3LF4A

Crystal structure of fluorescent timer precursor blue102
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
NMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorescent Timer Precursor Blue102
publication title Understanding blue-to-red conversion in monomeric fluorescent timers and hydrolytic degradation of their chromophores
pubmed doi rcsb
source organism Discosoma sp.
molecule tags Fluorescent protein
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3lf4A00
3CFHL 2G16A 2GW4A 2A52A 2A50A 2G3DA 2G2SA 2G5ZA 3LF4A 5EXCA 2A56A 3CFFL 3CFAL 2A54A 2A53A
chains in the Genus database with same CATH superfamily
3IOEA 2GR8A 3INNA 5EXCA 3UK2A 2A56A 2RETA 3LE8A 4MUNA 4BHRA 2G5ZA 2G16A 4MQ6A 3COVA 3EMOA 3IMCA 3IVGA 2A7XA 5KWVA 4MUFA 5BW0B 3IOBA 2I52A 3CFFL 3IUBA 3CFHL 1N2JA 3AG5A 2G3DA 1N2EA 2A53A 4DE5A 3IVXA 2GR7A 2A88A 4MUIA 4MUJA 2GW4A 2A86A 3IMGA 2A54A 4DDHA 3COZA 2EJCA 3AG6A 1IHOA 1MOPA 2IECA 1N2HA 3IODA 4EFKA 4FZJA 4G5FA 3UY4A 2A84A 4MULA 4MUHA 3ISJA 4EF6A 4MUKA 4IXJA 4G5YA 3QTTA 3MUEA 1N2OA 3IUEA 2A50A 3COWA 3IMEA 3HL6A 3CI0K 4DDMA 1V8FA 3IOCA 4MUGA 3Q10A 2A52A 1N2GA 3LF4A 2OGFA 3N8HA 3MXTA 3CFIA 3UA0A 1N2IA 1N2BA 5G2FA 3CI0I 4MUEA 5HG0A 1UFVA 3CFAL 3IVCA 2X3FA 2LMEA 3COYA 3Q12A 4DDKA 2G2SA
chains in the Genus database with same CATH topology
3IOEA 3INNA 5EXCA 3UK2A 2A56A 3LE8A 4MUNA 4BHRA 2G5ZA 2G16A 4MQ6A 3COVA 3IMCA 3IVGA 2A7XA 5KWVA 4MUFA 3IOBA 3CFFL 3IUBA 3CFHL 1N2JA 3AG5A 2G3DA 1N2EA 2A53A 4DE5A 3IVXA 2A88A 4MUIA 4MUJA 2GW4A 2A86A 3IMGA 2A54A 4DDHA 3COZA 2EJCA 3AG6A 1IHOA 1MOPA 1N2HA 3IODA 4EFKA 4FZJA 4G5FA 3UY4A 2A84A 4MULA 4MUHA 3ISJA 4EF6A 4MUKA 4IXJA 4G5YA 3QTTA 3MUEA 1N2OA 3IUEA 2A50A 3COWA 3IMEA 3HL6A 4DDMA 1V8FA 3IOCA 4MUGA 3Q10A 2A52A 1N2GA 3LF4A 3N8HA 3MXTA 3UA0A 1N2IA 1N2BA 5G2FA 4MUEA 5HG0A 1UFVA 3CFAL 3IVCA 2X3FA 3COYA 3Q12A 4DDKA 2G2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFH L;  2G16 A;  2GW4 A;  2A52 A;  2A50 A;  2G3D A;  2G2S A;  2G5Z A;  3LF4 A;  5EXC A;  2A56 A;  3CFF L;  3CFA L;  2A54 A;  2A53 A; 
#chains in the Genus database with same CATH topology
 3IOE A;  2GR8 A;  3INN A;  5EXC A;  3UK2 A;  2A56 A;  2RET A;  3LE8 A;  4MUN A;  4BHR A;  2G5Z A;  2G16 A;  4MQ6 A;  3COV A;  3EMO A;  3IMC A;  3IVG A;  2A7X A;  5KWV A;  4MUF A;  5BW0 B;  3IOB A;  2I52 A;  3CFF L;  3IUB A;  3CFH L;  1N2J A;  3AG5 A;  2G3D A;  1N2E A;  2A53 A;  4DE5 A;  3IVX A;  2GR7 A;  2A88 A;  4MUI A;  4MUJ A;  2GW4 A;  2A86 A;  3IMG A;  2A54 A;  4DDH A;  3COZ A;  2EJC A;  3AG6 A;  1IHO A;  1MOP A;  2IEC A;  1N2H A;  3IOD A;  4EFK A;  4FZJ A;  4G5F A;  3UY4 A;  2A84 A;  4MUL A;  4MUH A;  3ISJ A;  4EF6 A;  4MUK A;  4IXJ A;  4G5Y A;  3QTT A;  3MUE A;  1N2O A;  3IUE A;  2A50 A;  3COW A;  3IME A;  3HL6 A;  3CI0 K;  4DDM A;  1V8F A;  3IOC A;  4MUG A;  3Q10 A;  2A52 A;  1N2G A;  3LF4 A;  2OGF A;  3N8H A;  3MXT A;  3CFI A;  3UA0 A;  1N2I A;  1N2B A;  5G2F A;  3CI0 I;  4MUE A;  5HG0 A;  1UFV A;  3CFA L;  3IVC A;  2X3F A;  2LME A;  3COY A;  3Q12 A;  4DDK A;  2G2S A; 
#chains in the Genus database with same CATH homology
 3IOE A;  3INN A;  5EXC A;  3UK2 A;  2A56 A;  3LE8 A;  4MUN A;  4BHR A;  2G5Z A;  2G16 A;  4MQ6 A;  3COV A;  3IMC A;  3IVG A;  2A7X A;  5KWV A;  4MUF A;  3IOB A;  3CFF L;  3IUB A;  3CFH L;  1N2J A;  3AG5 A;  2G3D A;  1N2E A;  2A53 A;  4DE5 A;  3IVX A;  2A88 A;  4MUI A;  4MUJ A;  2GW4 A;  2A86 A;  3IMG A;  2A54 A;  4DDH A;  3COZ A;  2EJC A;  3AG6 A;  1IHO A;  1MOP A;  1N2H A;  3IOD A;  4EFK A;  4FZJ A;  4G5F A;  3UY4 A;  2A84 A;  4MUL A;  4MUH A;  3ISJ A;  4EF6 A;  4MUK A;  4IXJ A;  4G5Y A;  3QTT A;  3MUE A;  1N2O A;  3IUE A;  2A50 A;  3COW A;  3IME A;  3HL6 A;  4DDM A;  1V8F A;  3IOC A;  4MUG A;  3Q10 A;  2A52 A;  1N2G A;  3LF4 A;  3N8H A;  3MXT A;  3UA0 A;  1N2I A;  1N2B A;  5G2F A;  4MUE A;  5HG0 A;  1UFV A;  3CFA L;  3IVC A;  2X3F A;  3COY A;  3Q12 A;  4DDK A;  2G2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...