3LEYL

2f5 epitope scaffold elicited anti-hiv-1 monoclonal antibody 6a7 in complex with hiv-1 gp41
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
216
Chain Sequence
DVVMTQTPLSLSVTLGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLASGVPDRFTGSGSGTDFTLKINRVEAEDLGIYYCWQGTHFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 6a7 Antibody Heavy Chain
total genus 53
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyL01
4RQQB 2A38A 4KDTC 4Y2DA 4XCFL 3LQMA 1IGIH 4PJHE 1NANI 5DD0L 1T04B 5DURB 2X9WA 4N8PA 5TE4L 4ZD3L 3MJ7A 1OQOA 5B3JF 2F53B 3FTGB 3PIQA 4K9EC 5DC0A 2BSSB 3OX8A 4M8QB 4U6HB 5ESAB 4XVUD 4X6DB 4QTIL 5HVHC 5DQDL 4KROD 5DD3H 5EO0B 2WP3O 3OXSB 2AEQH 4PRIA 5E7BA 4GAFB 5I8KH 2ED9A 5KAQF 4RWYL 1XCTA 2HT2D 1FIEA 3CUPB 3S97C 5A16B 3WKML 2XV6B 3CLFL 4XP6L 5TH2B 4KU1A 1QRNB 4AYFA 3Q2CA 2JJWA 4FQLH 2IADA 1A0QH 4TQEH 3QUXB 1CICD 5DVKA 5JHDB 2X9XA 4Z0BH 4YDIL 4U7MA 4G9DA 4GSDL 3SE3C 1GPOL 3WIHL 4ODWB 4K94L 3ULVD 3QXUA 4GW5B 5HGHA 4B50A 3EOBA 4X5LA 1I8MB 3K8LA 3D18A 4H88L 4HQQH 5CJQH 4WUUB 2G75A 2Z93A 4JRXB 3UROR 4X7CC 4WFGE 1P5VA 3X14A 1FG9C 1DBAH 1A2YA 2W9DL 2ATKB 4LCWB 4QKXB 1LMKA 3FZUC 4WHDA 4QOKE 2OZ4L 5HHQB 2FLRT 1NLDL 3W5NA 5TQ2H 4FP8L 4QRRE 2OX5A 1PZ5A 4UU9B 2N1KA 4W6YB 3I9GL 3TIEB 5CKAA 2V7HA 1BX2A 5BCAA 1GRWA 4JQIL 2ARJB 4ELMF 1IGJB 3LEYH 3QFJE 4PBWD 4ZS6C 1FNEB 3MUGA 2ITDA 2CKBB 3MJ9L 4Y5YA 2COQA 1XR8B 3K74B 1AO7E 2BERA 4OFIA 3Q6FB 1PY9A 3P0VL 5C7XH 1CICC 4XWGL 5TDNA 5FYKU 1UCTA 1P5UA 3I6KA 1FYTE 3RVWD 2ORBH 4U3HA 3MLVL 1TTFA 4GXVL 3TEUA 1C08B 4H0HB 3FN0H 5T3ZE 4HUWA 5KS9A 3B3IB 3MSPA 2W59A 1QLFA 2C3HA 4S1SH 3V4VH 2YPVL 3R1GH 4LAQH 2GHWB 4APQD 5E8EA 5E00B 5I71B 1DDHA 1BJ1J 1MLCB 5DZOA 3WDJA 1NLBH 3DYOA 1A6TA 1A1MB 3JTTB 1ZANL 3HAEH 3O4LE 5SX5K 3SKOA 2JK5B 4NC1E 1MFAH 3FQWA 3QO1B 3BQUD 4XPFL 1I8IB 3FONB 4IMKC 3T3MF 5JOFB 1E27B 2FDBP 1N3NA 2EDXA 3WN5C 2HRPH 3GZKA 1YYMH 1EFXA 4A6YA 5A3ID 1KEGL 3DNKA 4HBQA 5EIIB 1FLTX 1AHWB 2FX8H 1T6VN 3DO7A 2VJXA 5INDB 1AO7B 5E5MB 3ARWA 4ZTPL 5JW3H 2V17L 3VGHA 2R0WL 2FEDC 3OKMA 4X7TB 3PQYA 2GSGA 1S9KC 3P11L 4JZJA 2HAZA 5IEKB 4JDTL 1BVLB 1HINH 1O7VA 3OAYH 1ZVSA 4PGBA 3RY6C 1X5XA 5CJOH 2IPUK 5J9PB 4XWGH 1MCPH 5EU6D 4MS8D 4NQSA 4AT6B 1CLZL 3ARSA 3EYFB 3J7HA 2R69H 3MJ8A 2UUDK 1GIGH 1RVFL 4F2MA 3ESUF 1NMBH 3O6MH 3LQAH 3TPUB 4H8WL 5I1IH 1RMFH 3HMXA 3H9SB 1LDPL 2ITCB 1PJ9A 3W2DH 2Z8VC 4PTTA 3PWJB 1GZQA 1NCTA 1G9MH 3L5IA 4JZJB 4BFIB 1NCUA 5B8CC 4MAYB 1CFSA 3NH7L 2VDNH 2HT3C 5DI8B 5DA4A 1NGYB 5T3ZL 3CAFA 1A3RL 1CD9B 1RMFL 5CGTA 1C5DA 2Q87A 3ARPA 4QCIB 5ACLA 4OM1L 1GH7A 1P1ZA 1BFVL 1R5IA 2XICA 32C2B 3ZYJA 1TZGL 3DPBA 4LHUG 4TUKL 4X9IA 3UC0L 3QDMB 4Z7WE 2NY4B 2D0HA 1JHTA 2Y9RT 2GTZA 2YRPA 1OARL 2VDPH 1E4WH 4D0BB 2BNRB 4M6OL 5DQJB 4AEIH 2VIRB 2AV1A 4FQHA 4LSRL 5CD3B 5GGSA 5DK3A 2I5YH 3CFKA 5KVDH 4B41A 5SX4I 1NGZA 1Q9LA 4TQEL 2BP3A 4G8GD 3SKNB 1QZ1A 2GKIA 4P46D 1G9NL 3NCJH 1RK0B 3TBTB 1SVCP 1U9KA 3CFEB 1X5GA 5DJCA 3PWVB 4DUWA 5C0CB 5J8OA 1HIML 4JFPB 4XCEB 4LCYB 3ILQD 4M1DH 5T33H 4NQTA 1RSFA 4OZHA 3L9RB 2YBRB 3STLA 1AR2A 4FQPA 3GMPA 4LFHD 1FNGB 5DMIL 4I0PB 3MOAL 1LO5B 5H35A 1IGIL 3OKYA 3U7YL 3UBXA 5GRWA 3TO4C 3LIZL 5EO9A 3FONA 4MCYB 4ODXA 5IG7A 1Z5LA 3GSWB 3SDCA 4DVBB 1AHWC 4LLDB 2Z31A 3QDMD 5K9KB 4ZFFA 3VGBA 2AJVH 2R2HA 3VH8A 3LOWA 4PJCA 1IM3B 5KG9B 2DYPB 1ZT7B 1A1OB 2HFGH 2AQ1A 4RMTA 2C4FT 5GIRA 1CFVL 2Z0BA 5D2NC 2O5XL 1OP9A 5JNYA 3I2CH 2C26A 5C0ND 1NBZA 3BSZL 2VNCA 4IIQA 3QJFB 1INDH 5HHXH 5D7SH 5FUZH 5KTEL 4FOMA 2XPGA 1JNHA 4O2FA 4TUJA 1NCDH 2E9JA 3WFZA 1H5BC 2R8SH 2ADFL 4YEEA 4OGXH 3WXVH 2DN7A 5IB5B 3PHQA 1EHXA 4YEFA 3JXAA 2NW2B 2DQHL 4PJXF 1AY1H 5J4MA 3NA4A 1ZHBA 1QO3B 4PG9A 4NNXB 2VLRE 5IESL 1PW3A 2DLTA 1SJHB 2IAMD 1R3JA 4KPHH 2Y36L 4L8SA 4BSVA 1RU9H 3GBMH 3S98A 5KVFL 4R6UA 5C8JA 3QP3A 3H42H 1VA9A 5TGBB 1RIHL 2P24B 1FV1A 5F6HI 4HJ0C 5IT2L 4L8CA 3P3YA 1AGBA 4GLRH 1SVZA 3M17B 5D2LE 4F8QA 3DRTA 4P3WA 3MLXH 3OTTA 1EBPA 1F58L 4WY7L 4ELKB 1I3RA 4OF7A 2LTQC 1K8IB 3T0XA 5EC1B 3W9DB 5HGGS 4R90L 1DL7H 3OAUL 3VRJA 1W2KT 1KIRA 3MA9L 4I3RL 4XH2B 2M2DA 5FM8A 5F1IA 5BVPH 1CDGA 4WU5B 4GSDH 2CIKB 4ZUSA 5L9DH 3WS6C 5HHMD 5IJVA 3C8KB 5MEND 1CGSL 1LK2B 1XGYL 4LNRB 4ODWA 4NNYA 2F5AH 5FKAB 5HI5C 1ORSA 2R2EB 2YSSA 4Z7VF 2DIBA 5HI3C 1KLGB 1CZ8H 3RIFF 3U1SH 3FQNB 2EEBA 5DMGC 3RA7H 2Z8RA 1U8NA 1F42A 5C0BB 1ZT1A 5HYIA 1NGPL 3KPSA 4PR5B 3SOBH 4JKLA 4M5YL 4P4KB 3BZEA 3ULSA 4QXUL 3DV6A 3KS0J 3QCVL 2EKSA 3AC0A 2RBLA 4YHKL 1FRGH 4P2YA 1MCLA 3LKNB 2CJUH 1QFHA 3OHXA 1HHKB 1F2QA 3HAEB 5BJTB 1KIUA 3BUYA 4N90D 4LRIC 4M7KH 3ZT5A 5IW6A 5M94B 1JWSA 5F1NB 3WXWL 1BEYH 1Z0MA 4JPIA 3ULUE 2XRAH 4UV7L 3KPMA 2R39A 4E0RA 3R06B 4YLQT 1B0RB 5I8CB 1XGQB 4JDVB 1UA6L 3C2SA 5AUMB 1H3WM 3EBAA 1RZIB 2WWMD 4Z7OF 4NC0B 1NQBA 1U0QA 1OY3B 1KPVB 3TBSA 2H2SD 4RBPK 1BECA 4NT6B 3H9YA 3V8CA 3SHSA 1S8DB 3BW9A 4DK6A 1UH3A 3DO3A 1DANU 3QUYD 5F7DA 5C0AA 3UTQB 4ZPVA 5F96H 2P44B 3V6BR 3F62A 3QNXA 1ITBB 2EXWC 4KI1A 25C8H 3W82A 1E4XI 3DUUB 1VEPA 1M71B 3SDXB 4L8DA 1M7XA 2JK5A 4TSCL 3K2MC 2ZCLL 3CH1B 1CVRA 1A6TB 2VR9A 3VFOA 1JRHI 1U3HD 1XF1A 3QDJA 3PGFH 3VXUB 5D1XB 2F53A 1CZ8L 4GKZB 4NKMA 4K3DH 1X7QB 3C8DA 4BJLA 1L6XA 2YD4A 3BT2L 5FF6A 3CX2A 3LKQA 5K9QI 1EAJA 4PLNC 2D7OA 2VZTA 4F8TA 5AG9A 5F9WC 2ZOLA 4OGYL 4Y1AB 3TZVA 3M45A 3MRDB 2WWMC 1YJDL 4JFED 4W6XB 3QEQD 2HG5B 5CP7A 1T5WA 4P2OD 5ID1A 4LSVL 5A2KH 3IFOA 2ZG3A 4X7FC 5FUOH 4J3SA 3BIKB 3SCMC 1A9BA 1I9JL 1KOAA 1N4XL 1Q1JH 1DQDH 3FQXB 1FL3A 4NKMB 4OGYH 4ETQB 3O8XD 2O5ZH 3KG5A 3MGTA 4LCIH 2I9LA 4X8JB 2BFVL 4NQUA 4OLEA 4JRYB 4F7CA 3NCBB 3BKJL 1Q72H 4RIRA 5BVJB 1IGJA 1WZKA 1CD8A 1U8OA 2BX5A 4ELKA 4DKAA 1HWGB 5FIEA 1FFNA 4UT6H 1I1AD 1YQ2A 1KGCE 4MAYD 3TBWA 5CSGA 4KUCD 5TDPA 2EXYC 2BRRL 3HUJF 1AY1L 2GJ6E 1TJGL 3RVVC 1V3LA 3BZ4A 3R0NA 3TVMD 4QRRB 5FM5M 2MHAA 3TN0C 4XXCC 3OB0H 2A9MH 1DN0A 4IEFB 2WANA 4M7ZB 1QEWA 4KJWC 5CSZB 2YPLB 4XZUB 1FVDA 1WWAX 5F96L 4U0RC 2DBJA 1I1AB 3P4LA 4NC1C 3T3PE 4X4YB 4BK5A 3RUGF 4NNPH 1NC2D 4LPYA 1YY9C 1G7PB 4LHUB 5FECA 4QXGL 5CINL 1NMAL 2HN7B 4PRPA 4JPIB 1J05A 2YOCA 4KKLD 2VB5A 2BVQB 4XP4H 1MQKH 2R56L 4NUJA 4Q2ZB 3K8KA 3K1DA 4D0CA 3LKNA 4M61A 4X8XA 2CRZA 4FS0A 4AJ0A 4PV8B 2RR3A 2FECL 3VXRA 2RJMA 3H0TA 1MVFA 2PYED 1KT2A 3OR6B 2B1AL 2VO5A 3GO1L 4NQDD 4ZYKA 2R2BB 5I1CL 4GKSA 1L6ZA 1EAPA 5ID0A 3F5WA 3HHRB 2QSVA 4LNRA 1BREA 1HSBB 5SWQA 3HZVA 4U0RB 5MHSE 3MC0A 5JHDD 4KK9D 1WWWX 1QBLL 3RVTC 3GMPB 2HKHH 3QJHB 4NM4H 4HUUB 4OLXL 3L5JA 3KXFD 3GKWH 1D9KD 4PLJC 4NKOB 1UWGH 4XPHH 5C0EA 3N50A 4BUHA 3C60D 5FM5O 1T21A 3IF1B 3O2DA 2PXYD 1CICA 5C0GA 5LGJB 3RWIA 1GGUA 3JV5A 4YXHH 1HSBA 5SWQB 4UINL 4HF5H 4I2XA 2F5BH 4IRJA 3UTTA 3CC5B 1JI1A 1VPOH 3NACH 4P9HL 4M6OH 3ZSSA 2H8PB 1OW0A 5BO1L 3REVB 3TNMB 1AE6L 1KCLA 4ZUUA 1A1OA 5LG1A 4XCNB 5E0QA 4ALAH 3DLQR 4L4TA 4RRPA 1FZKA 4XVSH 3SDDA 3WE6B 3RNQA 2D2OA 4PJIA 3O6FD 3LEXB 5FV2A 2H6PB 1ZHBB 3GGWA 4LLUA 4RAUB 4XNYL 1I7ZB 2OTWB 1UYWL 1JGUL 2Y6SD 4NJAL 3F65A 1MQ8A 4NT6A 4P2QE 3JV0A 5JDSB 3G04B 3EJYD 4WI7A 4GAGH 1YPZE 1KB9J 4MJ4A 4LEXL 4OZFH 3GMLB 1MRFL 5DVMA 2X4QB 4PLJD 2HYMA 5CEXA 4MZ3A 2NY4C 5DJDA 5CZXD 5IW6B 1QBMH 3BKCL 4I0PC 2V2TB 2E27H 3HRZA 3TCLA 3LPFA 5CJOL 5CBAB 4I9WE 2F8OA 4PRBA 1I7ZA 4KK5D 3DXAA 1NGZB 1PGRB 4NKIL 3DRTB 5ACZB 3CFKB 3EYFA 5DRWA 3I3EA 3D1MC 4CJ1A 4JZJC 2VXVH 2AV1B 3QYCA 1CGWA 1H3PL 5IROC 2PKDA 5DEFB 1HHGA 4QRTB 1S7RA 3VXQA 4XMPL 3Q6GH 4J7RA 5SWZE 3U0TB 2UZIL 1X5LA 3DUSA 3EFFA 3F7PC 4P2CG 1YEKL 4X99B 4ORGA 4ODUB 3RWCA 5CBEA 7FABL 1JZ7A 3ULUH 1HK6A 1J8KA 4R97C 1LK2A 3GK8H 4PREA 4YPGB 1QLRB 1PYWB 3S35X 2Z31C 4Y4HD 4R4ND 2DLFH 1MFBL 3O2VL 1UM4L 4HJJL 1N6UA 4QO1A 4Q9QL 3BKJH 3QI9A 3DVGB 4EUPB 4JFFA 3T0EE 5CCKL 4FTVB 3L5WA 4G6AD 1RUML 3QQ4A 4G6FB 5C09A 3U0WH 4PRHD 4WGVB 2OJZH 2CDGB 5FYJL 5DMYA 4K23H 3HE7D 4RISL 4GMSH 4E41A 1XEDA 3X3GH 4XBEL 3S5LG 2PXYB 1XH3A 3BIBX 4E41E 1LP9F 4F2MB 2EH8L 3RL2B 4JN1H 1ORQA 1FE8L 1BLNA 2NY6D 5KS9F 4OB5L 3JWOC 2H32A 1T5XB 3FCTA 2P7TB 5E1AB 1GL4B 5A2IH 3MMEB 4DCQA 5IJKA 3VW3L 5MEPB 5LAXA 1Y18B 1MJJB 1WZ1L 2FL5A 3BT2H 3OKDA 4P9ML 5E8OA 5DHVA 5F70A 4PRAB 1U58B 3Q3GB 1U8KA 4FFYH 3BP4B 2YWYA 3EDKA 5IM7B 5F7KC 2ADGA 3HG1B 3O9WD 5AAMA 3MODH 4WFHD 5D6DC 4RA0C 1NFKA 3PL6B 2AABL 3FO1B 3LKRB 1BFVH 3IDNB 5F72S 4EDXA 4V2BA 4X7DC 5CIPB 4UTBH 5EU7E 4C56D 5E8PA 4WTXA 4LCYA 5D71H 2DQTL 1MJJA 2FL5B 2NZ9D 3MXVH 2BOBA 4HCRH 4L4VD 1UXSB 1XF4A 1NH6A 3N1QC 1WITA 4LPWA 5D93C 1I7TA 2GJZB 1UZ6E 4Y5VB 3RNQB 3TT1L 1WGOA 3A6CH 3BD3A 2ZUTA 5MP6H 2OXHA 3QNZB 3KWWA 5CZVH 1CI5A 4EI5D 1I85C 4XAKE 3RPKA 3VXPA 5IHUH 4CKVX 3ULVE 1YDPB 2AABH 3I85A 4K3HA 4V1DE 5B21A 3GSWA 2VZ1A 4Y4KC 4LU5H 4MAUL 3OKNA 3RU8L 4TULH 2GSGB 3QXAA 3W11D 1CLZH 2APVA 4F57L 3STBA 4R2GC 3G5YB 4WGWB 2P8PB 4FFVC 1KCUH 3FB7A 5BW7C 1K2DA 1INQA 5HTSA 3STLB 4BH8A 2C1OA 2WINB 4G8GA 3RGHA 5DLMH 2HFEB 4B7IA 1ZV5A 2R0LL 3DX9A 2Z91A 4U05A 1F5WA 3FOLA 5HGBB 2VAAB 3L7FA 5KSBE 4KTDH 2WNGA 4D8PB 5GGRY 1RPQA 4NCC2 1NBVL 3HI5H 1WT5C 2QKIB 4LLQB 2F15A 1T0MB 2OBGA 3IDGA 5HDBF 3SQOH 4XCYB 1KYOJ 1B2WH 1TNNA 3OAZK 3QIWA 1UM5L 4JPKH 3WKNA 5T3XE 3UZEA 3L3KB 2BNRA 1DN2A 1JV5B 1A02N 2X4OB 5CGMA 3DVGA 4X6BB 5T3ZD 5BVPL 4P2RE 1X6NA 5T3XH 2F58H 3EZJB 4I3RH 4M5ZL 3WL9A 2DQEL 1A6WL 2P46B 3SBWC 4R90H 2IQAB 1ACYH 4PJXB 5I1DB 1OWRM 1DQML 3NFPA 4KDVA 2VLKD 4GG6F 5ISZE 1DUZB 1N2RB 2YPLA 4PJFE 2C7UA 2J8UB 4YXLL 5IHUL 4HT1H 1WK0A 2ERJC 5GGTL 1A1NB 3MNWA 5CP3H 5AZEH 5EIIA 1DBML 3DJ9A 5LBSH 4BKLB 5E5RB 4KZEH 4WHCA 1EEYB 5EBMA 4NSKA 5F88B 5F7DB 3T2NL 3E8UH 3VFWB 3IVKA 2YR3A 2Y36H 1MLBB 2VZVA 2WM0A 2WMPA 1DVFC 4NZTL 1DQLL 1RZKH 1HHHA 4FQIL 3VXRE 4Q9BA 1FZKB 3WE6A 2X44D 1KYOK 3JV4B 5FEBA 4GRLC 3BZFB 3JWDC 5GQBA 2NX5B 5C2BH 5I1GL 5DJAA 3MMEA 4DCQB 1S3KH 1MH5A 5I73B 4GBXD 3HAEA 3TVMB 1UFUA 5KG9A 4R4BA 5BS0E 2BJML 5C0EB 5ENWA 1WCQA 5JPMA 4HUWB 4HKXB 3RAJH 5E8NB 1FVEA 4MA7H 2EYTB 4O5LL 3QXDB 4G8IB 5TQ0L 3H7BB 4I4WB 4C4KO 1GHFH 3TT1H 4GMSL 4HX1B 1HYRC 1HKLL 1UB6A 3MCLL 2Z8SA 4XI5C 1VPOL 3NACL 4XHJC 1KFAH 3LKPB 4LCUB 3S4SG 4P2OB 1IZJA 4JLRB 3K1KC 3CNKA 2ARJQ 4X6DE 3BPLB 4XPBL 3REVA 3TNMA 1X4XA 3EO1B 3EFFB 3MOAH 3WS3A 4J6RH 1BIIA 1DVFB 2V5RA 3KPRA 4J3XA 4P5KB 1U91B 1Y6MR 2R0KH 4K3DL 2J5LB 3QEGH 2PNDA 3GSNA 3PGFL 5FO9B 5AYUL 3DUUA 3MXWH 3TM6A 3BWAB 4PG2C 4DQOH 4HMDA 5D1XD 1QRND 4L3ED 4HD9A 2EDOA 2I26N 1JZ3A 3G6AA 5LGKA 1U8MA 1V7MH 2ATKA 4LCWA 4NUGL 4DTGH 3OMZA 5EU5B 4MD0B 3VXUD 5CD3A 4LHUA 2NQCA 5DLML 1EK3A 5GS0H 2FIKB 1S9WB 2FH6A 4XNUL 1QSED 4X4YA 1GGBL 3FQTB 4D9RD 4H20H 4N0FB 3RJDA 3UTZB 2A6DA 1H15B 2WUBL 3RTQD 2XTJD 4P3DB 1QFOA 3BRDA 2DQUL 4JGUA 4Y5YB 3ZE0F 3EW3B 4LVNC 5B39A 5DI8A 3RU8H 2R56H 1IGFL 4JHWH 4DZ8A 2YPLE 3DYMA 1MHPL 4X4MA 4FNLL 3VFGL 4HBCL 4JQVA 5GS2D 3U0PB 1J8HA 2OP4H 2OQJA 2Y06L 5I1LB 3LN4B 4X80H 5IVXB 1MNUH 2VLJA 3TO2B 3TJHD 1MI5A 2V9RA 3HTLX 3QUYA 4N5ED 3CFJA 3N9GH 1K5NB 3G6JB 3N0PB 4E42A 2EE6A 2RFXB 2CLVB 2K9UA 4KROC 1LD9A 1CG9A 1U8JB 3GUTA 3MV9B 1RAMA 5E9DD 1T04A 3UTZA 2HH0L 2VISB 1P4BL 2R2HB 5FK9B 5ISZB 2VXSH 2X09A 1SYVB 3OJ2C 4BSWB 5AYUH 4Z0XB 1BFTA 3JWOL 2MHAB 3QDJD 2FWOA 5SX5H 5IB3B 2NY1C 3D2UB 3N85L 4Y4KB 4DGYH 2F8XC 4N0UE 5D2LA 1FNSH 4S2SA 1GOHA 4XPBH 1RY7B 5EUKA 1RZJL 2VH5H 3MBED 3AXLB 5ANMA 3GHEL 4OZGA 4WW2C 4G7YH 2P45B 1NAMB 4POZD 1EFQA 3TN0D 4FZEH 3BEWB 1Q0XH 3OKKB 2X6MA 3LEXA 3G5VA 4NHUB 4B7LA 4RISH 2ZSVB 1WAAF 5FUCC 4DEPC 2VZSA 5HHOE 2H32B 3G5XA 3DVNA 1HDMA 4MDJB 3GSNL 3VDAA 4JEGB 4ENED 3NIGF 3HFML 5E1HB 4OZIB 2HTLD 2IH3A 4WUKH 5C3LD 3UAJD 2F54D 1ZWIA 3S7GA 1HXMB 1N6QL 4KI5C 1U2CA 1UM4H 1VEMA 4NN6B 1R3KA 5ANMB 1ZSDB 1MCWW 5ABDE 1H0DA 1BZ9B 2A1WH 3TGXA 4QXTB 3ZDYF 4BK4A 1B90A 5TDOB 5DJDB 3QRGH 3WNMA 3V52H 4HGMA 5HBBA 1JN6A 4NBYB 1EVTC 3RWHB 3RVWC 1EO8H 4MNQB 1MCSA 3QJFA 1EFXD 5DK0A 3SE4A 4CMHB 3WUWG 5L2JB 1UWGL 1AI1L 4R8WH 1SYSB 2IH3B 3ARQA 1BJMA 2QLVB 3HC4H 4U1MA 4Z7WA 2I60L 1MOEA 2Q8AH 3U4AA 1A6AB 4PJEA 2J7LA 2NY2D 4POZC 1FNLA 3RVXC 2YS4A 2GFBA 1MF2L 3P0VH 5C7XL 1A14H 5I2IB 4U1HB 4NQCA 2XA8H 1GXEA 4J1UB 4G42A 5ACZA 1KLFA 1ND0B 1JNLH 1CXHA 1FJ1A 5LQBH 1WCBB 5IFHL 3RP1A 3TBVA 4BUGA 3DXAB 1WBZA 3D69B 1QNZL 5L88L 4MJ6A 5FFLA 1TVBB 1W0YT 4EUPH 2DYPD 2BY2A 1TJGH 4OTXH 3SGEI 4NRZB 4MJ5B 3C5SB 5E6IA 4KRLB 1KELH 1T4KA 5D1ZB 5AUMA 2ICWB 5TQ2L 5DHYB 4XMLH 1DUYB 4MB3A 3R06A 1X3DA 1NUDA 2Z93B 4BQ6A 3C09B 1BAFL 3SDCC 3Q1SL 4ZO7A 5I9QB 2HVJB 1KIRB 3HI5L 4M1DL 5T33L 4I5BB 4OQTH 1F8TH 3W9DA 2VQUA 4Z95L 1DQJB 4P57B 4HKZA 1FC2D 4KH2A 4XRCB 1I8KA 4KMLB 1AXTH 3L3JB 3G6JA 2BOCA 1MWAL 3NCYS 2ZOKB 3LRHA 2X70A 1U8NB 1XGYH 3TNNB 2GSIB 3MUZ1 1EPFA 2FSEA 4WO4A 1S5HA 4Z0BL 1N0XH 35C8L 3TT3L 5LCVL 4LLVB 4D94A 2WWKT 1KCUL 4UNVA 1MEXL 4P57A 1EH9A 3EYVA 4NKDB 4AEIL 3I50L 1EJ6A 1P7QD 2X40A 4L8DB 4YHYC 4XP9L 4RGMC 2VDPL 4MZ2A 1RZGB 4X83A 1DLHA 1INEH 3IYLW 1CD0A 4TVPH 3LRSB 3E0GA 3RWFA 3F58H 5KS9B 5D7JB 3BI9X 1CGTA 2R1YB 4JHBA 4YK4B 3MRIA 1OT1A 3S4SB 3H9ZA 4DGVH 4OV5B 4UT7H 1OAXL 4FXLA 4WFED 5FUOL 3LKSB 4M7LL 2ADJB 4LSVH 3NZHH 3BP6A 2MKLC 1ZHKA 4PP2B 3B9KB 1XGQA 2OS7A 5I1IL 3H7LA 4JFZH 1G9MC 4KTEH 5IMKA 2CLVA 1IILE 2PW1B 3D85D 4YR6A 3ORJA 4HS3A 3A6BH 1R3LA 1ZLSH 3BPNC 3PQYE 2NR6C 1T1ZB 4U1IA 3SJVD 3ALXA 4XP4L 2Z31D 4Y4HC 2H9GA 4R9HA 3BJ91 3H9SD 1DQQA 2WBJC 2DQUH 5GSRA 4P46C 4ELMA 2IH1B 3QIUC 5T1KA 1LO5A 4LP5A 1AQKH 3DO7B 3VJ6B 1TZIB 3OV6A 4RMVA 3SPVA 5ADPL 1FZOB 2IBGA 1U8KB 5I74C 3D85B 5IB4A 5EPMB 43CAB 1CBVH 2Z9TA 3F7VB 4QXUH 1DQLH 4CRPA 1QFWL 2CH8A 2YHGA 4LOUD 1ZLWK 2ILLA 3CDCA 3QWQB 5JXED 1XFPA 5FYJE 4PBVC 3T2NH 2VABA 3I75A 5B4MC 4P59H 3T2OA 3B8YA 2OP4L 2ZOLB 2JJTA 3G6AB 2UY7A 5CCKH 3K4ZA 3TCXA 1MHEA 5HHMB 5HHNB 1YC8A 1CD1A 3NIDE 4LLAA 4PP1D 2H41A 2GTWA 3BPNB 3BWAA 4K3GA 3HR5B 5ADOL 1QR1A 1LEKA 4OZHF 1Q38A 5ETUB 3X11A 3B5GA 2VITA 1BBDL 1Q1JL 1U8OB 5FYLD 2W65B 4TVPE 2UZIH 3ROLA 1DQJA 4LSTH 32C2A 2FJFA 4Q9RL 4XMPH 4JFOA 1GGBH 4UIKL 1H3XA 3LN5B 1DBKL 1BJ8A 1I3UA 3MNWB 5CEZD 3ARBB 3O2WH 4ORGB 1IEAA 2A6DB 1SJHA 4GS7C 4M5YH 4KGJA 5I15L 1OAQH 3GHEH 2AK4E 1NGPH 2ICWI 5C0IA 5HVFB 1HHGB 4QRTA 1QYGH 2MTPA 5MEQB 2D4FA 1SEQH 2QQNH 1CFQA 4QEGA 2R0LH 2WSKA 4XAWL 3V79C 2QBWA 3O11A 4QGTA 2D0GA 2EIZB 4UQ2B 3OKLA 3IAPA 2W9EL 5IBUG 2RFXA 1D5ZB 3R8BB 3TVMA 5ALBH 3S96B 5HGDB 2HH0H 2IFGA 1JCKA 3BEVB 3IDGB 1Q9WB 3FB8A 4S0SD 3P77A 5D96C 3HZYA 3MNVA 3IAGC 4LLQA 3W0WB 4CADB 1PG7L 3JVGA 4E5XB 3VWKB 1I1YB 4N0RA 4OLUL 5F9WB 4Z18A 2NY5C 1SM3H 1AO7A 2Z31B 4HT1L 2GCYA 4O5LH 4OSUL 1CFBA 4LDOB 4JHWL 1FZJB 4DN3L 1YMME 2VDML 5CIPH 3WO4C 4L9LA 1RU9L 5KVFH 3W39A 3IDIB 2OXGA 4LF3B 5KVGH 1LK3L 2JELH 4BQ9A 3WXWH 2A6IA 1I1YA 4NFCA 3NGBB 4HIIA 4OGAC 4YJZL 2AJSL 2ZPKH 4U1KA 2Y72A 4TNVK 2O93L 2DM3A 5J12B 5ITBH 2X42A 4PGBB 2CK2A 2ZUVA 1IGMH 5FGCE 5JNYB 4NM4L 1NBVH 4WHYH 2NY7H 4N68A 1IAOB 1FFPB 2B5IC 2VTFA 2YWZA 1HIMH 3B6SB 3IFPA 3RWEB 3MRBB 3EO1A 5HHXL 2CRMA 1R5WB 5JLZB 2P42B 5HHOB 2APXA 3VA6A 5I17B 1IAIL 1Z6JT 5J13C 1FE8H 4J4PA 2EH8H 1NMCB 4LF3A 4JO3L 4KVNL 3O3BA 1YEFH 2XWJA 5I0DA 2DQIH 1F11B 2G2RA 4AM0A 2OTUB 4HUNB 5EBWB 2EYTA 5I17A 4OLVL 3B9EA 3DIFA 4CN6A 1FYTB 2IC2A 4NO5A 3TPKA 1KB5H 4KVNH 3FB7B 1KIQB 2X1WL 2YPVH 3R1GL 4ODUA 3RWCB 3RWGA 3PDOB 5JO5A 3ARFD 3QXTA 4L4VB 1WLHA 4ZTOL 3TIEA 4GJTB 4JB9L 1A6UH 4KTDL 1SHMA 3L95A 3GHBL 4FXGB 1KTLB 3HZMB 2BVQA 3DRQA 1JHKH 1KENL 1AC0A 4HK3J 1LGVA 4URTB 2JLLA 1JTTA 1UKQA 4XGZA 3UDWC 2VN7A 3C5ZC 4K71C 1F97A 5C07D 1OF2B 1DLFH 3O6ML 4EZMA 5D1QC 3ET9F 2AJSH 3V6FA 1MHCA 5ICZA 1U8IB 3VXTA 2R8SL 4N0YL 4X6CF 4KUZL 4QCIA 4JANB 4F57H 1WIUA 1MCIA 1E4WL 1CT8A 2LTQB 2B8OT 1MRDH 1NGYA 1X5JA 3ZYOA 4PTUA 5IV2B 3CMGA 4P23B 4CADA 2VXUH 1FN4B 1NCAH 4WI8A 3FT4A 3EHBC 4KHTH 1B9ZA 3CVIL 5HPOA 3WSQH 2EIEA 4IIQB 4NQEE 2F19L 2VXTL 5C0AE 4M4RA 3DSFH 4HHAA 5FO9A 1IGCH 3FTGA 3PIQB 5I71C 1JZ5A 3WUWA 3O4OB 1AXSB 2K7QA 4UT9H 2VLRD 3RTQC 4E41B 3IFLL 1TPXB 1YEDB 2Q3AA 4U1KB 3E3QC 4LSQL 1MFAL 3RWIB 5JZ7D 1INEL 4HH9B 2OCFD 4EIZC 1IE5A 4W68A 5FDWA 3UZQA 1IGTB 2DTMH 1AE6H 2PTUA 3L3IB 4GKNB 4OCRH 5DHVH 1BD2E 3MLWH 5LJYH 2BNRE 3LRSA 1YA5A 4UINH 5FYLL 1QYGL 1F4YH 1V5JA 1B6DA 2R23B 1UWXH 4U1JB 4RMUA 3Q6GL 4N5EC 3BP4A 4K71B 5EA0H 3V4VL 1G7MA 4O4YH 4M7ZC 3NTCL 2H6PA 2B2XL 2FD6H 5CEZL 4LHUD 3MBEB 4F9PA 3DBXA 1L7TL 3CDYA 3IFPB 4IIQC 3VG9C 2VDKL 2YUXA 4HH9A 2DJSA 4UMGA 1W8OA 4BFBD 3GI9L 2WZPD 3V9FA 4LBEA 4OCRL 4O00A 1H5BA 3DSNA 1QBML 4P23C 3LV3B 3T4YA 3VGFA 1I4FA 2P8LB 1Z2KA 4XPFH 2Z35A 3UXFA 3PWNA 3MREA 3QULA 3T04D 1XIWA 2XIDA 4OSUH 3W9EB 2XZAL 3MQIA 1D7FA 4YHMH 4Q2ZA 4G43A 4QT5A 2V2TA 1ZANH 1JTPA 43CAA 1LDSA 4JQIH 3K4DA 4NKOA 3KPSD 2AKRA 1UJTA 4I77L 1TQCB 5DK2A 5EZJB 1T2XA 4YX2L 1FG2B 4MSWA 4M8VA 2EIDA 3U9PH 3MR9A 3HB3C 3SY0B 2X4TA 3KYMB 3S5LB 2YEZA 2F19H 2VXTH 2FJHA 4DGVL 3RY5A 3X3FL 1CBVL 1LVEA 2VE6B 3CVIH 1CE6B 4ZSOE 2FX7H 1UENA 3EOBB 5LXGL 4P2RD 1HYSD 4PJAF 3DUSB 3OKEB 4WO4C 3FRPG 2ESVA 3NFNB 1C16B 1FZMB 3V6OE 1DEDA 5C9KA 3BE1L 1OF2A 4N0YH 3L6FB 3LDBC 1I1FB 5JOPD 3HPJA 4PRPE 1LE9B 1CD1B 1P84J 1CDYA 3U9UB 1I8KB 4JREB 3O3EA 2KQNA 4JO1H 1QSFB 1OAYL 4X0KA 5I1HH 4LPUA 4HS8H 1OQXA 4JZOB 5D6DA 5J11C 1CL7H 2R1YA 4K7FB 3ULVC 2A1WL 4UUJB 3RWFB 2H2PD 1G7PA 5FECB 1AJ7L 5ELIA 4OD3L 4R0LC 3EDJA 4WHTB 3P4MB 4MWFA 3VDBA 3IT8D 5DURD 3MCKB 4YHNB 3M07A 1NCWH 2Y07L 3REWA 4XVSL 5D8JH 2L7UA 1OVZA 2R1XB 3GBML 4U0QB 1IBGL 4H88H 1G9NC 3QIBA 3MRMB 1FGNL 1I9IH 5CZXC 2R2BA 1S9YB 4OZ4A 1N59B 1X7QA 4N9OB 1NUNB 4JAMB 3MCG1 5EG6C 4R26L 4TNVF 3FFCA 3LSOA 2VZOA 4HKZB 3G5VB 5D5MB 1JGEB 3RX7A 2ZCHL 4MMZC 1KJ2L 3QA3A 4M8QA 3QNZA 2XA8L 4D2NA 5CINH 2HKHL 3MJ7B 3UP1A 1MF2H 3KPNA 5K33A 3ZKNC 4PJEE 2XKSA 2EZ0D 5E8EB 4ELME 3MRLA 1AQKL 2LV4A 4QTIH 4TOYH 3GMQB 1CDIA 4YXKH 2FX7L 2XPGB 3QJHA 4KV5E 4PJDB 25C8L 4OFKA 1Z0NA 3C6LA 4KFZC 3ULVF 4HZLB 1FVEB 4XMLL 4JRXE 3KPNB 1XIWB 4YDLC 3CZJA 3A67H 4GW5A 5HGHB 4UBDC 3GGWB 4LLUB 2DLHA 4O51A 1WWCA 4G6AC 5D5MA 3GRWH 5CKGA 2ADIB 1JF1A 4YFLF 1YEGH 2GAZB 5GSVA 1UZ8A 2IQ9H 5JW5B 4ODBD 3MV8D 3BQUC 4ONOA 1U95B 4DZBB 3QEQB 4PJAA 5I1LA 3ULUC 5IF0B 4YXKL 1A14L 1CE6A 3X13A 4DKEL 3GSNH 3WYRA 4MA3B 4DZ8B 4OBRA 1D5MA 1PG7H 2DQJL 2JIXB 1ZLUH 5GHWH 3UBXG 1B4JH 1X4ZA 4L8BA 1F6LL 4R3SA 2FD6L 5CEZH 2J6EL 5E2VH 2EZ0C 1MEXH 3O3AB 5LCVH 1U3HB 1CLOH 1ZA3B 5IWLA 3R8QA 1OTSD 2WK2A 1BQLH 1FO0B 5ESQB 5FOBA 3QDHA 4H26B 4NDMB 3R4DA 4F9LC 3IS0X 4JFYB 2IQAA 1VFMA 1HOCA 4QRQB 3VRIB 5HDBE 3WKMH 4L29A 3NCYP 5DXWA 3JWOH 5KW9H 4HK0A 1B88A 2NZ9C 1SEQL 4MNQD 4KZDH 4QNPF 5DEFA 4UBDD 4LSQH 3FT2B 1QRNA 1KT2B 4Z95H 5BXFB 1EUTA 5D6CA 4LVEA 4GKZA 3LZFH 1CLOL 3B9KC 2CK0L 2Z4QA 2XZCH 1PG7W 2EDBA 3D0VB 1C5BH 1KFAL 4AENB 1QSFE 3GO1H 1CDJA 2J6EH 3ROOB 1RJLB 3BESR 4NOBA 4ZXBC 1MPAH 3L5HA 5IFAL 3TO4B 2R23A 5FGCB 4G6MH 2F54B 1CL7L 1J1PH 3C60A 2E6QA 4J3UA 2XKUA 2C3XA 4U1GB 4X80L 4AY0A 3BN9D 2UYLA 3IS1X 4OTXL 2ZNXA 3WLWC 4KC3B 4Z7VA 2R0ZL 2WIMA 5B4MD 2X4TB 2XN9D 4HIXL 5TFSL 2VWEC 3VRIA 2I9TA 3D6GA 4X6FB 4Y2DC 4QRSB 5IFHH 2N56A 5DRZA 1YEGL 1J8HD 1MREH 1VCAA 4PJ8C 1ZGLA 3IXAA 1UJ3A 4F7TB 3LKOA 3GRWL 3T09A 2W60A 1H0DB 3PWPB 1T89A 3MV9A 4HKXA 2JF1A 4S1QL 3FT3A 5C2BL 5I1GH 3SE9L 3HMWH 3ZO0A 4DOHE 4HZAA 4KQ3L 2J12B 2Y25A 4C83A 4Y19A 2MSPA 1KC5L 1FRGL 2ZNWA 3KJ6L 4YDJB 4MQ7A 1EO8L 1AGBB 5CEYB 2UWEF 5AZEL 5ICXA 2A6KB 4L9DA 1XF4B 1S7TB 2J2ZA 1PX4A 4C83B 3KYMA 3S5LA 4WJ5A 1UWEL 4MB4A 3O3BB 1JGLL 3DROA 2BMKA 2CDEB 3WHXA 4Z5RB 5J11B 1KLUA 1M7IB 3Q5TA 5IOPA 1T0NB 4OZGE 5DD5H 1YZZA 2DL2A 3MACL 3MLTA 4RGND 2DQIL 3VI3E 3MA9H 1PQZA 5EC2B 3PP3K 2VDKH 3U7WH 4Z7OE 2FBOJ 5E5UB 1J0YA 1ZWIB 3DSFL 5FO7A 1ZT4B 4CVZA 4GT7A 5K9OB 1YJDH 1B2WL 4JREC 4N8VA 4XTRD 2B2XH 3ZKXB 3B9VA 3MRNA 3N1MC 1ZS8A 3UDWA 4NUGH 3NIFF 1DEEA 1AD0A 2W38A 1MWAA 5SWSE 5BRZD 1NBYA 4AEEA 3F58L 3G08A 2DKSA 1RZJH 1OAUL 3D39D 2X05A 2EKSB 4RCAA 1S7WA 4FXKA 4PJHB 3T0EB 1JPGA 2GSIA 4WO4B 4OI8A 1K4DA 2XZZA 4OCMC 4NN5C 4I3SL 4PJHF 4HS8L 4XNQB 2HA1A 2WIIA 4WTZG 1UB6B 3FOLB 3L3JA 1DJSA 2R1XA 2MPAH 4GG8B 1EEQA 1UVQB 3CIQA 4PRIE 1RZKC 4MJIE 3REWB 2FRGP 1RJYB 4A2MA 3DV4B 2BK8A 2FCBA 3JWDH 4JHAL 4XZUA 4Z77A 5C0CA 1GAFL 1H8SA 2WBKA 4Z7QE 1OGAE 3CMOL 4A2LA 4XI5D 4HJ0D 1G7JA 3CFDA 2FO1A 5F1IB 2ICWA 1NCAL 4PJ5D 2YZ1A 3WDIA 1A3RH 2VXUL 4X6BA 5CZVL 4YBHA 1N5AB 4JY5L 3WIFA 1LWRA 4XTRC 3NH7H 1NGWA 3RTQB 3JWDL 1A6WH 3ZDZE 4K94H 4KVCH 5E6ID 3RUGE 1U3JA 4XNZB 4HWNA 1FORL 1I1FA 5KOMC 2BNQA 2VL4A 5IMLA 3WIIH 3TA3C 1IC5L 2IPKA 4D9LH 3IDJB 3KJ4B 5K9KA 1EZVY 2VLJD 2PUQT 5HYSA 5EZLB 1VERA 3QCVH 3O6FB 3EYUH 5E94A 1IAIH 4FFYL 4U6YB 4OF0A 2C7UB 1KPUA 1BOGB 5CP7B 3PGCA 5E9DA 1K3IA 3U30B 2V2WB 5D4QA 4FQXA 2XWBA 3LRGA 2X4UB 4UV4H 3AROA 3ARRA 4PRIB 4ZD3H 5I66B 1CFVH 5DMJB 3FO2A 5TJWK 2MCG1 2AQ2A 4UIKH 3IAQA 3X3GL 3L7EA 1QFPA 1AR1C 3CFBA 4MGXA 1FNFA 1ZSDA 2Y5EA 4R26H 3OKNB 4L4TB 3SDDB 5KSBF 1AD9A 2HRPL 3QRGL 3VMOA 5KVMC 4Q0XH 5GS0C 1JZ8A 2GIYA 2XACC 4FQQA 5HI4D 3CLEL 4KK8D 1BVLA 1M71A 2HJKA 2Z91B 4PFEA 3TA3D 2H2SC 4JO4L 4RMQA 1VFBB 3SDXE 3G5ZB 3VD7A 4B53A 3A0OA 1TVDA 3ULUF 5IKCB 4KKAD 3VXMD 1SMOA 3HNSL 3FO1A 1IZKA 3NVQA 5FO8A 4PJ9D 2P5WB 1OP5K 5IEHA 1G6RB 3C5ZB 3VMPA 1G6VK 4XMKL 4EXKA 3VGEA 5D71L 5DJCB 5FV1L 5C07A 1NMBL 3NN8B 12E8H 3CFEA 3QQNA 4KXZI 1RIUH 2MOVA 3HLAA 4PJGB 1GZQB 1YUHB 1JK8B 3QO0A 4FQIH 2Z92A 4MB5A 2ADIA 1MCOL 2VLKE 3H9SA 3EYOA 1PBYA 4GRMB 2YD7A 3UYPA 1OB1A 1XGRA 1D5ZA 4NO0A 5BW7A 4PJ9B 4JPVL 3EYSL 4XBPB 3RVTD 5DO2D 4DKDC 5CBAA 2H26A 2Y23A 4P4KA 3BZEB 4YXLH 4D9QE 5EU6E 4IRSA 3IXAB 4B5EA 1R0AL 3PWLA 4MCYA 1JHTB 4NSKB 4XMKH 4JHZA 2HTLC 3NZHL 4G9FD 5CGYD 1ACYL 2E7CA 1JHKL 3U0PA 3VFVA 2AJVL 2FX8L 4KI5D 4IS6A 4P2OC 3OXRA 4WDIB 1P1ZB 2RGSA 1I3GH 3SCMD 4MJ2A 1XF2A 4JN2A 3NA9L 1WT5A 3EO9H 4H25B 2X10A 4PREB 4YPGA 4YDKH 4K7PY 4MA1C 3O8XC 2YEZB 4HBCH 3W0WA 3HS0B 4GAJL 1J0KA 4JDZA 3S34H 3O2VH 4HJJH 3L3OB 5EZJA 4LLVA 3ROOA 4KZDL 1NGXB 5E70A 4U6TA 1GIGL 1RVFH 1J0JA 1K3ZA 3CLEH 5F3BA 1AP2B 1E27A 1JGVH 4XP9H 5L2KD 3KYNB 4QWWD 3H9HB 5JOFA 2BNQB 4NIKB 2EDYA 2F5BL 3SBWA 4YXHL 2ZG2A 3MJ6A 1KACB 4FXKB 1SJVA 3KLAB 1JMZA 1OAQL 4LCCA 1RULL 1QFWH 4OB5H 1H3PH 4HWEH 3O4LB 4IRJB 4X7SL 4GXVH 1JWUB 4YAQB 1KEGH 1KCVH 4APQA 3LMJH 1F8TL 4XX1G 2FR4A 4Y2DB 4U4BA 1VFOA 4K7FA 5JIHA 5CGYC 4HC1A 3LPWA 4LCUA 1IGML 3OG6B 2VLRB 2F9BT 1X5HA 5TE7L 1P84K 4OAWA 4HUKB 2M1KA 4HX1A 1CDUA 5CAYB 4O2FB 4TUJB 4FTVD 5D7LD 1FFQA 3WNKA 4PGDB 3A67L 5JW5A 5MP6L 5H8DA 3I9GH 5GSVB 3V4UH 3ARUA 3MUGB 3SO5A 2CKNA 1OOAA 3JTTA 2H2PC 1JNLL 1R0AH 3ES6B 3QDGD 2IAMB 3JUZA 1QQDB 4KHTL 2VABB 5IK3A 4ZFGL 3V0WL 3F6LA 5L0QB 4NKIH 5KANG 4I2XB 1BQUA 2XZQL 4JRWA 1FO0H 1OTTD 5EIVA 3RBSA 2BJMH 4PJFA 4PJCF 5CJQL 1DQTA 3NN8A 5DJ6A 4HIIB 5E95B 3Q0HA 3IXTB 3C6SA 5F7FA 1OSPL 3E2HB 4JDTH 4AIZB 1BZQK 1GGCL 4FFZH 3QQ3A 3A6BL 3IJYA 2EDQA 3GI8L 1RIVL 3DXAE 2B4CL 4NO2B 3PWPD 4AEHH 2BRRH 1FJ1B 1A6ZA 1YYLH 43C9B 4YHLL 5IVNA 4ZUTA 2HMIC 4NQCB 1PKQB 3U4EB 4PRDB 4NJAH 1UYWH 2PW1A 4YR6B 1M05B 3D5OF 2ZZUT 2E5EA 1EMTL 1OAUH 2V7HB 1RUMH 5JPNA 4QHNA 3O6FC 5C0BE 1RJLA 2XFXA 3E1F1 2PCPA 1CIUA 1DQDL 4G6FD 3U79A 3QR2A 4Y5VC 1I9JH 2XTJB 3RZWA 1HEZB 2E9IA 4NO3A 2AI0H 1X5KA 2JB6B 3QIWB 1RHHA 3VFSA 4OLVH 5JMRA 2NR6D 4PJ7E 4X6CE 2DQEH 3CVHA 4POYA 4MS8C 4P9HH 3RY4A 3MGOA 4U1LA 4OD2A 5H37G 4GRWE 4JO2L 5I1HL 1UJ3B 4F7TA 1KIQA 3WFEL 4L4JA 3QIUD 2YSSB 5DHYA 4BSWA 4Z77B 3C5JB 2A2QT 2IGFH 4JVPA 3WEXA 4RQQA 3SKJL 1RJYA 2I9TB 4JZOA 4DGYL 4XPGH 3ZSTA 4MD4A 5ID0B 4UV4L 4GKSB 4F7EB 4ZYKB 4MDJA 3RPIA 1S7RB 4U1LB 2LU3A 4Y4KD 3WJLC 4KK5C 1KEMH 2JB6A 2N7AA 4OM0H 1JNNH 4R2GD 1HHJB 1TVHA 4Z76B 1A3LH 4PRHB 5INCA 3GJEA 5CSBA 2DQGL 4F33A 1NJ9A 3F12A 1KC5H 3H2WA 3C6LD 3STZA 4V2CB 4XB7A 3RUGA 1R5VB 2XT1B 1VENA 3LEYL 4PJDF 1FL5A 1H3TA 2AXFB 1TCMA 2DS4A 4HCRA 1P9MC 1CT8B 2MMXA 2Y1VA 5DHXB 3GJFK 4NNXA 4NPYA 1T21B 3IF1A 4OIIH 4GQ9H 4HC1H 1ZHKB 4ZPVB 4MDIB 4AQOA 2DM7A 1S9VA 5TDOA 3LKSA 1BGXH 3NCEB 4ZXBA 1KCSL 5GS1A 3ZKXC 1FC1A 3UEZA 2KKQA 3CSGA 3G9VA 3KNBB 1KJMA 1CLCA 4PJFF 5FXCH 1Z9SA 3HPLA 3ECBA 3FQRA 4JHAH 4M7LH 3HC4L 5D7KD 4G42B 2CJUL 4PJFB 1K4CB 5GGUB 4R8WL 1J1OL 4RFNB 1OSZB 4UTAH 3ZHKA 1AKJA 2QADC 4FFWC 3JV6B 2NTSP 2C5DC 4WHYG 4X6DA 2C1PB 4GQPH 1JF1B 3MX0A 5I9QC 3L5XH 3MGTB 5DEGA 1QR4A 3I50H 3SDAA 1IAIM 3FRUA 4UDUB 4YO0B 2B5IB 2YA1A 3O9WC 1QVOB 1KNOA 2BNUB 2GJ6A 3BO8B 4WUKL 2FIKA 1KLGA 3GMNA 3FFCE 5EFIB 3R0MA 1C12A 1T2JA 5GGRB 4NNYB 3WFCL 1EBAA 2GW5A 3MOBH 4OBSA 3T2PA 3VFPA 4WHTA 1A7PL 4J4PD 1JHLL 5DJ0B 1GHFL 3QBTB 5F9DC 2CDFA 3FN9A 5B38B 3ZKMD 1QA9B 1WBYA 1DN0B 2BC4A 1F58H 3H3KA 4I18C 4WY7H 3VD3A 1PYWA 2JTDA 3B9DA 3QH3B 4AK1A 4G7YL 1WJ3A 1S7SB 3SKMB 2NYYC 3TV3H 4DAGL 1TJHH 3RQ3A 4FNLH 3HR6A 5FUCE 1JGDA 2AEWA 3M1BA 1F6AB 3DURB 3CFJB 4TTGA 4XPAH 1MFBH 4X99A 3RDTD 1Q9LB 4LL9A 3LN4A 2MNUA 5IVXA 5ETUA 5MEOB 2VAJA 1Y0LA 1JI2A 2OQJB 3VRLE 3HR5A 1QR1B 1IQWH 4QXGH 2EDLA 1S3KL 3KXFB 3MRMA 1NEZG 1Z9OA 3C9NA 4NUJB 1LO2L 4HJGA 4Z9KB 4G8EA 5L88H 2BXYA 3O4LD 5F6IC 4XBGA 4FMFA 5GS0L 4OGXL 2NX5D 2J88H 1KIPA 3ZE1E 3PABA 5EUOB 4DTGL 1V7ML 1ZLVK 3SOBL 4LKXA 1YNTA 2HFTA 3WHE0 5JPMB 2ICEA 3T0DA 2VISA 4QY8A 1LO2H 2I27N 1FGVL 1OGAB 1VKXB 4BZ1L 1MCEA 2EEDA 5DVLA 4C54A 1S7QB 3WJJC 1MREL 4JKWA 4W81A 3P77B 1BF8A 2HFGL 4LDLB 5IMMA 4WVRA 1DQMH 3ZKMC 1QKZL 3CK0H 5HGDA 4MJIB 5AEAA 3SDDC 2GJJA 4ELMB 4LEXH 3N1PC 2DTSA 4KKBD 4WUUD 1DQQB 4JFZL 1JFQH 5HI3D 2XRAL 4UV7H 4QRPD 2ZJSL 1WBXB 4O02L 4LQ1A 5AD0A 1XIWC 1UB5A 3SGJA 3KR3H 1IM3A 1A7PH 1J86A 1UZ8B 5DMGD 1YEJH 2XKNA 2AI0L 4PY7B 1EEYA 2BSSA 3T3ME 4MXVE 1HDMB 3WFCH 5A2FA 2E7BA 2J8OA 4O51B 5B3NA 3WFHB 1RUPH 2DLGA 4NQXB 3IFOB 3PV7A 4PJXE 2OR9L 3DX7A 2FGZA 3BZDA 1CICB 5C0GB 5D1QD 5LGJA 3GJFA 3INUL 3MXWL 5DF0A 2VLRA 1AHWA 2UWEA 3DI2B 1KCRH 2YK1L 5JW4Q 5IESH 4P99A 3L5XL 1Z9LA 3MRGA 5ITBL 1A7OL 4WW1A 3GSXB 2P4AB 5F3HA 1OGTB 2GTWB 4GRLD 4TSCH 3QUZB 5I1EL 2YD9A 4MQXD 4LNVA 4LSRH 3OGOE 5JUEH 2AV7A 3LQZA 5EZOL 3SKNA 1MWAH 5HHME 3RBGA 2VKWA 1HKLH 1AXTL 3KS0H 5KZCB 1AD9B 3QIUB 4P2OA 2OSLA 2XZQH 2E7LA 1JTOA 3V0WH 1DE4B 2A74A 1K5NA 5LXGH 2HFEA 3KYAA 3BP7B 5DZLA 1EVUA 4U1SB 1UT9A 3O8XA 4R97B 5IB1B 3D3VA 4H0GA 1FZMA 1CF8H 3UYOD 4D0CB 3V7AE 1E4XH 4LMQE 1XCQA 3KPOA 5KSVA 3SEPA 4M5ZH 1GGYA 3ZMRA 2DI7A 3MA7A 3MO1B 1BOGA 4RAHA 4EN3A 3IXTA 5I1AA 5E2TL 2DMCA 5IB3A 3S88H 4HIEB 4WU7B 4MAYA 3QUXC 4M4PA 1Q94A 3Q6FA 1DUYA 4PJXA 5HVWA 5KN5A 2JKXA 2NY2B 5I19H 5K93A 3WUZA 2EDRA 3WL9B 1L9MA 5FK9A 5C3TA 5DJYA 2X4OA 5IFJB 2VLLB 1IARB 4RAVA 3BUYB 3D87B 3B2UC 2DM4A 1A5FL 3KAAA 1R5VA 1N6VA 4R0LB 4I48A 2IF7A 1ZGLP 1CN4A 4P9MH 4CDGC 5BZWA 4NJ9H 4MQXC 1T80A 3QULB 4PGCB 1P7QB 3DRQB 2JJUA 3DV6B 2OL3H 5D7IB 1KTLA 2ESVD 2IBBA 2QSTA 3SO3B 3MRJA 1MLBA 5JORA 3J8F7 4UAOB 2VLJB 3AY4C 3TO2A 2B1HL 3GSUB 2AXHA 1U93B 3P9WB 2FATH 2MJWA 1H3VA 3MFGB 4Y4FC 4ERSL 5IV2A 1BBDH 1FL6B 2V2XA 4MD4B 2OJZL 2IBZX 2VE6A 5HVGB 4JANA 4TYUA 3D3VE 1UM5H 4NKDA 5KSBB 2KPNA 15C8L 4WTWA 4MYWB 2J3SA 5SWZA 3S34L 2R4SL 5F7MC 2AK4B 3LS4L 1N6QH 2BFVH 5E2JA 2XXCB 2W0LA 4I4WA 1BLNB 3OJDA 5DTFA 1IQDB 4OZIF 2GUOA 3EO9L 1J87A 5IT2H 4G8IA 1BQHG 3RVUD 5DYOA 5T1MB 4PJAE 3MFFB 3JVGC 4J3WA 3TH4T 5JLZA 3MRKA 4LAQL 2I07B 1Q0XL 3LKQB 4S1SL 2R4RH 4NO0B 3D9AL 5IIEA 3OJVC 1ZT7A 4K7PL 5E2UL 3VCLB 4KV5F 3VXNA 2IANE 1ZVSB 5KVDL 3EYSH 3L7EB 2BOBB 4L9LC 1OSPH 1TMCB 3MRCB 1NCDL 5E8PB 4GMTH 1O0VA 4EDXB 3GJFH 4UQ3B 3MV9D 3LKRA 2XQYK 3CXDH 4NQCE 4U1JA 2FB4L 4G3YL 5EOCJ 1TZIA 3BSZH 2GYSA 2IH1A 4Y19D 5E2UH 4P3CH 3P2TA 3LB6C 1FZJA 2W92A 3MRFB 4JQXC 3VD4A 3V5HB 2YMXL 2C9AA 3QXAB 3WLBB 4L3EE 3DTXA 3VFUB 4FG6D 4M7JL 1QSZA 5EUOE 3OBAA 1T3FA 3UTSE 4F80A 3HNSH 4QF1A 3VCLA 4PRBB 3T2QA 4M02A 1YYML 2SEBA 4LEOA 1A6UL 3VFTA 4ENEC 1MY5A 4WTZA 4YHML 2Z92B 4S1DD 2B7DT 1IGFH 1B0WA 5GGSB 4NQVB 2FEEI 3RL1A 1OGAD 3QQ4B 3MRFA 4MXVF 4V1DA 1S7UA 4YWGL 4D0BA 5EBLB 1QACA 4EUPA 1KN2H 3ULUL 1RZGA 4LFHG 2GITB 4JM2B 4PJGF 5E08L 3OPZH 3MRRB 3DHMA 5FKPA 4EI6A 3NCMA 1T89C 2CLZB 3L7FB 1G9NH 3IGAA 1H3UA 4XPHL 3E6HB 2PO6B 5ANME 2JCCE 3SQOL 2P1YA 3ZDYE 1N3NB 5CWSB 3MRHA 2LQRA 3GMMB 4X4ME 3NOIA 2XWJB 3LY6A 2BHYA 1P7HL 2AEQL 2J4WH 3FOMB 1D9KB 5DJXB 5E1AA 5FYJH 4OT1H 2YRZA 5F7UA 1T03H 2ITDB 4DUXA 5JORB 2WBJD 4AL8L 3NFSH 2QSQA 5DRWB 5KSAC 2CRIA 3B83A 3EGSB 4P5TA 3SGKA 3UC0H 2X7LA 5E8DL 3BHBA 2NXZD 2NY4D 2AEPL 4OM1H 5EUKB 4I0PD 1QLFB 1AP2A 1CTNA 2B20A 7FABH 4OIBA 2FLBT 1C08A 1MAJA 3N06B 3DHJA 3NIDF 5J6HA 2R15A 2UWEB 2HMID 2QSCH 1BVZA 4CN4A 4YUEL 1OM3L 2OZ4H 4H26A 4NDMA 3GMOB 4ZFZB 5I1AB 2DICA 3W2DL 2OTUA 1I7TB 3FOMA 2EEAA 4Y5VA 4PJ5A 1NMAH 3U2SB 2WV3A 1YN7A 4Y8AA 2LFGA 4KMTL 1CE1H 5EU3A 4HS6A 5DQ9B 4PTTB 1MFDH 1G7LA 5IMLB 1VFUA 2IJ0C 5EZOH 5E03A 1OLLA 5GGVY 2A6KA 5JUEL 1QBAA 4HF5L 4NYLA 5JA8B 4J2XA 1CGXA 4RFNC 1OAKH 1CL7I 5ITFB 4XCNA 4R4BB 3VXME 1R24A 1IAOA 3MLYL 3B6SA 5F44A 1A0QL 3NABL 5KSAD 3W0WE 3EYOB 4IMKA 1SYSA 1BJ1H 2V17H 5FHBL 1EHLL 3D0LB 4DN4L 3WJLA 4L3EB 4IDJL 4IMLB 3BAEL 2DWEB 4Y16C 1A2YB 3L1OH 2NXZC 1JIBA 1PAMA 4K55A 1Q94B 5KN5B 3PGDA 2DBLL 5HYJB 5D72H 5DDHA 4XNYH 1ITCA 1JPST 4HLJA 2DQFA 2DDQH 4KJPC 1RUPL 4HV8A 3HG1E 5TE4H 5GRZA 1ZHNA 3I3DA 4EI5A 2VR4A 1XF3B 4K9EH 2WLZA 5ILTH 2GJ6B 1MCCA 4KJYB 2HFFA 4XNQA 3QHZH 4HMCA 1RZFL 3PE9A 2O5YL 5M95B 3IU3B 3TO4A 3FKUS 4LRNL 4OZFB 3QUZD 4HUMB 2OK0L 3MLZH 1BP3B 4OZIE 3PDDA 3QWRD 4WFFE 4PV8A 5DMIH 1MAMH 3TA3A 3VXNB 1S7SA 4HFWB 3PP4H 1XAUA 2F74B 4LVOC 1MVUB 2ORBL 2V7NB 3OKLB 5B8CA 1NEZB 4KQ4H 4MA1B 4L4TE 4QHLA 3K46A 4XXDA 3CU7A 2V9QA 3NAAL 3FRPA 4K07A 1HOCB 5DTFB 4OGAD 3VRLF 1T2QL 3L5WB 4NRXB 3BO8A 3KYOA 1CFTB 4PJEF 3P4MA 2GTZB 1FVDB 4MWFB 3QWOA 3WIIL 4Z6AT 5C2UB 3QIWD 4OCWL 4YHOH 3VA2C 3VWJA 5I8CA 3DI3B 3VXUE 4F7PA 2AS5M 2E27L 4KVCL 1KULA 3L3HA 3LH2H 1RFDL 1NC4A 2CR6A 3O6LL 2VDMH 1F3JB 1JF6A 4WWID 4MAUH 3BGFB 1YN6B 4P4RB 3JV4A 1ULVA 3GSUA 3WNOA 2Q76A 1VHPA 5T3ZH 5AYQA 2Y5TA 3QUZC 1N4XH 3MRJB 1U8PB 3TBYA 4H20L 4M48L 2NY0D 1GC1H 4GG6A 1TZHB 2EIZA 4QOKD 4UT7L 1GPOH 3FQNA 1RUAL 4YHKH 3WIHH 3QUMB 4ISVA 4F15B 3BP6B 5K9QG 1FQ9C 5ALBL 4ZAKD 1NDGA 2PTTB 4M6ML 4PLOB 3RZCB 2OL3B 4FQ1L 3IDYC 4NPYB 2HLFC 4JG0H 3BDYL 1OD7A 4M9PA 5CIPA 3QEGL 3WS6A 1UQSA 1JWMB 5FA4B 1ZMYA 3PL6A 2GK0A 2GK2A 4TPRL 3ARFB 5IMOB 4O2CB 3ARZA 4CW1B 2ZUXA 5A40E 5SV3A 4G6JH 4O9HH 4LSDA 2VC2H 3EOTH 5F1KC 5EOTA 4X6CA 5LKNA 1J1OH 1K6QL 3WS3B 2D7TL 1CQYA 4OZIA 4XBEH 4K23L 1ZT1B 3FO0H 3KLDA 1WIOA 3S3PA 1M05A 3ARGD 1MHEB 4KK6D 4ZUUB 5E6IC 3U4EA 3QHFL 4Y4HB 3QNXB 4Y5XB 2LAAA 5L0QC 3UBXI 2D7MA 2C3VB 3IGAB 1MHHA 4M3KB 4OV5A 5HHOD 1N64L 4MNQA 4YIQA 1FO0A 1AGCA 2KQMA 1JN6B 4IRZH 4XB8A 3RDTA 3RWDA 4CVXA 4YQXL 3GMNB 3EHBD 4I8DA 2BSRA 4JFFB 1D5BA 1XZ0B 2XQBH 4KKBC 1MCBA 4NP4H 5C0FB 2D03L 3GSVA 4L3CB 1YEKH 1IT9H 2D7NA 1YY8B 2OI9B 5EC1A 4JY4A 5C09E 1F45A 1I3RB 4P2QD 5LQBL 3D48R 4MA8L 2VOTA 5B38G 1PSKL 3EYVB 5GGQH 1KGCD 4NZTH 1RUKH 5DUML 4ZPTB 5HSFA 4KQ3H 5KTEH 5ADPH 1KSRA 1BFOB 1U8LB 4NN5B 1JGEA 5JZ7C 4EDWH 4Y4FA 2NPLX 2CKBA 2W0KA 4OLWL 3KPSB 2DWDB 4PR5A 1P53A 5F8RC 5D7IA 5IG7B 1A7NL 3BGMB 2EE2A 1A7RL 2X9YA 4M61B 5HI4C 2EDWA 2NY6B 1CCZA 3OGCB 4JKMA 4LLMA 1B3JA 3BPLC 4PPTA 2AEIT 4RFOL 5I6XB 2D7TH 4RIRB 1ZGLB 3AUVA 4PJDA 4IOIB 1K6QH 4M03A 5IM7A 4M1CD 3EOTL 3CFIC 1ZTXL 1DL7L 3OAUH 4Z7UB 3S8WA 4J8RA 4GW1A 1NCWL 2Y07H 4W4OA 3MPCA 4XX1E 9CGTA 1HI6A 5D7LB 3CVHB 3KPRE 1D6EA 2ZUWA 3HFMH 5GIRB 5I1KL 3U83A 3PABB 3SCMA 1HHKA 3UTPE 1JRHL 1B0GB 1MJ7L 5HY9B 2NY3B 2I07A 2UZXB 1ZAGA 5JXAH 1P6AB 2UWEE 3KPQA 3KHOA 1HXMA 1XF5B 3TWCL 2EC9U 4L4VE 2J1KA 3C09C 3BD4A 5BO1H 4NBXB 5J06A 2LVEA 1MI5B 5CD5C 2DI8A 3RVVD 3O6KL 3V0AC 4HWBA 1CGSH 4AEHL 1F2XK 1JPFB 4M93C 5L9DL 4X98B 3KDMA 5I16A 5E99H 1LP9A 3SGDI 5DT1H 3WXVL 4KJQD 5BVJA 4QYOB 3F8UB 1WF5A 1SJXA 3C2AL 3N85H 3HE7A 3MNZA 4NQDB 5HHPB 1UGNA 5C0CE 1B4JL 4MX7A 3LKPA 3KPTA 3ABZA 4O2CA 4CW1A 2EE3A 8CGTA 4S2SB 5BRZA 4TUKH 4WRLA 1HH9A 3TLRA 1AC6A 5DK2B 3L3IA 3PHOB 4GKNA 5EU7C 3RI5K 3GJFB 3VG9B 4ZO8A 3VGAB 2DQCH 2VDRH 5DJ2A 3MV01 2NMSA 5EOCH 1TVBA 1MI5E 4MQTB 4XCFH 5J6GB 3F5WB 2DKMA 2ZUQC 1P4IL 2BVOA 3CH8A 5FF6B 5IW1B 3MXVL 3EAKA 1U95A 1ND0A 4CU8A 4OLYL 3TCLB 4MJID 5C0DA 4QHKI 2Y06H 1T1XB 1QFUL 2DQHH 3KPRB 1QNZH 1IGYA 5HYFA 1UXSA 1LE5A 3TFKC 1U6AL 4R96A 5C08E 4HEPG 4JG1H 3U30C 3HE6C 1R5IB 3MBXL 2P5EB 2GI7A 4JZNA 4NN6C 4BH7A 3QG6B 1BBJB 1A8JH 5IVZB 1OSZA 2G60H 2XN9E 2MFNA 2CUIA 3PHQB 4ZUWA 1G7IB 1XCQB 5FO8B 1OL0A 4HKBA 2HVKB 1D9KC 1BMGA 5ERWA 1A7QH 1XF3A 2R0WH 2R29L 2R1WB 2I25N 4IDLA 3P73B 4QT5B 1MHCB 5ICZB 4PJIB 2H26B 5D5MF 2A6JB 2W9LA 1FP5A 3LS5L 1YNTB 3BUTA 1RZIA 2EH7L 5A3IC 2Z8WC 3AFLA 2Y4SA 3U0WL 1XGRB 1DZBA 3QUMA 3ULVL 2CKBH 1A1MA 1IBGH 5J1AB 1ZGLM 5D70H 1MH5B 4PJGE 5BV7H 1MCHA 1BOYA 5D7JD 3W5MA 1I7UA 2YD8A 3VRJB 1YMHB 2LU4A 5D5ME 2ICWJ 5C09B 3T0AA 5AZ2H 4X5WB 4LCIL 3AU1B 3BH9B 3BQUB 4K8RH 3VU2A 4XCYA 3GSOB 5KZCD 3K2UL 3O11B 4XVTL 1G7QB 1NGXA 3TFKD 5FYKD 4JFHE 1TVHB 4PLKC 4LARH 2FHCA 1FNGA 3RVXD 1FYTA 3E2HC 2V2WA 4CN1A 3CX5K 5GZNC 1PG7X 5T3XD 2E8ZA 4F7PB 5F93C 5TQ0H 2BXZA 2VXVL 2EDFA 1XF2B 1H8NA 4JO1L 3IU4L 4EKXA 4Z0XA 2E6PA 5J3HC 1SYVA 4WO4D 3NFPB 1T0PB 2GQHA 3H42L 5I1DA 1YEDA 3GMRB 1OARH 1G7QA 4XGZB 4BELD 4Y16A 5CJ8A 5A2JH 3I02A 5IQ7L 3BDXA 3S36L 3U46B 1MIEL 4AT6A 4RX4A 4IMLA 2HT4D 4GAGL 3MROB 1J88A 1WTLA 4P5TB 3O0RL 1JL8A 4G6KH 1BIIB 1Q9OB 4P48A 5J0BA 2APWA 1OP5H 4YK4C 1C5DB 1AKJB 3ZE2E 1D5IH 3GRWA 2VDOH 3MV7B 4M43H 4RFEB 3MRQB 4L8SB 3PWUB 2AERT 4U6YA 4PRDA 5IVXF 2EDHA 5TE6H 3W39B 1QO3A 3GNMH 1DBJL 5T1LA 2PO6A 3E6HA 5BS0D 3H7BA 5FCSH 4BH8B 3O8XB 3QFJB 4L5FL 5IB1A 4EI5B 1INQB 1YEEH 4IRJC 1QSEE 2YXMA 1G7HB 4QRPA 4WWKC 5E8NA 5A1AA 4CGTA 1B6UA 4ZOCA 3MV7A 1DCLA 1FAIH 4JZNB 4BH7B 5F9OL 3PWNB 5IVXE 4OCLC 1U58A 5DMKA 4LSPL 4YFDB 4NZUL 4GRMA 2NY6C 4S1RH 3KYKH 2P47B 4KY1H 5JQ6L 1FFPA 1IGYB 1RUQH 1TETH 1NBYB 1MCWM 4F3FA 5IMKB 1NMCC 4IBLT 4OLXH 1ZS8B 4FQCL 2FEEL 3OB8A 1CDHA 5EBGA 1QA9A 5DQDH 4OFYD 2FHBA 5D1QA 4QF1B 4DQOL 1I8LA 1KXTB 4PJ8D 5LGHH 2FEDD 3DECA 3VH8G 4X9FA 5IJKC 5HJ3A 1NCCH 2F5AL 5C0BA 1F11A 5FGRA 2NXZB 5EU4A 5E9DE 3BKYH 2ZPKL 3VXSD 3DUHA 4PD4J 2J6EA 4I0PA 2Q7YB 1T7ZA 2NNAB 4P3CL 1BD2B 1JYVA 4UDTA 2XQYG 3VWKA 1E6OL 3WHE1 1HH6A 4JY5H 4JFEE 1W72B 4P4KC 3U4BH 3SQBA 4X4XB 5L8KB 5AAWA 2W9DH 1LO4L 3HZKA 3TNNA 1DBAL 3ZE1F 2X70B 5I1JH 3CMOH 2DF3A 3D3VD 1ETZB 4NO3B 3BEVA 3W11C 4OD1L 1NGWB 3RTQA 2HT3D 4HFUH 1RZ8A 1X44A 1E6JL 1S5IH 3EGSA 3UTTD 3QEQE 1FCCA 4HCRL 3VXPB 5C0AB 4EN3D 2A9ML 3KNBA 4K7PH 5L6YL 4D8PA 2CLRB 4FTVA 2MPAL 5D7LA 1KPUB 1OTSC 4QOKB 3FJTA 3MLPA 4ONFL 1DANT 3DYPA 4IM8A 4I3SH 2AXGA 1DFBH 1MJ7H 5GRVK 3IDXH 3OL2A 4WEBH 1CGUA 4HIJA 4TUOB 3QCUH 3N1GC 2NW2A 3P4NA 5DGQA 4GFTB 3GHBH 4LAJH 1FL6A 2V2XB 5E7FA 2W0FB 3P0GB 2VR5A 5GGTH 1SMAA 4JB9H 4YDVB 2CPCA 3M8OL 3AVEA 5FDYA 1FYHB 1JZ2A 1U93A 5GS3A 1Q9OA 2OYPA 3FN3A 4F33B 3C87A 4YBLB 1ES0A 3JZ7A 4WI3A 1ERNA 3X11B 4DUVA 5INCB 3ARBC 1JPSL 4G7VH 3ARDB 5FGBC 2GFBB 3PNWA 1ZVYA 3BYTA 4OQ1A 2Q3ZA 3B4NA 2W60B 3PWPA 4RGOH 5B38A 3QIWC 3SE8L 4PGEB 1A7QL 5J9PA 4JPKL 2YRLA 4HXBL 3DIFB 2HG5A 4JO3H 1WWBX 2DLFL 5IJVB 3GB7A 4Y2DD 1FBIH 1G6RL 3QUZA 4MNGE 4XP6H 1G84A 1C7TA 2EKJA 1IQDA 4KTYA 3CDGA 2D0FA 3UPRA 2V5TA 1F00I 2IADB 5FYKL 2BSRB 2IFFL 3VFNA 1F90H 1OPGH 5CLTA 2P5WA 5L7XL 3RWDB 3BOVA 1S7VA 4KROB 5KBNC 1EJOL 5E56A 2QQLH 2ZUUA 1R3KB 3SGEH 1HZHL 3D3VB 3F7YB 5C0NC 1EFXB 1B4RA 3GSOA 5D1QB 1A9EB 1KB5B 4FQJL 3DX6A 4HUXB 4ONGH 2YUVA 3ZTJH 1KG0A 5HYSG 3DOSA 3VXQB 1FV1B 5F6HJ 4BSJA 2DMBA 1T83A 4GBXC 4EUPG 5BZDB 2O61A 3QPQC 1M4KA 3ARBD 1J1XH 4J3VA 5H2BB 3FHAA 1ONQB 4ZOAA 4LASH 4TSAL 2YUWA 2Q7NA 2EDDA 4OQTA 3ZTNH 4XPTH 3QQ9D 4LKCA 3P0YH 1BX2B 3EDDA 5D7IF 3AS3A 4E41D 2JCCB 2VSCA 3HNVH 3BKML 4R0LA 3VXOA 3O3DA 1VADA 2IAMC 3ARGB 3FB5B 3IKCA 1BHGA 1SM3L 4U2YA 3C6SB 2UVEA 4WFHE 5KANI 4WFGD 4CU6A 5CEXB 3MZGB 4JR9L 2AXJA 1CK0H 3HI6H 1NKRA 3RHWK 2XNAB 1X5AA 1QPPA 4AG4L 5IUSA 3FAXA 3MOQA 4N9GB 4JN2B 2XA3A 2ED8A 5IF0A 1GZPB 1VGEH 5E8OB 3TWCH 2BRQA 1ZEAH 2DLEA 4KDTA 4RAUA 4ALAL 2EECA 3OR6A 2CMRH 1FFOA 4HQQL 4JFXA 2IPTH 4WW2F 3SDCB 4DVBA 4I0KA 4N8CH 4QRRD 2Y5TB 5FM4A 5D1XC 4P2RB 1SQ2N 1GC1L 2DL9A 2VLMD 3HMXL 5J56B 3HI6L 1WUNT 2AQ3A 1DTUA 5HDQH 1HHIA 4JJ5A 5DSCB 4W70A 4AMKL 1I9EA 3MCKA 1ACZA 1AKJD 1HH9B 4LSTL 5ECJE 3LQAC 2EXYD 5L2KB 4JPWL 2VQ1B 1T5WB 5D2NE 2AJXH 4WI5A 2BVUA 1BAFH 2KZ1B 1NSNL 5IP4A 5T1DL 1NFIB 1ZHLA 1HILA 2IQ9L 1NPUA 3SDAD 1MFCL 2DJ4A 3NIFE 4QHNB 3ZYZA 3VI4F 4M1GL 3BFOA 4MNGB 3B5HA 5SWZD 4P59L 5GGQL 5DQJA 1YY9D 3FO9B 2OMNA 2OTPA 1DSFH 2OI9C 4Y4FB 5JTWA 3VXUA 1QP1A 4NFBA 3WFBH 5HYJD 1F13A 3DETD 4Z8FH 2EDTA 1UEMA 1PFCA 4Y88A 3QUYC 3T4AA 4JFYA 3QDME 4U1MB 4Z7WB 3TH2T 5C6PB 3K3QA 3F7YA 1V8HA 4OZGB 4HKJA 4XNMB 1IC1A 2VL5A 1V7NH 5BOPA 4GAYA 3GSXA 3EZ8A 5T1DH 3U36A 2X4QA 3LN9A 4Y4FD 3OAZH 5DD1H 1QOKA 4ZO9A 1KN4L 1FNAA 3TH3T 4HLZG 5ERWB 4CVXB 5HPMA 5EU6A 4NRZA 4M62H 5HYEA 1LO0H 1YNKL 1UADC 5ISZA 4DKFH 1X4YA 2C3VA 1U3HC 1XGTB 2ICCA 2JCCA 5F7WC 1IJ9A 2B0SH 4QGYA 4HULB 2NX5E 3S35H 4G6JL 3U7YH 2QQQA 4FZ8L 3O45A 5FB8A 1TJIH 5I18L 1OAXH 2P5EE 3ZDZF 1NFDF 2YKLH 4HJGB 4PJGA 5I8EB 4YHIA 1Q72L 4CMMA 4Y5XC 5BJTA 5DA0B 3OHXB 1ZLUK 3EOYG 5GRJL 3BEWA 1TPXC 4N9GA 1BWWA 2ATPA 1FFNB 1YPZB 4D0DB 1VGKB 1TLKA 2Y7QB 4C56E 5ALCH 5IBTL 3WO3B 1AJ7H 3WIFB 4OLZH 3MR9B 3MLYH 2ED7A 3KJ4C 5FAAA 2CSPA 2DAVA 1O7SA 4JM4H 1KJMB 1UJ3C 3MJ9A 3FAWA 1MELA 4APQB 1WTGT 1KCKA 1OGAA 1T22A 1DLHB 4YBLC 1N0XL 2ICEB 3HI1A 4N0UA 3EKCA 4HUVA 4OI7A 4WENB 3QA3B 4J23A 4PRNB 2DQDL 3C5JA 3GKWL 3OKOA 3PP3H 4EIGB 1TFHA 4RWYH 3BE1H 1Z3GL 4Y1AE 4JFDE 4QHUA 4KAQL 3SE4C 4EXPX 3GUTB 4XCCH 1C1EH 1JV5A 2QEJA 1RZ8B 2VXSL 4HXAL 2F54A 1C5CH 4OQTL 1P4BH 3L6FA 5DO2C 4KJWD 4NCC1 5DEGB 1U41A 4Y5YC 3C8HA 2APBA 4QNPE 3GBNH 3HS0A 4JDZB 3BKYL 4R4FH 1AH1A 5F7NC 3TESA 3I6KB 1AD0B 3L3HB 4I77H 2VAAA 5J7CC 1EERB 2CUHA 1U8HA 2BSTA 1ED3A 1QHPA 4TUOA 2C4XA 1LEGB 3LEVL 1NL0H 4K3EH 4ZFOA 2A73B 1S9XA 3X12A 3HPLB 4NZRL 3PWJA 2X4SB 4LCWD 1R3IH 3PG2A 1DBBH 4EOWL 4DFHA 5EIQA 3QQ3B 4KDWA 1P4LA 4I18B 3SGJC 4QWWC 5HVHB 4ISVB 3V4PH 4KY1L 5EBLA 3RX8A 3THMH 1U8MB 5I8OL 4LGRB 1YEIL 3RL1B 3B8SA 4WJ5B 5E08H 3V95A 2CQVA 1D5MB 1SEBB 4TTDC 1S7TA 3ILPB 5ICXB 5EB9A 2DKUA 5F6IB 1NCBL 1YDPA 2XFXB 1NGQH 3GIZL 1G7JB 2MWCA 5JDJA 3BISA 4ZPTA 2QR0A 4JY6A 4R7NB 5B39B 1EGJA 4JRYA 1FH5L 4OZHE 3DMMA 3WD5L 1GGTA 1Q9KB 4OJFH 5DK0B 3SJVB 3WLBA 4KJYA 4JE4B 1IL1A 3BVNB 4GO6B 5FYJD 4F9PC 1KTDB 1E4KA 4RNRA 5IGXL 2ESVE 3T1FA 4RFEA 1T1WA 2H1PH 3VFRB 2B39A 3ZKND 3HC0B 2P5WE 3QNYA 4JFFE 3T0EA 4Q74A 4DFIA 4FA8A 4FQQB 1TQBC 4HEME 5B8CB 1FYTD 5C0JA 1S78D 5FHAL 3WO4B 4NN7C 1A6VH 4ODSH 5JMOC 3S37L 3P4OA 3VI4E 2BZDA 4QTHB 2E9WA 3ARYA 4X4XA 4TRPH 5HYQB 1TTUA 3KHQA 3I3BA 5CJBA 1FIGL 4ZMAT 1CE1L 2X4NA 4KRPD 4NO5B 1V7NL 4DWHA 3ULSB 4N0CD 1W0VB 1F4XH 3AXLA 2YXFA 1MFEL 2E8YA 3V8OA 1KV3A 5I73C 3IETB 1JPTH 4ODTL 3H9HA 4Y16D 1CLYH 4JFDB 5IQ9A 4X6DF 1GVIA 1CWVA 1T1YB 1IEBA 2ZKHH 3RNKB 1IGTA 1A64A 4WV1C 5HD8C 1O5DT 5CWSA 1UACL 4KKCD 2IPUG 1K85A 1HWHB 2RAMA 2IMMA 3IDJA 4OCYL 4PYGA 1CDCA 1T66C 4KZEL 3FL7A 4YHZH 1INDL 3ESVF 3PGDB 2HKFL 4LSUH 1B0RA 6CGTA 4OJFL 5TF0A 3KPMB 3EJJX 1UH2A 4A6YH 3QT2A 2DRUA 4L8SC 2D4DA 3DVFA 3EFDL 4JKPH 4HGKC 4FQCH 3HZKB 2WLYA 5T3XL 3G6JE 3V6ZB 4C58B 4GS7B 2QHRH 2WUBH 4EQ3A 3KLHC 3KYKL 6FABH 5F9JA 3MV7D 3LD8C 2G75B 3V5DB 3ZHDA 4JJHA 1RK1B 5HDOA 3WMSA 5C0AD 3U6RB 1PD6A 2QHLA 4KI5E 4FQLL 5CMAB 5DQ9A 4UI2A 3HLAB 4U6VL 3LVEA 4RWHA 3B2VL 5C86A 3VWJB 5JXEA 4Q6YA 1TXKA 2HTKC 2D7PA 1YN7B 4JRYE 4LIQH 5EO9B 4EEEA 3IRPX 4QOKA 3OZ9H 3VGDA 3ILQC 4UZGA 1IFHH 3NMEA 2VRAA 4L5FH 2VUOA 1HE7A 5HD8D 3VD9A 2FJHB 3GNML 4KKCC 4ZAKA 4G8FA 1UM6H 1UCBL 5GISH 3CSYB 5I75B 3TIDB 3PXHA 2R0KL 3S88L 4M43L 2UUDH 3G5ZA 3UJTL 4J6RL 5DD0H 2RQ8A 4JCMA 3TPUA 3L3KA 3QDJE 5GGVH 1J10A 1QRNE 5EZIH 2OSLB 1Y6KR 2VDQL 1U91A 3ELAT 1REIA 4F3FB 1EHNA 1D5XB 1T0MA 4NWTH 1LK3H 2JELL 4Z7NF 5J1AA 5KVGL 4LDEB 1EGJH 1QHOA 1T6WA 3ARDC 3GSQB 5DMKB 3MLUH 4LU5L 1YUHA 4HAGA 1Z5LB 2FB4H 3G6JF 2EDNA 3KLHD 4NHCL 4R7DB 1R3JB 5LVEA 4BZYA 3KYNA 3O3AA 3IDYB 3RAJL 1AGEB 4G8GB 3DROB 1OAZL 4R3SB 1RIHH 4W4OC 4I13B 1A47A 5E99L 4JM2A 1QLRA 4CU7A 2GCYB 1A7OH 1XIWD 1SY6H 4OZFG 4PIRF 4N5UA 4WNQB 3CDGB 3LQAL 5DRNB 1SJEA 4PJBA 4RMSA 5EN2B 2DJUA 2ZCKH 4YHIB 1RK0A 3TBTA 5HYSB 5JHLH 3V6OC 3AREB 5CILL 1RZKL 4OKVB 1JZ4A 3FMGH 4JO4H 3VFTB 3QUMH 3RWJA 4RGMB 4P2QA 5FOJA 1AO7D 4LEOB 3I02B 5EORL 5DFTA 3IFNH 1KJVB 4PGCA 2EC8A 4UQ2A 4HIHB 1LE9A 1OTUC 5GRUH 3EUUA 4P2RA 1B0GA 5HY9A 2X4RB 4G9FB 2AK1L 4NRYA 4M6NH 3NIGE 4TNWK 1D6EB 4HPYH 1M6OB 2PR4H 4KK6C 3TYGL 3BYYA 5MEQA 5F3BB 1L7IH 3MRIB 3FO2B 5FGSA 1GJIA 4HS6B 2X1PA 3WBDA 2AJZB 5IEKA 1N8ZB 1JYWA 4DKFL 5H35B 2GEEA 1YNKH 1KXVC 3PGCB 1DUZA 1N2RA 5FCUH 1FAKT 5KSAA 1PX3A 2FGWH 3K0WA 3LIZH 5T1KD 2BHUA 3IJSA 4S10A 5IB2B 3VD5A 1YEIH 3ZL4H 4OUUA 4WEUD 5IHZB 4Q9QH 1J18A 1AGDA 1FGVH 3KDMB 5GGSY 1G1YA 2DIJA 5EWIL 1M6OA 3V5DA 4XNXH 4LIQL 4PGZA 1K4DB 3EYUL 4KGLA 2CO6B 4ODHL 5FA3A 1OLZA 1XCTB 4BQCA 5L8JB 5DR5L 5F89A 4HGWA 3QZWG 4YHPA 4NM8L 3SKOB 3QPXH 5HHVH 1NL0L 2VZUA 3BXNA 3GM8A 5MHSD 4LBEB 3TYFA 5D9SA 5ESVB 4KUCF 1ADQH 4Q58C 2I9LB 4OCSH 4X8JA 4XP1H 4XP5H 5F1SA 1N0LA 3QUXD 4ZS7L 1IVLA 2YD5A 2A73A 1IKNC 2HJFB 1YNLL 3MLVH 1U3HA 1JVKA 5CZKA 1KTRL 2P43B 3OR7B 1ED3B 3D25B 4BZ2L 1I9RH 1L9NA 1ZT4A 3GSRB 2A0LD 5DC4B 5BRZE 3MA7B 3B2UD 3AAZA 4ACPA 2L4OA 3RGVC 1WZMA 4WI9A 1K2DB