 3NIDE 4GKNB 4HC1L 4MSWA 3LB6D 1LD9A 3HC3H 1KYOK 2DLIA 5CLTA 2OS7A 3V0AC 3S97C 4OB5L 1RUAL 5IEHA 4U3CA 4N0YH 4NQEA 3V5KA 4WHDA 3QWRD 2XNAA 4QCIA 5T1KB 3VRIB 1JV5A 4JY6B 5DFTA 3DUUB 4GAJL 5TF1H 2V9QA 2PW1B 3NA9H 3WKNA 5J0BA 1G9NH 5A16B 3VWJD 3B2UC 1LO0H 5I1EL 3RNKA 3ARDB 1QA9A 1UQSA 5DFVD 3MBXH 4J4PC 3SKJL 1LK3L 4ODBD 1MVFA 2CRMA 3BIKA 1CL7L 1DQQB 4KU1A 1EEUA 4PP2B 4HUWB 2CR6A 5D1QC 2A9NL 4QOKB 3V4PH 4HMDA 2JELL 2V2TB 1MHHA 5GS2H 2A6JB 3RWHB 4Z0XB 4K3DL 2OTUB 4CNIB 2Z35B 5CBEB 1ZSDA 5FGCE 2V9RA 4X5XA 2ZPKL 1KENH 5DT1H 2CGRH 3UEZA 1GXEA 1NLDL 4WUUB 5HY9B 5D7SL 1LEKA 3PIQA 4L3AA 4JR9L 4XPFH 4WGVB 5JORA 4XX1E 3L3OB 5HI5C 1LEIB 2V17H 1IGIL 5EOCJ 1KBGL 4XVTL 3MBED 3EJZC 4JKMA 1T0NA 2J8UA 3DMMC 3D3VB 4FQ1H 3M07A 1T80A 2FEDC 4Z95H 2V2XB 3VWJA 4EQ2A 1LO2L 4IM8A 5T1DH 5JPMB 2XY2A 4RCAA 4NC1C 3O11B 4HAGA 3HG1B 3BKML 5C0BD 3B9KB 1WT5A 4XWGH 1I8LA 4LCWD 4JFQB 5IW1B 3RVVC 3SDXF 3MLUL 1B4JL 4ZS7H 5I1LA 4L4VB 4EDWL 4WENB 4X4YB 3X11B 1JZ4A 2ICEA 4ODHH 4YDVB 1A4KA 1F2QA 1GZQB 2F8OA 3QDMD 2D7PA 3I3BA 5HI3C 4LSVL 5C0FA 1IGIH 4DVRL 1TZIB 1DEEA 3WFEH 3VFSB 4PJ5D 3FFCA 2NY6B 4K9EC 5KVFH 2ZCLL 4OZHE 3FB6B 1G6RB 1IC1A 5CEZD 5B8CC 3L5IA 1KPRB 2KDGA 3IDYB 4YFDB 1IFHL 4P2QE 1OGTB 3SDAB 1EVTC 5CWSB 5DHVA 3WKMH 4QHUB 2HLFD 2GKIA 2XTJD 2P5WA 3RZCA 2BCKB 2GJZB 1AGDA 4U6YA 2G2RA 1BIHA 1JN6A 1H5BC 2C3VB 4WY7H 4ALAL 5BV7L 1MCPH 2ICCA 1TJGH 1FYTA 4ZTOH 2FB4L 5MEQA 4F8TA 4BZ2H 3AAZB 1HH6B 4XI5D 4JQVA 4DUVA 1ZHNB 1E4XI 3A67H 5D7JB 1QYGH 1MVUB 3ME0A 5KSAA 3LN5A 4OZ4A 3LVEA 1L6XA 1FAIL 3I85A 5CEXB 4FQPA 1FNEA 4J3TA 1QR1B 1D6EB 1IMHC 4LARH 4PBXA 5I1CH 2SEBB 1T7ZA 5I19H 1FNHA 4PJ5A 1BGXL 5T3XD 5MERB 1NAML 1DBBL 1WICA 5FA4B 3ZO0A 3DX7A 4EN3C 2IGFH 4Z7OE 1NAMB 5D4QA 3LAFA 2VXQH 4RBPH 4WI2A 5I30H 3ZE0E 4FABH 4J2XA 2GSIB 2VZOA 4PJGF 1MELA 1FVCA 4CDGC 5I1JL 3V5KB 4DVRH 4NO3B 5I17B 2DQIH 4OGXH 1OSPL 3CFEB 5HVHB 2XN9D 4NO2A 4L8BB 3DECA 3LQAC 1UCBL 4P5KA 5GRVK 1KV3A 1VSCA 5EA0L 2AJZA 4PB0H 4PJEE 5DK3A 4LAQH 2E7LA 2R69H 3BDYL 2X09A 3LKOA 4JO4L 3QFJB 4M48H 1GH7A 1YEKH 4BELD 2FBJH 3WUZA 3IDGB 2VR4A 5DTFB 2E8ZA 2NY2C 4U1JA 4JFZL 1EEYA 3QIBC 5ISZE 4QHLA 2JCCF 1LO4L 4OTXL 1MLCA 2EKJA 3NFPB 4HUMB 1NUNB 4HF5H 1KSRA 1P7KB 1VPOH 3HZMB 4MA1C 5DJCA 5I6XC 5CIPH 1NH6A 3BMVA 3REVA 4HAFA 2GK2A 2W9DL 4AY0A 4J8RA 4LARL 3KG5A 4R2GD 4HXAL 1ZGLB 3TA3A 4UQ3A 4PRIE 5C0FB 5E03A 1N7MH 4MQTB 4Y2DB 3WFEL 3WS3A 1Q9KA 4JFPA 3O6LH 4JFDA 5FYKH 3KNBA 2PYEE 4P46C 1GSMA 5D8JH 1R5WA 4AG4H 2CUIA 4JDZA 1ZLUK 2VH5L 1QHOA 1YN7A 4IRJB 3V0VA 1SEBB 3PP4H 2ARJQ 1TZGH 1NCDH 4PYGA 5DS8B 1XCTB 4TSBH 3A6CH 1BZQK 2DYPD 2R1XB 5CJ5A 3EDDA 1CICC 3UP1A 4NKQB 4PJ9C 1JRHL 1F90H 4X7SL 4X7TB 3KLHC 3HE7A 1FVEA 3BEVB 3G5XA 4OZFB 4FFVC 2ZOLB 1RI8A 1R3HB 2FEEI 3CPLA 3I02A 4KUCD 4XP6L 2D03H 1NMBH 3BE1H 5EORL 4Z7UE 2AVGA 3TZVD 2Q3ZA 2O93L 4NNPL 3IJHB 4PG9B 4YHPB 4D8PA 3B2VL 4JM2B 1Z9MA 3VFTB 3JWDC 3HG1A 4D0BB 2VN4A 3EKCA 3VU2A 2O61B 5E5UB 4YNYB 4QF1B 1LK2A 1JPTH 1I3UA 5L8KB 2CRIA 5F3HB 2AI0L 2NR6D 4U1NB 3VA6A 2ZUVA 4KRNA 3TPKA 5IVZA 2GCYA 3JTTA 1R5IB 1ZT7A 4Z0XA 5GHWL 3X14A 2AQ2A 1JNLL 4HX1A 3VFPB 4OIIL 3SGJC 2QV2A 4PTTB 3LN5B 1X7QA 3BISA 4XXCA 4QXUH 3TN0C 4JZNB 1NJ9A 1QACA 2NY6C 2MQ3A 5SWSD 1URLA 2QSTA 4D3CH 2W0LA 4DN4H 1BIIB 3CSBA 1U8IA 3RNKB 4FG6D 2IADA 5DT1L 1HKFA 1YUHA 4I0PC 3QXVA 1IGTA 3FQTA 4LSDA 4DGYL 2C1PB 5JXEC 3MJ9A 1KTRL 3KYOB 5DRNB 1KTDB 1G7IB 2NY7L 2GTZA 4MNQA 1GOFA 4M9OA 3X13B 4TTDD 4PRDA 5F7EL 5F9WB 1U8NB 5DJCB 1QFPA 3RWEA 4R7NB 4WCYL 1UM4H 4KRPD 5KJRL 2NY6D 5GRXG 1I7RB 3W9EA 5KVMC 1KIQB 3F7PC 5KOVC 4YHLH 3CFDB 5FV1L 2EC9U 3S4SA 1XGRB 4D9QD 4EZMA 1U8HB 1GL4B 5IB5A 5ANMA 4HBCH 3QYCA 3U0WH 2VDOL 2W38A 3UZVB 1FFNB 1T21B 5D7IE 5DO2C 1W8OA 3HI6L 3D2UA 4EVNA 1Q9WB 5DD6A 3GNMH 4ORGB 2FRGP 5EO1B 5EO0B 5DMGD 5IB1A 7CGTA 5I71B 1AGEB 4JFQA 5IW1A 4N9GA 1IKNC 3ROOA 4QHMB 4C59B 5BXFB 4PJGE 4X4YA 2Q8AL 4ODWB 4B41A 3KPSB 4NQVB 5JPNB 1MWAL 5I74C 3CLFH 4YQXH 3QUKB 4U6XB 4G3YH 4HWZA 3UJJH 5JTWA 1A8JH 2AJYH 5E1AA 3O8XC 5IHUH 1BBJA 1DE4B 3QJHA 3I6LE 2XQYK 3WXWH 2PTVA 3MLPA 4WRLA 4N0UA 5JDJA 3TO4A 4FMKA 5KANG 1D6EA 5IFAL 5BVJA 1Q72L 4CADB 5B38A 2F53E 4H8WL 2AEWA 3SE8H 4YNYA 3BZ4A 3OAYK 1MAML 5JW4M 1VCAA 4L4TA 3RVVD 1A6AB 3MXVL 2HN7A 3QIUC 4U1SB 3MV8A 1D3CA 3HA0A 4BQCA 3JTTB 2BOBA 4TYUA 5GHWH 3TNNA 5HHOA 1XF4A 1C16B 2M26A 3C2SA 3PABB 3W0WE 4MD0A 1X5GA 2R29L 1J12A 2X6MA 3WIHA 3B9EA 2Q76B 3BWAB 3NCCB 4JY4A 1AKJD 4LCCA 4M7JH 5C0GB 5HDBE 2IBGA 4ZOBA 4QRRD 4OD2A 5K33A 3TWCL 3S96A 2K1MA 1R3KA 5IOPA 5DZNA 1S7VA 3KGRA 5JDSA 3WN5A 3VWKB 4RWHA 3G9VA 4GQ9H 3VXTA 3CC5B 3S88H 4K2UH 1NDGA 3B3IB 4K7FA 2R0LH 1DUZB 4PTUB 3I75A 2EIEA 3HLAB 4NZDA 1RHFA 4HCRH 4OZFA 2LU4A 3BT2H 3PHSA 2ZOLA 3DMMB 2NY1B 4LLVB 3E8UH 2KZWA 3TCXA 5BZWA 1YEDA 4AH2A 2BSSB 4TUJA 5FM4A 1MEXL 1ZHNA 3QRGH 5HYFA 3RUGE 2OMNA 4F7EB 1A7PL 4EDXA 4TSBL 2Y4SA 1LO4H 4OTXH 2EDNA 1JPFA 2DM3A 3P0VL 4U0RB 1BX2A 3TA3B 5EUOB 4MA8H 5DJXB 5CGMA 43C9B 4UDUA 1DN0B 1S9KC 2V7NA 1VADA 3QULA 2F58L 1P84J 3MLYH 5ANMB 3UC0L 3D39D 3FJTA 3LH2L 3ZLQC 1IKNA 3JZ7A 3T3PE 4G8GB 4LDOB 1Q9WA 1G7IA 4KJWD 4AM0A 2B2XL 5DS8A 4Z7UA 4Y16C 1BF2A 1OGAD 4ISVB 3IU3A 4JLRA 3R8QA 3RWCA 2Q8BL 4PJ7B 5EOCL 5IR1B 3WE6B 3X3GL 3MRJB 4NKOB 1IQWL 4I48A 1HEZB 5LGHH 1XIWD 3OJ2C 3REWB 3FB7A 1C8PA 2Q7YB 4UQ3B 4S11A 4KXZI 1T0MA 3NFSL 3CVHL 4OSUL 4YHNB 3LEYL 3QO0A 4R8WH 4MCZB 4PRPE 1RK1A 3EFFB 1A14H 5BVJB 2BSRA 2KZ1B 3IJHA 4PG9A 1A6ZB 2VMFA 1M4KA 3O2WH 4LCUA 1OSZA 2WWKT 4PJIB 4YK4B 3UTPE 4KZDL 3QG6B 4IHOB 5J1AA 5JIPA 5ERWB 5C1MB 5FGBA 1HDMB 1MCBA 4ONFL 4LSSH 1T3FB 3DX8A 1MNUH 3K1DA 3VW3H 3BO8A 1MRFH 4K9EH 5D5MA 5JUEH 5A2IH 2OQJB 1YA5A 5C2BL 3HAEH 5IVXB 4KY1H 1PAMA 3WN5C 4Z7QF 2F53B 3TBYB 5C07B 1QFWM 4Y4FB 2XV6B 3GM8A 2XRAL 3GBLA 1CICB 3MV01 3BN3B 2Z8RA 2CJUL 3MFGB 3Q1SH 3KJ6H 1XGYH 1MCLA 1NCBL 2FGZA 5CP3H 2DLFL 1I1RA 4NYLB 3OB0K 5IB1B 4ZFGL 3H9SB 1K5NA 1UM6L 3P9MB 1TETH 4PV8A 2MOVA 1D5MA 5F96L 4LGRB 1CGYA 2YC1B 4KK9C 4L9LB 4Y16B 3M45A 4AEIL 1QFUL 4JGMA 3E3QE 5EU3B 4ZOCA 4OIAA 4C4KO 4ZXBB 5HD8C 5GRZA 2QSVA 1YQVH 2N1KA 3FQWA 1FLTX 1RPQA 3K7UA 3SDCA 3W5NA 2UZIL 1Q9OA 1T7VA 5CINL 4ZXBC 5DWUH 5EU5A 3K2MC 1W72H 3WN5B 1RUPL 5DLML 1F3DH 4RNRA 1RVFH 1DBAH 3V6OE 3HMWH 1UM5H 3LEVL 1SJEB 3SPVA 2R56H 3ZE0F 5JUEL 1OAQH 4QOKE 5FYLH 3WIFB 3MOBH 5J3HD 3E3QC 4XCEA 4F57H 5E2WH 1NEZG 4WWKB 3P3YA 1HEZA 4PLJD 4ORZC 4Y4HB 4PGZA 1MCWW 5E8PA 4JHWH 1R3LB 5IJVB 3TVMB 4FFZH 5CINH 3MV9A 2BERA 3DARA 1OAZH 1A0QL 3NBNA 4NQED 3CC5A 1WCBB 1WWCA 3QWRA 4X9GA 4JANA 5TFSL 4QT5B 5INCA 3SDCD 4P2QA 2R0WL 3QIBD 1HHHA 1I1AD 4UOW1 1RMFL 3T4YB 3B2UD 2WIMA 2XFXB 3ZHLA 3HB3D 3CH8A 5EZJB 4JFFA 4ZNEE 1MFCL 5DMIL 2OJZH 4JO1L 3OKEA 1AD9B 5LWYL 4MYWB 4PREB 4AENB 4CMHC 1BD2A 2R4RH 2CKBH 3HZVB 2UYLB 1RK0B 4Z77B 3TV3L 4OZHF 3TBVB 2EDOA 5T3ZL 3S37X 5E00B 3T2OA 2QADD 3VH8A 1TTGA 4UV7H 1JVKA 4YDJB 1FHGA 5FOBA 4ISVA 5E94A 4X6CA 3C09B 3RWCB 1E28A 4UILL 1CU4L 2NY1D 4MSWB 1SQ2N 1MJ8H 4F9PC 1F6AA 3MR9B 1B2WH 1OAUL 4HH8A 2F15A 3LS4H 1LWRA 3REWA 4LP5A 4DFHA 1GZQA 5E6IC 2YPLA 3MJ6A 4GRLA 5GGTA 1UB5B 3VXOA 1XF4B 4ZXBA 4PBWD 1OP3K 2VLRD 3P4OB 3H42L 2CDFB 3G6DH 3V6OA 2XTJE 3DUUA 1UKSA 5F8RC 3IJYB 1IAIM 5E6IB 1RJCA 4PRPB 5EU4A 1JGEA 2E9WA 4NDMA 5CP7A 3VMNA 1LO5B 2Q8BH 5HYJD 5FV2A 1KLUB 4G8IA 4NPYB 2D7TH 1QQDA 2HFGH 3X3GH 1YJDL 3T8XB 2A9MH 5HHXH 4XPAH 3Q5YA 5FYJE 5GSVB 4RIRB 1EERB 1EFXD 1RZ7H 2PW2A 3V4PL 5SWSA 2EDTA 4OSUH 3SDDA 4DQOL 2A73A 1A4JB 2NXZD 1CE1L 2XXMB 3GIZH 1RIVH 4RMQA 1IM3A 1BMGA 1GGCL 1CD1B 2F5AL 4I0PB 3RVUC 1SM3H 1FNEB 4DCQB 3MNZA 5D70H 1J5OL 4XAWL 1T7XA 3DYPA 5TE4H 2XWTB 3B9AA 1BQUA 5BJTB 4PRNB 2VLRA 4HKBB 4GMTH 3RRQA 3TYGH 2BJML 5JDSB 2D31A 1INQA 1UZ6F 2EC8A 3KYMB 2F74B 5E8NB 4QTIL 3PL6B 4GW1A 3ARDC 1BREA 4HXBH 4XMKH 2BHUA 3EO9L 1SY6A 5KZCB 5FYKE 5IKCB 3QXDB 1M7IB 1A7NL 1L7IL 4PJ9A 2XFXA 1YDPB 1GAFH 2BVPB 1OSZB 2AK1H 1P1ZA 2K7PA 1JV5B 4EI5B 3IFNL 1KF9B 1UYWL 2GHWB 4MDJA 2H8PA 4LPUA 1HDMA 2A74A 3WS6C 4XMLH 1YPZF 1MSPA 2DQTH 4EJ1C 3N9GL 3PDGA 4BFIA 1NDMA 4NSKB 4OLUH 1ZOXA 1I9IH 1EIBA 1AR1C 1DN0A 1PKOA 4RMWA 1J1OH 4DJMA 4P2RB 4WW2B 1CLZL 4L8CB 3QUXA 4BH7A 1HSBB 4TOYH 3VXSD 1GGBH 2QLVB 3ARED 3KPMA 3ABZA 3IKKA 4O4YH 1KC5H 3QEGL 5T33L 4ELKA 4FXGB 3GMPA 4KKBC 5EU6B 3WIFA 4JPWH 1IQWH 5TPWL 4K71C 32C2A 3U7AA 3OAZK 4HWEH 2XKNA 3VXNB 4JVPA 3IFOA 4XTRD 4PUBH 3LSOA 1K8IB 1SMAA 5J12B 4J8RB 2VRAA 3FN9A 5D5MB 2W0KA 2VNCA 1CGTA 1CFTA 1HWGB 1F11A 2I9TA 1NGYB 4PGBA 1WFUA 3QA3B 5EU7C 1NCAL 3IJSB 4LKXA 3ZHKA 4J3XA 2QQKH 5FA3A 4XPBH 2MHAB 3QEQA 4WVRA 3S7GA 2R0KH 2VLMD 2NW3A 2EXWC 1JK8A 3E6FB 5F9DC 1A22B 4JFZH 5KS9B 5MP6H 1R3JB 4XTRC 4QOKD 1HNGA 4AT6B 2F54D 4NZUH 1FNGB 2AKRA 3AU1A 1FBIH 3ETBF 5TQ2L 3WO4B 2P46B 3CCHB 5I8KH 4OKDA 2XZCH 1E6OH 4S2SA 2A6IA 2HJFA 4RMVA 1NGPL 1PFCA 2ENYA 4P23B 1UXSA 4LDLB 1I8LC 3GI8L 1U95B 3GSUB 3GJFB 5DK0A 1TJHH 4RGOL 4XXDA 3RWGA 1YY8A 2J6EL 5FHBL 3M1BA 2Z31D 1F3DJ 1EK3A 1CICA 3N50A 4KGJA 4I3GA 2HJKA 3NIFE 1Z5LB 1IT9L 5TDNA 1GIGL 4LU5L 1MJUH 2GITA 1T2QH 4WU5B 2YUXA 4PG2C 2VISB 3CUPB 3PL6A 1EVUA 5F89A 5I0ZA 1QRNE 3BGFC 3N85H 1S9XA 3MLRH 4L3ED 5HI3D 3IKCB 3DX9B 1U93A 1NLBH 5ICYB 3SPVB 4PJ9B 1EGJH 1I7UB 3U0WL 4U6TA 5EZIH 3THML 4O00A 2WSKA 5D7LD 4MQSB 5DUMH 1CD1A 3WFCH 4HF5L 3BKCL 4DVBB 4V1DA 5TGBB 4KDVA 4I1NB 2DQTL 3G6JF 3V8OA 1LO5A 2V5MA 3ILPB 4HZLA 5E2VL 1ZMYA 1KPVB 3ARWA 3G04B 5EU5B 2ZCHL 4FQIH 2Y7QB 5E2JA 4LIQH 2ICWB 3GEWB 1OL0A 2OZ4L 5MENA 1IEHA 2Z31A 4HV8B 2ERJC 5EC2A 3TC9A 5K9JH 2V5RA 4IRJA 5DDHA 4X98A 2ITDA 3ZE1F 3WFHA 4PJ8B 4QY8A 3WS6A 2PW2B 3NH7H 4W6XB 1NCNA 4R0LB 1C1EH 2R1XA 1IBGL 4M3JA 3S36L 1F6AB 1UVQA 4UDTA 3QNYB 4UV4L 3ULVD 4HIHB 2VKWA 4AENA 1FAIH 2YPLB 4GRLB 1JF1B 1FO0L 2HT2C 4YWGL 3S35L 4L4VA 3DBXA 4J7RA 1KIRB 3KPNA 1WZKA 1QLEH 2C4FU 2ZCKL 3KYMA 5HYJB 4WW2A 4L8CA 2UWEF 3LN4B 3WEXB 4K9EL 1JL8A 3QFJA 1W8NA 5HHME 2NLJA 2KKQA 1A2YB 4DK3A 4ZUTB 2NX5B 3HCVB 2E7CA 5FYJD 5ID1B 3LQAH 4J1UA 4DN3H 1DLFH 1ZLWH 3LKRA 2C3XA 3L3JB 4P9HC 1DSFL 4G7YH 5D5ME 3NFNB 3FCTB 4OFDA 2BRQA 1FL6A 4ODVL 5JLZB 4RIRA 5D71L 3KS0J 5FUZL 4PREA 1EUTA 2IBZX 1I8IA 1FJ1A 4KK5D 2WAHA 4C57C 4WHYH 2JCCE 1NCWL 2XN9B 3GMMB 4NQCE 4R97B 3ARGD 4XVTH 5GGRY 3UROR 4Q6IB 1ZT4B 2CKBB 4NQTA 2X4RB 4QXGL 3KXFB 3R0MA 4M5ZL 3PWPD 4ZS6D 3C5SB 5E0QA 1HH6A 5KN5B 4WV1B 3RWDA 1B2WL 5DMIH 3G5VA 4Y19A 3NVQA 1KCVL 5KS9A 4NUJB 2HT4D 3V52H 4X8JB 5EZLA 4EI5C 2B5IB 3O3BA 5IWLC 1OM3H 1AHWC 5EULV 1FE8L 2HKFH 3ZKQD 1CK0L 5GGVY 4XC3H 1LO0L 2FB4H 5I1EH 2CKNA 4PGJA 1MAJA 1L0XA 2YRLA 2OL3B 3TBWA 1LK3H 5INDA 1WF5A 1A1OA 1IM3B 25C8L 1NFKA 3ZDZE 4G8FB 3O6MH 4WO4B 1N3NA 2VXVH 4BYHA 4U1IA 3W9DB 3IF1A 3O45A 3CFIC 4GXUN 3TCLA 5C6TH 4ELMF 1JNHA 5E9DD 3U6RA 3LEXB 2BHZA 5C0IB 5C09E 1CFNB 1FCGA 3DI2B 5F9OH 1J9CT 2FWOA 5I16A 1JMZA 3ZT7A 2VZSA 3PJSB 1Y18A 4XPFL 5I30L 2X4OB 2EDKA 2KH2B 1HYRC 5EO1A 1Z3GH 3RY6C 2IWGA 3RY5A 12E8H 2NY4B 1B0GB 2P49B 4JRYE 4WEBL 5D93C 5TF0A 1FIGL 3MODH 4OZFG 3TZVC 5DTFA 4RX4D 2XKNB 1ED3A 3VXNA 2IG2H 1WBYA 3BEWB 4KJPD 2H9GA 4M00A 4Y1AE 3WL9B 3MX0A 3VRLF 4LVEA 1YMHA 2Y06L 5I1KH 1FSKC 3BZFA 2WWMD 1SJXA 3ZTJG 1YEIH 2D31B 4OLYH 1QFUH 4R96B 4P5TA 5MENB 3LIZH 1EEZA 1JGDB 5EBMB 5J1TC 3ZKMC 4N0RA 2P47B 2YD6A 4FXGA 3P9LB 1R5WB 3CNKA 4CL7A 3O3AB 4NRXA 1FYTD 3S36H 4RAVB 5C09A 2Z93A 2ESVE 3A6BL 3QDGB 4HUVB 2CLVA 5DGQA 4LF3A 3QDMA 1I9JH 1JTPA 3Q48A 4CVZA 2FECI 5HYQA 2BOBB 3CVHB 3IS1X 1JHLL 5HDLA 2VZ1A 1CTOA 3PV7A 3HC3L 4MJIA 3LDBB 1KJ2B 3CMGA 2DQJH 1OF2B 4XP5L 3CZFB 2WW8A 4H20H 4NZJA 2UWEE 3KLDA 2F58H 1QSEA 2QSCH 4S1DC 1U92A 4WY7L 5EBLB 3CPLB 3C5JB 1QBLL 3L5JA 2GY5A 4YHMH 4NZRH 3RUGB 1R3JA 3EDEA 5F7KC 4Y19E 5ERWA 3CZJA 4U1KA 1BEYL 2VXUL 4F7PA 5JW3L 4C56D 5ILTH 3MO1A 4QRRE 5L2KD 1EO7A 2PTUA 5JPNA 3G9AB 3KPNB 4KXZH 5IVOA 5KSAD 3GMMA 2C3WA 3UCRA 1JGLL 4JKWA 3NAAL 4DUXA 1NAMH 1K8DA 4YX2L 4TSCH 1M1SA 4G5ZH 1N3NB 4ENEC 4XVSH 2XA3A 1OTTD 2I5YH 5FA3B 3MACH 3CSPA 5C9JA 5IMLA 3WLWD 1QUNA 5E4EC 3EZJB 4OCYH 1CDJA 1JPST 5E9DE 15C8H 2V5TA 3D0VA 4KI1A 1D6VH 1S7TB 1IGJB 5T5NG 4V2CB 3QIWD 1NC2A 2WINB 4BUHA 4Z7WB 4LVOB 4X98B 2I9LB 1MJJA 1A6WH 2YSSB 2E6PA 2VDLH 2AJUL 5TDPB 1OP3H 4ONFH 3ULVE 3CAFA 1OQXA 2QKIB 2DF3A 3GHEL 3SKNA 2X4RA 4WW1A 4B7IA 3U7WL 2E9BA 1AXTH 3V5HA 1MEXH 5I8EA 3VXQB 3INUL 2FZ3B 1ND0A 5BQ7A 2CIIB 5IB4B 3D18B 4LSUL 2GITB 3STZB 1RZKH 3KJ6L 3DUSA 2DBLH 2GUOA 1N0XH 2HWZL 4DWHA 3VI4E 1EGJL 3I2CL 2BSRB 3DGGB 5JOFB 1NFIB 1OARL 3U4BH 3SDYH 3MXWH 1B90A 2GTWB 4FN0A 1HIMH 4MD5B 3LHPL 3S37H 4F15C 3LZFL 1A7NH 3X11A 3IF1B 2Q7YA 3MV9B 3FO2A 3UTSD 1YMMB 1KXQE 1GGTA 3DBXB 4LAJH 1QA9B 5HYSB 5HGDB 3L6FA 4QRUB 2J8HA 2ADJB 4LDEB 4L5FH 4PY8I 1T89C 3H9SD 1XCQB 5KVEL 2FH6A 4HBCL 1MIMH 2J12B 3ES6B 3P9WB 2ITCB 2P8MA 1CQYA 3BKCH 3O2DA 1PZ5B 3SOBH 1ZVSB 1XGQA 2V7HA 5IR1A 4WI6A 3PWLA 4HGMA 4OZFH 2R0KL 4U6YB 1WBZB 4ZD3H 4Y16A 4YK4C 4GQPH 1KPUB 2R2EA 4HH9B 3V5DB 4TNWF 1KB5A 4U33A 2DWDA 1CZ8L 4M43L 3VXUE 2EYTB 1SJHB 4OFPA 3OJDB 1IC4H 1XF2B 5DRWB 2VDKL 2NY3D 5I76A 2FJGB 3IGAA 5DVKA 3H3PL 4ZYKB 1E6JH 2YZ1A 4RFEA 3Q2CA 1NEZB 2NLJB 1BAFH 1WTGT 4X4ME 5HGBB 1F4YH 3MROA 1K3ZA 2N7BA 4F37K 4YZFE 5GGRB 4IJ3B 5C0IA 1ZS8B 3GNML 4U7SA 1YPZE 3OAZH 5BS0D 4NFCA 4OUUB 2Y9RT 4F7PB 3V79C 2EZ0C 1ORQB 5KSAC 2DKUA 3WNMA 3GKWL 4J3WA 5DJZA 4Q6IC 3QI9C 5D6DC 2IJ0C 1HILA 4PJAE 2B8OT 3MRLA 5ID0B 4JZOB 1DEEB 3V7AG 3ELAT 3MRPA 4G3YL 3TBYA 4NQEB 1OF2A 5JOPD 2IEPA 3EDKA 5CEZH 4PYHA 4KMTL 1YY9C 1RIHL 4TSAH 5J6HB 1N6QL 1PLGH 4EKXA 2Y5EA 3DTXB 1GGIL 3GSNB 4BFGA 2PUQT 3P40A 1T4KB 3EUUA 1KIPA 4M7LH 1BECA 2RBLA 3GMQA 3I2CH 4LHUA 5IBTL 1NC4D 5EG6C 3O0RH 4RFNB 2EO9A 3HAEG 5CIPB 1MFDL 2RJMA 3MRNB 1KNOA 3ZTNL 2V6HA 4UT7H 5BW7A 4GKOA 4XPTL 2YRZA 5ANME 4U2YA 2D4DA 4XNUL 2A1WL 2UY7A 2LABA 1J8HA 4NHCH 1DR9A 5I1IL 3QDMB 4Z78A 2H6PB 3HUJA 3QCUH 3C9NB 4IRJD 1QBLH 1G7PB 5KOMC 3HPLB 5BS0E 3D69B 1K3IA 5L2KB 4JAMA 2R8SH 1T83A 4P48A 2W07A 3OWEA 5C08D 3E1F1 4NO0D 4O2EA 1AI1H 3TT3H 4DKFH 1V7ML 3OXSB 5JW4Q 1GYAA 4I5BA 5MEPA 4DW2L 4FQQA 5EBMA 3FFDA 3ZHDA 3EYVB 5FUCE 5JQ6L 4NKMA 5D7KE 2XTJB 1B9ZA 3V0WL 2EH8H 4YHYC 2H45A 1D5ZA 3TNMB 2DMCA 2OBGA 4PY7A 5J1SC 3OAUL 1NMAL 4K94C 3MUGA 4P2CG 4Q7DA 1X4ZA 2EEAA 4Y1AA 1GCFA 3UYRL 4IOIA 1FDLL 5HHPB 4Z76B 4EOWL 1AH1A 3W2DH 3WJJA 4YBLC 2YBRA 1JWMB 1GJIA 4KDTC 4M6OH 1RUPH 5BRZE 1XGPB 4R4BB 2AXGB 4KGLA 4KJQD 5EU4B 3HNSL 3BGFB 1I1AA 1N64H 2Y72A 4K3JL 1E28B 3JUZA 1KGCE 2DOCA 4NJAH 3MRBA 1MH5B 4HW6A 1UJ3C 2NYYD 3IXTA 4FQCH 1CDHA 5CJXC 4QNPE 5KJRH 3AS1A 3LSOB 4FP8H 3L5HA 4N5ED 1NCDL 2WUBH 3QCTH 2FX8H 4HH9A 2R2EB 1ZGLA 2IQAB 3QXAB 3D39E 4K8RH 4CN6A 4PV8B 5A43C 1N0XL 3PWNA 5FYKD 2FJGA 3IGAB 1U41A 2W60B 5J6GB 4JDZB 3MA7B 3CLEH 2AK4E 5K9QG 2A6KA 2Q6WA 2MCG1 2RAMA 2FGWL 1SM3L 2RFXA 3UYOD 2X1XR 4PJXB 3A67L 2OCFD 3IDXL 1XGQB 2JJTC 2V7HB 5F1OB 2LAGB 4HLZH 3PWLB 1ZHKA 3IRZA 2XPGB 3VG9C 3DSNA 3BKYL 3RNQA 3BAEH 2E6QA 5L9DH 2GCYB 2DAVA 2GTZB 1ZA6B 3O4LD 3QDAA 1UXSB 3S5LB 2BZDA 1KJVA 1CFQA 1P1ZB 4LAQL 3KPLA 1HKLH 3I02B 1J8HB 4H0GA 4M1DL 1JHKL 2QADC 3KYAA 5E5MA 5E6IA 2DJSA 1LDSA 4D0DA 4WEBH 3ZKSD 4Y8AA 1I8KB 2CO6B 5GSRB 3SDYL 1JTOA 1J0HA 1KLUA 2HYMA 1AQKL 3DNKA 3BE1L 1ZVYA 2X4PA 1FC2D 4YBHA 2MNUA 2H2PC 3MOQA 3S35X 1CF8H 5CCKH 4BSWB 4XCYA 1NCWH 5DJZB 1OGAA 3D2UB 5K93A 3OKLB 1QTYT 3PUCA 5ISZD 1B4JH 3OKKA 1ZGLP 3DRTA 4KI5F 2C9AA 1HHIB 4JQIL 2YD4A 4OLWH 3AM8A 1FNFA 4JZJB 1K8IA 3OX8B 1BP3B 1F42A 3I6LD 1L7TH 3DTXA 1ND0B 5BQ7B 2IG2L 2VWEE 4KK6C 4TUOA 2IBZY 1OM3L 3T0BA 3VXPA 2YWZA 3MLSH 1PKQA 2AK4A 4F33B 3ES6A 5HGBA 1RURH 1S9VA 2M2DA 3QIUB 4NQCA 1ZWIA 1GRWA 5E6ZA 3O41B 1MUJB 3IYLW 3VH8B 1W2KT 1FO0B 4MDJB 3UJTL 43CAB 4OGAD 1MCHA 5CILH 2L7JA 1JGVH 5LAXB 2OR9L 2QHLA 4U7KA 1G9MH 5CUSH 2NW2B 3RWIB 1YYMH 1HHJA 3S88L 1X9QA 3R4DA 2DJUA 1UJ3A 2ADJA 5EIIA 3CFCL 5I19L 3X12B 1UB6B 2ITCA 5IG7A 3SY0B 3V6FA 4PP1D 1IQDA 3CIQA 4ZPTA 1WWAX 2Z92B 5BMFL 2EXWD 4OLWL 1OD9A 5CLWA 3VFTA 4HWBA 3OB8A 3MV8B 4D0BA 4PJBB 2APBA 5I1JH 5T5NF 4LRNL 3RHWK 1CXLA 1QEWB 4PGDA 5ALBL 2PTTB 1G9ML 3BFOA 4XAKD 1MAMH 2UZXB 3NFSH 4P9MH 5E1AB 3O8XD 3VRJB 3M1BB 1FVDB 1VGKA 5DQ9A 3LD8C 3T77A 4UIKL 1IAKA 2J8UF 4C58B 5F44A 4PG2A 4DZBA 4GS7C 3HPLA 2EH8L 4OF6A 2NY1C 1UT9A 1JK8B 1IT9H 2CSPA 3OJVC 4PJXA 4R2GC 4NCC1 2K3TA 4XB8A 1H3UA 4ZPVB 4XGZA 1HYSC 4PP2A 2Y36L 4TTGA 3GUTA 3U82B 2BY1A 1WFOA 1S9YB 4WFHE 4LSPL 1KEGL 3KDMB 4L1HA 2A6JA 4OUOA 5E8NA 5TJWK 4OCRH 3TT3L 4DKFL 2HFFB 5LJYH 3NIGE 5HYIA 1XR9A 2AJXL 1E4WL 3AS3A 3MBEB 3CX2A 1UKQA 3ZE2F 2J88H 3LPGA 2WBJC 3D3VD 1AO7B 3DSFL 3F58H 5DEFA 4HEME 5KW9H 3ARFB 1A7QL 1S7VB 1F6FB 4LRIC 4CJ1A 5IQ7H 1KN4H 1QFWI 4OKVB 1ZHBB 5DDHB 5HDBF 4MWFA 4XCYB 4H88L 4U0QB 1RJYB 5JPMA 4P2RA 1JWUB 3SE9L 4Z6AT 1RUAH 4XBGB 1U0QA 4GH7B 3UC0H 4K2UL 4FZ8L 4X5XB 1MCQA 3MPCA 4ZQKA 3ARGB 1MFNA 2BSTA 3ROLB 3PWVA 1KJMB 3BD3A 4WI5A 5D7LE 2VL5B 4K8RC 4FQHB 4WV1C 1RU9H 3OKNA 4OLXL 5ICXB 4ZOEA 2N4IA 1SVZA 4PJBF 3BIKB 4U7MA 3QXWA 2Z4QA 4MCZA 3ZTNH 1M05B 4Z7VA 5D2LF 4Y16D 3HE6B 1AC6A 3GRWA 4MJ6A 1IL1A 3VXMB 4PJIA 5FM5M 4FNLL 1UCTA 5I1LB 4HUVA 1R6VA 3SDDD 1ONQB 4PJIF 4U1MB 1H0DA 3T0EC 1F4YL 4K3DH 3SKMA 4I48B 4E41B 2LVCA 1S7WB 4M03A 2OI9B 1T1XA 1CXKA 2HTKD 3VXRB 4P4RB 4L4VD 2R0LL 3KPLB 3C87A 4CUCA 5D7JA 5FEBA 4TTDC 1A7OH 1ZT4A 4FFYL 4KROB 4Y5YA 3T08A 4CVUA 1SMOA 2F54E 3UAJD 4JPIA 1QO3A 3MV8E 1O7SA 3O2DH 4FQXA 5ETUA 5IW3A 4XNMB 1ZWIB 3EAKA 5KSBE 4P2OD 4YGVB 3RKDD 1IQDB 5I0DA 1T5XB 2PETA 2XY1A 4YXKL 3MCKA 3ULUC 5JIIA 3L3JA 4TVSa 1BJMA 1XF5B 1IGCL 1MLBA 1T1ZA 5DUML 1TQBB 5EO9A 3GMRB 2DQFB 3ISWA 3FKUS 4KRMB 2YUVA 2HLAA 5FO9B 2MQCA 2H26B 1B88A 2IH3A 4L4TD 2QJDA 2HG5A 4LL9A 2AGJH 4H8WC 4YWGH 1D9KB 3FFCB 5D7IB 3QPQD 5TDOB 1OLLA 1UXWA 4FA8A 3EYUL 1AO7A 1MWAH 5E8PB 4YHLL 4DKEH 4QO1A 3HAEB 4HD9A 2CO7B 1OPGL 2BSSA 1PEWA 3S37L 1QBAA 3U9PH 3SHSA 5D7JD 4DVBA 5GGQL 1JPFB 2RCSL 2E7MA 1FCCA 3A0OA 1VESA 1DDHA 4R7DB 1WAAA 1EEYB 3QUMH 2LE9A 1MI5B 3ZYZA 1MHEA 1P7KA 3MZTA 2BJMH 3HZMA 1OGAE 5CZXC 2GY7B 4MDIA 4U2ZA 1A1OB 5IWLA 2RIKA 4HC1A 1P6FA 3P4MA 3SCMC 3QIWA 1RZIA 5L88L 4GRLC 3BPCA 3QEGH 4L8SB 1UADC 3A6OA 3MRIB 3ZE1E 1VFBA 4JO4H 4NHCL 5E9DA 5KVGH 3RAJH 4XT1C 4X6DA 4L8DA 5I16B 5HHXL 2ZWLT 1U8JB 5CKAA 3UTZB 3L9RB 3BVNA 4RMUA 4XMLL 1GHFL 4OCWL 2HWZH 3OTTA 5D9SB 3SY0A 1I3GH 2X5PA 3FHAA 1T0PB 3S9DB 3CFEA 2NZ9D 3RDTD 4QRPD 2NXYC 1KCUL 2HRPH 1DVFB 3AFLA 4XX1G 4PJBA 2VZUA 1J5OH 4P46B 3RGVC 5C9KA 3MA9L 5LQBH 5DMKB 1BJ1H 1JE6A 5T33H 3QG6A 1VFAA 2PO6D 1QRND 2NTFA 3FT2B 5F6IC 5JOPE 2NW2A 5DJDB 2C7UA 2GJ6D 5IMKA 3WXVH 1KJ2A 4Q9QL 4P5TB 4IOSD 3DX8B 1Y0LB 3T2QA 3ARPA 3K4AA 5HHQA 5H94B 2UWEB 5BO1H 1UACL 4HPYL 4C55A 4DK6A 2FHBA 4G8IB 1EFXB 3QIUA 5C7XH 1RZGB 3C5ZB 4YXKH 3HB3C 3RVTD 3CXDL 1MWAA 2IF7A 1HQRB 2F19H 3HRZB 4XBPB 3ARQA 3HE7B 2BSTB 3K8KA 2DQIL 4BZ1L 2FO1A 3H9SA 4Q2ZB 2P5WB 3RZCB 2X1PA 5SWSB 2DB8A 1YQ2A 4LSQL 5F9JB 1P9MC 1MRDL 1F4HA 4HXAH 4POUB 3I3EA 4N68A 1UXWB 3EDFA 4KUCF 4RDQF 5GRUL 1JYXA 3ULUE 4TQEH 4APQD 2NTSP 1F4XH 3DUHA 5CJOH 1R3IL 2BY0A 5DR5H 1XZ0A 4FQXB 1ETZB 1H3WM 1NBQA 1M6OB 1YNTA 2IADB 3PGFL 4ZUWA 2W1NA 3ARFA 2AJXH 2V5SA 4PP1C 4M4PA 1I3RB 1JPSH 2JIXD 5ELIA 5F1KC 1G6RH 4MD4A 4E41E 2B39A 1TIUA 3LEXA 1C5BL 4HIIA 1N59A 1ZGLM 3U4EB 1RZ8B 3ARSA 5ESAB 4GG8B 1F8TL 2HLAB 3T0XA 4LHUG 4HQQL 1IGML 5J06A 4J12A 4TULH 1LNUB 4NWUL 3LS5L 3DIFA 4XPAL 2LU7A 3ZYJA 4PLNC 5JQHC 5TQ0L 5D7JC 2RR3A 1U9KA 3I3DA 4PGCA 4N8VB 1J10A 3MOBL 3SGEH 3TEUA 1MFBH 4OF3A 5HGDA 5F7YC 2AV7A 1QD0A 3DVNA 3DX6A 2BVQB 4RFOL 4LSPH 4AK1A 4WFGE 3ESVF 3ZDZF 4PB9L 2NCMA 1U36A 3FRUB 1FRGL 2CKBL 3ALPA 1H8NA 2DYPB 3KLAA 3NZHH 2EDWA 1YNKL 4IBLT 2AXHA 3T0WA 4FQXC 1PG7H 2E9JA 1XFPA 4ZAKC 3WUWB 5JXEA 5AZ2H 4MDIB 4WW2C 4P2RE 5D7IF 1L9NA 4M62H 1NJ9B 4G5ZL 5DEGB 3RIAK 1E4KA 4F2MB 2XWTA 1I1FB 2FIRT 2VLLB 3PWPA 4HWZB 4X6BA 3R1GH 5K59E 3BAEL 4EEEA 4QRRA 2FEEL 1F11B 3V95A 4G7VH 2IMMA 4OKVA 3QQ9D 2X4NA 3BPLC 4N0UB 1SEQH 1C5BH 3UBXA 3FO0H 3L1OL 3QEQB 3ECBB 1JFQH 2BK8A 3MRMB 4NUGL 5DURB 3L95B 4QHNA 5H37H 4L29A 3ZE2E 1NKOA 2WM0A 4JO3L 4Z7VF 1C7SA 4NHUB 3X3FL 3PL6C 1WVZA 1T04A 4N5UA 1YYLH 2I27N 2AJSL 2FGWH 3LKSA 3BXNB 5E94B 4DKAA 3SDXE 3DOSA 4YX2H 3QJFB 1A02N 3CFJA 3RDTA 1R24B 1W72B 4F7MB 2AAVA 3MRIA 4JQXC 2NXZB 2YRPA 1XGRA 4JHAH 1MAKA 4XWOD 4FTVE 5IMKB 4N8VG 2EDXA 1LE9A 3CDYA 4XAKE 3RL2B 1MRFL 3QFDB 5L2JA 5I73B 1K4DB 4LEOA 2IGFL 5DWUL 3BP7B 4FFWD 3RVTC 4EIGB 4ELKB 2NW3B 4R0LC 4G42B 4UQ2A 5E95B 3P77B 4XVJL 3CXDH 5F89B 4GW4A 1NAKH 4IIQA 4YHML 3MCKB 1DUZA 3ULVH 4BZ2L 4ODXB 5IMLB 3PHQA 3PNWB 1WBZA 1II4E 3O9WA 4WU7B 3CJJA 2VR9A 1Q9LA 2ZUQC 3QO1B 1EAPB 1MCKA 1B0RB 1CLYL 3SCMB 4UT9H 1QLEL 1SJHA 2ZCKH 2X1OA 4XPHL 5DK0B 4TNVK 4MXQD 1DANT 3MV9E 3PHOA 4M1GL 5F9OL 5LGJA 5C0RH 2YS4A 2K9UA 2P5EA 5LWYH 3QJHB 5FCSH 2CXKA 4OD2B 2XWJA 4HIJA 3ZDYE 3W0WA 4NRZB 1H5BA 3QI9A 3QISA 2R2CA 1F4AA 1NUFA 3ILPA 4B5EA 3ZMRA 1Y6NR 1AKJB 4OGAC 1MF2L 5AZEL 4YHZH 2XTLA 2FZ3A 4KHXL 1N5YL 1N64L 3HRZA 4K3JH 1X5HA 4XBPA 2EE9A 3R8BB 1N5AB 2X9WA 25C8H 5IGXL 2HN7B 1U2HA 3K2UH 4MXVF 1AGFA 4OM1L 3FFDB 1AI1L 5MHSD 2NY2D 3FO9A 5BRZA 2FH8A 3MRLB 5ID0A 1E4XL 1TETL 3NCYP 1HOCB 4Z18A 2DI9A 4I77H 4UTAL 4XWGL 3RVWC 5DVMA 4HJJH 4S10A 4KTDL 5DC0A 3RPIB 3DETC 3HUJB 1NFDB 4HPYH 2R2HB 4PGCB 1C5CH 5BW7C 4QRSB 1XZ0B 1QFOA 4M1DH 3GMLB 1VFAB 5EZIL 3THMH 2N56A 4U1LA 5F88A 1QR4A 4MQ7B 1L6ZA 3SGKA 5B3JE 3KPTA 4ZUUA 5J89A 2ICES 3C5ZD 1YMMA 1IRAY 4H1LA 5KTEH 1CS6A 3ULSA 2DL9A 4OD1L 1NC4A 4X0KB 1U6AH 4Z7UB 1PD6A 1F58H 5DRZA 4FQJH 2OMBA 3HKFA 4JG0H 2F54B 4CW1B 4G6AD 3VFOB 1MQKL 2VLJE 1ORSA 1XH3A 3V0WH 4NQDB 3QQ3B 4F7EA 4QXGH 5HI4D 3OAUH 4HZAA 4HCRA 4WUUE 4F7MA 3WIIL 2O5YH 3HI1A 3SBWC 1C1EL 4JZJC 4BQBA 1E4KC 3IXAB 2Y7QA 2JJTA 1A14L 4C83B 3VFVB 1TVDA 4XCFH 3WIHL 5KSVA 3ORJA 4P3CH 2VN7A 4EI6A 4QXWA 3U36A 4ZO9A 3UBXB 1KELH 3OR7A 3IS0X 1A6ZA 4GOSA 2WZPD 2OP4L 5IFHL 5IP4A 1F3RB 5D1XC 2HRPL 1R3IH 3QDJD 5D7KD 4CKVX 5TE7H 4MQXC 3GK8H 1UZ8B 4OFVA 4EBQL 2AK4D 4S1QL 1HHKA 1VENA 4RZCB 2JKXA 2HTKC 4S1SH 2HA1A 4IRSC 3U30B 4FRWA 5F70A 3FOMB 1RIUH 1H5BB 3KXFA 1AY1L 4GRWF 1CDIA 2A77H 3O45B 5D71H 3MLYL 3ECBA 1V05A 2AJVL 1F00I 1AD0A 4WI9A 3MMEB 1RUKH 3RWGB 3OPZH 4PJ5B 4ONGL 2E7BA 1D5XA 1G7MA 1S7XB 1ZXQA 2F53D 4Y19B 5EH1A 3B9KA 1NMCB 1GVIA 5E7BA 3LS5H 4XNZC 5FHBH 3I6GB 4GXUM 5ISZB 2BVQA 1GGBL 1JPGA 3ET9F 4XPTH 2FNBA 4IOFC 3T0VA 3U48A 1VB9A 4XNUH 1A3QA 1A9EB 2W59A 3GM0A 3V9FA 1QEWA 1KIPB 4MLIA 1EBAA 1QFWH 4LIQL 2YPKB 5IVXF 3FZUD 4QCIB 5T1KA 4OF7A 2QQLL 2XN9A 3FQWB 4XBEL 3AREC 5T1LA 1ZK9A 1J1XH 1OAXL 4ODTH 1UH2A 4H8WH 4NC0B 2Q86B 4TUKH 4YHKL 4NRZA 2PW1A 1JHTA 3HUJF 4YH6A 3BYTA 3VA2C 1N8ZB 2E8YA 4TSAL 5LVEA 2BFVL 4XNXH 3I84A 3ARDA 3MJ7A 4DKEL 5HVGB 1H8OA 1I3RA 1BM3H 3TO4D 5DVNA 2VERN 1NMBL 3MRGA 5I2IA 4ZSOE 3V6OC 5FECA 3OV6A 2R4SL 5KVGL 1VFMA 4Z7WF 5GGQH 4IRZL 3O6KL 5T5FL 4S1QH 3RX5A 2BX5A 4CW1A 4JVUA 1DANU 1P4IL 1V7NH 2PXYC 5I1DA 4NC1E 4JRYA 5EOTA 5F1NB 1AGCA 1IE5A 4P4KC 1Z9OA 3QQNA 4WO4A 3HMXL 2FEDD 3RPIA 5AD0B 4PD4J 2DN7A 4EIZC 2P24B 1BFSA 1IAOB 3UXFA 1LEIA 3C6SB 3RBGA 4LPCA 4X6BB 4NWTH 1LDPL 1H15A 5EU6E 1JNLH 4R3SA 5SX5K 3T65B 1DBJL 3PP3H 5C0AB 5L0QB 3CZFA 1AGFB 5D1QB 3HFML 3QHFH 1J1OL 3MNWB 4U1GC 1T0NB 1D5IL 4CVWA 1Q0XL 1WTLA 3D0LB 5GISL 3GGWB 1WIPA 1QSZA 3MRFB 2Z92A 4CAGA 3HNTH 3NACH 3DO7B 4I8DA 4ZO6A 1NFDA 5I9QC 1E6JL 1P84K 5JIHA 2L7UA 3G6DL 3GMNA 4GG6A 3HZVA 3AXLB 3DHJA 4LLUA 4X4XB 4BKLB 3MRQB 2J6EH 2AV1A 4HIEA 4MZ3A 1F13A 3F5WA 4HJGB 2RQ8A 4LIQE 4JANB 4P3CL 5GQBA 1FVDA 4HWBH 1RU9L 4XXCC 1HINH 1JRHH 1NGWB 3P73B 4LBEB 5HVWA 1LHZA 3P4LA 1RHHA 4U1HA 1T1WB 5ITFA 4Q6IA 3PDOA 2Z0BA 3O3AA 3D39A 4OM0L 4NRXB 4XP1H 2E27H 4KUZL 4GKSB 2XQYG 3DXAB 3J7HA 3UMTA 1MUJA 4M3KB 4O4YL 5FOJA 3LZFH 4WV1A 2QL1A 3QUYA 4YHOL 1G0YR 4FZ8H 1N6VA 1BQSA 4GAYB 1OCWL 5MEQB 2FIKB 3NIDF 4YHZL 5GS0C 1RZFL 3LPFA 3C6LB 5IGXH 3TVMD 1VGKB 3MLZH 4M93C 2LTQB 3JV6B 3QI9B 2YUWA 5E8EA 3TJHD 1B3JA 1PSKH 2DQGH 3QUZD 1IC5L 1WZMA 4GRWE 4JG0L 1UH4A 4U49A 5D6DA 4XNYH 1TJIH 3SDCB 4O2FA 4WTZA 3NAAH 1GPOH 1IGTB 4XNZB 3IVKA 4YFLF 1EO8L 1J0YA 3T2NH 3PNWA 4OZIE 3VH8G 1JWUA 2H41A 3P0YH 1UWGH 5FIEA 2DIBA 5KSUA 1YC7A 1DLHA 5BOZG 4OLUL 4MHHG 3HPJB 4J3UA 2DI7A 4XVJH 3BW9B 1ED3B 5C9JB 5HGHA 2JB6B 4NO0A 1NBZB 2JK5A 4MQ7A 4PJDF 3IXAA 3FQTB 5D8JL 4A2LA 3EO9H 1H3XA 4G6FD 1S3KL 4UB0H 1PY9A 4KVNL 1L7IH 5H2BB 5JR1L 1LILA 4X80H 4UU9B 4MNQB 4PRHD 3FMGL 4MS8C 2P8MB 4QHLB 2BVUA 1FC1A 2EH7H 4JO2H 4KC3B 1MCFA 3LRGA 1YEIL 2F54A 2DBLL 2AK4B 5J9PA 3BQUA 4BZYA 4MD5A 4Y0GA 4ZDHB 5CBAB 2P48B 4JO3H 5IFJA 1RIVL 3L3HB 3B9VA 4BKLA 3GRWH 4JB9L 4H25A 4JM2C 5J13B 5GS1B 4B7LA 5E2UL 1CL7H 3KVQA 5KVDH 4KRPB 1IM9B 4JY5L 1BBJB 1DE4A 1OAQL 3SKUD 3MRHB 3EIFA 4DEPC 5JW3H 2VH5H 3LV3A 4OF8A 5DD1H 5BMFH 3VI3E 4EVNB 1KT2B 4CJ0A 3HN3A 2YR3A 4S1SL 5JOFA 2G75A 4HJ0D 1JF6A 5C07E 4P2RD 1SEBA 2FJFA 4MNGB 2ZG3A 3FT3A 4L3EA 4OGYH 3DV4B 2EDEA 3LKPA 1A6AA 4FTVD 1NLDH 3GSXB 3DO7A 3H3KA 4U3XA 4QLRA 4XNQB 1Q8MA 2FJHB 3D9AH 3SJVB 3WFZA 3W39A 1UA6H 2RGSA 5DMKA 4D0CA 2P24A 1D5BB 1LP9B 1G7JB 1PYWA 1V8HA 3O6FB 1JGVL 5K9QI 2HFEB 1BD2E 2VDRL 4JJHA 5T1MA 5HD8D 2ADFH 4ZAKD 3QPXH 1RQ5A 1R3HA 4EI6B 1QP1A 1WEJH 4FP8L 4LLQB 4O5LL 1MFCH 4YBQD 4FZEL 3GSNA 4JM2A 5HYSG 5D2NB 2P8LA 3FQRA 4M7ZC 1NDGB 3VD4A 2PO6A 4OUUA 4KKAC 1NSNH 3I6KB 3PP4L 3ZT5A 2A6IB 5E4EB 3D0VB 1AR1D 1I85C 3SKOA 4BSVB 4ZTOL 1NCUA 3DMMA 1KPUA 4NQUA 3GHBL 1HILB 3VD9A 4XI5C 2WBWB 5GPRA 4KV5E 4RA0C 3U9UA 4NT6A 3OG4B 4YC2C 2ZJSH 5TGBA 1QSEE 5JW5A 2P43B 3DLQR 5EFIB 4PLJC 5F7DB 5JHLL 2R1YA 1VDGA 1G7PA 5AZ2L 5LGHL 4U1HB 5JHDD 1JZ8A 4PJ8D 3WKML 1F4XL 4WU5A 5C0EA 1IAOA 3H9HA 4HS3B 4EN3D 4JDVB 5L6YH 5CAYB 1JPGB 1U93B 5T1DL 1MCRA 1P7QD 3LMJL 5D2LB 2F74A 1CFSA 4LNRB 3UPAA 3NCBB 4GAYA 5ENWA 4P23A 4PJ5E 5DJYA 3FZUC 4M6NH 3KYOA 3PDDA 4BZ1H 5ITBH 4H0IA 3FRPA 4LASL 5GRJH 5GS0H 4LCCB 5C0GA 4R7NA 3QXDA 1LEKB 1UCBH 5FM5O 4KI5D 5K9OB 5AUMA 3DMMD 1YY9D 3G08B 4RRPA 3U7YL 1JNNL 4TQEL 2J5LC 4S0SD 3G6AA 2PNDA 1F2XK 1EHNA 1T0MB 1TTUA 1VFUA 4HUWA 5LXGL 4I5BB 3GMQB 4BFIB 3NH7L 1KCKA 4NO5A 1WWBX 3DXAD 4NFDA 3DX9A 5HYSA 2BDNL 3L6FB 4XPHH 3SGDH 1OCWH 3RWHA 2F9BT 2Z9TA 3N85L 1MCOL 1T1YB 3MCLH 5SX5H 8CGTA 4NN5B 1BFTA 3WUWA 4ZS7L 1ES0B 2FLBT 1HSAB 3WE6A 3B5GA 2NX5E 4G8GD 4WUUA 1AGCB 4X9HA 4JFHE 3CK0H 4K23H 3CLEL 2WIIA 3FCTA 3LPWA 3E6HA 5HHMB 3WHXB 5JA9A 4JDTH 1FZJA 2DQEL 1HI6B 4M1CC 3MRQA 1LE5A 4H26B 1ONQA 5EU7E 1C12A 2QHRL 3TPUA 5T3XE 1KUMA 1VADB 1WIUA 3P0GB 1JWMA 4XMPH 1J1PL 1XIWB 1OWWA 5B8CB 5J6GA 2D0FA 4LCIH 4R90H 1N2RA 3BESR 5JMRA 2DQUH 5I1GL 1M7DA 1DLFL 3EYQC 1GGUA 1U8OA 2W0FB 2Z8SA 3Q6GH 5TH2A 3C08H 5DJ6B 2R8SL 1U3HD 3VXUD 4F7TB 4GAJH 2HH0H 1MH5A 3TN0D 3SE8L 3GSWB 1DQJA 1PKQE 7FABL 1H3VA 3UO1L 3VFGL 5J56B 2YC1A 1PSKL 4UDTB 4R8WL 4YUEL 3DPBA 5J4MA 3N1GC 1RUMH 2X89D 2OTPA 3K74B 1QZ1A 4OT1L 5IVXA 2NTFB 3FT2A 3VGAB 3QUMB 3KPPA 1FNSH 1MCDA 1ORQA 4HKJB 5D1ZB 1G6RA 2DQFA 2R0ZL 4IDJH 4NKIL 4MAYD 3RAJL 4DGVH 2XA8L 5LBSH 2O26U 3RVUD 1NKRA 1AHWB 1ZHLB 5F9WC 3S96B 1FBIL 3H0TA 4RDQG 3F6IA 2CLRB 4MA8L 2JCCB 4JFYA 1J1XL 1OAXH 5I18H 2A1WH 1JI2A 5SWZD 4W70A 2H2SD 5HPMB 4NC2B 2HT2D 3CFKA 2W0PA 5HDQH 4HK0B 1S7RA 4PRIA 2AABL 3SGJA 4D0CB 2VLJA 4DFIA 1LP9A 4ELMA 1ZLSH 3V7AE 1UG9A 3ARBD 2Y5TA 4OZIB 3TN0A 3FAXA 4LHUB 4UIMB 4J23A 5ESQB 3C60B 4JFFE 4M7LL 4G9FB 4PJFA 8FABB 1I9IL 5HHVH 2P5EB 2ILLA 5FYJH 3TF7C 1CDUA 1H3PH 1N6UA 1MREL 1QRNB 1U91B 5FK9B 1MFEL 4PY8J 2XG5A 3HE7C 4MJID 2WBKA 4Y5XA 5B22A 1GHFH 4I4WB 4JDVA 2YD3A 3B6SB 4OCWH 4ZTPL 3ULUD 2X4PB 1GAFL 4UT6L 4JRYD 3V2AR 1UQSB 2NX5D 4JN2B 3KPRB 3EYSH 5GRVL 1MHHB 3UZEA 3W0WD 4L8DB 3EOTL 5KS9E 5SWQB 5EOQL 4QOKA 4JLRB 5EZJA 2A38A 1NL0H 4KZEL 1A1MA 1JI1A 4OF0A 3DIFB 3F7YB 4HUUB 5F7DA 1KB5H 4PJ7F 3S3SA 3E2HB 1HCVA 1TPXB 3PE9A 3RWIA 3QNYA 5HVFB 5I75C 4OI7A 5HDQL 3NCJH 3SN6N 4Z5RA 4HPOL 4BSWA 1UB6A 1YN6A 1TENA 2X4OA 2X4TB 4MJ2A 4P3DA 5D96B 1OAKH 4M7ZB 2YD1A 5EIQA 2JIXB 1DQJB 3O41A 3D5OF 2E3VA 3QNXB 1XH3B 5AWNL 1I1AB 1I7TA 1QSFE 1FP5A 1A9BA 1OTSD 4G6JL 2HVJB 3OX8A 3UJIL 43CAA 3C5ZA 3T3MF 4XP1L 3MO1B 4HXBL 1LP9F 3UJJL 1YNLL 2OQJA 3P4OA 2B1AL 4ZFOB 4LVHC 1TTFA 4W4OA 1KN4L 5D96C 5MEOA 4Y1AD 4NT6B 1T3FA 3VD3A 1H9VA 2ZUXA 1YEFL 3RU8H 1ZEAL 4UAOC 5GZNC 2XZCL 2YKLL 4I13B 3BYYA 1ES0A 1Q1JH 1NBVH 3QDGA 1BAFL 2WINA 5IJKC 4PRBB 3LKSB 2E9IA 2EIDA 4Y5YC 3WHXA 5IVZB 4WI3A 4LSTH 5FYKL 2EXYD 5FYLE 4LSRL 4PJCA 4ZMAT 2FSEB 3JWNC 3VFPA 5GJTH 1INDH 5J13C 3WIIH 3EGSA 1HXYB 4WFFD 3K1KC 1U3JA 4D3CL 3G08A 4PJEF 4H1LH 4NZTH 2VLRB 4HKBA 4UNUA 3RJDA 3BX7C 1V3KA 2LQRA 4U1LB 5C0JA 3S5LG 3BH9A 1X44A 4FNLH 3H42H 3DX7B 3LY6A 3QEHA 4L3CB 1GGCH 1I8KA 4MWFB 4Z8FL 1A7RH 1I9RH 1Y6KR 4ZFFA 4PJCF 4G9FE 3MLVH 3Q6FB 5BRZB 4GAGH 5IB2A 1YNLH 4AG4L 4AL8L 1MRCL 2PKDA 4S1DD 3INUH 5C0CE 4XCNB 4YPGB 5IROA 1I7RA 1JGEB 5CP7B 5CZKA 4JHWL 5EFIA 2GJJA 3ULVC 5J12C 3AS0A 1TITA 3IFLL 4XVSL 4D94A 4XP5H 3F7QA 4QYOB 4P9ML