3LEYL

2f5 epitope scaffold elicited anti-hiv-1 monoclonal antibody 6a7 in complex with hiv-1 gp41
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
216
Chain Sequence
DVVMTQTPLSLSVTLGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLASGVPDRFTGSGSGTDFTLKINRVEAEDLGIYYCWQGTHFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 6a7 Antibody Heavy Chain
total genus 53
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyL01
4O4YL 5LGKA 4WHYH 1RULL 4Y1AB 5D7KE 3ABZA 1S7WB 4PJHB 1PBYA 1G9MH 2WK2A 4L1HA 4Y1AD 1MFAL 3IDMA 5FV2A 2FX7H 3X13B 1JNHB 2JJUA 5DJ8A 4U3CA 5FYJH 1OSZA 2ZG1A 5IQ9B 1IGTB 2LU7A 3CZFA 2KH2B 3WSQL 2K3TA 5HJ3A 1G0XA 1MCKA 3T1WA 1KPVA 3QBTB 3U7AA 3QUMA 1T2QL 3BRFA 4XBPA 1HCVA 1T3FA 2OL3A 4JZOB 3VI4E 3E8UH 2DQUL 1N64L 3KAAA 4I8DA 5ETUB 5MEPA 3MROB 5C0BE 4KAQL 3LS5L 1UXSB 4MA7L 2A74B 4LLVA 4NCC2 3CFJA 2CIKA 5IT2L 2XPGB 4X9BA 5CJ5A 1EZVX 1ZEAL 2YBRB 2VITB 4FHBD 3T77A 5K9KB 4GRLA 1JNNH 4V1DA 2DS4A 1IGML 4E9LA 2ICWB 3MRQA 4P2YA 4UT6L 2EDRA 2WBKA 3AREA 1A6WH 1EAJA 1SQ2N 5SWZA 1P1ZB 3L3GB 1A47A 3GMQA 2E27L 1AO7E 3MGTB 1CFNA 4PGEB 2V5RA 1E4WL 2Y36L 2YEZB 4FMKA 2N56A 2B4CL 4GW4B 4OCWL 4OGXL 1LK3L 1ZEAH 5TF1H 3HS0A 4G8GB 4P0DA 1P53A 1X5XA 2C3XA 3U82B 4WI5A 5C9KA 2R9HD 2UY7A 2GJ6E 4PP2A 2W0PA 1X5ZA 4Z0XA 4RCAA 3OAYH 4JDTH 3G5ZA 3UBXG 2HT3D 4DCQB 2NZ9C 1RZJH 1DN0A 2PW2A 3LKPB 5ACZB 1XR8B 1LP9F 5E00A 5CGTA 1D9KB 3QWOA 4G8EB 4KVNH 4YDJB 3B9KD 4G7VH 2ZUQC 1U8OB 1CGTA 4MD0B 4NSKA 3WSQH 4WTXA 1AGEB 2CK0H 3T2OA 4HDIA 4ZNEE 3TBTB 4P4KA 1AGEA 4PREB 3OG6B 3LAFA 5DJDA 4Q6IC 5F21B 5A16A 4KI5F 4XP4L 3UTTA 5FECB 1MNUL 3QDJD 4R7DA 5KSAD 4YGVA 3LKOB 3KYKL 2ZUVA 4QXWA 3VXRA 1EXUB 1JTPA 1IARB 3P0VH 1FZOA 4PTUA 5T1KD 2CRYA 3QJFA 4GKZB 5FUOL 4C58B 3QDMB 1SJXA 4JY5L 4PP1C 2GK2A 1FYTD 3I75A 2X89A 5I8CA 4FZEH 3EGSB 4IOSD 1Q9LB 2ORBH 5DD1L 3BSZH 5T1LA 3S7GA 5C2BL 1H5BC 4LLYB 2DD8H 3O2WL 1AGBB 1BBDL 2Q3ZA 2AK4E 2FZ3A 3BKJL 3KXFA 4ODTH 3V7MA 4PGEA 2VDPH 3O9WC 2NY2D 2CIIA 3MLSL 1EEZB 4JM2D 4LLAA 2DLFL 3T08A 3GMRA 1BIIA 1S9YA 1MAML 1NMCC 3BPNB 2A6DA 3NCJH 4XAWL 4D3CH 1ZTXH 5GGSA 1ZLSH 5BMFL 2R1WA 4IS6B 3RIAK 3EYUH 4ACPA 2R2BB 1ES0B 2X4SA 5KZCD 5GISL 1AXTL 4U33A 4YHKL 4HZAA 3JUZA 1S5HA 1DQTA 4CVUA 4Y19E 4K23H 4J3VA 3LY6A 1OCWH 5I1AB 1ZLVH 4DGIH 3WNOA 5GGVY 1R3IH 3MCKA 3UBXI 5B8CB 4HKXB 3ZE1E 3LQAL 4FXKA 2YKLL 2IEPA 2L0DA 2NTFB 3MLXH 4DUVA 3PWVB 3FFDB 1CG9B 4PLJD 1PZ5B 2X4RA 1BVLA 5IM7A 2HT2C 3JWDC 1XMWA 1ZAGA 2ZKHL 4HIXL 1EXUA 1N6UA 4Z7NE 2X4OB 4KQ3L 4QTHB 1XGPB 1S7WA 3AFLA 4WFGD 4PJXF 1D5IH 2GKIA 4Y1AA 1AE6H 3UJJH 2HYMA 3ZDXE 3C6LB 3PP3K 5CEZD 4NO5A 3TBTA 4TUJA 3NGBC 5EN2A 1MFCL 2WMPA 3OKMB 2ORBL 2J8UE 2D2OA 4LGRB 4RFEA 5I8KH 1W72H 1VFOA 1RIUL 3MRPA 3TCLB 1MPAH 1MUJB 1INEH 1YPZE 1J0JA 4WUUE 4P9HC 5FUOH 4ELKA 1AQDA 4P5TB 1RIHH 3RKPA 4MJIA 3NPZB 3SO3B 2FB4H 2DYPA 4QHUA 1KIQA 1OTUD 5D8JH 1CFQB 1RJLB 1YY8A 2JLLA 3P4MB 3C5ZC 5C0NC 1G7IB 4P57A 1F42A 5DRXB 4BELD 4PJCE 3IF1A 4R4BB 5J3HD 4NCC1 2W60B 1ZGLM 3CX5J 4KZEH 1OD9A 5L88H 1RJYB 2BOBB 3ET9F 3OF6D 4OGYL 5TDPB 2CDEA 4GG6A 1D6EB 4QRPA 1QVOA 1LQSR 4QXUL 1E4KA 1A6ZA 2HFFA 5DVMA 4KC3B 5CEXB 2DMBA 2Y1VA 3R8QA 2AJSH 1IAOB 4M5YL 5CEXA 3C60C 2JB5H 1C5CH 3G6JF 1BAFL 5ELIA 4OF7A 3BP5A 5F3BB 1QFUL 1YEHL 3TO4A 4V2CB 2NX5B 4PY7B 3RTQD 4RBPK 4U1NA 4JRYB 5ICXB 2R23B 5DJZA 4NWTH 4MA1C 3WKMH 4RZCA 4HUNB 4NZRL 4G9FD 3DX6A 2LAAA 3D5OF 4KI1A 5D8JL 1SEQH 1FNLA 2FB4L 3RA7H 4MD5B 4HIHA 4N0UB 3DI2B 3D9AL 2AQ1A 1BREA 3HNSL 3QUZA 2F54D 4J4PC 3KJ4C 1HWHB 4YPJA 4ELKB 5CKAA 4LCWD 2HLFD 3HFMH 3VGBA 4MJID 3SDXE 2AJSL 3QUXA 2H26B 2P8MA 5D6CA 3SDYL 2VN7A 4ODVH 5F7KC 4CVZA 5ICYB 2BRRL 1YJDL 5DJCA 5JDJA 4PJ5D 2APVA 5CP7A 2CLZA 4CW1A 3EW3B 5E5MA 1BLNA 3VXTA 4MAUL 1N7MH 1D9KD 2V9RA 2P7TB 3UBXB 2R0LL 3S3PA 3KHOA 4RMQA 1B6DA 4GW1B 2DQGH 2HTLD 1JF5A 5ERWB 5LQBL 4NHCL 4YO0B 1AR2A 1INDH 4IIQC 1U41A 1JHTA 5ACMA 3PNWA 3HC0A 3MA9L 5HI5D 3V52H 1HH9B 3O8XD 2BC4A 4ETQB 4LMQE 5IEHA 5I8OL 5IMLA 4M1DL 4K71C 2H3NB 1OWWA 3VXSA 4CL7A 2W9DH 5D7LE 2GITB 2IWGA 5ISZE 3ULVD 3SPVA 5J13B 3VXRE 1DEEA 2W9EH 3RIFF 3VRJA 3RNKB 3OXSB 3V9FA 1YA5A 4Z7WB 1L0QA 4ORZC 5E9DB 5CSBA 5FGRA 3SGKA 1F3DJ 3MLVL 1HHKA 5IWLC 5DK3A 1F8TH 5HGDB 2JIXA 3IDXH 3CXDH 2IH3A 3JV5A 3JWOL 1OGTA 4PBVC 3P4NB 4R2GB 5CEZH 5AUMB 3FB6B 2NXYC 3L3OA 1U8KA 2VR9A 3HMWH 2HFEA 2EH7L 5DURD 4N8CL 1AGCA 1KIRB 1BQHA 1LEKB 4F2MA 2H32B 3MRFA 5EU6D 5C0IB 4WHTB 5K93A 4ZXBD 3UYOD 2GCYB 3VXMA 4E0RB 3RAJL 4Z8FL 3J7HA 3VFOA 3UTSB 1T1WA 5GRJH 5C0DB 1EEZA 1JI2A 1BFOA 2GEEA 2FO4B 4Y16C 5CSZA 4LLQB 1Q94B 5CAYB 4R97C 1ZT4A 4C56D 3EDKA 5E8NB 1AY1L 4XP9H 5KSBB 2QTEA 4YXLL 3E6HB 5EU4B 1EEYA 4GKSA 1PY9A 2CUIA 3BP4B 3PWUA 5C08A 2HMID 1PG7W 4JFZL 1JPSL 2EKSB 4NKMB 5CINL 4LEOA 4EUPH 3O2VL 1CLYL 2Q86B 4XNMB 2HFGH 1U8MB 1VEMA 4U05A 5TFSH 3V95A 2NX5E 3RTQA 2APTA 3S4SB 3ARED 5IESH 4QO1A 3FO9A 2DYPD 1GZQA 5BW7A 5D1ZC 4ZFOA 1FBIL 4ZS7L 1LD9A 3F62A 4CJ0A 3VJ6A 1PLGH 2YZ1A 4XP6H 5H35A 4ONFH 5CBEA 1DVFB 4JFPA 2EZ0C 4FA8A 1EFXD 2OTWB 3CDGA 3SDDA 1AC0A 5IB5B 3MLTB 3NZ8B 4OFIA 4YDIL 3V4PH 2X4PA 1U3ZA 4NYLA 4B5EA 1NL0H 1C12B 4HHAA 4XWGH 4PJCB 4LSTH 2LTQB 2JB6A 4LHJB 3B6SB 3C9NB 5DSCB 4Q7DA 2VERN 5ENWA 1KN2H 2FX9L 1A1NA 4L5FL 1FORH 4HSQA 1A7RH 1RZ8B 1NAMA 1P7QB 4WW1A 4MQ7B 3H3PH 1PAMA 4PRIA 4NQSB 3I6GA 3D0LB 2Q8AH 5E6ZA 1J1OH 3GSVB 3MREB 3MRMB 1I7UB 4GLRI 2EXWD 4J3XA 2R69L 2X41A 3PP4H 4HH9B 1CFNB 1YECH 5HDLA 4HLZG 5KS9E 1F45A 4RGMC 3QXVA 4P2RD 2NYYD 3EYVA 4P9HL 2VLRA 4APQD 5SWQA 4AEFA 1NUFA 2X9XA 4NQXB 5AYUL 4Q74A 4G6FD 1HOCB 3D25A 4JLRB 5GS0D 1BOYA 2ADGA 2XV6B 5EOQH 1CU4L 2VE6A 4Q58C 5FHBL 3KPRD 4X5WA 5FYKH 3A0OA 5DUMH 4PJ9B 4HUVA 4MNQD 3QUZD 3MZTA 3RHWK 1IGYA 1NLBH 4RAHA 5JW3H 1JPFB 1UWGL 2X10A 3WIHA 3C5SA 2LAGB 1VHPA 1RUPL 2R1YA 4KMTL 1CDCA 1ZS8A 2F58L 1YPZB 4QTIL 1JNLL 3OAUL 2DQJH 3UCRA 3EDJA 4UDUB 3ES6B 3PGFL 4JO3H 3SDCB 4Q9RL 2HT4D 1EO7A 4YHNA 5D7SL 3G5VA 2YD8A 4YBLB 1JYXA 1YEGL 2EC9U 3CLFH 5D9SA 3OKDA 3V6ZA 5BS0E 5LGHL 1ORQA 1LEGA 4A6YL 1EGJH 4M1CD 3O0RL 1ZK9A 2XKNA 4L29A 1A6WL 1JWSB 3HMXA 3LMJL 1VACA 2IPTL 4PJFE 4NBXB 2AEQL 1AGFB 4GBXA 5EC1A 5HHVH 4LPCA 4XMLL 3WD5L 3O41B 2FYYA 3TJHC 5D5MA 4JDZB 4JGMA 1KJVB 3TFKC 1M05A 3NABL 3WHXB 1YY9D 2O26U 4OV5B 3CX2A 3PABA 1T04A 4D0DA 4Z77A 3MNVB 4JRXB 1GXEA 1YEDA 1YDPB 3PIQB 4WIQA 1EPFA 1T2QH 2DM3A 4Y88A 1TZHA 2OLDA 2WANA 1G7QA 5FGCB 4N9GA 5EO1B 1S7SB 2IQ9H 5KSBE 3OZ9L 1ZHNB 1RV6X 3T4AB 3GKWH 3Q1SH 1B2WH 2VQTA 1CDIA 2PYFB 3NIFF 1KLUA 1NUNB 3HUJB 5I17B 3VXSE 1FDLH 1F3RB 2P8PA 4OV5A 4HMDA 1CLOL 1P7QA 2PYED 2C4XA 1SYSB 3LIZH 5JHLL 1HKFA 2XG4A 1A6UL 1CFTB 5EO1A 4HXBH 4PJBA 3HE7B 3N1PC 2RFXB 2RBLA 3MLUH 5C07B 4I18B 3OKDB 1RJZB 4U1HA 5MEOB 1KTDB 1TNNA 3TO4D 1HDMA 2FLBT 3VWJB 3KYOA 5GJTL 4LLUA 2F5AH 4L5FH 5EUKA 1NAKH 4PJDA 1A0QL 5LAXB 4Q2ZB 4P4KC 5FGBA 3L3KA 1ZS8B 2FYYB 3U36A 2O5ZL 4L9LB 1S9VB 5D7JA 1NMAH 1ZSDA 1FLRL 1S7TB 4F9PA 5EOCH 4FMFA 2HJKA 2XY1A 5FHAL 3RHWF 1D5XB 5IHZA 4GT7A 1A4KA 3BYTA 4M6OL 7FABL 4NDMB 3VFSB 3LCYA 4WUKL 5I1IL 1DUZB 2Y7QB 1TZIA 1U8MA 1PD6A 4KH2A 4S1DC 3V4UL 2VNCA 1VSCA 1IQDA 5D96B 1N6QH 1BBJA 1RZIB 1Z2KA 2HRPH 3QEUA 4P2QD 2I60H 1GPOL 2XN9B 2BXYA 3BAEH 5FM5O 1PY4A 5SWQB 3MBEC 2EDTA 3WUWB 4QRQB 2ED9A 2R8SL 2FO1A 1DP0A 1NBZB 2YWYA 1VB9A 4LRIC 5JIHA 3TIEB 2FWOB 4JFFB 4LHUB 5DK2A 1FLTX 4XBEH 3P11H 5L6YH 3CVHH 2NY0C 3CFKB 5IFAH 1U6AL 2ATKA 2IPUG 3RDTD 1OF2A 3Q3GA 1VKXB 3U7WH 1IM9D 2JCCF 3DV6A 1FGNL 1JTTA 2V6HA 2VAJA 4NQXA 4LSUH 4Y89A 2D7TH 4MHHI 5HHXH 1BZQK 5ILTH 4KK9D 2F53D 1RUAH 1K5NA 4RGOH 4RAVB 3B5GA 3L3OB 4OUUA 1G0YR 2KBGA 5E94B 3H9ZA 3FQWA 5F6HJ 3JWDL 4GRWB 5DFTA 3F12A 3WJLC 5F7UA 3VXRD 3S96B 3QQ3A 1UZ8B 1MJ8L 3MRDB 1TXKA 3VRJB 1WFUA 3SKJL 1HEZA 5CMAA 4K8RL 4TVPH 4MJ6A 2A9MH 4XCFL 3EYOB 25C8L 5IEHB 2CK0L 5IBTL 2QQQA 2BDNL 2ITCB 1HKLL 5HYQA 4JCMA 2YUWA 4ZO7A 3DROB 2FSEB 4JO1L 3V6OC 1NCTA 3KVQA 3I9GL 3ROOA 5GQBA 1QSEA 2XRAH 1NKOA 2XTLA 4X5XA 5I8OH 1OOAA 2EDFA 1U8HA 1UEYA 4FQCH 5JHDA 1JPTL 3DGGA 4JO2H 5B38G 1MCBA 4JZJC 4XMPL 1HQ4B 2JB5L 2X42A 3X17A 4UMGA 2OJZL 1KELL 3QUXB 5ALCL 3NTCL 5IIEA 1YYLH 4HX1A 3VCLB 4P3CH 3UJTH 5E08H 5E1AB 4R3SA 3HI1B 1L7IH 1H3VA 4X7EC 5IMKB 1MFBL 4UIKH 4U7SA 2LU4A 4UIKL 1QRNE 4HWBL 5JORA 3GMPA 1I4FA 4WHDA 1BX2A 4QXUH 3NA9H 3O6MH 4FG6C 2AXGA 4DWHA 4FQPA 2YPLD 4ETYA 3P4NA 4LLQA 3PGFH 1QA9B 3MR9B 5F7MC 3TO4B 4P46A 5KSAA 5IQ7L 4QRSA 1MIEL 3LH2H 2BMKB 1FQ9C 1INEL 4IOIB 5T33H 3HE7D 4QYOA 2P24A 2SEBA 2NW2A 4HWBA 1SJEB 4R7NA 3IFLH 3PV6A 1YC7A 2A6KB 3GK8H 3SJVE 3IDIB 1KXVC 1PSKL 2HKHL 4ZD3L 4PS4H 1R3LB 2ZCKH 3HRPA 1IEAA 2HAZA 4MXWL 1BX2B 2WNGA 3U0PA 3UJJL 4F80A 5DFVD 4K94L 2FDBP 4B0MM 3X3FL 1UM4L 1VGEH 3QQ4B 4NNXB 5T1DH 4DGVL 3SKJH 1TIUA 5DURB 1IT9H 2CKNA 2D7OA 2CLZB 4FQXD 3QNZA 4OFPA 3U83A 4KKLC 1CXEA 4JPVH 4LKXA 2PTTA 4IMKC 3GUTB 4GMSH 4I0PA 3OB8A 3T3MF 2NY4C 2D7TL 2M8XA 1CGVA 2QHRL 1N59A 5FGCE 1QLRA 2XY2A 2DIBA 1V5JA 4NO0D 4LARH 1T7VA 5J0BA 1CT8B 4KK8D 1XF3B 1XZ0A 3FFCE 4GMTL 4ESKA 4LLDB 2VC2L 2JCCA 3EJJX 3LV3A 5H37G 5FO8A 4CW1B 2VMFA 4F3FB 3SDAC 4KKAC 4HS8H 1S7XA 5CIPB 2J8UB 3HZVA 5I73C 5LWYL 1WAAE 5IKCB 4GXVL 1NCCL 3QJHA 3EYUL 4UQ2B 4X8JB 3VFRB 2NTFA 1IC4H 3O8XB 2CLRB 2E6JA 2V5SA 2R56L 2VL4A 2MWCA 4MWFB 4QHNB 1IGJA 3HLAA 3VI3E 3QWRD 4Z7QE 2D31A 2VSDA 3DX6B 4XNYH 4R4NC 3UAJC 4D0BB 1KCUL 2BX5A 4QHKI 1A1OB 5KSVB 4PJ5B 5IW1B 1UXWB 4D9RD 5JORB 4Q6YA 1G6VK 4I2XA 5BV7L 2F54B 2IQAA 5MEQA 4GMTH 1AH1A 3LD8B 4ZS6C 1VADB 2YD7A 4R8WH 3KWWA 3RAJH 3UMTA 1BFSA 1R5IB 4QYOB 3QB7C 3C8HA 1U6AH 3UPCA 4F58L 3BPOB 4OQTL 3MRBB 5HGHA 3ARFA 2BMKA 4OZFG 2DAVA 3T0EE 5IVZA 1YYML 2CPCA 1R24A 2G75A 4KUZH 2GUOA 4L1DA 1ZLSL 3HZVB 1J86A 4O58L 1EV2E 1P7QD 3DGGB 4H1LH 5GRUH 3VXUA 3QCVL 5CLTA 1FV1A 4BSWB 3VXSD 3H7BA 3L5WB 1IKNA 1TVDA 4R3SB 1MH5B 1N8ZB 5CP3H 1QKZH 4DUXA 3TNMB 1EBPA 1T4KA 2X44D 4QHMB 1JWUA 1MWAA 4IM8A 2VXTL 3UJIH 3MV7B 3MJGX 1G7MB 4ZG1A 3M07A 3ARSA 1T22A 2AEIT 5DHXB 1P7KA 4YZFF 4GAJH 1BPVA 4NNYA 1UCTA 4PRIE 1BVZA 1VFAA 1A3QA 4XT1C 3KYAA 2XQYG 4KGJA 5HVHB 5JMRA 1X4YA 2J4WH 1I1AD 3V8CA 4BFIB 4BJLA 1XH3B 3O4OC 4KKCC 2B4CH 4AIZA 5EBMB 3FQWB 3O6FC 3QHZH 3AC0A 1URLA 3JV6A 4YNYB 3T0AA 1OB1A 4U6HB 2Y06L 4Z0XB 1KTLA 2C4FU 4JO4L 5B38B 3H9SD 1WC7A 1WEJL 4FQQB 4IRJC 5JW4M 1U8IB 2G60H 4WEMB 1II4E 3DETD 1P5VA 3FFCB 3CFEA 1JGUH 5ALBH 1AXSA 5ID1B 4KROD 3E0GA 4QRRE 2MQ0A 2ZOLA 4E41D 1D5MB 4QCIA 1CBVH 5DUML 4R26L 5A2JH 5IK3A 1G7QB 1B3JA 3MRRB 3DARA 5JPMA 1S5HB 1KENL 4H1LG 5T3ZD 3MX0A 4C57C 4WV1A 2I07B 2RB8A 5AYUH 1H3TA 2F53A 1U92A 3VFTB 4CVXB 5CGYC 3VWJD 4X6CF 2B4CC 3FT2A 1PX3A 4F7CA 3NACL 3S97C 3QULA 2H2SC 3SE9L 4ZQKB 4I0PC 1TQBB 3MLYH 4WJ5B 2XPGA 4N0FA 5DVKA 3QUMH 1CTOA 5FO7A 4KZDH 2A6IB 2APWA 1BQLH 4CN4A 3QO1B 1J1OL 4NQDB 5HHMD 3ALPA 2QR0A 3IJSA 2VDNL 3HI5H 2E8ZA 3IU3A 1FC1A 1CLCA 1E4XH 1NGYB 1OARL 4POZD 1XF4A 3UTTB 5B39A 1UQSA 3RX8A 1T3FB 5DRZB 3SE4C 4HG4K 3QEUB 4LL9A 3ARGD 4HIJB 4HIIB 4OD2B 4RWYH 5SWZD 1T1XA 3MNZB 5DO2C 2EXYD 5EO9B 1VPOH 5C70A 3FO0H 3SO3C 1U58A 2NMSA 3QWOB 3T0WA 4HWNA 1GCFA 5IG7B 5HGBA 4O2CA 3BH8A 3DJ9A 5F9OH 5H2BB 5F9AC 1XGRB 1KJ2L 2GY7B 2JELH 1A4KB 4JRXD 3U30B 5FKAB 3FQTA 2G5BB 2QADD 3LEXA 1KJ3H 3G5ZB 4JFXB 1MFCH 2WBJA 2OL3L 5J6HB 5IBUG 3KS0H 4G6KL 3BO8A 4JJHA 2VDOL 5BRZA 3JSSA 3VFNB 3RVWD 1JF1A 3NCFB 4UOW0 5LAXA 1MFEH 5I17A 4F8QA 3VGGA 1PDKA 5IMMB 4PRPD 3RKDC 3MJ6A 2MOVA 3AS2A 1W72L 1DQQB 3NFSH 3WE6A 1CD8A 3TT3L 3GIZL 3UTZA 3WE6B 4TQEL 1CFTA 1F58H 3GFUA 4IRSA 4KTEL 3RVUC 5BW7C 2YRPA 3MREA 5EPMA 1ODAA 1TDQA 1N5AB 3WO3B 2EDQA 5T3XE 3I6GB 3SGKC 5BO1H 1WT5C 1IC5H 1MFNA 1F4HA 4U49A 2ITDB 5HDQL 5ID0B 2R0WL 1DVFC 1ZT7B 3PL6D 3E2HC 4U1KA 3T3PE 5AYQA 5L2KB 3N1QC 1A4JA 3QZWB 3UYRL 3PG2A 4L3EE 4KTDH 5EIIB 2ED7A 5A3ID 3WHE0 4IRZH 5C86A 2YXMA 4CAGA 2X4PB 3SDCA 5CIPH 4OZFB 3PP3H 4M3KB 2G9HB 4K3GA 1A0QH 3EYSL 4UBDC 1CVRA 1QOKA 5FIEA 5CLWA 5ITFA 4N8CH 1VDGA 3LQAC 2XOTA 3MO1B 1LO0H 5DD0H 5TDOA 5IJKA 1VACB 2E7HA 3CH1A 1FNSH 4RFOH 5CUSL 4ZFOB 5DHVB 2X1XR 1OSZB 5GS2H 1K4DB 2WW8A 1AR1C 1IM9A 1NEZG 2OSLA 4XC3L 2AXJA 4P2OC 4ZAKB 3TH3T 3T4YB 1GPOH 2FH8A 3EKCA 3QNXB 3B8SA 3BUYB 4P3WA 1CTNA 5MERA 5ACLA 1T21A 1T5XB 4AEIH 4NRZA 3MLSH 2WUCH 3NFNB 3G5XA 4NQTA 3DTXB 4IHOB 2LFGA 3VFPA 5CBAA 3BQUA 3HNVL 3EYVB 4NKOB 3MUGA 5EU3B 3VXMD 3TF7C 2FO4A 1YMMB 3QUYC 3QZWA 4BQBA 1WFOA 4CMMB 3BRDA 3T2PA 3MRLB 2DQTH 1EFXB 2H9GB 2XKSA 1HI6B 2VDML 1AC6A 1BF2A 1S78C 2AKRA 5J9PB 1OPGL 2AEQH 4J23A 4Y4HA 1BP3B 4MA1B 4OIIH 2HP4A 3AB0B 1V3JA 1AGDA 1KT2B 3HE6A 1T0MB 4K71B 4NQVB 4G42A 3QCUL 5E95B 2PXYA 3QQ9C 1F02I 2VZTA 4WGWB 1PSKH 2M1KA 1DR9A 4XP5H 4KK5C 1NDMB 5EUOA 1YDPA 1CFVH 3D0LA 3B8YA 3LOWA 3RNKA 3M8OL 4HWEH 3BIBX 1FZJA 4PRIB 3EDDA 1U3JA 1S5IH 3PWNB 3BPLC 3GSRB 3T3ME 1A7NH 2UZIL 1FYTE 2ZG3A 5HVGB 3P4LA 1A1NB 3QG7L 1QFUH 1YEHH 3RWEB 3Q48A 4L8CA 3L3DA 4KKBC 1CIDA 1BFVH 2EEAA 1QLFB 2YC1B 2DQCL 3P77B 4M1GL 1B0RA 2V2TB 2MHAB 1YMMD 1KEGL 1CBVL 1KB5H 2NY2B 1S3KL 3AS0A 1L7IL 5CZVL 2BNRB 2OR9H 4OTXH 2DMKA 2YD1A 5GPRA 4PRNB 1CR9H 3OF6A 2PW1A 4JFYA 1A1MB 5C0CE 1XF4B 5B39B 1QPPA 5CJXC 1HK6A 3WL9A 4X7TA 1Q94A 4W68A 2G75B 5I9QB 1IGYB 2IMNA 2MKWA 2Q76B 2VN4A 5I1KL 3U2SA 3UJTL 4S0TD 3S98A 3DOSA 3EO1B 2VKWA 2CO7B 3PXJA 2B1HL 2BVPB 1I1FA 4DEPB 4MMZC 3JUYA 3P30L 4NKMA 5T3ZH 4LASL 3AM8C 4JN2A 1F3JB 3C08H 2R0ZL 1IL1A 1TZGL 1G9EA 4IMLB 1OTTD 5IMOA 1EO8L 4I4WA 4FFWD 3VG9B 5FCSH 4YEFA 4U2YA 4P23C 4PJAA 4HS3B 1Q1JL 1U95B 2UY6A 5L2JB 4OIAA 1NJ9B 3CIQA 4YHLH 5HGDA 3S36L 1I8LA 4YHLL 4YDIH 1KJ2A 4WFEE 3TEUA 5GRYA 3WFHB 3K2UH 43CAA 3EIFA 1T5WB 1TPXC 2ZKHH 4UQ3A 2GSIB 3CVHB 1ZHKA 2GITA 4LSRH 1D6EA 5CEZE 3ARRA 1AE6L 2GFBB 1OB1B 3IXTA 4XPTL 1KFAH 3U7YH 1KYOJ 4LCWB 5ENWB 1BVKA 4G8IA 1J12A 3T8XB 3BZ4B 4PYGA 3CFBB 4JB9H 3QHZL 2GAZA 3VRLF 1K8IB 2A2QT 4PJEF 1ADQH 3QEQA 2X9YA 3UTTE 5JMOC 3QZWG 4LVEA 3LKSB 3T0EC 5C0EA 4J12A 5F96H 3IDNB 3V6FB 4NN7B 4J1UA 4UINH 5ICYA 5K9JH 3L3IA 1G7MA 3GUTA 3I85A 5CP3A 2FJFA 5E99L 1YMME 1GZQB 4QHMA 1S8DB 3D48R 1PW3A 1NL0L 2OQJB 5I18L 4HJ0D 3TBVA 1HYSD 3DHMA 3QWRA 3X3GH 2IJ0C 4Z5RA 1LP9E 3V5DA 2XWJB 1NGWB 1FV1B 1TETL 1G9MC 2AK4A 2DLIA 3OKEB 4GKSB 5JDSA 1U2HA 2R23A 2EIZB 2W0FB 1N4XL 4PJFA 3F8UB 3LSOB 3MJ9H 1MHCA 1PVHA 1K8DB 3DX8B 1MQKH 5IBUB 1F8TL 2FHBA 5KN5B 4UILH 4X4XA 1YN7A 3GKZA 1G7PA 4Z7VF 3MRJA 3RZCD 3G6JA 1EFQA 5CGMA 4K55A 1SBSL 4K23L 4LCUB 2I5YL 4R4FH 3VDBA 2HG5B 1WZ1L 1WIPA 4HT1H 3P0GB 4OJFL 4O51B 2ZUXA 3BPCB 1RVFH 4P59H 4NN6B 4U1NB 4BYHA 5L8JB 3IF1B 4R4BA 2XN9E 5B4MC 3MA9H 5DUBB 3PWJB 3JV4B 3NN8A 2B2XL 2GTWB 4LCCB 1P69B 5L7XH 1HHKB 1BM3L 1G9NH 4UUJA 4WEUD 1MLCB 5EZOH 1B2WL 4ERSL 4DAGH 1MIMH 4K8RC 4EXKA 3D85D 5J1AA 4PGZA 2A73A 2ARJQ 1DSFL 3SGEI 5F6IC 3O3UN 4BZ1L 5HBBA 2Y4SA 1J8HD 4XNUH 1T0NA 4KRPC 3CXDL 5E6IC 3ZDYE 4TPRL 3Q2CA 4QHUB 1FGVH 3W9DB 1Z5LA 3BD4A 3NAAH 3M17B 4TN9A 4MS8C 4C83B 4GKZA 1NH6A 3BISA 4ZFFB 2VXUL 4WEBL 4L4TB 4IIQA 5TGBB 4EI5D 5I1JH 1RQ5A 3BWAA 4Y5VB 2F74A 4P4RB 4LU5L 4R90H 2OR7A 4M8QB 3DMMB 4L4VE 5TH2B 3F7PC 5I76A 4UIMA 5EN2B 1KN4L 2VDRH 3A6BL 3MODL 4M62H 5F7HA 5I8EB 4YLQT 4M5YH 5IW6A 4UDTA 1QFHA 1UACL 3L7EA 3RY5A 3SE8L 1V7NH 2OTUB 5B39G 3BEVB 1NMAL 1RZGB 3LPGA 4OD1H 3SGJA 1QBAA 2J8HA 5KSBF 1IM3A 1V05A 1RK0A 3AUVA 2G2RB 1GL4B 4JREC 3MYJB 3GHEH 1JNLH 3OAUH 2V5YA 2C1OB 1MOEA 5DQJB 5IT2H 3KLAA 2EO1A 1PZ5A 3NBNA 1CU4H 1QPXA 3W0WA 5GGUA 1MCPH 1GVIA 2HKHH 3MJ8B 4RMRA 5E2TL 3MOQA 1LP9B 4AENA 5JNYA 1NCAH 1SJEA 5DWUH 2IADB 3QIUC 4LAQL 5E7FA 3LDBC 4HKXA 4S10A 3RWHB 2ZOKA 4V1DE 2ICEB 3DLQR 3TWCL 3N85L 3A67H 3DX9A 3I3BA 1S7QA 4K9EL 2VLJD 3KYMB 3RIFK 5GZND 3QDJB 4NP4L 3DX9B 1HXMA 4FS0A 3D3VE 3VFUB 1EK3A 1NBZA 1PKOA 1J0YA 1SJHA 4HBCL 3ZHDA 32C2B 1OTSC 5DJXA 4A2LA 5F72S 3OPZH 1OAQH 2CUHA 3WIHH 3IAPA 4LVOB 3KPLB 1L6XA 1TZIB 1DLFH 4Z7UB 5HSFA 3TPUA 4YBHA 4XMLH 4LGPB 2NXZD 4Z0BL 2HJKB 4HKBA 3LZFL 4RFEB 1S7TA 3QG6A 3SGDI 4NCDA 1IAIM 1QACA 3A6BH 3MODH 4OB5H 5C6TL 5JPNB 3DO7A 4HBCH 1CZ8H 1ONQA 3QIUA 2DI7A 1NFIB 4KXZI 5JXAL 4Q9QL 3GEWB 1MFAH 1XGPA 4LBEB 4LFHG 1HINL 1CS6A 1FZOB 1T6WA 1JNHA 3BDYH 1XR8A 1RIUH 3N1FC 4LOUC 4YFDB 3BIKB 4L4TA 4LHQB 4GJTB 5D1XB 1XGYL 3MV7E 4NO0B 4U1SB 2X4RB 3LKQA 4L8DA 1FFNB 1RURH 3N06B 4OLXH 4JN1H 3VXNA 5CFHA 1INQA 5EC2A 1ZGLA 4AY0A 3BH9B 2BSSA 2HVKA 3F5WA 4AH2B 1EBAA 3REVB 1WWCA 5DA4A 3T4AA 3ZHKA 5IR1B 3GMNA 2GYSA 5F89A 5GRZA 1FE8L 4P5KB 2DD8L 2C3GA 4KQ4H 5CJOH 1MLCA 1FRGH 4QRUB 3MNVA 4PV8B 3VU2A 4LPYA 1RK1A 5ITBH 4X4ZA 1B6UA 1MHHA 4KUCD 1D5ZA 4M6MH 5DUBA 3BXNA 2WUBH 3GBML 3RZWA 1WT5A 5F7FA 1EAPB 3S5LA 3DWTA 3QDJA 4FXGB 4Z18A 4GUPA 2B5IC 4HF5H 3KXFB 5FA3A 1RURL 1U3HC 1FL5B 4CRPA 3IFPA 2BSTA 1BHGA 4FQ2L 2AW2A 4FQLH 4UDUA 2J6EA 4XI5C 3I75B 4CJ1A 5I8CB 3QAZB 4LSSH 5EZIH 2ICWA 4M4PA 2WLYA 4PJ8A 3IFNH 1UWXH 2AABL 4V1DB 5K9KA 2WIIB 4P48A 1FL6B 5JUEL 3EFFB 3PGDB 1J10A 4X6CA 1FFQA 3CMOL 5DJ0A 2BNRD 4TUKL 4BQ9A 1IEBA 2XZZA 3V0VB 2ZCHL 3QXTA 1MHEB 4AQ1B 1X5YA 3V5DB 2WSKA 3HPJB 4PYHA 2EICA 4H20L 1WFTA 1F4WL 4HFUH 5FYLD 4JFDB 1H3PL 1X5IA 3DYMA 3QUMB 3TZVA 1ND0B 3L3JA 3B9DA 4JPKL 1D5BA 2EECA 5FA4A 2V9QA 1TJGH 3TA3A 4X80H 2PXYD 4G9FA 2FCBA 4R0LB 5F1OB 1C1EH 4ODWB 2DL2A 2DQGL 2BCKB 1CD1B 1SM3H 4PJ7E 1LO3L 1F4YH 1NCDH 2Z93B 1FNHA 4N90D 1FNGB 2AJYH 4M8VA 4LQFL 1QYGH 4JFEB 4XPAL 3R1GL 2F15A 4G7YH 4LIQL 3BX7C 1CFSA 4ZPTA 4ZD3H 1HHGA 3GJFB 3VG0H 3MRNA 1C08B 1FE8H 2PYEE 3O4LA 2HFTA 3VDAA 1B90A 1LMKA 2X1PA 2AJUH 4Y4FD 4LVHC 3DXAA 3HTLX 4OAWA 1SYVB 1G7LB 4NWTL 3RGVB 5HD8C 3DVNA 4NC0B 4DN3H 4P2QA 3O2DL 1L6ZA 4OT1H 4NC1E 5F1SA 1DEDA 5FGSA 3B6SA 4WNQA 3MZGB 5DMGC 4PJCA 3DVGA 1EHXA 3IKCB 3NA9L 1MF2H 2C1PA 3WFHA 3P3YA 1MEXH 2WBWB 2IBZY 2NNAB 3KLSA 3GMLA 4QY8B 5EU6E 3UZEA 3T0EA 4JCLA 3OB0K 4YIQA 4X4YA 1MJJA 3IGAB 1MWAH 3T77B 1OHQA 5I71B 5HHOE 1BAFH 5I6XB 4P3CL 3O6KL 2RGSA 4I4WB 4PLKD 4E42B 4WI7A 1HHIA 2R0ZH 4O51A 4PB9H 4YDVA 4PJHF 4ZODA 4ZOCA 1NBVL 1LILA 5E8DL 3QEHB 5KJRL 4J6RL 3K0WA 5J12B 2HN7A 3MMEB 3WNKA 2X4UB 4P23B 3NVQA 4YR6A 4Z7OE 3LB6D 1T80A 3HPLA 4JJ5B 4PD4J 3V52L 3CC5A 3IDJA 4JPWH 4E5XB 5HVFB 4X6EB 4LP5A 1E27B 4JY6A 2J88H 4YHIA 1FJ1B 3MUY1 4ZDHB 4F33A 1KPUB 4PJBF 3E6HA 2R0LH 4J8RB 1YNLL 4AG4H 4W81A 4PJFB 1OAQL 4HAGA 4Z6AT 5L2KE 3HC4L 4TUOB 4BSJA 4JFYB 3RZCA 5KW9L 3HNTH 1MELA 1H15B 1UM4H 1M7XA 4XWOD 5KOVC 3UTSA 2VXTH 1QNZL 1FP5A 2DQCH 15C8L 3FO1B 4M5ZH 1EH9A 3C8KA 5L2KD 3TZVC 3FQRA 1EUTA 3QUKB 2O93L 4N90E 1A5FH 3AMLA 3P9LA 2NY2C 5HI3C 2YWZA 2FX7L 4DN3L 1RMFH 1SBBA 1TVBB 3PWNA 3W39A 2OJEB 5GRXG 1NFDF 3C6SB 5INCB 5AEAA 4ORGA 2FGWL 1TVHB 4FOMA 3F7YB 3VG0L 2DDQH 5I19H 3FTGB 1MI5B 2VLLA 3DVGB 4JFZH 5GGRY 1JUFA 4NRYA 4S1RH 4Z78B 4IMKA 4WU7A 3P9MB 1T2XA 1OT1A 2NY7L 4YHKH 1PYWA 2PO6B 1UACH 3IT8D 3KXFE 4B50A 3ZKND 2DB8A 2R1XA 2NY3B 2AKRB 1MCCA 5ERWA 1H3GA 3FB8B 1T66D 2YXFA 5H94A 2OJZH 5KG9A 1W0WA 1BFVL 3GSNL 4EZMA 1KN4H 4MSWA 1BEYH 4JZJA 3T2QA 5DK0B 4HAFA 4NKOA 5EIQA 5AG9A 4YUEL 5IBLD 1LHZA 3ARBB 2A1WL 4GQ9H 1J1PH 1FZMA 1XF5A 1FFRA 4OQ1A 3VFVA 3D3VD 4PJGE 4ZOBA 3TA3B 4WUUD 3EZ8A 1D5BB 5JW4Q 4NZDA 4UT9L 3NCBB 3GI9L 3S88L 5CJQH 4NQCB 3DIFA 3QNXA 3O6LL 4K3DH 4MYWB 3W5NA 3HMXH 4G3YH 5DJ6B 4HIHB 1MI5D 3UTPE 1JPSH 5CINH 4OLWL 5DC9B 3B2UC 1IEBB 2IGFL 1R5WB 3O4OB 2D03H 1Z0NA 2XTJD 3W2DL 1MCOH 2B1AL 1X4ZA 2NX5A 4DKFH 3QXAA 4ODUB 5JHLH 1NUDA 5IHLB 3HI6H 3S8WA 5T5NG 2OM5A 3L6FB 5GRJL 4PJXE 4NHCH 3P4OA 3GI8L 4H5SA 5JQHC 3GI8H 1DE4A 2B2XH 2Z91B 4YBQC 3RPKA 5ISZB 4KPHH 5FO9B 2Y6SC 4HJGA 1S9WA 3SCMC 3ZO0A 5GS2D 1K3ZA 2CLVB 3OZ9H 5J6GA 2I9LB 1MJJB 3IGAA 3VW3L 3JZ7A 1DQMH 5C0AE 2XZAH 4EBQL 1FZJB 2NTSP 5EBWA 1A2YA 4Y2DD 3VXQB 5KS9A 3OTTA 5EA0H 4KDWA 3L95A 3EUUA 3GIZH 5FYKE 2P5EB 3H6JA 4XCEB 1XR9B 3ILPA 1WLHA 2A0LC 2FATH 1RU9H 4WHYG 1ZVHA 3QDAA 1QO3A 3HR6A 4HJJL 1NDGA 2VDPL 1QSEE 1ZLVK 4TUJB 3DRTB 4OD3H 4EOWH 2Y23A 5I66A 4RGNB 4BH8A 5JQ6L 1PQZA 4WWKD 5K9JL 1XGUB 3TJEH 1JNNL 1UGNA 3DUSA 3LKRB 3MACL 2WBJB 2XFXB 4JFXA 4Y8AA 3QDGB 5L0QB 4HC1H 1F6AB 3JWNC 4H1LA 4LVNB 4LDOB 1QSED 5SWSA 3BDXA 4I5BB 3DSFL 3BQUB 3U6RA 1NLDH 5LVEA 1Q9WB 5F7WC 3ZTJH 5FA4B 3MLZH 3EDFA 3L3JB 1AD9B 4RAUA 3JTSA 1L7TH 1MI5E 3P73A 3TIDB 3UTPD 4FFYH 4PJHE 3QG6B 2VDNH 3LN4A 2VLJA 3VG9C 3RWDB 1F58L 4NQEA 1EO5A 4JG0H 4KGLA 3CCHA 2JE8A 4LLWA 2BNRE 4RMTA 5HHNB 5DJ0B 1G9ML 3BD3A 1P6AB 4ZQKA 1W8OA 1B9ZA 2DTMH 4FQ1H 1QSZA 2NY1C 4NM8L 4NBYB 5IB1B 2DQHH 5LCVH 4S2SB 1RK1B 1B88A 4F15B 2VIRB 3WIFA 3SE3A 1XIWB 1SJHB 1KJ3L 5E1HB 3FONA 3NZHH 3CPLB 2NLJA 4P5KA 2Z31C 4PRAB 2NW3B 1W72B 4PJIF 1JGUL 1ITCA 1TZGH 5I71C 5D7IF 5D7LA 1BJ1J 4NN5C 4BSVA 5HY9B 1G7IA 3D69B 4PG9B 1CICC 3K81A 35C8H 1FFNA 5D2LB 5IHUL 1CXIA 2R39A 4R2GD 3FN0L 3EHBC 5HTSA 4A6YH 4NZTH 4Y4KB 4MJ5B 2ARJA 4GOSA 1Q9OA 3DNKA 4NRXB 4LSDA 1KB9J 1HNFA 4HCRA 4MA8H 1S7UA 4U6TA 2ESVA 1RK0B 1TCRB 1LWRA 2ADFL 1IM3B 1AD0A 4W6WB 2WBJC 1HSBB 4RNRA 5T1MA 2OP4H 3RWGB 4Y16B 4BZYA 5D6DC 1ND0A 4MNGB 4MX7B 4MA7H 5HPOA 5JW3L 3GSOA 1P2CB 5I76B 3E8UL 1AFVH 3W11D 4DKDC 4YHPA 3LEXB 1JWUB 5FKAA 3V0VA 4KRNA 1KC5H 4WTWA 4HMCA 3WKNA 2EDOA 5DVNA 5I6XC 1WV7T 5FYJL 1LE5A 3ZE1F 5M94B 4ODSH 5C08E 1QFWH 2PO6D 4LQFH 2EDJA 4Q0XL 5HHOD 1SHMA 1F4XH 1CGYA 1AKJB 1JVKA 2IAMA 5CCKL 3EOTH 3OKNA 4Y2DA 3BKYH 3VGFA 2K1MA 3N1GC 5FO7B 1Q72L 1EAPA 4JPKH 5D1XD 4H88H 2DKSA 1CD9B 1IKNC 4HK3J 3K4AA 3KPLA 2Q6WB 1I8IA 4OZIF 5EBLA 5FYKU 1MVFA 4XP4H 2VDMH 4M6ML 2WLZA 2M26A 4N0RA 2GIYA 3U9UB 1KC5L 4ALAH 4KVNL 1FDLL 5JW5A 2E6PA 4ALAL 2VDLH 1A7PL 3IFNL 4F7PA 3G9VA 4GBXD 4M1DH 5F9DC 3GKWL 5GIRA 3HRZA 3QEQE 2KPNA 1P9MA 5DQ9A 1BFTA 3IXAA 3VD3A 5MEPB 3MRJB 2VLJE 3DUUB 3B4NA 4D9QE 4YAQB 4O2EB 1AJ7L 5CKGA 5T1KA 3BSZL 1J0HA 4MMXC 4FQQA 1EMTL 3QDMA 4KJPC 5C0ND 4GRLD 1XCTB 2GJ6A 2IAMC 2VQ1A 4XZUA 4MNHB 4M8QA 5DQJA 5DJYA 3CZFB 2LU3A 2VH5L 3FOLA 4PJ7A 4X6BA 1UH4A 4MQXD 5EBMA 4AIZB 4OLVL 4I48A 3MCLH 3QIWD 3T65B 5C0AD 3W9DA 5JOFA 3O81A 3TBVB 2AJ3B 1A3LH 5HHPA 2HT4C 5DD3L 3KG5A 3BE1L 4HLZH 4JAMA 4Y16A 5BS0B 2P45B 5T1MB 3RWGA 1JHKH 1OAYH 1KGCE 5FHAH 4G8EA 4NO2A 1LVEA 1FRGL 5D7JD 1QSFD 3FQNA 4KMQA 2D4DA 2EE6A 3IDNA 5ADPL 4N0YH 1SEBB 1DFBH 3BW9A 3TJHD 1IFHH 1PJ9A 3ARBC 2O61B 1XGYH 5J12C 4IOFC 2Q20A 5JW4N 1C5CL 2CRZA 3AAZA 3HCVB 1DZBA 5D7KD 4HS8L 4EUPG 2PETA 4GW4A 1S9WB 1N0XL 3OJ2C 4TSBH 4QHLA 5J1AB 4AEHH 5IVZB 3EYQD 1Q38A 5J4MA 4PTTB 1KTKE 5HGHB 3RDTB 5GJSL 3X11B 3KPOA 2DMCA 3ARZA 4P2RE 4GXUM 3GSWA 4JFOA 3MJ8A 3QIWA 1U93B 2X5PA 5E2VH 1IQWH 5EG6C 5CD5C 2Q7YB 1OT2A 2NY1B 5C0FB 1CL7L 1INDL 2KZ1B 5I16B 2ARWA 3BPCA 4QOKE 1DL7H 4LVHB 3VXOB 1IT9L 4X0KB 2A77H 3C5JB 2DQDH 3TBSB 4Y19A 2EDYA 4DVBA 5C7XL 3JVGC 5IMKA 5E03A 3BN9D 4HV8B 1YUHB 4N9OB 1YJDH 5ETUA 4ZYKB 3BJLA 1RUQH 4LCYA 1TLKA 3ULSB 3LRSA 3QFDB 3RL2B 4JFHD 2OS7A 2R0KL 4PJXA 3BQUC 5EU7E 3CK0L 2ZP0T 3WXVH 4X7CC 1FIEA 2VZOA 5FYLE 1NCNA 2W38A 4XNZC 3RNQB 5DHYB 2DBLL 1IMHC 2GHWB 5C07D 1J0IA 1FN4B 4NFBA 3OGCB 3FB8A 2FATL 2OZ4H 4LIQE 4BH8B 2CKBL 1C5BH 1UG9A 2HH0L 3GNMH 3CFBA 1A3RH 1S8DA 1T89A 1YC8A 3T8XA 3A6CH 1YEEL 4JFFE 1IFHL 1AIFA 1YEFL 3RGVC 2NY5L 1NGXB 4BH7B 1EJOL 4DTGH 5IB2A 2IALB 2VZ3A 4JO4H 4PFEA 4DK3A 5C0EB 4C54A 4KRLB 4UV7L 3S96A 1QEWB 1PG7L 4AL8L 1MCJA 1CF8L 3T0XA 1IILE 4EN3C 5EBWB 1S3KH 4XAKE 4MNGE 2OJEA 4WU5A 3WFBH 1MAJA 4WRLA 4W4OA 1Q0YL 1UADC 4XC1L 1OL0A 4XXCA 4PRBA 5MP6L 4U0QB 3WN5A 2CRMA 3MBXH 2MCG1 4OLWH 4BUGA 2CQVA 4P59L 3UX9B 2VAAB 3WUWG 1HH6A 4QRPE 4MD4A 2V2XB 1MRFL 4N8VG 2R4RL 1RSFA 1JCKA 4LKCB 1OF2B 3Q3GB 1G1CA 4ODUA 1YN7B 4G8FB 1KN2L 2FX9H 1X4XA 4XC3H 3VW3H 2EDBA 3EOAB 4POUB 5L2JA 3DX8A 1M4KA 3ARYA 3MUGB 2A9ML 3I02B 2NR6C 5EU3A 4LNVA 3ZLQC 1MIML 4XWGL 3CLEL 1X3DA 1NCWL 5E4EC 3IETB 3WCYA 4WHCA 4YHIB 3FQRB 3RI5K 2XTJE 1E27A 2HTKD 5DJAB 1A6TA 1KIUA 2AEPL 3QAZC 1NC4A 4OZIB 1EDQA 2BNRA 2EH8L 2V2WA 1NEZB 5DDHB 1A6VL 2C3VA 1E4JA 5F7DA 1RZFH 4XTRC 4ERSH 3UC0L 4XCNA 3VCLA 4KDVA 4JPVL 5IV2A 2UWEF 2LTQC 1KCRL 1UM6L 2FR4A 3RWEA 3RI5F 1S7VB 2UZXB 1LO4H 4MCYA 3HI6L 4ELMA 4APQB 1R0AH 4NKDA 2WAHA 5EZJA 4OLEA 3GB7A 2BRRH 4HT1L 4P2RB 4N1EA 5FDWB 4D9QD 5FDYA 4JR9H 2NY6D 2OZ4L 4M3JA 1BMGA 4PJ5E 3MJ9L 3KDMB 4HUXB 3DROA 4WWKA 5C07A 1JYVA 1X7QA 2RFXA 3A6CL 4NT6A 1CGXA 4PRPE 2KQMA 2XWTB 4TSAL 3IJYA 1BVKB 4L8CB 1HHIB 3G6AA 2W59A 3WFCH 4JKWA 1V7MH 3EDEA 3NFSL 1NGPH 4Y4HD 2IC2A 1OW0C 1DBMH 1WIOA 1ZT7A 3QRGH 1R6VA 4RA3A 4Z78A 1LO0L 5DD0L 4YDLB 1HSAA 1ETZA 3T0EB 3GO1H 4P3DB 2EDLA 4H25B 1FPTH 4PBWD 4YHOH 1T83C 5LG1A 1XF2B 3OWEA 5E99H 5B3NA 5EIVA 5T5NF 2ICES 4JFDD 1GGYA 3NCYP 1QRNA 4WNQB 2GT9B 4HKJB 3RUGB 4W70A 3HB3D 4G42B 2MTPA 1RI8A 3EO0A 4ODWA 3MA7B 1EVTC 1I9JL 1X44A 1WZMA 3QRFM 3QHTC 4MVBD 2F5AL 4QGTA 2ZCLL 3C08L 1TQCC 3KXFD 3GJFA 2H9GA 2V5MA 3HZMA 4Z7WE 4PRDB 3RBSA 2G5BA 3RNQA 5JXEA 5DT1H 1WUNT 1IZKA 2N7BA 4AYFA 4O2FB 2YD9A 1XGRA 2NY4D 2OBGA 4JQVC 4OM0H 1U91A 4GXUN 3WL9B 4N1HB 1MWAL 3G5VB 5JO5A 2WIIA 4R0LA 4PGCB 5JZ7D 5LQBH 1I8MB 1HILB 1QP1A 2E9WA 1GYAA 4ISVA 4DGYH 4EJ1C 4XNXH 1BF8A 4HCRH 3CSPA 3BMWA 4C56E 5F1IB 4YHYC 1T2JA 1Y6NR 3INUL 2R1YB 4JJ5A 4PJ7F 5GGQH 2V7HA 3N9GL 2BSTB 4U7KA 2MHAA 1CDGA 3ARDC 3VXPA 3QO1A 4KKAD 1UH3A 3QEQD 4M7JL 3S36H 4HUVB 4NP4H 5FHBH 2JELL 5D2NC 3HFML 3PWLB 1QFWI 1OAZH 5ID0A 2QKIA 1U93A 5FUZL 3S9DB 2V5TA 4OFYA 1GC1L 4ZFOL 4I3RL 5TDNA 4OZFH 1I3RB 1Q0XL 2X4TA 3SBWC 4L8SB 2EYSB 2GY5A 2VISB 4M48H 5T3XH 3HI5L 1CGSH 3KLHD 1ZKAA 3FQUA 4Q6IA 4OD3L 5JXED 4GAGH 4C59B 1A3LL 1FZKA 4EDWH 4OLYH 4TTDD 5INDB 3BH9A 1ACZA 4YHYB 3OHXB 1M6OA 4XGZB 4JFQB 3HCVA 1CICA 1RU9L 3U79A 2X4QB 4YHZH 1NAMB 1TJHH 1EHAA 3DMMC 5JHDD 3MOAL 1W0VB 2OYPA 1UB5B 1YMMA 4D3CL 1JWMA 3SKOB 3BH8B 2HLAA 1OP9A 5E4EB 3CXHK 2HVJB 5F9JB 4ONHB 1FG2B 2HVKB 2BRQA 1P4BL 2R15A 5AZ2H 1MLBB 1OAYL 2VLRE 4ZSOE 3NFNA 4L3EA 3EFDL 4NNYB 1T21B 4UAOB 4PJGB 4FQ2H 5DD3H 1REIA 2R4SH 4KRPB 1WEJH 2YRZA 1MPAL 2OMBA 5C08D 4GG8B 2AXHA 2X05A 4HKBB 3KYNA 3GIVB 5BV7C 4ZUVA 4O4YH 2A6IA 3SGDH 5DEGA 1MJ8H 1Q72H 5KTEL 1A9BB 1N8ZA 1CXHA 4MLSA 1EHNA 3DV4B 1F2QA 1DTUA 1H0DB 2CR3A 2D9QB 4P46C 1F4XL 3FT2B 1QSVA 1YZZA 5FM5M 4EN3B 4RISH 1I8MA 1P84J 4XPHL 1FORL 3DUUA 2YPKA 5F88A 3PQYD 3NIFE 4X80L 1OP5H 1CK0L 3C5SB 1WFNA 4UV4L 5LGJB 2BY0A 5HDBF 4CU7A 3QPQC 3O3DA 2FEEI 3U0WH 2Z31A 2X1WL 5AZ2L 8CGTA 5JW5B 4U1MB 5IGXL 1WWWX 1JZ2A 4ZOEA 5D1ZA 3BXNB 5F6IB 1AQKH 1J5OL 3AB0C 3KJ6L 4AENB 5JNYB 3U4EB 4BK5A 2E5EA 1IAIL 5M95B 2I9TB 2ADIA 3RWIB 5MENE 1KLGB 3U46A 1KTLB 4BQ8A 1ED3B 2I60L 1IJ9A 2J6EH 2HRPL 3K3QA 1Y0LB 4OGAC 4LSSL 2LVEA 3QA3B 1YEJH 4XP1L 2XZQL 1GHFL 5IK3B 1GGCL 5KSUB 1Q9KB 3V4UH 5EWIL 4NQDD 1I7UA 2XIDA 3RVVC 1QEWA 5BZDA 1CZ8L 4N0CD 4UI2A 2NXYB 4IRSD 1H9VA 4DUWA 3BDYL 5BXFB 1J8HB 1FL3A 4EQ2A 5DR5L 1C16B 4I0PD 1K4CA 3W81A 1WC7B 4Z7NF 4LPWA 1N5YL 3U0WL 3CSYB 3O4LD 4WFHE 2O5ZH 3Q0HA 1S7XB 2X9WA 4NQDE 4KK6D 3C6LD 3C9NA 4UV7H 5DSCA 3K8KA 5KSAC 3T1FA 2G2RA 4EUPA 3ROLA 3D2UA 1XH3A 4JY5H 4UU9A 2Q8BH 4QRPD 2W07A 5HDBE 3RP1A 4XXDB 1FN4A 1QSFB 1FNAA 2EXYC 2K7PA 3CX5K 2OTUA 5CILH 3LQMA 1VFMA 3O9WB 4HIIA 3PGCB 2VKXA 3MV11 4Z95H 3X3FH 5I9QC 4QXTA 2JJSC 5K59E 4NM4H 2APXA 3ULUC 4Y4KC 5DJ2B 1TQCB 4KMLB 3DX7B 3S35L 3VMOA 4HUUB 4WJ5A 1M7DB 2FECL 1LDPH 3K7UA 2RR3A 4JM2C 3KWWB 2EKSA 1ULVA 4LSPH 3IRPX 4PJAE 4K9EH 1HQRB 3PWUB 5C08B 3QI9A 1MIEH 4RZCB 2MQ3A 2MSPA 1SJVA 4Z95L 3X14B 4K7PH 2VR5A 1FCGA 3FO0L 4WI6A 1HXMB 4O02L 4X4ME 1NMBL 3QO0A 4YDLC 1F00I 2VXQL 4J6RH 1KIPA 5I1DB 5GS0H 1CR9L 1T20A 4MDJA 2DM2A 2GCYA 3VXMB 4PTTA 2AGJL 3EBAA 3SQBA 2HFFB 2DI9A 5D70L 1GRWA 5AAWA 4FQJH 4J7RA 3MRIA 4CKVX 3RX5A 2DQHL 1MHCB 5DQDL 4PP1D 1EERB 2AXGB 2VDQL 5AUMA 5IJVA 1OGTB 3CCHB 3MLRL 4LSQL 2A9NH 2HG5A 2JIXB 1C7SA 2GTZB 4TSBL 3TV3L 2E7LC 1XF3A 2CLRA 3T0VA 1UB6B 2IPKB 4WW2B 3H2WA 4NKIH 2IFFL 4KJYB 5IW6B 5IIEB 2XQBH 4TVSa 5GSVA 3FQNB 4LPVA 3VWKD 9CGTA 2FJFB 1LNUA 1FFPB 2PR4H 3ARXA 2W91A 4DZ8A 1YPZF 3WFZA 3MV8A 2BC4B 5CILL 4ETQA 4JAMB 2H32H 3FO2A 3QCUH 4OCYL 1Z0MA 3JVGA 5ADPH 4P9HH 4OM1H 3QEQB 1L4IA 4PG2C 3CVIL 4WI4A 5HVHC 5KVEH 5IEKB 2DQIH 4RIRB 5E5MB 1FIGH 3ZDXF 5JHDE 3MYZA 2IANA 1JZ3A 1OTUC 1T1ZA 4XPBH 5FF6A 2J1KA 4J4PA 1IC7L 1RPQA 2GFBA 1IEAB 1NKRA 4TVPD 3R0MA 2PTVA 4NWUL 2F8VA 4PLJC 4QEGA 1HEZB 3SO5A 4KUZL 2HT2D 4U4BA 4OUOA 3ULUF 2P5WE 3CFCL 1UB6A 1T5WA 2IPKA 4DKFL 1KV3A 3QIBD 1MCOL 4M7ZB 1WZ1H 4Y5XA 5IF0B 5KSUA 4U7MA 3NPSB 2QQKH 1OAKL 3BZFA 4IEFB 3WDIA 4X0KA 1NFDE 2O5YL 3REWA 1VESA 3TBWB 1OAKH 4ODSL 4YZFE 3W9EB 1L9NA 1QKZL 3D87B 3L5XL 2X4SB 1MFDL 1J1PL 1MY7A 1UKTA 4JVPA 3GMPB 2R8SH 1JYWA 4LSTL 1P84K 2N1KA 3RVTD 2Z91A 4K8RH 1UH2A 2VLKB 1B0GB 4I3SL 4KHXL 5ANME 3ZDZF 2Q6WA 1LO5B 1YJDC 4ZAKC 5HGAB 4R97B 4HIXH 1IC4L 1YYMH 3BFOA 1CF8H 3V6OE 1XIWD 3WFEL 4NPYA 3ZTNH 3O2VH 1AI1H 3IKKA 4UINL 4OZ4A 3RVXC 1HZHL 2QLVB 2W60A 4Z7UF 2Q3AA 1Q0YH 4XC1H 2EIZA 1WBZB 3ZSSA 1QR1A 4IMLA 1NCBH 4HG4J 5D7IA 2JK5A 3DECA 3I6KB 4RMSA 5J06A 2V17L 4Z5RB 1I1FB 4G9FE 3GRWL 1U8JB 5DS8A 1LO4L 5FKPA 4UT9H 2HTLC 5I1EL 1UWXK 4MAYB 1EEQA 5TE4L 1UVQA 5HI5C 4P2OB 2H1PH 2K7QA 1A9EB 2DTSA 2Y07H 4QXTB 2PW1B 4GMSL 1C5BL 4I9WD 3P9WB 1MQKL 3OB0H 3QNZB 4HK0B 2EH7H 4YFLF 2VLRD 4MCZA 4LLUB 4EI5A 3SKNB 3EJYC 4LDEB 4Q9QH 1CD0A 1NBQA 5LWYH 4GG6E 2XZCL 2LABA 5EU5A 3STBA 2R56H 3D1MC 3VH8A 2GAZB 5DI8B 2YC1A 2FX8L 3NCYS 3PJSB 2AAVA 4MDIA 5D2NE 1Y0LA 2NZ9D 5HYJB 3FFCD 3OR7A 4PLOB 1RIVL 2PCPA 4NJAH 3GJEA 1CG9A 2ICWJ 2R4RH 3GSRA 1K4CB 2GSGA 1CICB 3MLPA 3MV01 5D7LB 5FYLL 2DLEA 4KJQD 3IXAB 1ACYH 4AMKL 1JZ6A 4O00A 4RSVA 2Z31B 5KVGL 3P30H 4LHUA 5H8DA 1KTRL 3L5HA 2FWOA 3VDCA 4I3RH 5E8PA 1FNEB 2FHFA 1FH5H 4YJZL 1ES0A 2XACC 4UB0L 3VMNA 1IL1B 2ADIB 3RWIA 1I9IL 5DD5H 3QIBA 3OBAA 1CL7I 4MXQD 4GBXB 5GJSH 3WIHL 4M7LT 3OJMB 4DEPC 4M03A 3OPZL 3ILQC 3UZVB 4Q97A 4M7KH 4HUUA 2AJZB 2HWZH 3EOBB 4OKVB 4JHAL 3RWCA 1RUKL 1D5XA 1MCPL 3WS3B 3INUH 3Q6FA 8FABA 3DSNA 3T2NH 5F1KC 1A6AB 4XNXL 2QQLH 5D1ZD 2KZWA 5HHQA 3BP7B 1IGCL 1U8HB 3E1F1 1QFWM 3DV4A 5TQ2L 3ROOB 4PGCA 2BVOA 4HUMB 1E4WH 2LQRA 7CGTA 1NEUA 5TQ0H 1U8QB 5DJ8B 3RWCB 4WTZG 3I84A 1N5YH 1IM9B 3HE6D 4PJBE 1JWMB 4PRPB 1BQHG 5FK9A 2D0FA 1FAKT 4I9WE 3TO2B 5MENA 2VYRE 1FG9C 3U0TA 1RUKH 2EYTB 5DJDB 1I8KB 4RDQG 2F54E 4PREA 4YQXH 2HKFL 3CZJA 5MHSD 1A22B 1AD0B 1MREH 1OLLA 4WVRA 2BVTA 3O3EB 3O3BA 1WWAX 1KG0A 1U8LA 4KXZH 4ELMF 1MJ7L 5EULV 4LK4A 3SE3C 3O3EA 3ULUL 2IH1A 1ROWA 3CMOH 3IS1X 4N8VB 2B7DT 5FYKL 2WUCL 4BFEA 3DXAB 5D2LA 1XGQA 4TYUA 2GSGB 5J9PA 3OGOE 1Z9MA 4J3UA 3MOBL 1M6OB 1SVCP 1I8KA 2Z0BA 5HHMB 3C09B 3IRZA 2VZVA 1YMHA 4TUKH 2UZIH 4KI5D 5SV3A 1H8OA 1KCSH 1W72A 3FT3A 1LO2L 3I9GH 5F7NC 3L5IA 3T3PF 5DMIH 4EEEA 3ETBF 1DUYA 4RMWA 3K4ZA 1F11A 3PP4L 1TTUA 1SM3L 3QUZC 5FEBA 3DRQB 2FIKB 4WCYH 4Y5YC 1WVZA 3LHPL 5BJTA 3AXLB 3MRQB 5HHQB 3MBXL 3ZKMC 4M00A 2IFGA 4H88L 5JO5B 3KPPA 4CN6A 5C09E 1WBXB 1ZHBA 1ZMYA 4E41B 1QBBA 1OPGH 1MHEA 4BKLB 5J3HC 4KROB 4LLVB 4BKLA 4NQED 3S4SA 4O2CB 5DS8B 3BPNC 5ITBL 1E6OH 3ZYIA 3LS4L 4GG8A 3B5TA 4XB8A 3HG1D 2C3VB 1S9VA 2OXGA 4M1CC 5D7JB 2ADGB 5EOCL 4YWGH 3U7WL 3TIDA 4JLRA 2NYYC 2B5IB 4RMUA 4YC2C 3V7AG 1DBKL 2FD6H 3BP7A 4XCCL 4NOFA 5IFAL 1AO7A 5BOPA 1CE6A 4OLXL 4ZUWB 4M7ZC 5HJ3B 4OGZA 4AQOA 1WBZA 3O11A 2VH5H 3IU3B 5DC0A 3TVMC 3TVMA 3H9SB 4DGIL 5GS0C 1JPFA 3STZB 3WLWC 4FXGA 4PY8I 3B9KA 1ZV5A 1MY5A 2DM4A 4ZPVB 1LGVA 4HXBL 4NKIL 2DLFH 3HZMB 2DLGA 1L0XA 4MA8L 4UTBL 3BKJH 4G6AC 4MD4B 4J4PD 3DRTA 4WW1B 5I75B 4XBGA 1J11A 4LSQH 2VDKH 1FNEA 5INDA 5I1GH 2BNQE 1N6QL 3G6AB 3EO0B 3RQ3A 2A83A 4PRBB 4Q6IB 2PYEA 3O4LE 4WDIA 2X1QA 3MRHB 5EOTA 4KJWD 2IH3B 4AT6A 4KUCF 4PBXA 4PGBB 3O3BB 2H8PB 1H3UA 3G9AB 4RGND 1JRHI 4DKEH 3GBNL 3SY0B 1I3RA 1PKQE 5ID1A 4TULH 2JTDA 4Z8FH 1A2YB 5TE7H 3TO4C 5HPMA 5CBEB 3BO8B 3VXSB 5T3XD 4M61B 4QRTB 4MA3A 4BQ6A 5J6HA 3TFKD 1YY9C 5E2UH 3RJDA 5GS1B 3EOTL 3U30C 2DTML 3QI9C 4RQQB 1CDYA 4LF3B 1UKSA 1UT9A 4MXWH 1M1SA 1NFIA 3ULVC 1RMFL 3BKMH 2V7HB 4LSRL 2V2WB 5FDWA 4K9EC 5F1IA 2BZDA 4ODHL 1KUMA 3C5ZA 1OSPL 3QUXC 5I0DA 1AKJD 1A6AA 4J3TA 2BSED 4OM1L 4CVZB 3W0WD 2W9DL 3BI9X 1LNUB 3Q6FB 2QR0B 2GI7A 3I02A 4G5ZH 3IJSB 3TESA 1MF2L 2H2PD 3MBED 3HG1E 4K7FB 3FO9B 5D2LE 3V4VH 5GGRA 3RPIA 4KRMB 2HWZL 4BFGA 2ENSA 3HPLB 3DI3B 1NEZA 3L5WA 5K33A 4F7CB 1HOCA 3B2VH 3D25B 1BQHB 1LEKA 4F2MB 4TNVF 5IQ7H 4XRCA 3U9PL 3R0NA 4HWUA 5DHVH 4FNLL 2D3VA 3TYFA 1OP5K 1RZKC 4Y16D 4KZEL 2YMXH 4HUKB 3REWB 4WW2F 2VJXA 1W2KT 4G8FA 2X4NA 3GSWB 5EZLA 1IAOA 4I13B 2DLHA 2VDRL 4M62L 2HMIC 1LO5A 3CFEB 3TA3D 4JEGB 3FFCA 1OY3B 2VWEC 2ZSWA 4LU5H 3PF2A 2F54A 5MEQB 2IALA 2XRAL 3MUJA 1UYWH 1H3PH 1RJYA 2BOBA 2C5DC 2GW5A 4P2QB 1PX4A 5FF6B 3V6BR 1MEXL 4U1LA 1DQML 1U3HD 4FQHA 4M02A 2XWBA 1X7QB 3BGFB 4JG1H 5E9DA 4OZHF 2VLLB 4M43H 2EZ0D 4GW1A 2PTUA 4Z7WA 2NY3D 3NH7H 5D72L 3TLRA 1CFSB 5LXGH 4RRPA 4JKPH 5EUOE 4L3CB 2G60L 4DQOL 2V9TA 5JR1H 3EAKA 5HYIA 3H0TB 2AABH 1N59B 2GQHA 1YNKL 4ZXBB 3VI3F 4WO4C 3DMMA 1UVQB 3RL1A 4ZXBA 1R5VB 5BVJB 3HZKB 3O9WA 1JRHL 2JCCB 3LV3B 2FEDC 5IP4A 5L9DL 2AJ3A 1ADQA 2ZG2A 4QOKB 3L9RA 1ZVYA 5TFSL 4XVUC 3H7BB 2QJDA 2EO9A 3VXUB 3MV9B 4WCYL 3VRLE 1CQYA 2EXWC 3U0PB 4PJ7B 4ZSOB 1U8PA 4HGKC 5FUCE 4PIRF 1BIHA 4L9LC 5J89A 3FL7A 2A73B 3CD4A 1RJCA 4FFZH 5GSVB 3ZTNL 3SDXB 1QFOA 3ZKXB 3VFOB 5C8JB 1JFQH 5DQ9B 4NN6C 1A7PH 3DVFA 3QDGD 2X4NB 3QR2A 5E2WH 2HN7B 4GXVH 4PJAF 5I18H 5E2WL 4P46B 5DMKB 3P40A 5C0BA 4LPXA 2DJ4A 2M2DA 5C0BB 4ZO6A 2OZ4A 3MBEB 3VWKA 1HXYB 1MHHB 2A6KA 2CGRL 3HAEB 3HLAB 3GMMB 3KPMA 3PV6B 5ESVA 1IGJB 5HI4D 1EA9C 5HYFA 5C9JA 1CE1H 1EJOH 4GH7B 5FB8B 4MJIB 1F3DH 1LDSA 1H5BA 3OXSA 2HKFH 3UTOA 1YNTB 1RHHB 1J7VR 4NO3A 1J9CT 4UAOC 4XNQA 4X4XB 4EIGB 4S0SD 2GJJA 4PLKC 3EJZD 5IB2B 3ELAT 2NY7H 4OFKA 4QGYA 3IVKA 3OKMA 2AK1H 4XMKH 5IROC 4ZSOA 1T1ZB 2BFVH 5E8EA 5DRXA 2NY0B 3ZT5A 4U6YA 1VCAA 4LLDA 3WIIL 5JOFB 4J3SA 4XAWH 2YK1L 4PJ9D 2BXZA 4NC1C 2X4OA 4RQQA 1FNGA 3TCXA 3VXRB 1DBAL 5DMJB 2E8YA 4NNPL 2ESVE 4NO2B 3EYOA 4N5ED 2W1NA 3VE0A 1G0DA 1WCBB 3PWVA 3WEXA 5CJQL 4HDIB 5BXFA 3TYGH 5FOBB 2QQKL 1FC2D 5DFVC 4S1SL 5DMIL 1QSFA 1G7JB 1GIGH 2VABB 3AU1A 4NUJB 4RRPG 5GIRB 1I9IH 5DD5L 1TCRA 1K8IA 1QHOA 4ZUTB 1CCZA 3MRHA 2YD5A 3OXRA 1MJ7H 4NQCD 4P5TD 5DA0B 3MRKA 4JM4L 5T33L 5HYSG 4NBZB 5DJYB 4GW5A 4FQXC 2DKMA 4NQEE 4PJGF 1MREL 1UJTA 3LN9A 4PP2B 2XA8L 1KEML 5D6DA 2R1WB 1S9XB 2BVEA 32C2A 5DJXB 1J8HA 1FL3B 4TNWF 4NOBA 4PUBL 2ATPA 2W65A 3ARDB 5E8OA 3KJ4B 5KVDL 3PUCA 4IBLT 1Y18A 1CWVA 3DYPA 5A2LH 4IOIA 4XVTL 3MCKB 4ODVL 5EZLB 5GZOD 3QEGH 5I74B 1YN6A 1P4IH 1E28B 1A6ZB 2D4FA 4UTAL 1S7QB 1E28A 2AS5M 3GMQB 1JTOA 1I3GH 1HNGA 1TFHA 5LGHH 2RCSH 2ZOKB 4RAVA 2E7CA 4I0CC 3B9VA 1JPTH 1BD2A 4N68A 4P99A 4TNWK 4O5LL 1AKJA 2R2BA 2XN9A 3QUML 2W9LA 4IS6A 4LGSB 4KDTC 4YFLI 2C3HA 1HQRA 3B9EA 2FECI 2P47B 5I1JL 4N8PA 3KLAB 3VXUD 3PWLA 3BW9B 2ATKB 4ZUTA 1NCAL 3DX7A 2A74A 1S5IL 2CKBB 3GIVA 1WBXA 1ZHBB 3CDCA 2QSVA 3PDGA 2YPKB 5F88B 2AJUL 5HGGS 2JCCE 1J8KA 4JR9L 4HGMA 3PDDA 3V0AC 4I3GA 5IBTH 3C5ZB 3WEXB 4JFHE 4NO5B 3RUGF 4M4RA 1KPVB 1DCLA 2FIKA 3G6JE 4JM2A 1IRAY 1RJZA 4RGMB 4KK9C 4X6DF 2HJFB 2X09A 1JGEB 5GSRB 4CU6A 4FFVC 1I1AA 3SE8H 4TULL 3W82A 4ZFFA 1OGAD 1W0VA 4D0CB 4XZUB 1CXFA 2IAND 1N3NA 3QCTH 4FTVB 3U36B 4FQCL 2DRUA 4R90L 2FL5A 3L3KB 1MRDH 2B39A 2QQNH 4RGOL 3SCMA 3STLA 4JGUA 4N8VA 3QQ3B 5GGVH 4YGAB 5BZDB 5EUOB 4GQPH 1ZHNA 3CVHL 3G5YB 1UFUA 2ESVB 4PRAA 5FXCH 1XR9A 1KYOK 4AT6B 4M7LH 1IC1A 1YNTA 2N4IA 4NO3B 4DJMA 1NC2A 3BUTA 1ED3A 2GK0B 1AGDB 3HE6B 2WWKO 1AXTH 3OAZK 3C60A 2A38A 3WNMA 3VGDA 1IEHA 4OQTA 1E4XI 1XEDA 1HI6A 4WV1C 3QPXL 1VKXA 3WN5C 5D1ZB 2VLKE 3FZUD 3MRLA 3OKLB 1XAUA 1FNSL 4CNIB 5GRUL 1S7SA 2FGZA 2Q8BL 1I1AC 3B9KB 2FZ3B 1QG3A 3PWPB 3TN0D 1QBMH 1GZPB 4NZUL 4FQXA 5C92A 3Q5TA 3DTXA 5C0CD 3V7AE 4P2RA 1DN2A 4OCRL 1A7OH 3ESUF 1AD9A 1JHLH 4NKDB 4YC2B 5I1EH 4X8XA 3OQ3B 1MCLA 4WI9A 5BO1L 8FABB 2OSLB 1DUZA 3DETC 1U8PB 4S1RL 1C1EL 5E6IA 1U91B 1ZA6B 5ADOL 1NAKL 4BM7A 4H1LB 4KROC 5EWIH 2DDQL 5EO0B 4XCNB 5T5FH 4H8WL 1WJ3A 2YPVH 4NHUB 4MNQA 4YGVB 3ME0A 2QV2A 2OP4L 1DLHB 4LLMB 3L7FA 1JK8A 2QSQA 3OX8B 3MO1A 2IFFH 3GMOA 4DW2L 1N0LA 4Q2ZA 1O0VA 4RAUB 4KDTA 3NCCB 5C07E 1CVSC 2P44B 3TV3H 5C0JA 4HWZA 1Q9WA 4K7PY 5BRZD 2H6PA 3QHFH 3ARBA 4YDJA 3W5MA 3GSQA 5C2BH 2CO6B 2H2SD 2GT9A 3RUGA 1S7UB 4NFDA 4F7EB 4HH9A 5F7LB 2QQNL 1XT5A 2P5WA 3FKUS 6FABH 1DQDL 3FT3B 5HYEA 3L95B 2XT1B 2WWMD 3ARWA 3AY4C 1YMHB 1NAMH 4ZFZA 3GSNB 4I0KA 1NFDA 4MQ7A 4POZC 2P8PB 3E3QC 3PHQA 1D6VL 5ESAB 2VLRB 5T3ZL 1LK3H 4KKLD 4EQ3A 4R96A 4KWUA 3FQUB 4HKJA 4N9GB 4BZ2H 4UZGA 3KDMA 4HUXA 1Z9OA 3VFWB 4A6YA 3MRMA 4H5SB 3OKKA 4NYLB 4NWUH 1YNKH 3SKNA 3AREB 3O0RH 3C6SA 3EHBD 3QT2A 4WFFE 3GB7B 4KVCL 1KJVA 2ZCKL 3CLFL 5IB1A 1BQSA 1LE9A 3GK8L 5EC1B 3D9AH 1LD9B 5K59F 3IFLL 2I9LA 3O3AA 4DN4L 5E2TH 3ZE0E 1K3IA 3VFMA 4MAYA 1N26A 5FK9B 4JFEE 4TTGA 1KOAA 4NT6B 4QWWC 1ORQB 4C56B 3TWCH 4YXKH 3VXPB 5ECJE 3F7VA 3KPRE 3ZE2F 6CGTA 5EU6B 2ZPKH 3TBYA 2FBJL 4NQEB 3V2AR 2IQ9L 5TPWL 1A3RL 1G7PB 2FIRT 2Z8WC 1G7HB 1NGQL 3O6ML 4JANA 4G43B 1IZJA 5H35B 5J7CC 3NOIA 2OX5A 1NSNL 4YK4B 4Y4FA 4PV9A 4OLYL 3UAJD 5KBNC 1FJ1A 2EDDA 4PRNA 3CK0H 2EDNA 4HUWB 3SN6N 2AV7A 2UYLA 2B8OT 3MLWH 4K3EL 4S1QL 2DWEB 1QYGL 1MCIA 2Z92A 1RZKL 2Q86A 4YR6B 1YECL 2X4UA 3QUYD 1RZKH 5F8QC 2VLKA 2L4OA 5E9DD 3U1SL 1F4YL 5MEND 1HHJB 1GGIL 3QIBB 4QHKJ 2AV1A 2VXQH 4RFNC 4OCXL 2E6QA 1UWEH 3L3DB 1U3HA 2KUTA 1S78D 2OR9L 1WIUA 3OR6A 4WO4A 3VGHA 2VL5B 1NAML 4KAQH 2XG5A 3Q6GL 1OAUH 3BZFB 1DQDH 1T1WB 1DJSA 3UO1L 1NGQH 3A6OA 1TVHA 3V4VL 2FX8H 1RIHL 1JPGB 5F1NB 3VI4F 2D7MA 3H9YA 4JQVA 3BZ4A 2BSRA 4KVCH 5B38A 4QT5B 5IOPB 3HZYB 3LQZB 3P9MA 1KCLA 3HZYA 3Q5YA 5HYJA 5IOPA 4DN4H 3SBWA 5FO9A 3BKCH 1ZHKB 5JTWA 1R3KB 3C2AH 5IEKA 3LRHA 3S35H 4K7PX 2O61A 2YA0A 4K3HA 3NZ8A 4ORGB 4MCZB 5KVGH 1OP3H 4ZPVA 4KQ3H 3F7QA 3STZA 4OCNC 4Z76A 1U95A 4ELMB 1WQVT 1R0AL 4MZ3A 2FBOJ 4G9DA 1AIFB 3O6FD 4MAYC 5C0JB 4Y5XC 5BS0A 3AVEA 3BPLB 2YPLE 1NFKA 4JY6B 3S88H 4NGHL 3TNMA 2YN5A 2DF3A 4W6YB 3I3EA 3IAGC 4CU8A 5EORH 5B8CC 3IJHA 2CH8A 2H45A 1H15A 3P2TA 2Q76A 4YDVB 5D7IB 2W0LA 4OZGE 2ZSVA 1YEJL 1FBIH 1ZT1A 3GSNH 5I16A 2LV4A 2VXUH 4WEBH 5DK0A 5D6CB 1G6RA 3WYRA 1LE9B 4H0GA 4HGWA 1ZXQA 1JL8A 2HT3C 5IB4A 12E8L 2MFNA 1F90H 4X7FC 4OZFA 4UOW1 4HV8A 4MNQE 4YEEA 4FABL 4N0UA 2VSCA 3MMEA 4BZ1H 3QUYB 5BZWB 3IDGB 2H32A 3MRFB 3MLVH 1AY1H 2HFGL 1M71A 4X6FA 2DM7A 2YSSA 3CFCH 3WN5B 3JXAA 3FB6A 5EORL 3VGAC 5A2IH 1T03H 2VTFA 2OK0L 1JUFB 2F19L 3NPSC 5F3BA 2LE9A 4XNYL 5GHWL 3BEWB 3WNLA 4MWFA 5DD6A 5EPMB 5DEZA 5D5ME 1OW0A 2BJMH 5IVXE 3AROA 1SEBA 5TJWK 3MTRA 4U6XA 3W39B 3OJVC 2ERJC 1UJ3A 1IGFL 4QRPB 3MXVH 3T0DA 4S11A 1KULA 4M6NH 1OM3L 4KHXH 3REVA 3JWOH 1F2XK 1TCMA 2R9HC 1QFPA 2N7AA 1YEFH 4H0IA 1JHTB 2MMXA 1VGEL 3N50A 4JFDA 3UDWA 1C08A 3O4LB 3EFDH 3VD7A 3HNSH 2EYTA 4U3XA 2C9AA 4FQ1L 3U0TB 4NO0A 3HC4H 2Z4QB 4U1SA 1JZ5A 3UBXA 3MLYL 3VXTB 3FQTB 3H42L 2P5WB 4N5UA 2UUDK 1I1AB 1QR4A 2IPUK 3B9KC 4F7EA 5KZCB 1JGEA 2DJUA 5GSRA 3RZCB 2MKLC 1XGTA 1ZA6A 4U2ZA 4Z7WF 2P48B 1CXLA 4K2UL 1U58B 4L4VB 3LMJH 4LKXB 5K9OA 2H26A 5GGVL 1JF6A 4ZDHA 1PGRB 1T1XB 4XB7A 2NQCA 2QQLL 1L7TL 4F57H 4R26H 3ARQA 1JZ7A 4OIBA 1JGLL 1TJIH 2APFA 4Y1AE 1YEGH 3UPAA 3ULUH 1X5JA 3MFFA 3QCTL 2J8UF 4OCWH 4GAGL 1VPOL 5I1AA 1TJHL 4CDGC 1IAMA 4K94H 4OD1L 4MB3A 3T0ED 1W0YT 4HC1L 3CH1B 3ARTA 2IBBA 2B20A 5A3IC 1QBLL 1ZVSB 3O6FB 1ZLUK 5TQ0L 1CDHA 3EYFB 4PG9A 1CGSL 5T1KB 3C60B 4F7TB 3RWJB 4DZBA 4ZNCD 1BIIB 1S9YB 4MJIE 4JQXA 3VFUA 2OMNA 2AJVL 3FHQA 1X6LA 2AJVH 5KSAB 5D4QA 3VXUE 1RUPH 1YN6B 1WK0A 2CDEB 4GG6B 4XXCC 4LLYA 4L4TE 1PKQA 3FONB 4J3WA 5DWUL 3RWHA 3SEPA 4O5LH 3F5WB 1CLZL 4ZUUB 5I15L 2IADA 4EN3A 4PGDB 2ITDA 4X6DE 1OQXA 2X6MA 4S2SA 3DURB 1ZVSA 3MRNB 4PV8A 5E6ID 1MFBH 4BFBD 5E1AA 4OZGB 2Q8AL 3RZCC 4HX1B 1HIMH 1WITA 2XZCH 3FT4A 3PWPD 5MI0B 3LKOA 4O9HH 4LASH 1TQBC 3ULVE 1G7JA 5FECA 4L3AA 2RHEA 1ONQB 4YXHH 1FO0B 5D2NB 4WFED 1S7RA 4B7LA 3KR3H 5A1AA 2EKJA 3BVNB 1VFAB 4HK0A 4IDLA 4CDHA 4JG0L 5JHDB 2E7BA 4DOHB 2FL5B 1CFBA 1RZFL 1T22B 1N3NB 4RNRB 2EEBA 4GLRH 3V8OA 4OJFH 1KBGH 5GHWH 2ESVD 1PEZA 5D1XA 4P4RA 3MRGA 2F74B 2VWEE 1T4KB 3TYGL 1IAII 1UB5A 3C60D 4ODXA 3HUJE 4WI2A 2AI0L 2ARJB 2JIXD 4NRXA 4XP6L 5CZVH 2F8OA 2Q1EA 4KK5D 1GHFH 4AEIL 5ESQA 5EO9A 3DURA 1A14H 4BA8A 2ENYA 3NCJL 5KANG 2YS4A 4PD4K 5KANI 2YPLA 3OHXA 1NDGB 5TE6H 1WCQA 1BOGA 1C5DB 4MD0A 4NSKB 5IVXB 2YPVL 2D0GA 1QO3B 1X5FA 5IROA 1FL5A 1RZ7L 4PR5A 4NPYB 3V5HB 5A2FA 1CLYH 1Q9KA 3QIUD 3KPTA 3QDHA 1MHPH 4U6XB 5D1QB 2NLJB 2VDLL 2VOTA 1J1XL 3HAEG 1PFCA 5DD1H 5TF0A 3ISWA 5SWZB 2C7UA 5A43C 3C5ZD 1DBML 5FB8A 4YWGL 1H8NA 2OI9C 2ATPB 2W65B 3ARDA 3KPMB 1MAKA 3GM8A 4GRWE 4ENEC 2IQAB 4KQ4L 3O6FA 5HY9A 4BSVB 4PGDA 1UXWA 3MSPA 5DFWH 3QFJE 2ZUQB 4GO6B 4OZHE 4PJ5A 5J6GB 5EH1A 2C1OA 3HB3C 4UT7L 1IC5L 3TBWA 3S37X 3V5HA 2BY3A 1A7OL 2ZOLB 5IR1A 1CYGA 3RWDA 1P1ZA 3OKNB 1SMAA 1Y18B 2VABA 1TJGL 3C8DA 3O8XC 1GGCH 5E5RB 5E6YA 2DQTL 2YPLB 1U8IA 4OF8A 5KN5A 4X98B 3UPRA 2J7LA 3CFIC 4O9HL 4L4VA 2R4SL 2BOCB 4JKPL 3QJFB 5IQ9A 4PTUB 2Y5EA 3OXRB 2CIKB 2Y5TB 3LHPH 2L7JA 4Y5VA 3SJVA 5JDSB 3FHAA 5BRZE 1DBBL 1DBJH 4GG6F 1AQKL 1J5OH 2XWJA 4L8SC 2HLFC 3MFFB 2VUOA 4LOUD 4NUJA 5J57B 1PQZB 3MCG1 1HHHB 2X70A 3BP6B 5EZIL 1ZWIB 4U6YB 2OQJA 5K9QI 4G80B 1P7KB 3NABH 3DPBA 5D2NA 3BOVA 2BY2A 1HSBA 1OTSD 3U6RB 4I0PB 5HHVL 3WD5H 3SDDD 4M93B 5C7XH 5FYJD 1D9KC 3I2CH 4HPYH 3TPUB 3H0TA 1DANU 1QRNB 3CUPA 2WUBL 1GOHA 1NUGA 3LKRA 1BQLL 1X5KA 4PJ8D 3RRQA 4KY1H 5C9JB