3LEYL

2f5 epitope scaffold elicited anti-hiv-1 monoclonal antibody 6a7 in complex with hiv-1 gp41
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
216
Chain Sequence
b'DVVMTQTPLSLSVTLGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLASGVPDRFTGSGSGTDFTLKINRVEAEDLGIYYCWQGTHFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6a7 Antibody Heavy Chain
molecule tags Immune system
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
total genus 53
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyL01
4AEHH 5JOFB 1W72L 4Q7DA 1MLBA 1XGQA 1MAKA 2WIMA 4AY0A 1SYSB 3TH4T 5HHMD 3W0WB 4HXBL 2DQDL 5I6XB 2VLKB 3INUL 2JJUA 5DRZB 3C09C 2W1NA 1FPTH 4Z7WF 1UG9A 2NY1D 3CFJB 4OCXL 4MSWA 1WFUA 3DSFL 5I1AB 3QIUA 3ARFD 3DO3A 3IFLL 2H9GA 3PWPB 4NWUH 2E3VA 3O2DL 5F9OL 2HJFA 1N6UA 2UY6A 4Y19E 2X1OA 4PJ9B 3BKYL 4Q2ZB 3SDDB 3B9AA 3BZEB 3FFCA 4UAOC 4PTTB 4X6DF 5TE7L 2EZ0C 3V7MA 3DWTA 2DF3A 2EH8L 2CDFB 2FH6A 3WFDH 3MLPA 3X13B 3RU8L 5F6IC 5FGRA 3HZKB 2MPAH 2EIZA 2D7NA 2CMRH 3R06A 1IC5H 2PR4L 2VWEE 3H9YA 1XZ0B 3GGWB 5HYQB 1M7XA 2YUXA 3RTQB 4YWGL 2W59A 1UXSA 4RX4A 4OB5L 4HZAA 3MFFB 2Z31D 1BFTA 1BGXL 5BCAA 4HK0A 4WDIB 5KS9A 4P3DB 3ARWA 1TPXB 2A2QT 4XBEH 1LILA 2E7MA 2VDLL 2YPVL 5J13C 2AV1B 3VXSB 5DEFB 1B3JA 4LF3B 5C2BL 4FTVA 5L6YH 3GK8L 2V17H 2UWEA 1YQ2A 5C0CE 3MZGB 4TN9A 1YJDL 4F8QA 3OAYH 5E4EB 1QBBA 1LQSR 2PTTA 4KAQL 3RWCA 5DUBB 2A0LC 3RUGF 3DVFA 3DV4B 1OM3H 2XWTB 2COQA 1T1XB 3LEYH 2CDFA 4I0KA 1A2YB 4RGND 3K1DA 4J3OC 1G6VK 2NYYD 2O5YL 3VG0L 3X14B 4LLQB 3QRFM 3G5XB 3VI4F 4GSDH 4J4PA 3Q6GL 3QIWA 3RPIB 5I1JL 1DQMH 4M8QA 4PJDE 4FZ8L 4QTHA 4DK6A 3QCVL 4N0CC 2FLBT 1KLUA 1MCHA 1INDH 4HWEL 4O02H 1NC2A 4JDZB 1YJDH 3ELAT 5EU4B 4G5ZH 1ZSDA 3V4UL 4F15C 1VSCA 2E8YA 4JFDB 5F6HI 4HFUL 5TE6H 3QXWA 4OIIL 5JW3L 4JO1L 4G9DB 3UTPD 2Z91A 1ZXQA 1P1ZA 2Z8RA 5F7FA 5FYJU 1YEGH 4TUOA 4F7MB 1DBJL 4TQEL 1E6OH 5IVZB 2I24N 1JPGB 2DJ4A 5JOFA 1RK1A 1J8HA 1JTTA 2FB4L 3O9WB 4KZEH 5A2JH 3V6OC 5LXGL 3RP1A 3MJ8B 5CLTA 1K6QL 2UV3A 5C0EA 3GBNL 3V52H 1SEBB 1CGVA 1K4DB 4QRUB 3N85L 5F21B 5KANI 3FT2B 3NAAH 1HEZB 5D7LB 4N0UB 5CLWA 1DN0A 3TZVC 3SKNA 3ECBB 4KMLB 1AXSA 3N1PC 4HIEA 1WTLA 3KPOA 4PV8A 4WU5B 1U3HD 3LMJL 1PZUB 1OT1A 2FJFB 1HN1A 1ZHBB 5F93C 3PP3H 1NANI 2G75A 4G43A 4O4YH 2BVUA 3OG6B 4O9HL 1I7RB 5H2BB 2VZVA 1EFXD 3IDJB 2ENYA 3MRJA 3O4LA 4AL8H 1HZHL 4NKOA 3K74B 4NKMB 2YUVA 4R7NA 1WICA 1WFOA 3F7QA 4HHAB 2HTKC 2AJSL 4C54A 4M48L 3IJSA 4M7KH 2BHZA 1SQ2N 3IFOB 1BBDL 1BMGA 1OP9A 2DWEB 2EDWA 2E27H 4QT5B 4TTDD 5DWUL 3RZCB 3BZFA 1EUUA 1S5HA 1XH3B 3CSYB 4Y5VC 4YHNB 5ESAA 2FZ3A 2OLDA 3GKWL 3CX5J 3DI2B 4MQ7A 3MCLH 2C3GA 4UV4H 3RY5A 3T3PE 3E8UH 5TDPA 1AHWB 1BQLL 1NFDE 4LVOC 5EBLB 2C1PA 1A7OH 4KMQA 4RIRB 1CZ8L 3OGCA 3I9GH 1GSMA 1U58A 5FYJH 4TUKH 3EBAA 3QDMA 5EU4A 5FA3B 3IJYB 2CLZB 4NO0A 2NY5H 1T1XA 5CJOH 2HFEB 1KNOA 1FIGL 1MFAH 1EHNA 1JTPA 1T2QH 3JSSA 4XMPH 3CK0L 4PPTA 4YHLL 1JZ2A 4L4JA 3KYNA 2VMFA 1AO7B 3OV6A 3ZHLA 4QOKD 4EUPG 4R2GD 1WV7T 2N1KA 3DROA 4IHOB 2WAHA 4NC1C 3U7WH 3NCJL 2ADFH 3PHSA 4NQCE 5E99H 1DTUA 3D2UD 3I02B 2DM3A 2DWEA 2VH5H 3A6BH 1OTSD 2VR9A 3H9ZA 5C0GB 3TN0B 5DURD 3MBEB 1I7TB 1NMCB 5IESL 4DN4L 3HPJB 1N59B 3O11A 2VAAA 4HCRA 3HC0A 1CTOA 1J0IA 6CGTA 4KK6C 3KXFB 3P73A 1WBXA 1INDL 5F1NB 1NCUA 1F2XK 2BVQB 1NCDL 2NQCA 3KPLB 4TVPH 2VLRB 3UTTB 4Y1AA 5I1JH 2CIKB 4YNYB 3UDWA 2OZ4L 2XXMB 5EDXA 3OWEA 2APBA 3CZFB 4JFHE 4PJDB 4LARH 4JKWA 5J3HD 2R15A 3LEYL 1CLZL 1KEML 4OCWH 5I74C 4XPGH 1KTKE 4FP8L 5EO0A 1MELA 1TVBB 3MA9H 3HNVH 5SWQA 4NQSB 5IB5B 5AD0B 4G9FB 5EUOB 3SKUD 2AEPH 2OJEB 1T04B 4OJFL 4HUKB 4CADA 4XX1E 3PABA 3RZCA 4O51B 4M3JA 2NY3B 5IB1A 3GK8H 1YEJH 2XPGA 3C5SB 1QHOA 2O61B 4KQ3H 3O11B 3P11H 4PR5B 5SV4A 1B90A 3D85A 3TYFA 4I5BA 3B83A 4LLDA 2FO1A 5C86A 1YMMA 1F11A 4LIQL 2GCYB 2J6EH 3QUYC 4HXAL 3AS3A 4MVBC 1P9MA 3ARDC 3G6JB 5FKPA 2NXZB 4DN3L 4XAKD 5IBUB 2PYFA 3FO2A 4WUUB 5EN2A 3WKMH 3LKSA 1DUYA 5IGXH 4HKBA 4TUKL 4PJDF 3KPRD 2R1XB 2NX5E 4YHML 1AO7A 3M1BB 1YECL 2HT4C 4BSVB 4DN3H 3B3IA 4MXQC 5C6TL 4ONHA 3TBTA 4PGEB 4XVTL 4KUCD 3ARBD 4N90D 5DC0A 5D1XC 2HKFL 2Y06H 2OK0L 4LU5L 5HGAA 1E4WH 4PLNC 1FVCA 3GKWH 4KDTA 1J1OH 2A38A 1ZOXA 3TPKA 3PQYB 3SJVA 1OP3K 1TENA 5AYUL 4JM2F 5ALCH 2P42B 4KZDL 1OP5K 1VA9A 3OXSA 4GUPA 1DE4A 2VTFA 4IDJL 3GJFH 4L4VA 3CFDA 3IGAB 4JN1H 1GC1H 4YFDB 5BJTA 2OR7A 2Y1VA 3VFSA 3ZKMC 5D7JA 3W39B 1C16A 4FG6C 3FQTA 4M7LL 3N0PB 1IQWL 1U93B 5I8CB 4XNUL 1P84J 2EDLA 4LNRB 5J1AA 2ZNXA 2VC2L 3P0GB 4TNVK 4ZTPH 2MWCA 5D2NA 3CZFA 1XF5A 4BSVA 4QRSB 4WTZG 3STLA 5LVEA 2QR0A 3DVNB 1UQSB 5EG6C 4BELD 4Z76B 2JJVA 4GAYB 3A0OA 4P2CG 1WT5A 3GHEL 3QO0A 2IPTH 3DXAA 1UEMA 2WQRA 4IEFB 5ESQA 5L8JB 1RD6A 3GBML 2Q86B 1I7UA 3FAXA 4U3XA 4WFHE 1F45A 3HZMB 4HS3A 3B6SB 3ARDB 1DEEA 5I30H 4O51A 3UTTA 4YXLL 1TVDA 4NQCB 4EUPA 3L6FA 1F4AA 1T7YA 2HFFB 2QLVB 4WUKH 4LBEB 4L4VB 5C3TA 2JJSA 2DWDA 5JIKA 3RWDA 4KU1A 4A6YA 2YKLH 4JFFB 4CGTA 1H3GA 5CJQH 5GRJL 4D0DA 2JELL 4Q6IA 5DHYB 5FYLD 3UC0H 1AGDA 3ZDXE 2EDFA 2H6PB 3FONA 4J1UB 4HWBL 1BOGA 5D7SL 4QHLB 4RWYL 3ULVE 3IXAB 3GUTA 1DANT 4IOIA 1ONQA 2UY7A 4JGJA 4YHLH 4YBLC 1NBVH 4XH2A 4PY8J 4PREB 3VI4E 3H9HB 2CK0L 3EJYD 5JW4M 5GGVY 4HUWB 1S8DA 4PJFA 1MAML 2QHRH 3QIUD 2H32A 4Y2OA 4YZFF 3CCHB 4PRNA 3VI3F 4NQED 2AKRB 2B8OT 2NY4C 4R2GC 1ZSDB 4LDLB 2J1KA 3MJ7B 3I6GA 3MLVL 3S7GA 5FM4A 1U8OA 3SQBA 3EJZC 3HC4L 4UIKL 1CXHA 4WTWA 3VFTB 1G6RL 4F7MA 4Y4HA 5CGTA 3WE6B 3VW3H 3PG2A 4HX1A 4MX7B 3GSUA 4ZTOL 1QA9B 1VACB 4KROC 3LKOA 4UU9A 3HE6C 4JKKA 3Q0HA 3C8HA 4HT1L 4QF1A 4EN3B 3MLRL 5CD3A 2CKNA 5BS0A 5KSVA 3IDGA 1KENH 1X5AA 3LAFA 4M6MH 4OCYL 2YMXL 3HE7B 4NJAL 4WIQA 2DQUH 5DEZA 1J12A 2XY1A 2PUQT 3F12A 3MBEC 4RGOL 2OTUA 3FN3A 4PV8B 4WU5A 1F2QA 5C0AE 1JHKL 3RL2A 1V7MH 3WHE1 3GI8L 4LAQL 2XWTA 1RZGB 2EDRA 2GT9A 3KPNB 4S1SL 5IP4A 4XI5C 3T1FB 2WLZA 2MTPA 5GSVA 1NFDA 3KYOB 1XF5B 2UZYB 3I2CH 3RPIA 2FJGA 4N0FA 4KMTL 3L1OH 5D9SB 1AC6A 1CQKA 4J3SA 4MA1B 3ARVA 5BS0B 2F53E 2DYPD 4PP2B 1LO3H 1AQDA 3VD3A 2LE9A 1JPSL 1FNAA 1KCKA 1PVHA 2O93L 8CGTA 1HYRC 5JW3H 5IKCA 1R3KB 3PHQA 5EBWA 2GK0A 2ADJA 3O6ML 1QUNA 2Z8VC 5T1MB 3CSBA 3T3ME 4N9GA 2F15A 3SJVD 1FGVH 4N0UA 2E7LA 2LU3A 1QRNB 1X5KA 1NBVL 1YQVL 3O2DA 1FGVL 1R24A 2P5WB 4R26L 1PX4A 4NO0B 4LHUD 2GT9B 2FLRT 4BZ2H 1MHPH 1C12A 1TJGH 4O2FB 4G6FB 3RHWK 1DUZB 4NUGL 4X6EB 3EGSA 4RAUA 4X7SL 3RNKA 3C60A 1NLDH 2DICA 2DTML 1CI5A 1JPTH 2V5TA 3MRKB 3QDHA 4F7CB 4HH9A 2BMKB 1QSFD 5DJDA 1DJSA 4PRNB 3P9WB 3U9PL 5KG9B 3MUZ1 3S36L 2OR8A 1CDYA 3BI9X 2R69H 3ARQA 4M00A 5MI0B 2NMSA 2V17L 2PXYB 4LCCB 2WZPD 3UAJD 5L6YL 3D5OF 3QUXA 3LN4A 4OD1H 1T66C 2DI9A 5GISH 1OOAA 3IDJA 4NKOB 3QPXH 4XPHH 1D3CA 2AXHA 3GRWA 4RRPA 1GL4B 5IMKB 1NGYB 5JIIA 3MMEA 4FQ2H 4OV5A 3MZTA 3TJEH 2KH2B 1DL7H 1KCRH 2F5BH 4Q9CA 1ZMYA 2Q3ZA 1RZGA 4X7CC 4MJ6A 3GSQB 2YMXH 4JKPL 2FR4A 1TLKA 5HHPB 3QFJD 4DZBA 5GZNC 5KZCD 4EDWL 5I76B 2OSLA 5I71B 2ESVA 2X4OA 4NKIH 5AWNH 4HT1H 5TDPB 1RFDH 2EXWD 3BQUB 4FMKA 5CCKH 5ALCL 5HVGB 5JPMB 1U8MA 3RL2B 4YQXL 4MJIB 4L3CA 32C2A 4WI7A 2OI9C 4HBQA 3HC4H 2YA2A 2K1MA 2XNAB 4XCCH 1DQQB 1EK3A 3TPUB 4ZO8A 1IT9L 3DMMA 4U6YB 1RUQL 1D5XB 4L8CB 1BIIB 2V2XB 4Y16C 2EYRA 4Y4FB 3UC0L 4PJGE 3OG4B 2XN9E 2KL6A 3AY4C 3HR6A 3ARFC 4QCIB 3FRUA 5TF1H 2CK0H 5T3XH 3P30H 4ZXBD 1EIBA 3DGGB 3K3QA 3RBGA 5JDSA 1P7HL 4LCWB 5JR1H 4MD0A 3LV3A 4NUJA 3FTGA 3EW3B 2XFXB 4W4NA 3DUSA 3T8XB 5DFTA 3PWPE 3MNZA 2VXSL 2OSLB 4X6EA 5D71L 1C1EH 4QTHB 1KN4H 4L9LA 4TSBH 3VFRA 4YZFE 1EDQA 3HC3L 5KSUB 5FOBB 5ILTH 4OZGB 1CF8L 2ZUUA 4FTVD 5BQ7A 5DRWB 1KPVB 3SDYH 3JV6B 2I9TB 3QNZB 5L2KB 4LCCC 2A6IA 3GSXA 1U91A 3VXSD 3C6SB 4QXUL 3OPZL 5DMIL 1HINL 2X1WL 1ADQH 5FM5O 1ERNA 3LSOA 4GS7C 4MS8C 3X17A 3EGSB 3IGAA 3CFDB 2VXQL 4OCWL 3NMEA 2V9QA 4NIKB 4UT7H 4P3WA 4DW2L 2X89D 4J12A 1F3DJ 1CFNB 3BP5A 4OZ4B 4L29A 4NQUA 5J13B 3SKJL 3MXVL 4OD2A 4OF0A 2VC2H 2IG2L 4ZTPL 1S9VB 3GMLB 1B0RA 1YN6A 1G7PB 1KJMB 4BKLB 1TTUA 1OTTD 4HCRL 2OP4H 3B3IB 4M6NL 3WS6C 1KEGH 1VEMA 5IM7B 2AXJA 3KJ6H 3AROA 5HYJE 4G9FD 3UJJL 5IW6A 3QJFB 4JQVA 3LZFL 3MV8E 4F80A 1FZJB 3ARYA 4JHWL 4U33A 4WW2B 5E8DL 5MERB 5BXFA 5INCA 4POZC 4BFBD 4P2OB 3OAZK 5B4MC 3WKML 1FG2A 1P7QD 2AABL 3VE0A 3O4OB 2EYTA 4WEBH 1AJ7L 5HHNB 2GAZB 2V6HA 3OJMB 4LSTL 3HI5L 3LRSB 2VKXA 43CAA 1RUML 4HZLA 4JFYA 5TGBB 1NAML 3IJSB 3QQ3B 3SHSA 3W39A 5CJOL 5HGHB 1TITA 2ICEB 3QFDA 5CBAB 3NH7H 5IW1A 5IBLC 4XH2B 1G7QB 3ULVF 3T8XA 3MSPA 4YGVA 3T2QA 3GSOA 2AXFA 4LEXL 1X9QA 1U8LA 4YDIL 5ANME 5L88H 2VABA 1IGCL 2AS5M 3T2PA 4FQHA 3Q6FA 2XICA 2GSIA 3V0WL 5LGJA 3ILQD 2V7NA 4JM4H 5ISZB 1S3KH 3QDMB 4HIHA 1G7JB 4K2UH 3ARDA 2R0ZH 5EIQA 1EJOH 1CGXA 1SY6H 3D9AH 4ZUUB 1TPXC 2ORBL 4MJ5B 1YEJL 4MDJA 5ERWA 4PBXA 3MXWH 3SQOH 3ULUL 5KSBA 2V5MA 2X9YA 3QA3A 3DVNA 1ULVA 2BNRD 3QDGA 2LABA 5GRYA 3ZSTA 4HJJH 5FECB 3VWKC 4RFNB 1FDLL 4Z0BH 4JY5H 4F7EA 5EUKA 2VXQH 1I1CA 4X9HA 1EBPA 3LPFA 4LARL 4Y1AE 3ULUF 2ATKA 5AUMB 3CXDL 1VKXB 1N4XL 5HVHB 2VDOH 2AXFB 3MPCA 3REVB 3HPJA 2J8UB 1JI2A 1Z0MA 3WNKA 4X4YB 3C8KA 3WXVL 3EIFA 3RZCD 2APFA 5E03A 3MV7A 5E8OB 1CK0H 5FYKD 3QUML 3KS0H 3N85H 1CFTA 4L5FH 4XZUB 1B6UA 4JREC 3A67H 4K23L 4Q6IB 1CE6A 3HPLB 3KPQB 2ZCKH 4WW2A 5L8KB 5T1LA 1WAAA 2P5EE 2ED7A 1MWAH 4NN6B 1FG2B 4PB0H 1TNMA 1MY5A 4MZ2A 2Y36H 3QDGB 1S7TA 4NWTL 1MRFH 5D6CB 4I77H 3MO1A 5IF0B 3CU7A 4AH2A 5GGQL 3P9MA 5IR1A 2R2EA 4WHTB 4OQ1A 4GXVH 1I4FB 5D7LD 4KQ4L 1PZ5A 3CXDH 2ZCLH 3VH8B 5HSFA 4P4KA 2XWJB 3GB7A 2BVPA 2PYEE 4QRRE 4YX2L 5TQ0L 2Q20A 5CHNA 1S7SB 4Z0BL 1PSKH 1N3NA 2R1WA 5B8CB 3D85B 1P4BH 4Y4HB 3WE6A 1WTGT 3OAZH 5ANMA 1LDPL 3MV11 5C09D 1OWRM 3U1SL 2HMID 4B41A 5E00A 1UM4L 2R2HA 1JNJA 5B39G 5J89A 1S7XA 3AREC 4MA8L 1G0XA 4XRCA 1U8IA 4WU7B 2BFVL 3P4MB 1R3LA 4BH7B 4G3YH 1MCRA 3KLHC 3BRFA 2WINA 2VLJB 1HI6A 1MCQA 4R97C 4G80A 1DL7L 2F5BL 5DJZA 5FGBA 3QDME 3RX5A 2CUIA 4P4RB 4GXUN 5DUPH 3ROLB 3VWKB 5FUOL 3GMQA 1LP9A 1QFOA 2EKSB 1WFTA 2HVJA 2BY0A 4JRXD 3SPVB 5IR1B 1A0QH 1KLUB 2KZWA 1TCMA 3CFEA 2JK5A 3BN9C 2YPLD 3RWEB 1LK3H 4PG9B 2NW3A 2NX5B 1PKOA 5FKAA 3IXTA 4KKLD 2C1OB 4JQIH 4HG4K 5DSCA 3HZVA 3F7RA 1NCCH 5C92A 2HLAB 4R7DB 2Y5TA 1YEHL 4X80L 4ZOEA 4MQSB 5F1OB 4Z7VA 1T0MB 2DTMH 3O4LD 5E94B 4O5LH 3V5HB 1XF4A 1P7QB 3BMWA 5E9DA 3V52L 2AK4B 3GRWL 2Q8BH 4C56E 4PJXE 3ESVF 3PHOA 4UQ3B 4X6CE 3K81A 5JDJA 1B0WA 3CXHJ 4AG4H 2QQLH 2Z31B 3FKUS 4X99A 5DMGD 1DBBL 4KZEL 4JHBA 3DYMA 4QHMB 3JV4B 2FRGP 3SE3A 2YD4A 4G6AC 3ZTJG 3QUZD 2QBWA 3HZMA 4ODBD 4S1RL 1DBAL 3O6MH 1RJCA 4PJXF 3V4VL 3WDHA 4HAFA 2VDOL 1MJ8H 4LSRH 1KTLA 4XI5D 4P59L 1OGAA 3H42L 1I8KA 2DDQL 3NZHL 4RMWA 4N8CH 2GFBB 4TTDC 3GSNB 2Y23A 3C60D 1XF2A 4FABL 3DX6B 3MX0A 4IJ3C 1NUGA 1XF4B 3OKYA 4YHOL 5T1LD 4TNWF 4GRWH 1HHKB 3I6LE 2GI7A 1TZIA 2BJMH 2H6PA 3FONB 5KG9A 5F9AC 1HNGA 1VB9A 4HMDA 3TFKC 4KHTH 3ZO0A 3IRZA 2AJXH 3SY0B 4IOIB 5C0BA 3UTQA 2K9UA 3BT2H 1X5YA 3QUXD 1MHCA 1RSFA 2IQ9H 3VGHA 1CL7I 4D0BB 5LQBL 3S35H 5A16A 1FJ1B 4K71C 4XNZB 1CS6A 3OAUH 5TFSL 4XMLL 3CFEB 5KW9L 3ES6B 1WIUA 3I6GB 1Q72L 4PRIB 1OGAB 3P30L 1AGEB 5INDB 4EIGB 4X7EC 5FKAB 5H37H 4NNPL 4OZFH 3U0PA 4PJFE 4I0PC 4U6XA 5EWIH 4PRDB 4Y4FD 1ODAA 2ESVD 3L95A 2H26B 5D5MA 3VFNB 2EC9U 4HHAA 3MRHA 3ZL4L 1RZKL 4OZ4A 3I02A 1I9RH 4NWUL 5HDLA 4HWUA 1T03L 3CFCH 3RGVA 4GRWE 2H1PL 1ITCA 4BSWB 1G1YA 3CC5A 1M4KA 5SX4H 4MJID 1A3QA 1M6OB 1BD2D 3CJJA 3SE8L 5EZOL 5CCKL 3LS5L 4JG0H 1HWHB 2FWOA 5D8JH 4YFEA 2EEDA 4Q74A 3OF6D 4C56B 5F9OH 5CSGA 2OQJA 5ID1B 1ZA3A 2CO6B 4WW1A 3EOBB 1NCBL 4HMEA 3S96B 3ARGB 1XF3A 2V7HA 2IQAB 3HRPA 4WCYH 3QWRD 4OLXH 1RZ7H 2FO4A 3QIWD 3GNML 3C09B 1H9VA 3QAZB 3BQUC 3CUPB 1N7MH 35C8L 4KJPC 4UT7L 4WI9A 4S1QL 1FO0A 1UYWL 2QADD 4JN2A 4JVUA 4DVRH 1QLRB 2XA8H 5C07D 2ZG1A 5FUCE 1ORSA 4MA3A 3SOBH 2A6JA 5DMIH 3RTQC 2ZOLB 3SY0A 1IJ9A 1ETZA 3L5XL 1LNUA 4FFWD 2A1WL 3AM8A 2FWOB 5H94A 1UACH 4WHCA 1NFDF 2UWEB 5T1KD 1XGYL 3QZWB 4U6HB 3FB8A 1ZA3B 1X4ZA 3RVWC 2YOCA 1XF2B 3SO3C 1EFXA 1A6UL 5F89A 3ARFA 3LKQB 3PL6A 1KBGL 1RUPH 4KVNH 4AEIH 1HHKA 4GAJL 5CS7A 5I75C 2YD1A 1FP5A 1ZANL 2MCG1 4EI5B 3VXNA 2EDEA 5JR1L 1NQBA 2ARWA 5CUSL 1UH4A 1MCBA 1J88A 1EGJL 3RNKB 2A6KB 4UV7L 3S34L 3S88H 3U0PB 3SN6N 2M26A 1MCOH 1EMTH 1YEKL 3QIWB 3O3AA 1EO8H 2PCPB 1MQ8A 3B2VH 1RV6X 4LRNL 3QCUL 3Q2CA 2W07A 3LKNB 5EO1A 1LGVA 4MD4A 3G04A 4JAMA 4ETQA 4JZOA 1QYGL 4DFIA 3RWHB 1JPSH 4H25B 3FQRA 1ZVYA 5F3BA 3ULUE 4LK4A 4LSSL 3EYFB 1JWMB 1QO3B 3ROOA 2DM7A 3ZKSD 1LEGB 4P57A 1FYTD 1A3RL 4HLZG 5AG9A 3UBXG 1SMOA 3H2WA 3CFCL 1J86A 3RA7L 1AO7E 3IU3B 5GGTL 2WWMC 2O5ZL 3HI6L 3HI1B 1I75A 1TTFA 3QUMB 4I4WB 4KJWD 2AVGA 3GMNA 1E28A 3PL6B 2DQIL 4KPHL 3QRGL 4ODWB 4M9OA 3WFEH 4PJ7A 1EEQA 4G6JL 1YECH 2L7JA 2P47B 4EDWH 1TTGA 1JHTA 2VZ1A 3LD8C 2RFXA 5IUSA 2IGFL 2R56L 5AYQA 1MUJB 1J0ZA 4I9WE 4OFDA 1U8LB 5BZDA 4HJGB 2DBLL 5F7NC 3UTSD 4H0IA 1MEXL 4WHTA 1XEDA 2K7PA 2CRIA 5CZXD 5DC4B 4PRIE 4M6ML 5BO1L 1A7BA 4EN3C 3B6SA 1LEIA 3X3FL 3CFKB 4PJCA 4KKBC 3UYPA 1AXTL 2BOCA 5DTFB 1UKQA 4KTYA 1UXWB 2P8MA 3K4ZA 4HJ0C 4NO5B 1A7RL 5C08D 3VXOB 2OXHA 3LPGA 4W6WB 1HH6A 4FQXB 3RVTC 1NSNH 2HFTA 2DMBA 3VCLB 5CEYA 1PDKA 2CH8A 4GAGL 1CLZH 4R96B 1WEJH 4PD4K 3O2VH 5F8RC 5ACMA 2YPKB 1KJ2L 2APWA 4TOYH 1II4E 1QBMH 5JW4Q 2ICES 3PWVA 4YHKH 2YSSB 2Z93B 1F4WH 5D1ZD 5FO8A 4XP4H 4XP5H 4L8BB 1L4IA 4UNUA 2QHRL 5MHSE 3DTXB 3FB6B 1KPUA 4P0DA 1IAII 3P4NB 4LKXB 3TT3H 1KGCE 2AJUL 1BD2A 3MGAA 4UOJA 2YBRB 4AG4L 1I4FA 4RWYH 5GZOC 5JPNA 1A14H 1YC8A 4E41E 1CFVH 1F3JB 3LD8B 2C4FU 1ZT1A 1MHHB 3L7FA 5HGBB 3OQ3B 4MDIA 4LPCA 4JY4A 4GKNA 4F9PC 2FX7L 1FBIL 4GO6B 3VJ6A 4X9GA 3AAZB 3HMXH 4OLUH 5GZND 3MLWL 1ZWIB 1VCAA 3ZHKA 4YPGB 4PG2A 2YRZA 2ADFL 4U6VL 3V5HA 3VRIB 1QNZH 3V95A 3KPMA 3OXRB 4J4PD 4ESKA 1W72B 5E70A 3I2CL 3HNTH 5I2IB 2W0KA 5CD3B 1L7IL 5CMAB 1S7UB 3GRWH 3ARBA 3UP1A 2VNCA 5IB3A 1PQZB 1WVZA 2KPNA 2FH8A 3V5KA 2D7OA 1G7PA 1KJMA 1HI6B 5C0GA 1FH5H 4WWKA 2CUMA 2B39A 2HH0H 4L3EA 4MXWL 4J2XA 3ALXA 4XPFL 1OAKL 1UCBL 4X4XA 5ICZA 4EVNB 1JHKH 3WXVH 1AE6H 1KCLA 1N64L 4JZJA 4YDJA 3HI1A 3QUMA 4BM7A 4JFQA 1SBBA 4FQPA 4UQ2A 3A6OA 3TO2B 4Z6AT 1S78C 1FLRH 1I3VA 2VZUA 4M7LT 4XXDB 2Q8AL 1GIGH 1HHGB 3KPLA 4DVRL 1MF2L 4M7LH 5IT2L 2W9DH 3IETB 4NQDE 1NPUA 1IQDA 5TJWK 3VE0B 2FD6L 2EYTB 2ED9A 3W5MA 1A7QH 3PWUA 4NCC1 5B21A 3MRIA 5L2JB 2BY3A 3IDXH 5FUOH 4X4MA 3MV8A 3TWCL 3IB4A 2ITCA 2VXTL 2VLJD 1A7QL 1NEZA 5ICYB 2VDML 3SGDI 4N9OB 4GMSH 1QP1A 1NBQA 3ARUA 3QCTL 4JFPA 5CILL 3UZQA 3PQYD 3MCKA 4JPVL 3VFMA 4NKDB 4TULH 3X14A 3Q5YA 3F7PC 3UYRL 1MHCB 4NSKB 2GK0B 2VAAB 2X9XA 4N5ED 5HDQH 5FOJA 5C6PB 4PR5A 4D0CB 1RIVH 3S36X 5E56A 3T4AB 3RWCB 3TBVB 4NN6C 5GJTH 1UZ8B 3SDAC 4EOWL 2W60A 1URLA 1QFUH 3SKOA 2VLLB 4Q0XH 4OCRH 4JO4L 4DGVL 1WBYA 5JOEA 4GQ9H 3T3PF 1RURL 3EUUA 4HXAH 4FXGB 3RVUD 3VGAB 3WMSA 1A9BB 3NCMA 4NGHH 4MDIB 1DBKH 3G9VA 3QNXA 5IFAL 3ETBF 4RAUB 3GSVB 5LBSL 2OTWA 5DMJB 1AY1L 4PJFF 1M71A 2QSTA 1QSFB 3NIDE 4PJBF 1KG0B 2CRYA 1D5MB 1QVOA 5T3XD 3VXRD 6FABH 4OT1L 2ADIB 1OW0A 2HAZA 2YR3A 5GS0C 1CCZA 4YR6B 3M8OL 4OIIH 4OSUL 1SEBA 1CR9H 2VRAA 5BW7A 3U2SA 3EDJA 2J8UA 3FT2A 4K23H 1RJLA 1TDQA 1Q0XL 1BZ9B 4NO0D 3ARGC 5IVZA 2F8OA 3T0EE 2YK1H 1MFDL 2J4WL 2GYSA 4YDJB 1X4YA 4JO3L 5EC1A 5SWZB 3ARPA 4FZ8H 5D2LF 1FNHA 2ITDB 3MNWA 3O6FD 5B38B 4NQEE 5DJ2A 1ZLUK 1FE8L 5EIIB 2O26U 1PQZA 3I50H 15C8L 1UB5A 1UVQB 2VLME 3DXAE 5EA0L 2CUHA 4EN3D 5E5MB 1OB1A 4N8CL 5BS0D 2BNRB 2HMIC 2NTFA 3KXFD 2XZAL 1FO0B 4I1NB 3L95B 3SGEI 7CGTA 3MUGA 2MKWA 2B0SL 4OZHA 4P9MH 4XVJL 4HIEB 2HG5A 3BZ4B 2ENSA 5FGCE 1ED3A 1S7RB 1IGCH 2EEAA 1C5CL 3NA9L 5DI8A 3ULUH 3M8OH 3WJLA 1NC2B 4JDZA 3SDYL 2BDNH 3H8NA 4WO4B 5C0JA 4R9HA 4P4KD 2R4RL 2E5EA 2N7AA 5ISZD 2FGWH 1FFNB 3IETA 1AGBB 1Q0XH 3IDYC 3F7VB 3WN5B 4XHJD 5HYSA 1GXEA 2C26A 2IJ0C 3ZYZA 1WBZA 2ILLA 1KB5H 3EJJX 4EI5C 1RUMH 5B22A 3R8QA 4WFGE 43C9A 2I9LB 3NBNA 3HG1A 5DQ9B 1TQBC 3ZKNC 4QT5A 1G7LB 1JPST 3NH7L 5IHZB 1SBSL 3BP4A 2ZUVA 1S9WA 1Q9WA 2WMPA 1QLFB 2IPUK 5BVJA 3UX9B 4PJHA 1H8SA 2ZZUT 1RK0B 4KRPD 5DQJB 5KVGL 5D7IA 5JA8B 1QQDA 4LIQH 1ZHLA 4PJ7E 5IQ9B 3KJ6L 2PN5A 1B0GA 3AXLA 4M3KB 5ENWA 3BGFB 3RKDC 2JJTA 3L3DA 4P2YA 4FNLL 3FOMA 3ROOB 3OJDB 1VFMA 4ZPVA 4Z7NF 1U0QA 4XPAH 1FFNA 4K94L 5JHLL 3EDFA 1U3HA 3R0NA 2C1OA 3DECA 2Z35B 2FO4B 3EFFB 3QI9D 4OCSH 5CILH 5EBGA 1EFXB 5F89B 4AEHL 4Y2DD 1G7LA 1D5MA 2BFVH 3VXQB 2QQNL 1JP5A 5K9JH 1FLRL 4M93C 4Z7WA 4KUCF 5C7XL 1A1OA 5E4EC 1WQVT 3TWCH 5F96L 5CJ8A 5EIIA 1I7TA 4JO2L 1A1MA 4X5XA 1ETZB 5DK2B 1NAMB 1F6AA 2Y5EA 3T0AA 1T2XA 2YZ1A 3OBAA 1XGYH 3B5GA 3IKKA 4NOFA 1AKJA 4NP4L 1D5BA 2VLKA 2GTZA 4I3RL 5I15L 4L4VD 2R69L 4F37F 5IEHA 4DN4H 4L3EE 1QSFE 5L2KD 1E4XH 4XNYL 3PUCA 1JWMA 1QO3A 5IJKC 3L7EB 2JB5L 4U6VH 3WL9A 3STZA 3X13A 1XCQA 2V9RA 3ARDD 5DFVD 6FABL 1NLDL 2GY5A 4HC1L 4S1QH 3S5LB 1ZA6B 4OFYA 5E1AA 3QAZC 2YEZB 4GMTH 4Y8DC 4ZFOB 4Y4FC 1YJDC 4ZYKB 3DV6A 4RMQA 5EU6B 3T2NH 4OZHB 5DUBA 4K9EC 4YBLB 4HGMA 5DR5H 1U36A 1VGEH 1T0NA 3IS1X 1QNZL 4U0QB 1JWSB 3VFVB 4P23D 4ZNEE 7FABL 3OKNA 4Z7UF 4ZXBB 1Z2KA 4WFFD 5C0BB 5E24E 2D4DA 1MUJA 3VD5A 1B4RA 2Q87A 4XAWH 1QLFA 5JXED 1RAMA 5DEFA 3MFGB 4OI9A 1YEFH 1J8HE 4OZIB 1OT2A 3EKCA 2ADJB 5L7XL 5E2UH 5C8JB 3TGXA 1N5AA 1XF1A 4OBRA 1QQDB 3RDTA 5LGJB 3FN0L 3CH8A 1QFWM 3HG1B 4X6DA 5EZOH 4CAGA 4NQVB 5IQ7L 2NXZC 3OZ9H 3OR7A 1GAFL 3HR5A 4GAGH 4JB9H 4JKPH 4ONOA 1NFKA 3DX7A 3RL1B 2EIZB 3ET9F 4O2FA 1OW0C 1DE4B 2FBJL 4LLQA 3H9SA 1DLFL 2XWBA 1XZ0A 3GGWA 4FQ2L 4OF6A 5BRZD 4MAYA 1F4WL 3VRIA 1ZLSH 3PV7A 2YXFA 1UM6L 5I2IA 4Q58C 1ZTXH 3GFUA 1FVCB 2Q7YA 2VDLH 3C2AH 5C0IA 3H3BC 1X7QB 3KPRB 3HRZA 2VIRA 1OGTB 2ICWB 3QR2A 3SDXB 4NZRH 1E4JA 2Q8AH 5E4IA 1IBGH 2P8MB 4IRSA 4U1GC 5I1HH 2IADB 2OL3A 4JM2B 3SKMA 2R8SH 5FO9B 3V79C 3C5SA 3LMJH 2PW1A 2HVKB 4NO3B 1CLOH 5MEOB 1CICA 1L9NA 3UTSB 2XA3A 5KVEL 5HGDB 3W5NA 4JRYB 3QPXL 5KANG 4C56A 1RHHB 1B2WH 1RK1B 3VCLA 2YBRA 3Q1SH 5CEZE 1FH5L 3F58L 3KPSA 1LE5A 3H9SD 4PY7B 4HIJB 3O8XB 2DQIH 2Z91B 1JWUA 4YJZL 3BEVA 3PL6D 5BVPL 3RAJH 1MREH 3FQUB 1JUFB 1F8TH 1WAAF 4X9FA 4HAGA 4NT6A 4M6AA 3ULVL 4GKOA 1GAFH 5E08L 5EFIA 5HJ3A 2QHLA 1NC2D 4X7SH 1AXSB 2UZIH 2R2EB 5D7JC 3T77B 2GSGB 1BOGB 5E8NA 2BNQD 1S7VB 2H3NB 1I1FA 2O5ZH 1U8KB 3HI6H 1HOCB 2I5YH 3H9HA 1EMTL 4FQLL 5FO7A 5FV2A 3VFPA 1M05A 4UILH 4QHUB 2LAAA 4JFHD 4DKDC 4MB5A 5C6WH 1AKJD 4FQXC 5SV3A 3VXUB 3L3IA 4M61A 4XZUA 4FN0A 5GRVK 5EZIH 1I3GL 3DMMC 2JCCA 2AW2A 1BWWA 3IT8D 1AGDB 1K8IA 4KHXL 2FL5B 4QCIA 2W9EH 4FXGA 5IOPB 4NFDA 3BEVB 1I9EA 3MBED 1QSEE 2JE8A 4TOYL 3S4SB 2ERJB 2VLJA 3CFBB 1UFUA 2RR3A 3EYUH 1OM3L 3VWJA 5E7FA 1EA9C 3MA7A 3BUYB 1H8OA 2P24A 2GW5A 4QF1B 4ODTH 3KPOB 3NIDF 4JQXC 4PJBE 1NEZB 2BP3A 1U58B 2XA8L 3BJLA 3T0VA 3JWNC 5TDNB 3D1MC 1KPVA 2CIIB 4AIOA 1OLLA 5C9JB 1BQUA 3FCTB 5DD6A 1OAZL 5CHNB 1KNOB 1JI1A 4LAQH 4GKZB 1AI1L 1SJHB 1IQDB 1UACL 2H9GB 4HJ0D 4N1EA 4LKCB 3LRHA 2JCCF 3KYNB 1SJEB 1Z9MA 1OQXA 2UUDK 1MEXH 3EJZD 3KPRE 4X8JA 5IMOA 4OLXL 4OF5A 4QRQA 1FRGH 4XNZC 2R8SL 1GGCH 1RUAL 4DOHB 5I1CL 4KI5D 3P9LB 5KTEH 4LSQH 2VLRA 4TVPD 5KS9F 3M17A 1K9TA 3MRCA 3NFSH 4R4FH 3TBWB 4DGYH 3VXME 2DQFA 3NCEB 2Y25A 1UM6H 1K8DB 4NSKA 3UYOD 3O0RH 3O9WD 4LVHB 2VQ1A 4CVXB 1ZLSL 4DTGL 1NGWA 1NCWL 3UTSA 2GTWA 3BWAB 4G8GA 4FQ1H 2AJZB 4HV8B 4OUUB 3SGJA 3CLFL 1BHGA 1KULA 5DRXA 4IS6A 4WY7L 3TCLB 3QEUA 4R6UA 5IG7B 5INCB 1IVLA 5GSVB 1U8KA 4DAGH 1OY3B 4HGWA 5C6TH 5IMOB 1EGJA 3FQNA 3QEQE 4YHIB 1MCWW 4JFOB 4MB3A 1TFHA 4HS8L 3HHRB 1KG0A 4Q2ZA 1AD9A 5EFIB 1VESA 2AI0H 1RZKH 1W0WB 3JWOC 1T89C 5IB1B 4WUUA 3AB0B 3D3VE 4GAJH 5IK3B 5DJXA 1XGPB 4WI8A 2FGWL 3QUMH 4QXWA 3P11L 5EU5A 2FX8H 4FXKB 1RUKL 5CP7B 4P99A 3DLQR 4Q97A 1N0XH 4AJ0A 1KSRA 5F7LB 4MNHB 4HUMB 1NANH 3QXDA 5HHOE 1EHAA 2DIJA 3RPKA 1X3DA 1FVEA 4ZS7H 4PGCB 4NP4H 1Y0LA 4MDJB 3SCMC 2NZIA 3C60B 5HYIA 1PKQB 4QRRD 1GGTA 2OTPA 4X8JB 3GSWB 1MRDH 2E7LC 1ZLVK 5AD0A 1Z9OA 4LOUD 2W9EL 4UT9H 2HG5B 4MCZB 4JGUA 5JZ7D 1ZT7A 5I6XC 2DQTH 2LU7A 1G7HB 3QQ4A 4TVPL 5LGKA 4YHOH 1JF6A 2Z8WC 3FOLA 2DD8H 4WO4A 5SX5K 3UTQB 1NDMA 5L0QB 4YGVB 3FQWB 3L3GA 5DD0H 1BM3H 1HEZA 2FDBP 5CP3A 1FORH 4M62H 3GO1H 2HKFH 4OGAD 4D94A 3QULB 4WTZA 5A16B 1GC1L 1T7VA 1H3PH 1FNGB 2GTZB 2C3WA 5HGAB 4U1KB 3BAEL 2IAND 4IIQC 2FSEA 3MRNA 4LEXH 1X5XA 4HWZA 3HAEH 5T1KA 5J11B 3ARGA 4JRXE 4B5EA 5F97E 4QRRA 2DLIA 4NN5C 2FYYB 2V2TA 5JORB 1U6AH 3M17B 5E99L 1W0VA 2CGRL 2FEEI 3MRJB 3O4LB 1OCWL 4GG8B 4PJXB 5ALBL 2HYMA 1QR4A 3CLEL 5E2JA 4DWHA 3K80A 1B88A 2NLJA 3UO1H 4OF8A 3BE1H 4H88L 4RGMC 5CP3H 4WHDA 4RGNC 1REIA 2PF6A 4J6RL 2W0FA 2NYYC 1IKFL 5I1EL 4NRZA 5F1SA 2BY2A 3CSYA 4QGYA 4D9RE 1NDMB 2R2BB 3GZKA 3ZT6A 3RWFA 4ELME 3V6ZB 2YRPA 4G8IA 1MIEL 2F19L 1YNTA 2AEPL 5IV2A 4TULL 1XR8B 3MJ9A 1NCAL 4YDLB 2OP4L 3QI9A 4OCYH 2ZUSA 5A1AA 3HCVB 3ARFB 4JPWH 2E27L 4H1LH 2V2TB 5HDBF 4EI5A 5D70L 4HKJA 4TYUA 2BJML 5DD3H 4A6YL 4PYHA 5H2BA 2DLTA 3D0VB 4JPKH 4NCC2 4ZPTA 3W0WD 4AL8L 4ENED 3S9DB 2VUYA 4XCNA 2XZQL 3L9RA 4D0DB 3SDCB 5IT2H 1KEMH 4FFZL 1UA6H 3UPAA 4FXKA 1ND0A 5DJAB 3IDYB 3G04B 4PJAF 2D03H 3HLAB 4L1DA 1S78D 4U1NB 2A6JB 4OI8A 1OLZA 2IH1A 3TPUA 5KAQG 2EDDA 2RBLA 4XAWL 2WIIA 4JVWA 1MHEA 1U8QA 2WUBH 3FB8B 4EI5D 4KK6D 3KPSB 3DV6B 4R7NB 3U7WL 5E6ID 3N9GH 3HNTL 5IESH 4M5ZH 1R3HB 3U30C 3MLUL 5CZKA 1ZLVH 1NKOA 5GRZA 3RY6C 5D72L 4KFZC 4PS4L 3GMLA 1ZT4B 1CL7H 5JDSB 4X5LA 4PJEF 4GMTL 1UB5B 1UVQA 4HUUA 5I16B 1WZMA 5CINL 5DJZB 4LIQE 1G7IA 1H0DB 3NCFB 5EOTA 4E9LA 4JY6B 5EZLB 4DFHA 4LGPB 1MCJA 5SX5H 4IOFC 1BIHA 3GIZL 1JZ7A 3BESR 2VR5A 4NCDA 3QULA 4KDWA 1T04A 4LCWE 3QH3B 3L5IA 3U79A 1TJHL 3OGCB 5C71A 4JQIL 1BVLA 4U1NA 1DQTA 2NZ9C 3MV9B 2AJUH 4J3TA 1QFUL 2IH1B 2CPCA 2R2BA 4QHNB 1GOHA 2XZQH 4P2OC 3RWFB 5TH2B 1AGBA 1K3IA 2IPTL 1NFDB 1PGRB 1CGYA 3REWB 5MEPA 1AQKH 3QPQD 2H2PD 1W8NA 2HT2C 4X0KA 3FFCB 4V2CB 5DJ6A 3V0VA 4PTTA 1UENA 4RBPH 5FKPB 3ARGD 2QQNH 3MLSL 3OX8B 4PJIE 1VHPA 1I9IL 1LMKA 1P7QA 3U36B 4X9BA 5C0BE 2NTSP 3QUZC 3PXJA 1YN7B 3NN8B 1I9IH 1JWUB 1H0DA 5DVOA 2UWEE 2J2ZA 4MXVE 4M48H 2NZ9D 5FO8B 4ZUSA 5ID0A 1JJUA 1JZ8A 1NAKL 4IRJB 1J1XL 5C0CD 4LKXA 3LKRB 4U1IA 2APXA 3PXHA 1HZHH 3ZDZE 1KCUL 1GGYA 3BZDA 4K9EL 5E6IB 3SDDC 5ABDE 1A1NA 3D3VA 5I1EH 5C07B 2OJEA 4IMKA 4KDVA 4ODXA 2M2DA 4O4YL 3TNMB 3W9DA 3ZKXB 1FGNH 5I73C 2QADB 2DJSA 4ERSH 1SJHA 1VEPA 3OXSB 4OGXL 1BZQK 5F7KC 3C8KB 3TV3L 3BDYH 5I8KL 3WUWA 3AUVA 3CPLB 3CVHH 3QHFL 5EZJA 1JGLL 4OGZA 4D3CL 2GY7B 4U0RB 4OFKA 1IGJB 1DDHA 1D5ZB 4NWTH 3UTZB 1TVBA 5MEQA 3O6LL 2Y72A 1W2KT 1V05A 5T1DL 1T83C 4I3GA 4P2QE 3G6JA 5IJVB 1TJGL 2P45B 3QDJB 2J6EL 3MLUH 4NZJA 3N9GL 2NY1C 4HKBB 4K7PX 3WFHA 3GO1L 1GZPA 4U1GB 3OKDB 4HUVA 4X4YA 5ALBH 2X70A 5J4MA 1IGML 3LN4B 4Q6YA 5D6CA 1YQVH 2P49B 3GMMA 1JHLH 3EAKA 3FB5B 2LTQB 2X10A 3MRQA 5IROA 1EAPA 1BD2B 1CFTB 3KLHD 4QNPF 3SGDH 2X42A 4KKNA 3D18B 4P9HC 1YC7A 1C5CH 2YN5A 3RVVC 3BSZL 5I18H 4HFWB 3BH8A 4H1LA 4R4BB 3L6FB 1A14L 1L6XA 3MLTB 1FORL 1IC1A 4M62L 1S7SA 1FCCA 1QR1B 3WO4B 3ZYJA 4FP8H 3S34H 3S88L 1D6VH 1MAJA 4XB8A 5DZOA 2DQJL 2BMKA 3VWJD 4ONHB 3TBTB 3KPMB 3OXRA 1CU4H 1ZANH 2YD8A 4AH2B 1W72A 3SE3C 3OPZH 5FECA 4R0LA 2ICWJ 4GG6F 3H7BB 5D1QC 1LDSA 3QO1B 4UAOB 4HH8A 2ORBH 2PKDA 1KF9B 3MCKB 5KOVC 4QTIL 5JQ6L 4QRSA 4GKZA 4EEEA 1G84A 1P6FA 5EU7E 4LKCA 2GKIA 2NNAB 3MJ9L 1HSBB 1MJJB 5CEZH 2BSED 1HXMB 3UTOA 3BWAA 4D0CA 1A7RH 3RDTD 2JLLA 4G42A 5C08A 3WS3A 2X4QA 2GJZB 1CXEA 5DLMH 3TIDB 3DGCR 3MLTA 2YPVH 1CF8H 4UNTA 3G6DL 5T1LB 1KENL 1TCRA 3TBWA 1KUMA 3V7AE 1IKNA 5IVXE 4J3VA 3MGTA 1G0YR 3WUWG 4WI6A 3FRUB 5I0DA 3W11D 2XG4A 2Q86A 3O4OC 4ODUA 4RFOL 1MCPH 3S3SA 2IGFH 2R56H 2CRZA 2IAMB 1Y18B 4JKLA 3SGKC 1KV3A 1ORSB 4MA3B 2VDRL 3VWKD 2PTUA 3QIUC 1CTNA 1NCNA 4ZFGH 2RQ8A 1A4KB 4ZOAA 3SE8H 3PWPD 2ZUXA 4OZGA 1MQKH 4PJ5D 4XCCL 1Q9KB 1ZLUH 2VDKL 3VGEA 1QLEL 4KTEL 5A2KH 1UZ8A 4M6NH 1JNHB 3HAEB 3BGFC 1YMMD 5J0BA 4L9LC 3HUJF 4HMCA 4HWBH 3MXVH 1FLTX 4LQFH 3GMRA 5CSZA 1FVEB 5KSAB 3IDXL 3SGKA 1YEEH 5TE4L 1JYXA 2QKIA 5GGUB 1CD1B 3DIFA 4X6FB 1EO8L 5SWSD 1KJ2B 4HKZA 3B8YA 3VXPA 5LG1A 2YKLL 2ZUTA 4O9HH 1A6VL 5EU5B 4I18A 1E4XI 2ADGA 5CUSH 5TGBA 4X83A 1JF1A 5F71A 1FZJA 1JN6A 3FFDA 1KJ3H 4K3JH 2J3SA 2VKWA 5F3BB 1NBYB 2V5SA 4AEIL 1OGAE 1LEIB 2HLFC 1KCVH 2P5ED 2IANA 2NY7H 3BT2L 4HS6B 2FX8L 5DMYA 1LO4L 3QUZA 3KWWB 3A6CH 3X11A 2BVQA 4S0SD 2X2YA 1T3FB 1UJ3B 4LVNC 3Q48A 4QHKJ 4G6FD 4M1CC 2NXYC 5GGSA 3DV4A 5MEND 1JZ3A 4G9FE 5LXGH 5EZIL 1AGEA 5INDA 4EDXA 3FFCD 4LHUG 4C59B 3DJ9A 3TZVA 1YN6B 3MLWH 4LSUH 1JRHL 2W38A 3HMXL 3JUZA 5E9DD 2ZJSH 1XGUB 2AJVH 1YEGL 3MLZL 2EZ0D 1Q94A 3IS0X 5EOQL 3VD4A 3Q6FB 3BSZH 1ZHLB 1FNGA 4GBXA 1MVUA 5GRUH 4PBVC 3V5DB 3C5JB 4W4OA 1EXUA 2MHAA 3KG5A 1QSEA 1W8OA 3I75A 4KGLA 5DJ8B 4M4RA 1OAUL 3PP3K 2AV1A 3V6FA 1D9KD 3DOSA 4QY8B 5D2LA 2VXVH 1KTLB 1IM3A 4NBYB 3GKZA 2UVFA 4GSDL 1ZKAA 2KQMA 2I9LA 3G6JF 3CMGA 1R24B 1T22B 4AMKL 4UT6H 3QXUA 5D7JB 9CGTA 1FFPB 1N2RB 4I13B 2D9CA 3GMOB 2LVEA 4UBDC 3QXVA 4NQDA 5F9JB 4JLRA 4AQOA 4X80H 3CVHL 3QHFH 5BRZA 5I1CH 3DX8B 1LO0L 2YSSA 3QUXC 3D0LB 4DOHE 2ESVB 2X4OB 4GBXD 5IKCB 2F74B 2YD7A 1I1RA 4P49A 1EERB 4P23A 2DQHL 3C6LD 4RAHA 5JOPE 1BECA 3L9RB 3QH3A 3SDCA 4EVNA 2DLHA 2GEEA 3HFML 4KUZL 32C2B 2P5WA 3TVMC 1T1WA 2R9HC 1ACZA 4PJGB 5FYLL 3O4LE 2JJTC 5J56B 5JLZB 4NN7C 2FGZA 4TPRL 4X6BB 3VXRE 3MYZA 5T3XE 4RDQG 4P2RD 5KVEH 4G43B 4U6YA 1FYHB 1OP3H 3EO0B 3IDNA 5HGGS 3U9UA 3BD4A 2CDEB 4ZTOH 4WNQA 4LASH 2WWKT 1FZOB 5J3HC 3QEGL 1T4KA 4PRHA 5DGQA 4X6CF 3CUPA 1ZWIA 1ZVSA 4P23C 3OX8A 3X3GH 2H26A 5D5MB 4UT6L 4JN2B 3O41B 4XVUC 1ZTXL 3T0ED 1U3ZA 2OZ4H 4HUXA 1TMCB 3QRGH 3WFEL 3P2TA 2YD6A 3EYOA 4H26A 4K8RC 3OKKA 2B2XH 4KHXH 2EDHA 2FR4B 1SY6A 2M1KA 4EZMA 1EEYA 5I1KL 4PB9H 3MV7D 1IC4L 2UYLA 5IIEA 4LOUC 2DDQH 3NZHH 4WWKD 5C07A 2CKBA 2BCKA 5IMKA 3W9DB 3QNYA 2GJ6D 2X4PA 2E9WA 1A6WL 3QUKA 3O45B 3OF6A 3BPOB 5J6GB 4JRYD 2P44B 2Q3AA 3E0GA 2DJUA 3MV9A 4WW2F 5FDYA 3G08A 1R3LB 4BH7A 3ARSA 1RZIB 3VFTA 4U31A 4Q9RH 2EYSB 5CINH 1AGCA 1EPFA 4G7YL 1YNKL 4O2CA 2D0GA 4IBLT 4LFHD 5FFLA 2NY4D 3ZE2F 5J1SC 2N4IA 5CBEA 2OL3H 1DP0A 4DQOL 1CDCA 1ZLWH 4QXGH 5JPMA 2KZ1B 5K59E 4PJGF 4X98B 3OKNB 3GB7B 4JE4B 3SDXA 5BRZB 2VDQH 1T5XA 4M1GH 1ZK9A 1LEKA 4OZIF 1TIUA 2ERJC 1V7ML 3IRPX 5FYJL 1X5LA 2NY2D 2APTA 4GXUM 4NOBA 4XPBL 8FABA 1D5IH 3LKRA 4U1IB 3BIBX 3E8UL 3JV4A 4S0TD 1KLFA 3HG1D 1GGUA 2ESVE 5EIVA 1ZHKB 4R4NC 2OL3L 3GSRB 4K55A 4Q9QH 3TNMA 1A6VH 3FO1B 4J3WA 1QG3A 2YPLB 1KOAA 4I8DA 4K9EH 2DQGL 3QISA 1YMHB 4HEPG 1W0VB 5FM8A 3FTGB 3GNMH 3PHOB 5IB4A 4WFEE 5D1QB 2CLRA 5CAYB 1ZS8A 4M4PA 4HF5H 4P23B 5KSAC 3GSNA 1XGQB 1T0MA 2FBJH 1NDGA 4JANB 4IJ3B 1RJYA 1PYWA 3PWJB 5IB5A 1A6WH 2MCPH 1G6RH 1M1SA 3LKNA 1DANU 5EO1B 4TNVF 3D2UA 5DVMA 1MQKL 5LAXA 3RGVC 1T5XB 1WISA 3EYOB 4H26B 4NHCL 2C4FT 3BQUD 4JHAH 4R4ND 3V6ZA 4NO2A 4OD3H 4JCLA 3SDAB 5C09B 1HIMH 3JVGC 3MRGB 1BZ9A 1NUFA 4QHKI 1HXMA 1EEZB 3NABH 2P46B 2ZCHL 2UYLB 5IIEB 2E6JA 3KR3H 4JFXA 3HE6B 3NAAL 4BFGA 4HIHB 1FN4A 5E8PB 3DURB 3H6JA 5B8CC 3BZEA 1E4WL 3DVIA 1H5BB 3V4PL 3LS4H 5A2FA 3GEWB 5D7SH 3WFCH 5FYJE 1BPVA 4WTXA 3PE9A 1KB5L 3LKSB 1MCIA 3RWGB 3J7HA 2V2WB 3E6FA 3GIZH 1YEDA 4OKVB 2R39A 5GS2H 4WEBL 2VISB 4O2CB 2BNRA 3QDGD 4ZOBA 2IPKA 1GJIA 1I1AD 4K7FB 2YUZA 3SJVE 2MQCA 3C5ZA 2BDNL 4PP2A 5KAQF 2R0LH 3R0MA 2PW2A 4KKBD 1CE1L 1C5DB 5IB3B 4OJFH 4MWFB 1C5BL 2FHFA 3V4UH 4J7RA 1IAMA 4UUJB 5HGBA 2CRMA 2O61A 4LF3A 1GCFA 5JQ6H 1AD0A 4Q6IC 1CT8B 1DSFL 2F5AL 5EA0H 1CK0L 3VG9C 1FE8H 4NYLB 1JL8A 2VE6A 4OZHF 2XI9A 4KHTL 4NM4L 4UQ2B 5F6HJ 4FQXA 1SVZA 5CBEB 5DJYA 3WLWD 1VADA 2WK2A 1HYSD 4LHUB 3IJHB 4DVBB 1INQA 2DN7A 1N4XH 1UH3A 4P9ML 3O6FA 4A2MA 4CW1A 1I8MA 2P8LB 1SM3H 2BSSA 1G9ML 1QRND 4YHYC 4LNRA 5J1AB 3QUYD 2HJKA 2A74B 5JUEH 1M6OA 1T5WA 2VSCA 5F7DA 4U7SA 4GAYA 4POZD 4KVCL 3BUYA 5D7IB 3RIAF 3RHWF 3D39B 1MJUL 2YN3A 3T0XA 4FQQB 4GRLA 1FL6A 4MCYB 5DDHA 4HS3B 4XPAL 2VH5L 4OCMC 2GJZA 5EOQH 5EU3B 2AK4E 1YZZA 2YPLA 4PRPE 1J1OL 1DBBH 1N3NB 5B8CA 3IAPA 3MJ6A 4K8RH 4N68A 3REVA 4DCQA 3L7FB 2XKUA 5CZXC 5KS9E 3G6AA 4NGHL 5TF0A 1ZVHA 4I9WD 3RWDB 3ZZ1A 3RWJB 1HQ4A 5CGYD 5T1DH 4ZFOA 2XTLA 1RY7B 1JNHA 2MPAL 1FFOB 3FQTB 1JNLL 1R5WA 4MJ2A 1F02I 2IAMA 1BFOA 3QJHA 4WRLA 1CZ8H 2CDGB 5D2NB 4BZ1H 3PL6C 5D7KE 3RVTD 3H9SE 4X7DC 4Y16D 1AH1A 2ARJB 1NGWB 1R5IA 4UV4L 3IDIA 3PGDB 4LSTH 4UINH 3HE7D 3O2DH 2H32B 3IFLH 1AJ7H 1KXQE 4OUUA 3TBVA 5B38G 4JZJB 5TDOA 1A4JB 2DM2A 4MA7L 2A73B 3MRRA 1GOGA 1OAYH 4FQ1L 3BMVA 4MJ4A 5TQ2L 1K3ZA 3QEUB 3RUGE 2WNGA 4HK3J 3VXNB 5CD5D 1NFIB 1CFQB 4QYOB 5C07E 3O6FC 5MENA 2Y5TB 2AEQL 1CD1A 1F90H 3DIFB 3OKOA 4JPVH 2IBBA 2VISA 5L2JA 3V0AC 1DDHB 4ALAL 1T22A 4XMKH 1UJ3A 5EOCL 5C0FB 4RFNC 2FECI 2R2HB 3LKOB 3O8XD 4NRYA 1MF2H 1AD9B 3RVVD 2RGSA 5GGVH 2XXCB 4YK4B 5C0AB 3BPNB 4CW1B 2P8LA 3QQ9C 1S9XA 1LEGA 1T89A 1B4JL 1R5IB 4M03A 4XCEB 3QXAA 3TVMB 1MFDH 3ABZA 4JM2D 3EZ8A 2PCPA 4QHMA 1OARL 4RAVA 4PP1D 5AEAA 5CFHA 5IW6B 5DD1L 4IRSC 4S1DC 3ULUC 4Z8FL 2ZG3A 4KQ4H 3T4AA 1VADB 1DZBA 3QXDB 4LLUA 2W92A 1RPQA 1U8IB 5EU3A 3HB3C 3RI5F 4JFFD 2DIBA 4V1DD 1Z6JT 4FTVB 4OT1H 3O8XA 2QSVA 4LDOB 3LN9A 4TQEH 3IDMB 5JW4R 1Y6KR 1UEYA 1KB9J 1S5IH 3H0TB 4GH7B 2Y9RT 4ODHH 1K6QH 1T7ZA 4YHZH 4JM2C 3KYMA 4U3CA 4OFIA 4PJAA 4F15B 1T1ZB 3MJ9H 3EYFA 4JLRB 4S1DD 3MLXH 4PLKD 1LO2L 2X7LA 4YUEH 2CDGA 4URTB 3QXAB 4J8RA 1O7SA 1N59A 4E42A 1X5GA 4JO1H 5IV2B 3MGOB 2E7BA 1BQLH 4JZJC 3UZVB 2GQHA 3WFZA 4Y2DB 3NZ8A 4LPTA 4G5ZL 4PV9B 2EH7H 1DQJA 2OYPA 4IIQA 3S8WA 1GVIA 2NR6C 5EU6D 1F3JA 4I2XE 2ED8A 5ERWB 2I27N 3HA0A 3WSQH 1CD8A 2IPUG 2VO5A 4ONFH 4X8XA 2LQRA 3PQYE 1PG7X 2D7TL 4S2SA 1FNEA 4XCYA 3QHZL 4YHKL 1C7SA 5KZCB 1S9KC 1WWWX 3CSPA 4U1LA 5EO0B 4XP9L 1S9YA 3QUYA 5C08E 4M1DH 4XX1G 3MA7B 3ILPB 4DGYL 3X3FH 4NM4H 1N5YL 4R4FL 3QFDB 5CBAA 4PGBA 3BGMB 3VWJC 1PLGL 1VKXA 3U0WL 3ARBB 4D9QD 1MCWM 1WT5C 3RKDD 4Y16A 3KJ4C 1P1ZB 4G6AD 1HHHB 2BNQA 1M05B 3P77B 3NGBB 3HMXA 4LPVA 2B4CC 1CE1H 2L0DA 2HH0L 3L3IB 4M61B 5FYKU 3EOBA 4CDHA 2ATPA 3QIBA 5TE7H 3QSKB 3RX7A 5JXEC 1UJTA 3QI9C 3T0DA 4UOW0 4ZUUA 2FJFA 1CG9A 2XTJB 2IQAA 5AZEL 3L7EA 3WL9B 4HW6A 3UO1L 5C0EB 4KRMB 3G5YB 5FIEA 1MI5D 2R0WH 4KY1L 1RJYB 3MREA 3PWJA 4P5KB 4WO4D 3T0EB 2EH8H 5K9OB 5DQJA 2NY3D 3K8KA 5HDOA 2WBJD 3MRHB 2HP4A 3OL2A 4MNGE 3BAEH 4PRAA 1KCUH 2E6QA 3C9NB 3LKPA 4ZS6D 4M6OH 3T0WA 4D9LH 1XH3A 2PO6D 4LRNH 3CC5B 2BVPB 4AENB 1I3GH 1MAMH 3VFMB 5AAWA 4JFDA 2X09A 3AU1A 3DMMB 1YPZB 2EYSA 4GKSA 1MHEB 4OCXH 4L8DB 4FQLH 3DURA 2BVYA 3K4DA 5GRUL 1YYLL 4PJCE 5JNYB 3KXFE 2MQ3A 5CWSA 3QCUH 4XC3H 5L9DL 3CDYA 3VXQA 4AIXA 5JIHA 3RX8A 2IANE 5HDBE 3LV3B 1UADC 1I3RB 4DKFL 5HHPA 4NC1E 1EGJH 3DO7B 3O3BA 3QB7C 1FAKT 4KMTH 3D69B 2R4SL 4IRZH 1MVFA 3PGFL 4YC2C 4YXLH 1IGYA 3AS2A 2C3VA 3U82B 4G8FA 1NGQH 3D2UB 4FG6D 5ITBL 3S96A 1JNNL 1DQQA 2VZ3A 3MUJA 3K8LA 1A6ZA 1FHGA 1YMHA 3UXFA 1D9KB 3OTTA 3THMH 4DUXA 3L5XH 3TCXA 3VGDA 1FYTB 4L8CA 4OAWB 1JGEB 2RJMA 4PGDB 3WLBA 1AR2A 2HLFD 3JTSB 3GM8A 4P46B 1Z9SA 1EH9A 3UTZA 4KJWC 5DA4A 3O6FB 3WN5C 5EU6A 5FGBC 1P9MC 3AREA 4YDKH 3WJJA 5KSBF 2VITB 4JFPB 5E1HB 1KN2L 4H20H 1GYAA 2DS4A 3MNZB 1JWSA 3VFVA 3MRMA 4PJEE 4U1SA 4LQFL 5ESVA 4JPIB 1Q8MA 3MYJB 1I85C 4OTXH 5DEGA 5MP6L 4K94H 2SEBB 5JHLH 1PG7W 2YS4A 4ZQKB 3WNPA 4N1CA 1N5AB 2NCMA 4Z9KB 3FT3B 3SBWC 3C8DA 2CLVA 4RNRA 1NGPH 4FQIL 4LHQB 3MLVH 3KYKL 1JVKA 4M1CD 5EO9A 2H41A 3LY6A 3VA2C 1QSVA 3BIAX 4ZFGL 4PGCA 5DJ2B 5F3HA 3CH1A 2GJ6A 3QIUB 1IEHA 5E2UL 3CDFA 1F6LL 1YEDB 4GG8A 3K1KC 3QG7H 4RMUA 5IGXL 4H8WC 4KI5F 4B7IA 1TZGL 1SYSA 4PJ8C 1E28B 3SE9H 1T03H 1Q72H 5EUOA 43C9B 2HTLC 4APQB 7FABH 3OKLA 2X6MA 4G6MH 5B38A 2X89A 1BJ8A 1FRGL 3QJHB 5IOPA 3RVXD 2H8PA 5C0IB 4F33B 4KJQC 5EWIL 3PIQA 4XBGA 5D1ZA 3IU4H 3NIFF 3MYJA 5DEGB 1AI1H 5F44A 5GISL 4C55A 5I1AA 5BV7L 1RZKC 1IC7L 1CD9B 2NY2C 4JHZA 2XKNA 3D69A 1CXIA 3VGGA 1P7KA 3BZ4A 1ED3B 1S7RA 2A1WH 1CICD 1MHHA 5LQBH 4TSCL 3HNVL 3VFWA 3CH1B 2PYFB 3BE1L 4H88H 3H7LA 1U92B 4LSPL 4LRIA 1FG9C 2WUCL 3QHTC 3LIZH 5C0FA 5HVWA 2IAMD 1KFAL 2BOBB 1UXSB 5GS3A 1BZ7A 1CU4L 4F3FA 4WCYL 3W82A 3TA3D 5A43C 2J4WH 1IQWH 1WF5A 3V5KB 1GRWA 4R3SB 1S9WB 1AXIB 2XOTA 3E2HC 3FRPA 2HN7A 1WZLA 1NGXA 4RGNE 4C83A 5HYSB 3B2UC 4LSRL 3BVNB 4W70A 3B5TA 3IDIB 3PGDA 4JG0L 3B9VA 3BOVA 5DVLA 2FBOJ 3RVUC 5BRZE 3CX2A 1F58L 4F2MB 3U46B 1C08A 2FIKA 4MD5B 4XPTH 4FNLH 4BQ9A 4Z7QF 3BP6A 1A7NH 1HYSC 4CVZA 4UNVA 4KXZH 4WGWB 2OK0H 4GRWF 4LSUL 1NCCL 2C7UA 1HXYB 3F8UB 4KROD 5JMOC 3TA3A 4P5TB 4RCAA 4XCNB 5BMFL 5FCUL 2X41A 4LDEB 4HPYH 2NY5L 4Z0XA 5C0CA 3TO4C 5HPOA 3T08A 4DGIH 1LE9A 4F58H 3GI8H 4XAKE 5GGRA 4EOWH 1T1ZA 2L7UA 4GG6E 4ODVH 3BPOC 1KT2B 4PRHE 3TC9A 5LGHH 3D6GA 3HN3A 4RGOH 5TPWH 5M95B 1EHLH 3TV3H 2ZSVB 2NW2A 3QEQA 5JHDE 5H35B 3U0WH 1BBJB 2DKMA 3HUJE 5DC9B 1Q9KA 3MACH 4JFFA 3BISA 2YEZA 1A3LH 4YFLI 2AI0L 3V6BR 4P46D 4QRQB 3BP6B 2VR4A 4XP9H 3G5VB 1RIHH 2WSKA 4ODSH 4ZUTA 5DVKA 3VGFA 4PFEA 3WDIA 4WU7A 1CFSA 4MNQA 3GUTB 4FQXD 1K4CA 1XR9B 3GSVA 3S3PA 3IFNL 5FF6B 1NMBL 4HPOH 3C08H 4TSAL 4XNMA 5EH1A 5SX4I 5GS1B 2W9DL 4LSDA 1E4KC 2AV7A 3BQUA 4I18B 4Z7UA 4EKXA 3VRLE 5KVDH 2YRLA 2VLKD 3TIEB 1EAJA 4OV6F 2J88L 3UTTD 2A77L 3U1SH 1NL0L 5ITFB 2XG5A 4OIAA 1NCDH 1LO2H 3MRBA 3O6KH 3TJHD 5DHVB 4YX2H 4JFED 4C4KO 4LBEA 2NX5D 1BWMA 4I4WA 1WWBX 3IF1A 4Y5XC 3GMNB 2VJXA 1GHFH 1L7IH 1RHHA 5KJRH 3IYLW 4LSQL 2DQCL 2EO9A 4ZODA 4NBXB 3BWUC 1GC1C 3FOLB 3DX7B 4ZXBA 5CKAA 4O58L 3FO0L 3BXNA 1HHIB 1UJ3C 2F54D 2VZSA 3RGVD 1VGKB 3TNNB 1WWAX 1YEHH 4J8RB 1TZHA 5LBSH 3FQUA 3VMOA 1AO7D 1LP9B 1CXFA 4QOKE 3JBG7 2NY1B 4N5UA 5HJ3B 3BKJL 5CP7A 4RMSA 1HHJA 4L5FL 3ULVD 5I75B 1MRCL 1UZ6E 4O02L 4N5EC 4K3DH 4HIXL 3GBMH 4H1LB 3LHPL 1T80A 3CFJA 3JWDL 3LSOB 3BKCH 5HBBA 4Z78B 2Z4QA 5HDQL 3MV9D 3O3DA 3DX9A 2O5XH 3QIWC 1QRNA 5GGRY 4P5TA 3U6RB 2MJWA 1EJOL 1BF8A 3F5WA 1WZ1H 4PJCF 3FQXA 1LE9B 1CFNA 1FNFA 3R8BB 5GSRB 3NIFE 1D6VL 3I3EA 4JN1L 4IRSB 4MNQE 1BFSA 3U4BL 5J9PA 2XZCL 5FO9A 2YD5A 5E6IC 3QEQB 4PJHF 3UJIH 3VFPB 2A83B 1FSKB 1DQLH 5FYKL 3VA6A 5DJDB 4UTAL 5AYUH 2P24B 1A3LL 3OHXB 3AMKA 3L3KA 3KYAA 4RIRA 2PTVA 2UZIL 2G5BA 2HKHL 4WEMB 2X1PA 5SWSE 3GJEA 4YIQA 4OB5H 5TDNA 2Z31C 1U3HB 4YWGH 4H8WH 2XPGB 1F8TL 5IMLA 3AY4A 3KPNA 3HI5H 3VGAC 4XVSH 1JRHI 1N64H 3RNQB 3ZT7A 2EDJA 1JGEA 4PGDA 5D7IE 1AE6L 2CMRL 1ZLWK 2B4CL 3TJHC 4PRHB 2EE3A 1OGAD 5DO2C 1RVFH 2WWKO 2NTFB 5MHSD 3S35X 5SWQB 4YPGA 5J6HA 2B1AH 1UWEL 2GIYA 4X5WB 4KPHH 5B39A 1A1OB 2EIBA 2Z93A 3UJJH 3MRCB 3BP4B 3CLEH 4OLZL 1S9XB 4WDIA 5KS9B 4KWUA 5I8KH 3QUXB 4Z7OF 1DEDA 1VGKA 5EORL 3O3BB 4BYHA 1N26A 1EBAA 1FL3A 1BOYA 8FABB 5GQBA 4LAJH 3QDMD 1U41A 1GPOL 1D6EB 2CIIA 2AQ2A 3L3HA 5C9JA 3JV5A 5I8OL 3ZE2E 4QHNA 1RIUH 1XGRA 5HPMB 1XCQB 4ETYA 1YEIH 2X4SB 1KTRL 4V1DB 2DD8L 4Z78A 4HJJL 4YE4L 4XP5L 3ARBC 4AZ8A 3SE4C 1X5ZA 4OZIE 1NDGB 5F9DC 3O9WA 1QFWH 4LLVB 1A6UH 2DL2A 3B9DA 1HHJB 4G8FB 1MCDA 4Z7WB 3CX5K 3MODL 5HYSG 4M02A 5DYOA 3S3JA 1A1MB 4X5XB 1D9KA 2ZPKH 4E5XA 1A6AA 5C70A 3VXMD 4P2OD 3PWLB 2SEBA 3PJSB 2XQBL 3ALWA 1PD6A 3V0VB 3ORJA 5B3JF 1JYVA 1KIPA 1PY9A 4KK9D 4U1HB 1MCCA 2DLGA 4ZNEA 2NY6D 1RUKH 1SEQH 4YBQD 5K9KB 5BV7H 3MLYL 3C6SA 4WFHD 5HXMA 5T5NG 1KN4L 3QFJA 4H1LG 3GSQA 4AIZA 2K7QA 4AQ1B 1LP9E 2DI8A 3BN9D 2W9LA 1RURH 2WP3T 4OM1H 5I76A 5DF0A 4M5ZL 4CN4A 3D87B 4G8GD 3EOYG 4NKMA 1GHFL 3KPSE 5T5NF 2IMMA 1TZGH 3FHQA 2BRRL 3L3JA 4I3RH 4QRPD 3NCBB 4R3SA 5JW5B 5GRXG 4LMQI 1JN6B 4OZGF 3SDDD 4OUOA 5EO9B 1JK8B 4TUJA 3DNKA 1SHMA 2FZ3B 5HI4D 5HTSA 1F4HA 4BUGA 1HCVA 1IT9H 4L8SB 5H94B 5I8EB 5DHVH 4JRYA 4X6CB 4PLKC 4QLRA 2D03L 3D3VD 1EAPB 1RI8A 5GHWH 5JIPA 4WI5A 3UBXI 4ZYKA 3EOAA 4GW1B 2CQVA 1UA6L 2FSEB 3MRNB 4M7KL 2IG2H 1F6FB 1P4LB 5HHME 3VFUB 4FA8A 1RMFH 2AEQH 3DI3B 1CQYA 2DQDH 5ESAB 4Y4KC 1Q1JH 2FD6H 3DUSB 1QFWI 4WEUD 3AS0A 2A6DB 4MGXA 1UCTA 4RGMB 3VWKA 5KTEL 3GMQB 1RUAH 1J0JA 1ZT7B 1IAOB 1ZAGA 4Y19D 2HT3D 3D39D 5DI8B 3VMNA 1UWGL 4HFWA 4UINL 2F53B 3SDCC 1OD7A 3BKML 3GJFK 3TP4A 4PG2C 5FXCH 4X6BA 1MFEL 1U9KA 3SBWA 2BXYA 1YPZA 3M45A 1JFQL 4JR9L 1DFBL 3WD5H 5T3ZD 3F65A 4U2ZA 2HRPH 1QA9A 3GBNH 3TYGH 3ZT5A 4MB4A 4Y4KD 2D4FA 3C6LC 3MOAL 4MNGA 2XZZA 2UUDH 1HSAA 4J6RH 1AC0A 2YC1A 1LD9A 5BMFH 4MD5A 4F3FB 1GGIH 4BFEA 3GMOA 3H3KA 2DMKA 4PYGA 1IE5A 3FRPG 4DEPC 4G7YH 1UYWH 2QSCL 3DX8A 3R06B 2E8ZA 3QFJB 2A6DA 3LH2H 1H3TA 2CO7B 3UZEA 2NNAA 1IGFL 1A6AB 1YNTB 3V4VH 2OTUB 2W0FB 3LCYA 1DBAH 1MOEA 1MCNA 5HI5D 4R26H 2AKRA 4U7KA 2VDPL 1EZVX 3OJDA 2ZPKL 5K9KA 5DRZA 3QIBC 5EBWB 1J5OL 2F53D 1KIRA 4MLIA 4KJYB 4MSWB 4WNQB 1RU9H 1MNUL 4L8SA 3IF1B 4MQTB 3BYTA 3WLBB 3CU1A 4PTUB 3L3OB 5HHOA 1F11B 2Y6SD 4POUB 2CKBH 5JXAH 5IHZA 1BQHG 2Z92B 4LVOB 3V2AR 2WQ8A 4Z7VF 5BOPA 4K71B 3PWVB 3EDDA 3OKKB 5E6ZA 3G5XA 3TJEL 4Z7OE 3VD9A 3STLB 3BHBB 1AP2B 1CBVH 5ICXB 3UTPE 4TPRH 3G6JE 3PP4H 5DMGC 1MWAB 4B50A 5C2BH 4ZQKA 4ZFOL 5IF0A 3RKPA 3F58H 5ENWB 4NN7B 1FJ1A 1KLGB 4Y8AA 2AQ3A 1WCBB 4XNQA 1ZHNA 3SDDA 3N1GC 3DRQA 3FO0H 1HHGA 1CLCA 3FL7A 1F4XH 3G08B 1MLCB 5EN2B 3CMOH 3EO1A 3JWDC 4ZUWB 3VFOB 3MRLA 5DS8A 1JPTL 4UIKH 3S4SG 4K94C 5I73B 5ACZA 3H0TA 2DKUA 5BJTB 4LLWB 1HQRA 4YXKH 3MGTB 4GG6B 1NMCC 5GJSL 3TO4B 1P2CA 4YLQT 4HQQH 1W0WA 1IAKA 4QXTA 4EDXB 3FFDB 4MMXC 5DFVC 3O81A 5F9WB 3GBLA 3RA7H 2EEBA 1U8HA 4H8WL 2Y4SA 3X11B 1NGPL 4KRNA 4RAVB 1VFUA 1ACYL 4O00A 2FIRT 4JVPA 1I7UB 2X4TB 3IVKB 2JK5B 3DRQB 4W81A 4ZO6A 1NCWH 1DQJB 2EDQA 3U36A 2ZJSL 2NXYD 3L5JA 5IG7A 1VFBB 1Q0YL 4Z77A 4G80B 5FYKE 1IM3B 5MEPB 3REWA 5HYJA 2CJUL 5HD8C 3O3DB 2OTWB 1OD9A 5DR5L 1DVFD 1FVDB 2B1HL 2EDXA 4YAQB 4Z95H 2EKSA 2HVJB 3SPVA 1X5HA 1J8HB 1ES0A 1KIQA 1OQOA 5BV7C 1NEUA 4G8GB 4X6DE 1TJIL 4QXTB 2JELH 4R0LC 3C5JA 4Q9BA 2ADGB 1UWXK 5TPWL 1EHLL 3EYQC 3K8MA 1AFVH 3HE7A 2D2OA 2F8XC 4HKXB 4ISVB 3M07A 1RULH 2X4RB 4FZEH 4JCMA 4EUPB 4LNVA 4ZUVB 5IK3A 2DIAA 2LTQC 2A83A 2NY6B 3BKJH 1JMXA 1X6LA 3FO9B 4R8WH 4DZ8A 3UPRA 2FECL 3L3HB 4XNQB 1H5BA 4CVZB 4DVBA 1U2CA 2J12B 4Y5XA 3EYUL 2X44D 4L4TE 1U8NB 1A9BA 3JTTB 3KPPB 4EQ3A 4FFYL 3BRGC 2XQYG 3QWOB 4OZFA 4G6KL 5EZJB 4P2RB 4XC3L 5L9DH 3TT1L 5FK9A 2MFNA 1J11A 1QSFA 1FO0L 4PJFB 1Q94B 4P46C 1S3KL 3W0WA 3PDOA 4G3YL 5I1LA 3D48R 5B39B 3T77A 1IC4H 5CGMA 4FFVD 4HKXA 5JLZA 1YMME 4JJHA 3WO3B 2ZSVA 5EUOE 1UM4H 4U49A 4OLWL 3DRTB 3P77A 1LDPH 1YA5A 3K4AA 5D6DC 1XR8A 3DETD 1ZV5A 3VFOA 2AGJH 5KVDL 1LHZA 1QD0A 5D7JD 1ACYH 4NFBA 1B6DA 1QHPA 4ODWA 1TVHB 1NAMH 4HIJA 1IEBB 1QACA 4IOFD 1U8NA 4GXVL 5E2TH 1IAKB 4PJDA 1MREL 3TN0C 1U95B 2EKJA 5BVPH 4E41B 4XNMB 2B5IC 3AVEA 4KJPD 1LP9F 4F7CA 5IM7A 2VAJA 1FSKC 3VFNA 3DYPA 3O3EA 2F54A 3QJFA 4MHHI 4JHWH 1YY8A 3QO1A 1R0AL 3IU4L 1BX2B 4WWKC 1EUTA 4R4BA 1U3HC 5IHUH 2FX9L 3IFPA 4K8RL 4XGZB 5LJYH 2IQ9L 3DRTA 1EV2E 4QTIH 5C0DB 3D25A 3MRBB 1JYWA 4NQXA 4P5MA 2HA1A 3MUHL 3VXUA 3G6AB 5DHXB 1IGIL 4OAWA 4ELMF 43CAB 4P4KC 2CKBL 4PGZA 3GSNH 5MENB 1T20A 4W6XB 1KC5L 2PTTB 1VPOL 1IFHL 2JB6B 3QQNA 4Y4KB 2E7CA 5HGHA 1J1PH 4GW4B 3FO1A 2PYEA 4H5SA 2W65A 4N8VB 4UDUA 5J57B 3DARA 2YPKA 4U0RC 4KRPB 1OPGH 1A5FH 4LFHG 4RISL 4BQCA 3HUJB 5JXEA 2P5EB 5A2LH 5L0QC 1S7WB 3ZKND 5DK2A 5EB9A 2VSDA 1TZHB 5AG8A 5JXAL 4ORZC 4OZFG 2BHYA 4F8TA 2I60H 1CVSC 1I1YA 2PXYD 1F58H 2FEDC 4YH6A 5J12C 3ULSA 5H37G 5CJXA 3FO9A 3FN0H 3ZDYE 1MNUH 1IGFH 5E95B 4IS6B 5LAXB 1ZT1B 2AJVL 3MLZH 1IGMH 1C12B 4OLVH 5C1MB 2VDPH 4XWOC 2VXSH 1CGTA 4OSUH 2HFGH 4Y88A 2EYRB 4Y4FA 3DX9B 4ZPTB 4DUVA 1V3JA 5L88L 3QZWA 4U6HA 3WXWL 4XMPL 1YMMB 4LVNB 4CNIB 4ODHL 4H5SB 1I9JL 4PP1C 3AREB 1FZMA 2HTKD 3PDOB 3NACH 4D3CH 4NUJB 4XB7A 3F62A 3WFBH 4ORGB 2W0PA 2LV4A 5E7BA 3UCRA 3ARXA 3RGVB 1SYVB 2PXYA 5GS0L 1KCVL 4NHUB 3HB3D 5CIPH 1Z5LA 1R3IL 4YXHH 2DOCA 3SEPA 1LO5A 5FHBH 5GGSY 3DXAD 1RZ8B 1Z3GL 1GZQA 1BBDH 5DWUH 1IAOA 1XGTB 2DYPB 3NIGE 1WCQA 3OR6A 1IEBA 3WYRA 3NZ8B 3S37X 3VDAA 4JJ5B 3STZB 3E1F1 3U0TB 1KJVA 3GHBH 2ZNWA 4JG1L 2X4UA 4JFOA 1IAIM 5K33A 2PETA 4HCRH 1OTUC 3VXUE 1MJ7H 1R5VA 4J4PC 4OFYD 3VXTB 2J8HA 2OMBA 3NVQA 1MH5B 5F8QC 4PUBL 4X5WA 4JQVC 2OM5A 1AQKL 1Q1JL 4MWFA 2RFXB 5IVXA 1S5HB 1HDMA 2WINB 3WFHB 4QRTA 5D8JL 2VYRE 4P57B 4DW2H 1T5WB 4FOMA 4JDVB 2XN9D 3FB5A 4ZUSB 3KLDA 2E7HA 1N6VA 2XKNB 4FQIH 3U4EA 1Z3GH 4WV1C 5EORH 2A9NL 1MCPL 2DLEA 5GHWL 5HY9A 1P4IL 3MRFB 1T1YB 4U1MB 4BSJA 4JFXB 1D6EA 4BQ6A 2NW3B 1UKSA 3WIIH 4KI5C 1FFPA 1N2RA 1TNNA 4C57C 3ZDZF 2BOCB 4PJBB 2HFEA 3RWIB 2ZOKB 5AZEH 5BW7C 3DUUA 2G9HA 1CWVA 4ZUWA 4KJYA 2V5YA 1BVKB 4XC1L 3CSGA 4MJIE 5ETUA 1JZ4A 2N56A 4X7FC 4P4RA 3CPLA 4L9LB 3B5HA 3VG9B 5ADOH 1SEQL 1V7NH 3QO0B 3TM6A 1BJ1J 4BK4A 4LPYA 4NNXB 4U6TA 2GUOA 3QZWG 5CD5C 3LVEA 1U8JB 5DDHB 1H8NA 1T21B 2FB4H 5DJ8A 2AK4A 1G7QA 3QPQC 4L29B 4GAFB 2W91A 5FA4A 1F00I 4HEME 2QL1A 1I8LC 5DRNB 4QRPA 1N5YH 1Z5LB 4M43L 1CICB 4GRLD 3PWLA 4R7DA 4OFVA 5FHAH 3WLWC 1G9MC 3O2WH 2XQBH 5E94A 1R3JB 5E0QA 3WHXA 5JOPD 3HCVA 2FYYA 4MVBD 1FDLH 2AJYH 4U1JB 2FL5A 5F9JA 4ZDHB 4KK5D 3OKEA 5I9QB 1EX0A 3WNLA 5D2NC 1I7ZA 5DFWH 3UJTL 2C3HA 2O5YH 5L2KE 5DD5L 2Z9TA 5B3JE 4TNWK 2GITA 1OTUD 4S1SH 3O2VL 5F7WC 4L4TB 5T33L 1Q38A 3MUGB 3CGTA 3FN9A 1BFVL 4RQQA 4S1RH 3EYVA 1NSNL 1NCAH 2YK1L 1U3YA 3LKPB 5E8NB 2DYPA 3IDGB 2FHBA 2R0KH 4KXZI 1BLNA 4X98A 3MRPA 3HNSH 3S37L 4CN6A 4IRSD 5T1MA 1YNLH 3VXSA 4RSVA 1JYNA 5KBNC 3OB0H 2GHWB 4KK5C 1CR9L 2ICCA 4X6CA 1FZKB 4D0BA 1RQ5A 3U7YL 1EJ6A 3H3PH 4QGTA 4OD1L 3WFDL 3DX6A 2HLAA 3QNYB 3EOAB 4GW1A 4HDIA 3S6CA 1A6TA 5DQ9A 4UI2A 2IBZY 5CSZB 2X4QB 5DUMH 2QJDA 3BKYH 1Q9LB 3WIIL 3BDXA 3T1FA 4FMFA 5IHLB 3HZKA 2QKIB 5GGUA 2X4NB 5E2TL 5IW3A 2CGRH 1XCTB 1BVKA 1H5BC 1LEKB 2KBGA 1AGFB 3MO1B 3ZKXC 4XHJC 2B1AL 2ARJA 2NR6D 3MV8B 3F12B 3E3Q<