3LFTA

The crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
295
Chain Sequence
SNAKIGVLQFVSHPSLDLIYKGIQDGLAEEGYKDDQVKIDFMNSEGDQSKVATMSKQLVANGNDLVVGIATPAAQGLASATKDLPVIMAAITDPIGANLVKDLKKPGGNVTGVSDHNPAQQQVELIKALTPNVKTIGALYSSSEDNSKTQVEEFKAYAEKAGLTVETFAVPSTNEIASTVTVMTSKVDAIWVPIDNTIASGFPTVVSSNQSSKKPIYPSATAMVEVGGLASVVIDQHDLGVATGKMIVQVLKGAKPADTPVNVFSTGKSVINKKIAQELGITIPESVLKEAGQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Streptococcus pneumoniae
molecule tags Structure genomics, unknown function
molecule keywords uncharacterized protein
total genus 96
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04392 ABC_sub_bind ABC transporter substrate binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lftA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lftA02
4WT7A 5JS2A 5HSGA 4MQEB 3HO1A 4KK4A 1DRKA 3C3MA 2E4YA 3N0XA 5I4CA 1LK0A 4EGSA 4YLEA 3FDFA 5B3JC 4HNQA 3KLOA 6ABPA 4JASB 5KWSA 3BILA 2FVYA 2QXYA 3E3MA 4CBVA 1Z16A 3KTOA 2LIVA 2FMIA 3OO1A 1YIOA 4JB0A 1QQAA 1JF8A 4HYEA 1WETA 2HQRA 3C3WA 4YR7A 1ISRA 1XHFA 2TMYA 2JBAA 4EVQA 3LMKA 1USIA 3DBIA 2IKSA 4WWHA 4O1IA 3MM4A 3LUHA 4WUTA 5JNTA 4B09A 3DLBA 5IUKC 2WY2D 1QO0A 1XWWA 2B4AA 3C3KA 4N0QA 2QZJA 5D2CA 5KQPA 4RK7A 4OBBA 4OLAA 3FFXA 1EWVA 4D6XA 1JX6A 4G0YA 1TMYA 3H1FA 4PZ0A 4RKQA 1OXKB 1KRWA 1ZH4A 1ZN2A 3ILHA 3IP6A 1A04A 3GL9A 4MS3B 4PYRA 3GRCA 4G0PA 4XFKA 4YO7A 4JB2A 3F6PA 2HQBA 3KSMA 3I09A 2FQYA 1J56A 4NQRA 2MSKA 3RVPA 1W9HA 3M9XA 4YCSA 3MF4A 4UHKA 2MYUA 4O1HA 5TPWB 4DQDA 3SY8A 3H5TA 1Z12A 3I45A 4YRZA 4ZYLA 5JNVA 2AYZA 2BGGA 2F8SA 4TLMB 3MA0A 4E7PA 2B1JA 4MGEA 1JBEA 5IUJC 1ZESA 1NXWA 4IMJB 1P6QA 2PUFA 5DLEA 3C97A 5EWMA 4EUKA 4DADA 1NXXA 3NNSA 3QEMB 4TLLB 3LUDA 1L5ZA 4MQFB 4XXHA 1R8JA 2I6FA 1S8NA 2PMCA 1PEYA 4JA2A 3JY6A 4RY9A 3RVKA 1Z26A 3HEBA 4EYGA 2IPLA 4MS1A 2MYTA 3TO5A 2JVJA 1VLZA 4F12A 1ISSA 4LE0A 3DGEC 1FQWA 1K68A 4L85A 3CS3A 3OMXA 4RK0A 5DGCA 5EWMB 2A9OA 1CHNA 4KFCA 3Q7RA 1QP7A 1NATA 4H3KB 4LDZA 2A9RA 4RY0A 3DLHA 3JS5A 5CNKA 1E6LA 3HV2A 4MR7A 4RXTA 3HK2A 4N41A 4D74A 2ZAYA 4MRMA 1M5TA 4MS4B 4YWHA 1NXOA 4P1ZA 5DKFA 5KQGA 1JFVA 4PE5B 1ZDMA 2L2QA 4LRQA 3OO0A 2WJWA 2VUHB 4LE2A 9ABPA 2FTKE 3L49A 3KLNA 3FGZA 2E4ZA 2CHEA 1DBPA 2PL1A 2PJUA 2R25B 4N47A 1HEYA 1JFSA 3LUJA 2DRIA 3CRNA 1GCAA 1VRVA 4TN5A 5IX8A 3KYIB 2YHBA 1C4WA 1U8TA 1YMUA 3BREA 4Q6BA 3Q9SA 4KPYA 4F06A 1KGSA 4Z9BA 5IEBA 4KRFA 3LUFA 1EFAA 3NNDA 4EY3A 3LUAA 1AB6A 4IMIB 5DCLA 2QVCA 1ABFA 4G0ZA 4LDAA 3RH0A 4N0PA 4Z4IA 2E4WA 8ABPA 1ABEA 5KI6A 2AYXA 3JVDA 4MR9A 3H5LA 2RGYA 3O2QB 1QP0A 2JCGA 5TQ0A 4YS6A 5EWJB 2MSLA 4ZJPA 5FBHA 1DBQA 5IBQA 4QICA 4W5NA 4MQFA 1BDIA 3H5VA 1PUXA 2N9UA 1DCKA 1LBIA 2FQXA 5DTEA 3GBPA 4EYQA 3K9CA 5BQ3A 4YGXB 1USGA 3KHTA 4RY8A 2FLWA 5E3JA 3D02A 2IOYA 1KRXA 3E61A 4Z4EA 1DC7A 1SXHA 4KQ9A 4MLDA 2QSJA 3LUCA 1NXVA 2IYNA 4Q6WA 1LJUA 1P6UA 1SD5A 4Z99A 1DG9A 1NY5A 5CNMA 5JNRA 3SAJA 5EWLB 2QVGA 4O5AA 5JS1A 3F73A 4ETMA 1MAVA 4MS3A 2PUCA 3HXMA 4NICA 2PL9A 1LJLA 3RVQA 5T7BA 2JVKA 3OLYA 4LZLA 3A0RB 3OLVA 1EAYA 4RWEA 1EHCA 3GA5A 3GV0A 4HNRA 4IILA 3G85A 3HS3A 3CLKA 3Q7TA 2QW1A 1B00A 3OMWA 2CWDA 1A2OA 2GKGA 2A9PA 5HKOA 4KREA 3IPCA 4KNYA 1JL3A 3MQ4A 2QU7A 3CU5A 4N03A 3SQNA 3Q41A 2PUAA 2KYRA 4Z4GA 3JPYA 1GUBA 5ABPA 3EODA 1QO0D 3IP9A 1ZHHA 1E2BA 1QNLA 2LPMA 3IP5A 3H5IA 2FXIA 2FMHA 3ROFA 3OM1A 1RXEA 4F8JA 2FKAA 1JHZA 1JYEA 2ID9A 2MYPA 5BRJA 2R48A 1UDRA 5IEJA 2FEWB 4KQCA 3QLVC 2XDYA 3KYJB 4XARA 4XASA 2WWVD 1D5WA 1DP4A 4RU1A 1W25A 1H9CA 1MB3A 2FMFA 3IP7A 2M98A 4G0QA 1SXIA 4G0XA 4Q7EA 5KC8A 1E6KA 3LUKA 3QLVA 2FSPA 3IPAA 3TMYA 3FMVA 3NBMA 5TPZA 1DJMA 5KC9A 3CNBA 2PUGA 4E7OA 1MB0A 1F51E 1XHEA 3GT7A 1ZGGA 1SRRA 1ZH2A 1ZITA 3OLXA 4G0MA 5TQ2A 1PNTA 4D6YA 1JFTA 3LTEA 3RVRA 2JBAB 3LFTA 1E6MA 3CHYA 4KK3A 5JNSA 1GCGA 2VK2A 3LKBA 1SXGA 4ETIA 3RVSA 5CNJA 2NT3A 4MR9B 1U04A 4FB4A 1Z13A 5FBKA 3M6MD 2OENG 3JVIA 3N0RA 3QK7A 4MAAA 3HJFA 1NTRA 4JP1A 4G86A 1Z2EA 2FEPA 3EGCA 4ZPJA 2PKXA 2W42A 1U2QA 4JOQA 3QEMA 1YS6A 4KZKA 1D4ZA 2HPHA 1RPJA 3QEKA 1APBA 3UKJA 2M1ZA 4QYWA 4RKRA 4Z9AA 4RK6A 1DC8A 2FN8A 2JVIA 2IPAB 1Z25A 3HCWA 4KVFA 2CD7A 3H1GA 4OG2A 4RDCA 3RVJA 4NCBA 3CG0A 4IF4A 3Q7SA 4MQEA 5TQ0B 5FWXA 3RVOA 4XLTA 4RXUA 5KQLA 1ZAYA 1BVHA 1CEYA 5TQ2B 3G1WA 1M5UA 1USKA 2CHFA 3BRQA 4PEVA 4G0OA 5EWLA 1BDHA 2R47A 1VPWA 2FQWA 1QP4A 5C5CA 2NZVG 5B3JA 5KQMA 2PUDA 4L4UA 4P98A 4MR7B 2PAFA 4Y9TA 2IPNA 5TQJA 3CTPA 3JPWA 2ZWMA 5FWXB 3KS9A 1TLFA 4QYMA 4Z4CA 1Z2DA 3NNNA 1ZY2A 1RZRD 4H3HB 3N53A 1YTUA 2IDMA 1T34A 2Q5CA 3R0JA 1DCMA 4QPJC 3OM0A 4H60A 1PHRA 3P9YA 3QLTA 1D1PA 3BBLA 3URMA 2QV0A 5C5EA 5EWJA 1NXPA 3NHMA 5HM6A 6CHYA 1JYFA 1JDNA 1JWLA 1JLKA 1M2FA 2FLKA 3K4HA 4Z4HA 1MIHA 3LKVA 1Y1LA 3H75A 1QMPA 2J48A 3TD9A 2WMYA 1URPA 4EYKA 4IRXA 1FFGA 3A0UA 3N6VA 4FE4A 4GPAA 3KKEA 5FWYA 3B2NA 4YP9A 1PNRA 1JDPA 3EULA 3D8UA 3DZDA 2JRLA 3JTEA 1MVOA 1NXSA 2ID7A 3CZCA 3OLZA 3A10A 3CZ5A 4DN6A 2P4UA 1AB5A 5JNUA 2JB9A 1KMIY 3H6GA 4EVSA 2WB4A 2HJ9A 4WXMA 1GLGA 1LBHA 4LE1A 4MS1B 3M9WA 4N76A 1FSPA 1EWTA 3H5OA 1BA2A 2NUBA 3F7NA 4EYOA 2E4XA 2PLNA 1ZVVA 2OQRA 4RK4A 4M88A 4UHJA 2E4UA 1RNLA 2O20A 3QLUC 4PICA 4G97A 5BR1A 3HSYA 4S05A 1ZGZA 4ETNA 1TVMA 1YK1A 2LP4Y 1YK0A 4MS4A 2H0AA 4MRMB 3VNBA 4EVRA 3OQOA 1L5YA 1YMVA 1NXTA 1BDJA 1U2PA 2GBPA 3QELB 4Z0NA 3CKMA 5TPZD 3RVMA 3QLUA 4NV3A 3CFYA 1I3CA 3RVLA 2L18A 3C6QA 4KMRA 3O2JA 3TX6A 3T38A 1Z17A 5TE9A 4S04A 4WXEA 2NT4A 3O1HB 3EQZA 3N8IA 4OATA 2E4VA 3FFWA 1YS7A 2WJAA 3LOPA 2F8TA 2MYNA 1EWKA 2L17A 5BRAA 3H5WA 3MIZA 1P8AA 5GQSA 3H6HA 3W9SA 3NHZA 3OLWA 4MYRA 2GWRA 5IC5A 4XAQA 5ED4A 1A0OA 3I42A 4GNRA 3RVNA 4JAVC 3MYYA 4KV7A 2X7XA 3CG4A 3ROTA 2JK1A 3S99A 4RK1A 2LUOA 1K66A 2R4QA 1M2EA 3L6UA 2HQOA 4F11A 4RS3A 3HDGA 4OTZA 3KJXA 4RSMA 2NZUG 1PEAA 2H3HA 3DGFC 4MR8B 4OLBA 3GYBA 5CNIA 1BAPA 4ZMSA 5TPWA 5HQJA 3BRSA 1D2AA 1DCFA 2WRZA 2A9QA 2GI4A 4ML3A 2HSGA 3T8YA 7ABPA 3SG0A 4W5QA 3N0WA 1DRJA 3HDVA 4F3TA 1Z15A 3RQIA 4Z4FA 3HUTA 5JNWA 3O2SB 3H1EA 1D1QA 3O1IC 5PNTA 3O75A 4W5OA 4W5RA 3QX9A 1C0EA 3O74A 3TB6A 3LUGA 3Q15C 3QX8A 4MR8A 3HZHA 4TMYA 3EQ2A 3VNAA 1IIBA 1TM2A 1P2FA 3N75A 4RK5A 4MLCA 3A3KA 3ILYA 2QR3A 5T3YA 4W5TA 1FFWA 5FWYB 1GUDA 1CYEA 1Z18A 3KCNA 3I5AA 4MPTA 1DBWA 2FW0A 2PE5A 2RJOA 1RXIA 1YVUA 1VKRA 4FE7A 2V0NA 4IGAA 5CHYA 5IULC 3EAFA 2GX6A 3EDCA 1QKKA 4RXMA 3SM9A 4WZZA 2VUIB 4NCAA 2PUEA 3EJWA 5IUNC 3HVRA 2RJNA 2LBPA 3HM9A 3GWGA 2IPMA 2FN9A 3OQNA 2L19A 1QPZA 1OXBB 1TJYA 3SNKA 2VYCA 1FFSA 3IDOA 3GBVA 4YV7A 4RV5A 4RZSA 2PUBA 1QQBA 2YHAA 3FFTA 3O1JC 3T95A 1DZ3A 4ZMRA 2FMKA 3OQMA 3T6KA 5F64A 2P9HA 3QELA 1JH9A 3UUGA 3F6CA 4LX8A 2FEKA 3HUUA 3KG2A 5GOTA 1RZRA 3MMNA 1U0SY 2MSWA 1F4VA 4HNSA 2RDMA 3O21A 3UK0A
chains in the Genus database with same CATH superfamily
1XQXA 3P9SA 4A36A 4KO2S 1T9BA 3C6KA 3MB8A 4KSCA 2P9FA 3I9V1 2FQ1A 4PLCA 4MPPA 3IQFA 3QWFA 2CT8A 3W5HA 3JQCA 4W5WA 1SBCA 3SJ7A 2HD4A 2PSFA 6ABPA 4K9PA 5EKTA 3WIUA 1NVDA 4H1VA 4B3RB 3PGA1 1QGUA 5DWDA 3R5TA 4NH4A 3KTAA 5EJEA 4XW2A 1KARA 1BW9A 2X0KA 3RG8A 5FNZA 2WABA 3VUEA 4ZIRA 2HDWA 4G8DA 2FDCA 3IR5A 1MC5A 4RLQA 1SULA 5HIAA 1AH2A 5DLPA 2HQRA 4RF4A 1I4TD 4TT3D 2O6HA 3B1ZA 4BVJA 3A4TA 3RTEA 5LQKA 3OJ0A 3P52A 4E1VA 1XCGB 3B60A 3TPZA 2OWEA 2ZYHA 1N9GA 1NUUA 2XTJA 4US0R 2O2IA 1I8TA 4WHMA 2D4HA 1QGZA 2WP8J 2LTAA 3GUZA 1Z5VA 4YGYA 3WWZA 1K1EA 1B16A 1S2GA 4RTJA 2AUTA 4WCFC 1QIHA 2QZJA 3DMYA 3I2HA 4ND2A 1KK3A 4WN9A 2RB4A 2NZ2A 3SOPA 1JVNA 3DDWA 2AW3A 3FFXA 2PX4A 4D9HA 1HKUA 3IAHA 3PV0A 4I1OA 2WU4A 5EQTA 4F4HA 1NNEA 4AXBA 5LZ9A 3VU1A 3LE8A 4NOLA 3TQHA 1I9CA 2P8SA 3FZNA 1QC5B 3CE6A 4BQNA 1YU6A 4JKYA 2OV2A 3KSBC 4B40A 1XLUA 3DE0X 3FETA 3GCWA 4B3BA 1PWZA 1JG7A 4XGRA 1RYDA 2AV6A 4YAFA 3U48A 1XTRA 2NO5A 1E2EA 4KVGA 5JWRA 3CEHA 4ZCQA 4Y30A 4NECA 1J24A 3NHYA 5AKKA 5EP2A 3U7RA 1PR0A 4G0NA 1FNMA 2O2SA 5CD1A 2PDAA 3H5TA 5JNVA 4PLWA 1BDMA 4CEIB 1RHRA 2X7JA 1Z7GA 2H48A 4QPDA 5JIBA 3KBBA 4P81A 4V24A 1BNCA 1L7NA 1Y1SA 2W4QA 1IXYA 3IO5A 3C87A 4EK9A 1P6QA 4U2EA 4DT1A 1ORVA 4G3XA 4E0BA 3EDRA 1M6NA 2JD0A 2QTZA 2QYTA 3N7UA 1PG2A 3QG1A 4TLLB 3B1FA 1F0NA 4XXHA 3AUXA 4JUAA 3QU5A 3RRYA 1S8NA 4AY6A 5KJCA 2N0SA 3RVKA 1K7YA 2GCOB 2IPLA 5T4BA 3K6RA 3A1DA 1JDTA 4BFYA 1VLZA 3JQ9C 5AHOA 1T10A 5BN5A 1NMXA 3G23A 3K6SB 3R41A 2XBUA 1JU4A 2ZSKA 2MCFA 4RD3A 2A4KA 1SUWA 4XIJA 4TZTA 4GRDA 4PF1A 1N0IA 3T5TA 3ZVMA 2GARA 4QPNA 5ECWA 3RS0A 4G0WA 1GRQA 4AIIA 5DTMA 5F7XA 4AG3A 2O9JA 3PL1A 4DC0A 2Q0XA 4N41A 1UFQA 2I1LA 3L7LA 5J4YA 1XJWA 3KQNA 2BMVA 1RW4A 4FP9A 2WZQA 3F2IA 1DJLA 5BWBA 1S8FA 2I3GA 1KJ8A 1XDZA 5D7BA 2X4IA 1MZPA 4JC4A 4G09A 3TZKA 4MCJA 3ZWKA 3H84A 1NMEA 2IL1A 1CUJA 2NWQA 2QRZA 5FTMA 1QYVA 3RK0A 4DR5B 1N6OA 1KZ1A 2Z2XA 2WOOA 3A3YA 1YA6A 2RAFA 4ZZ0A 2PMKA 2DECA 2B0CA 2I80A 1G3RA 5CFPA 4N47A 4M83A 3L5OA 4BDSA 1GN8A 4XQEA 3ESDA 1R0ZA 4ZC8A 2G1KA 4HLDA 3V4SA 1C4WA 1K3TA 4B6RA 1M2VA 2PZLA 3IUSA 3JRNA 1UFOA 1U7DA 4ALLA 5AK4A 4CMHA 4M0DA 1G6HA 3KT0A 2UZIR 1TW3A 4P5PA 3FKSD 3HU3A 1KQFA 3ZDBA 1RRKA 2VVTA 2AYYA 1E66A 3M4JA 4J0FA 4RPIA 3TR5A 5DCLA 4EFDA 4N5MA 4CKCA 1L2TA 2FPMA 3G5LA 4MVWA 1WNFA 3WA7A 2WJZB 4CKYA 4BEWA 3QOXA 3P4UA 1T8PA 4L50A 4P53A 5C8ZA 1GADO 1SBHA 2FK8A 3OD5A 4PYIA 3E84A 1QO7A 1YCHA 3QSYA 5IVKA 5SZJA 2R6ZA 4IDPA 4EA8A 3QEOA 3HKEB 2IH4A 3DKVA 3BKXA 1SJ9A 1G1AA 4CMJA 4YRMA 1HDYA 3QNWA 1K98A 1P39A 2JCVA 3D02A 2VRNA 3QXXA 4YXFA 1X14A 1KI2A 4G5XA 1KO8A 2APJA 3L6RA 1LBSA 4TTSA 1O6FA 2CDBA 2HFKA 3TRJA 3UKDA 4Q6WA 4R1MA 1A8IA 4L4YA 2G1AA 2C03A 2ZTLA 3BEDA 4CDNA 10MHA 2UYHA 4F1JA 4CM9D 1NMQA 3JYNA 3CNQS 2ZTVA 2J31A 4E30A 3HCOA 1QLJA 3VDMA 3IPYA 5K4HA 1R0YA 3S2GA 3VC3A 1ENZA 1T1EA 2ZJ6A 2FR1A 3HNRA 1B0PA 3INRA 3OTGA 4MS3A 5T64A 5JZ9A 1RYMA 2FWRA 5KYXB 5IM4A 2PUCA 5JCPA 4JLBA 3RANA 3NM6B 2W6JD 4REOA 1X70A 4OHOA 1YULA 1E69A 1LK5A 3V1MA 4DR7B 2VK8A 2H4HA 4OSPA 3PICA 4JL8A 1M2KA 4D26A 4I9HA 2RGNC 1WOYA 1P9RA 3N7AA 3G6WA 4NE2A 1Z75A 4DSOA 4CRWB 2I4MA 3DKKA 5D3MA 2PQ6A 3I4LA 4WFQA 1PZMA 4B7AA 3TR6A 1R64A 3UK6A 3K6JA 4B46A 4ZTUB 1JL3A 2A14A 4BS9A 2Z56A 1X19A 2Z1DA 1LLFA 1J90A 3PGMA 1TEXA 1GRCA 1YDEA 1RZ3A 2PZAA 3N3AC 1RWMA 4IJKA 4JJ6A 3RDPA 1QF9A 1QO0D 1PN3A 2ZJZA 3E8SA 3CZ9A 3WSWA 2JATA 1T1SA 1PFYA 2BFPA 5CU7A 2M6LA 4LOIA 4U63A 1D1TA 3REQB 1VDZA 4G23A 3OM1A 3AEKB 4AB1A 5AVRA 1VRWA 2I33A 4W6QA 4HFJA 1YC2A 1VL8A 1NMSA 2WHXA 2HDOA 2XLBA 4EEZA 3GI1A 4DY6A 1CULC 1K4KA 2IYVA 3DZGA 2ZOSA 5T6MA 4KQCA 2NVWA 4HVTA 1I1NA 4WK4B 4YFYA 5AUPB 1XC7A 3EGEA 3ZK7A 2Z8YM 4XIIA 3O3NB 4JS0A 3QENA 2B4QA 2FMFA 3SN6A 1ZK0A 3TI7A 2ZEJA 3DEHA 3WGOA 4DC1A 5ALMA 5BQFA 1KC1A 4DBLC 5BXYA 1PQUA 1UT6A 3DEJA 4Q1VA 3IPAA 4ZVNA 4FZ3A 4IY1A 5A3SA 5A04A 2G72A 3ORHA 1JA1A 1Y89A 4JEMA 1MABA 3KWLA 2D2EA 5CXXA 5A2QA 1F51E 3ZVNA 4MRVA 2GUGA 3DQQA 2Q2OA 4OUKX 1C9DB 2DJ5A 2VP6A 1VPVA 4EB3A 4PNEA 3F4LA 3C3XA 3E58A 4Q3LA 1C14A 1WSDA 2NSHA 2NX2A 3KPUA 1NONA 4MR9B 1U04A 3ZQUA 3BFXA 3MWDA 4X6UA 5LMUB 3Q3HA 2BUBA 4OBEA 4KQKA 4TV9A 4UPVA 2GDJA 2X9NA 3I2FA 3L1HA 3QJ5A 5FBKA 1X80B 3PLNA 1JB1A 1K63A 1XZBA 4G86A 3QVTA 2JA1A 5JDIC 1ETUA 1NKSA 2RHHA 3CF2A 1WULS 2BMWA 3PUWA 2YV1A 4IUBS 4QUEA 4UEJA 2N47A 4QYWA 1MB4A 3IAAA 3LO5A 2DFPA 1QK4A 2CDCA 2D7DA 4GBMA 1CUHA 4YALA 2JS7A 1LWNA 4G5RA 1HQKA 1U0TA 4ZQFA 4MKZA 4WOPA 5EI5A 4IF4A 5BN4B 1TQDA 1XTVA 2VHYA 3HBFA 3RVOA 1ONSA 4JLKA 3HVHA 3G2JA 4CL3A 2YZKA 3P2JA 1QAQA 4MH0R 5TRTA 3LP6A 1AUQA 2Q5HA 1UQUA 3AJRA 2GESA 4WFKA 5JQGA 1IYZA 2YXEA 3AHIA 4DE5A 4ZAZA 2RSLA 4TRJA 5H70A 3E0XA 4M4SA 3MRTA 5CM9C 4ZYTA 3BXOA 4B3IA 3WY9A 1CC1S 1CJKC 4PR0A 4Q7JB 5TQJA 2NV0A 3H65A 2CN1A 3F96A 5SV2A 2OWDA 3MG9A 2I55A 1ZJJA 3IURA 2GNOA 3OFVA 3T5BA 2EHJA 2Q0SA 3U3JA 1NVMB 1VJDA 1DXYA 1A9PA 1J06A 1GITA 1NFFA 3GC6A 4GVXA 2Q5CA 5FNVA 1JBKA 1TF5A 1Y1TA 3C1TA 3U3OA 4FN4A 5DBIA 3P9YA 2X14A 1D1PA 1SZPA 1ZGCA 3ESAA 4M98A 4MVJI 4BBJA 1CS4C 1WCWA 2PO7A 4GSLA 4KZPA 5FBRB 5C4MA 4C4OA 1GTRA 3AJ8A 2J4DA 2FW8A 2I2WA 2BE9A 3G5MA 3GJYA 2H2WA 2QRVB 1W5SA 2FMXA 1ECLA 3WLRA 5FWYA 3D3JA 5A7GA 3SICE 3QVLA 1DUVG 3DO6A 3NG1A 5CGZA 5EE9A 4BO7A 5M7EA 2AKAB 2K2QB 1ADYA 1UJCA 2GFIA 3EULA 2OORA 2YKGA 2JRLA 3GT3A 1O8CA 3NEYA 1N2XA 4TT3A 2W0SA 3CF4A 1DOHA 2D5AA 2REXB 3NBFA 1XZ8A 1R4ZA 1ST2A 4Q82A 4YRPA 4BQOA 2A8YA 5JNUA 2ZRMA 4DV4B 3DEZA 3MAAC 2GPAA 2OOKA 2RAUA 4GZ3A 3KQLA 3HBJA 4M8SA 5DNAA 4MRAA 4BKMA 2V7EA 2PWZA 4MS1B 4M22A 1FSPA 3QITA 1X1RA 2YASA 4JELA 2QTVA 4Q3BA 1EDDA 2QMYA 5TJHA 3SC2A 3W5CA 3PEEA 3PFWO 3VOSA 1KI1A 4NBVA 1JJAA 3PTZA 1DZIA 3PGXA 2VPTA 4FFBA 5ALHA 2P9BA 4QGHA 5A6SB 3Q7IA 4B6FA 2QBYA 2QQ5A 2Q1YA 3B6ZA 3M2PA 2EBWA 1BJKA 4G5SA 3B3AA 3K16A 4EGJA 2XKJE 3D3KA 3QELB 1UPFA 4ZV7A 1RJ9B 3ZBUA 4DMHA 2ZRGA 1CUCA 2WW8A 1MTZA 2H1VA 3QMPA 4KSYA 5AH0A 4YRDA 1HDRA 2XE8A 3FUTA 5AM4A 3E23A 5G2OA 1Q0QA 3TX6A 2ATCA 3F5QA 5LPNA 4BMZA 1XZMA 2HADA 1LI5A 3S68A 4AN4A 5HA5A 2XHZA 3BE5A 2X58A 2DWQA 1UPBA 3PNOA 1FDUA 1Z34A 2XWQA 4FCTA 3SVTA 1UC5B 1ZJ5A 2EF0A 4MUBA 1R8YA 5CDFE 1X0VA 1QANA 4P7BA 3S4YA 4PCVA 1XSEA 1QHIA 3BORA 3IAFA 2BVNA 3KXIA 1QGOA 3NALA 2IXEA 4FFNA 4ESHA 1GCIA 1S01A 3KZVA 5I01A 3CPHA 2E55A 3KV3O 3O4IA 4HEHA 3M89A 3WGLA 5I7WA 1YFKA 4JR2A 3TAUA 3L1UA 1MHPA 1THMA 3NAMA 4K9LA 2WYOA 3W6PA 2PQ0A 4R40A 4WKNA 1CIJA 2M9MA 3P26A 1LX6A 4WZBA 1PT5A 1NLUA 1C7IA 1Y9DA 2BIFA 3QFRA 4P5DA 4DNQA 4OQDA 3KJXA 1JLHA 3PA6A 2I91A 2H3HA 4ZYYA 3LO8A 1MXHA 5EP3A 2CNOA 2KJQA 4K6KA 1OXMA 2WHRA 4LXXA 4K40A 4L73A 2V3WA 5JCXA 2GN2A 3QQ5A 4HWSA 3Q2OA 1PSDA 4W5QA 1ZNZA 2R79A 4I9GA 1F8GA 4DRYA 3N0WA 5HK8A 4DV1B 2ATVA 2OZKA 3CVJA 4YBZA 4PYJA 3B48A 3P9RA 1YUNA 1IG3A 5LIRA 3T9CA 1M1NB 2BHRA 2B1GA 1Z0IA 3DE5X 3ZV5A 3AVPA 3QX9A 3V7WA 4YCLA 4B3GA 3FTDA 4F5ZA 1HYGA 3LUGA 5LB2A 1B8OA 1J25A 5IKPA 1E4EB 2DBZA 1G8HA 3D7SA 3ESXA 3MN1A 3ECCA 4LQ4A 5LA6F 3KFVA 1L4UA 4MI3A 5FV4A 1GUDA 3P9ZA 4V39A 1WM1A 3FPEA 5JJKA 3KCNA 4ZICA 3HRIA 2EG5A 3P7MA 2VQ3A 1IPEA 4MPTA 4Q7KA 4BMVA 4HGNA 1RXIA 2OVFA 3ESYA 3EWIA 4P83A 1D2EA 1EFCA 1YVUA 5J23A 3R3VA 1UBJS 3PXDA 4UFNA 5B4VA 4B3MB 1X1SA 3GJSA 3GJ4A 1WVGA 1Z29A 2UUPA 3IYLW 4JZYA 2XCRB 4P0PB 3OIDA 2CWWA 1NW4A 5A7HA 4CIWA 3TEMA 5LJIA 2QF7A 1H4TA 2FF7A 1FNNA 2XUDA 2IPMA 4QC2A 221PA 4JI7B 4EUEA 3ICEA 4I08A 4U2FA 3WLEA 2NAPA 4E33A 2AW5A 2VFAA 2IGTA 1V48A 1U6KA 1WMAA 3O8NA 3DG9A 4R2KA 3SEAA 3ZWQA 1Z5UA 1I4WA 4GD3Q 2PIDA 5EFZA 5KDOA 1WW8A 3FPBA 3W2HA 4BFZA 1ZOLA 1V5IA 2ERCA 1WIWA 4NYMQ 4R1NA 4WK0B 4QU8A 2VPWA 2Z95A 1M34B 3AGPA 2QXUA 3MMXA 1P0IA 4R7GA 3WWPA 1H5QA 4G5YA 1ZGJA 1GA4A 1YZTA 2HHAA 3WK9A 3WRXA 1W29A 4W82A 4BYMA 4JEIA 4DHWA 4ZMRA 3GOHA 3K4QA 3SBDA 1V11B 2F1KA 1DTWA 2BDUA 2JFPA 1UDBA 2KPOA 3QELA 4LEIA 4E08A 4D3ZA 4DB4A 4OX9B 1E2HA 4JCOA 3PCTA 4WBNA 4XJTA 2GVDC 2RCYA 4Z51A 2XMGA 1JYSA 3R3YA 2PKYX 4RIHA 4EFKA 4B83A 1U3WA 5BY2A 5HSGA 1KZ9A 1FXWF 1YJAA 2H65A 4N3CA 5DYGA 3D5TA 4P33A 4PPNA 1QWSA 2BT4A 3G0HA 5BN1A 1FFHA 1MW9X 3AR8A 1AY0A 5FQNA 5TPWA 2O1EA 3KDSE 3GGPA 4J94A 2HQ1A 4JLSA 3RUIA 5K6AA 1NWCA 1ZKMA 2R86A 2Q9UA 3LLUA 1L0BA 4M1ZA 3KTOA 1OXTA 1Z6QA 1M6HA 3DJYA 1O3YA 2WWTA 3G0OA 3PDWA 1E4OA 4NP6A 4PXSA 3ANTA 1Y5RA 2R84A 4DMUB 4AUNA 3EW9A 4GYKA 3V8RA 4D8UA 3RS9A 3RAEC 5DHFA 3GP8A 2JC3A 1PJ3A 5CXUA 2DQZA 1N5RA 4RABA 1NUPA 5I6DA 1Q7EA 1GTZA 2VHUA 1IQUA 5JHGB 3VPHA 4JI4B 3ZXUB 2IHJA 2XX3A 2FK7A 5EHNA 1LV8A 3IBYA 2AEFA 5L3ZA 4CR7A 5EQDA 2BGRA 2NG1A 3HDHA 4CU2A 1CEQA 3D3WA 5K0EA 5CITA 3L82B 3GZTB 2ZBQA 3AHHA 1QO0A 4NV1A 5IDXA 2RMKA 1YZVA 2A5LA 3AESA 5DMXA 1AN0A 1UWCA 3DE6X 1VP3A 2D1YA 1U8AA 3N7TA 1Q1QA 3O8QB 4R6XA 5HE9A 4C43A 1EWVA 3BL6A 2BMFA 3OFSA 4F8YA 2RG7A 1ZSYA 4DMCA 1ZK1A 4R31A 3E8MA 5M5BA 2FZWA 5IP5A 3ZCRA 1SUPA 3N8HA 2KI5A 4L7QA 2BF4A 1Z4JA 4C06A 2B99A 3CY6A 2ZRDA 1HE1C 3NTUA 3OEED 3GVXA 2I1QA 3OPNA 4N7JA 2GFHA 1L5HA 1Z88A 2HQBA 3KSMA 3PRHA 1RWQA 4MVXA 1SN7A 3EPHA 2F3TA 4LVUA 3R5FA 3BL5A 3N8KA 2GNPA 4O1HA 1OTXA 2FU5C 3HO6A 4MGIR 3I45A 4Q66C 4J4HA 1CY1A 1EJBA 1HFWA 4Q1DA 5JSYA 3ZDEA 5A4FS 5LWQA 1QUEA 2O2DA 4DYDA 4EKEA 2IIQA 3UVEA 3EEFA 3AH8A 1NX6A 4MUXA 1ETHA 2AX4A 1I24A 1KMNA 1S8AA 3IKVA 4IHJB 4DADA 4EB6A 2EWVA 4LKOA 4K03A 1L5ZA 3L0ZA 3IVRA 2QEQA 4MQFB 2HV9A 4EAQA 1OC4A 4AN1A 5G4LA 4QBIA 3IE2A 1OD6A 4UCWA 3EOZA 4Q3EA 3ZOKA 4JVNA 2W8BA 4L6IA 1M6WA 1BN7A 4IIGA 3WGIA 4G0UA 5K0NA 1B14A 4FGSA 4P6VF 4Y8VA 1DQSA 1DT3A 2Z8ZA 3UO8B 3CS3A 4CU5A 5ISMA 2A9OA 2FAXA 2XVXA 4EPWA 2V7UA 4KBGA 4NABA 1D6MA 2RCNA 1PX0A 2F8MA 5AJTA 4B4WA 1T4CB 2P3SA 2XQVA 2CSUA 3K1YA 4IGKA 1E1CB 5EKXA 5HKLA 5IAJA 1FVHA 1JPVA 1U90A 3IRUA 4MO9A 3RD5A 1YR2A 1BRMA 1QYIA 1ZA1A 5JT1A 2ZJ3A 3ZV6A 4DEYA 1DARA 2BSQA 1KDRA 2HQSA 2HJSA 3ZV4A 4MVJF 3VVLA 4BRZA 2FTKE 4N54A 5TC4A 1JHAA 1WSAA 1YJXA 1HDIA 1X7DA 1L4EA 1BDBA 1FP7A 2QQEA 2XGOA 3E9DA 2IEDA 4RFVA 4Y2VA 4C08A 3PQ6A 2GAFA 1DKNA 3DHWC 3DP7A 2PKWA 3HBNA 4IDHA 3LUJA 4QREA 4KE8A 4R2XA 3MRVA 1NN1A 3HN7A 3ROMA 2Q3LA 1U1IA 3T7JA 5HGXA 1R0XA 5C1DA 5L9AA 1U8TA 3WLOA 3V2HA 3OURA 3ENZA 1ZJWA 4BO9A 5F76A 3TLAA 4AAYA 4QOJA 1UBUS 3I73A 3KYBA 4LMRA 5AVTA 4QGGA 5IS2A 1JG4A 1T1JA 5AK0A 1Q0UA 4GPZA 2VTKA 3KUDA 3E48A 4JR0A 1G7CA 4P7KA 3QBTA 3D1LA 4RFSB 4OQPA 3NHPA 4QBFA 2C4UA 4Y2RA 1E77A 3N2NA 4F6CA 1D4OA 1VLQA 3CLUD 2E7ZA 5GONA 4JCCA 3IT3A 1H8HD 2W2NA 2AG6A 3K0FB 4INOA 3EBOA 4HZIA 2HT6A 2P9TA 2X5NA 4IOKA 1CF4A 5F1PA 1GWNA 2XTNA 5JZVA 5GP1A 5CPBA 3S2UA 2BW0A 1NG1A 3T0IA 4PXYA 3QVSA 1XMJA 2J09A 3U6BA 1SIOA 2REBA 3ISVA 6LDHA 1U7WA 4GP6A 2FEMA 2PUTA 4RYLA 4ZZ1A 3D0RA 4BCDA 4TTQA 4AJLA 3MUFA 2C2KA 2OPBA 5E4JA 2ACWA 4KQEA 5JU6A 4YGXB 2WAOA 2FVXA 4ZQCB 4NYIR 1WR8A 2WAAA 1JA9A 1O4VA 2DAPA 3K0FA 4U2DA 1IHUA 5MFPA 5ESDA 1PV4A 3U4DA 5KKNB 5JPIA 4ZZ3A 1GZ6A 1RKVA 2YXPX 1HZJA 2Q07A 3CPSA 3ZI0A 4DWOA 1R3UA 3O47A 4U9HS 3CLRC 3G5UA 4M55A 2V7WA 3B78A 3C3BA 3DA8A 1H5NA 3GFTA 3P9XA 3AVWA 3M34A 4HXYA 4I7EA 1SVMA 1O2DA 4NMXB 4YDRA 2V6JA 2UZ4A 1EQ2A 4TN1A 1D3AA 3C2QA 4XYMA 3WZLA 2FP4A 3H3FA 3RRMA 3JWHA 3UAYA 1ORWA 2V1XA 3C5CA 3WQRA 3ED5A 3OFKA 3GFQA 2R751 3L1IA 5MGBA 1ZCBA 1YF3A 2C9BA 3FGOA 3IPLA 3PVCA 4QODA 4R9UC 5DEIA 1Z6GA 2Q0QA 3U80A 3EX7C 1H3FA 1QVZA 1RQPA 2IY9A 2W8BB 3AF5A 4ROSA 2QNIA 5CB4F 1BVYF 1YQGA 2C4MA 1YRHA 3DKPA 5ALLA 3NRJA 1G98A 2FCAA 3NAGA 3R6GA 1LTKA 1K92A 3P0HA 1HFEL 1QVWA 3GLHB 3HJNA 4GMGA 4FQ7A 3PG5A 4OYYA 5TS2A 1CEEA 2OR3A 1R16A 1FP4A 1AG9A 2YIVX 5EUQB 4AKTA 4N01A 2H9AA 2JPDA 2PXAA 1IEVA 1QO9A 1XRPA 1OAOA 3TL6A 5TMPA 3PQEA 1JFFB 2F8LA 2AXEA 1GDHA 3KZMA 2GLXA 3DVSX 3NKFA 3HNPA 4YP0A 3AKZA 2QRLA 1X7WB 3R3XA 2BI4A 2HUNA 5KQSA 5JG7A 4LW8A 2FEWB 3OFND 1YB5A 2P6UA 4MGHA 4LV5B 4NULA 4DSZA 1M3SA 1C1YA 1MC1A 1WBBA 4JLPA 1YO6A 1S2NA 4BWYA 2J7PA 3E3NA 4YI3A 5M2QA 4RD1A 3LIPA 3HKDA 3VC2A 2UYGA 1LF5A 3SP1A 1ISMA 4J0EA 2BTQB 1BXZA 4EW3A 5F77A 3TMYA 5LVAA 3FMPB 1XAHA 3FMVA 5HJ2A 3WHPA 3G9ZA 4X63A 1O97C 3CNBA 3WLSA 5KC9A 2W2LA 2WWWA 1XHEA 5EE3A 3R6LA 1SRRA 1OPRA 3LYLA 5CLJA 1JFTA 2PA3A 2Z9DA 3K3PA 3AM1A 4FXPA 4KKXB 1AUXA 2XITA 2QMUA 4DA4A 3LFTA 4DFDA 1Z3IX 2X5OA 3E35A 2HUPA 2IV3A 1SXGA 2ZBGA 4YRLA 3VHXB 1SA0B 3SZUA 1RAFA 2COEA 5DISB 2LGJA 2HO4A 4YJ3B 1PG0A 1VSQA 5LXTB 4M6WA 1UC9A 4RGYA 1Z0UA 1NE2A 1WTCA 4XH9B 5SYMA 3CMCO 3LVRE 2A92A 3RUAA 1SU8A 3S7TA 3VU9B 3L1JA 2HWUA 4DPLA 5I45A 2Y1KA 3D6AA 2ZAMA 1PTJC 1TKCA 3FSEA 4YRRA 1J8DA 3C45A 1CBUA 3F7MA 3V32A 2WF5A 2WJHA 1G2PA 4K05A 2QN8A 3SMVA 3ST7A 1VL5A 1EVKA 2JVIA 2R6R1 3DUFB 2DPLA 3H1GA 3IB3A 4EUSA 5JY6A 2VDUE 2WD8A 1XPJA 5LBIA 4H4CA 2QT1A 4I9UA 3B1XA 3R5KA 4K87A 2G9NA 4EATA 3S2FA 1UJMA 1YHZA 4BKQA 2ETXA 5AOVA 1QKIA 2Y1WA 3AF1A 4X8HA 1GPKA 3HFJA 4GC5A 3VC7A 1UQRA 1USKA 2CHFA 2FOXA 5INTA 4XGQA 5KBYA 4G0OA 1PBTA 2AHOA 4MV7A 1KPHA 1FFAA 4G9EA 4FLMA 4UVGA 2R7KA 1SRQA 4W99A 2FFRA 2NZVG 2PLAA 3KTFA 2HKIA 1CTQA 1XNJA 3D5QA 5AJHA 3O8OA 3PDUA 3E70C 5EJIA 3AYZB 5KOYA 2CVFA 1LLQA 1CWUA 2GAAA 1HYEA 2ZE6A 3H83A 2CD9A 4I9NA 2ZRFA 5KOHB 2POCA 2BRUA 4X3CA 4Q7MB 3R6WA 5DNEA 4DB2A 3RHSA 3ESZA 1KYTA 1VECA 2IEIA 3OCJA 4I4NA 1BGXT 1PZEA 3GMDA 2HHJA 2I6UA 3IEIA 3LLCA 2VJDA 1YAJA 5KKCA 2R8ZA 1OYWA 4J1QA 1KO1A 1P2BA 2Q62A 3U3MA 2EGUA 2Z3VA 1RWOA 4J16A 2VRWA 3G02A 4KWHA 4QOGA 1S7GA 3DWEX 2IKQA 4PZUA 5B1HA 4EYKA 2ASVA 2ZBFA 3OX3A 1FFGA 2FSUA 4FE4A 4GMFA 3T7DA 1BJRE 4LOAA 5ITZB 5DYWA 3GYGA 1O94C 1X2EA 4UU0A 2P5UA 1HLPA 2VDWA 4R05A 1DKQA 3PFHA 3PKJA 4D57A 2O6LA 4F3RA 2FMTA 3R5SA 1XCJA 8LDHA 1VKZA 3QKRB 3GMSA 4GDMA 1J7JA 1ZCJA 3OEYA 1K3FA 4FJ2A 3KLBA 4D79A 4EM6A 5A3RA 1NPTO 1RPZA 5KJ1A 3QKIA 3NIGB 3KQHA 1PFWA 4KX3A 3FUCA 2QAIA 1EK2A 1G0NA 3BMOB 4TMXA 2Q6OA 3X0DA 5JH7F 4IXDA 1AM4D 4UHJA 3VR6H 3V80A 4AZ3B 4G9GA 3J7AC 3FCSB 4IVPA 3C7TA 3CRMA 2FPIA 2G70A 4G97A 1SXJB 2J3KA 2WNIA 3PEUA 4S05A 4DA7A 1FE8A 1O97D 4TYNA 1AVTA 1TAGA 1NMZA 5FOVA 4WX2B 1VGRA 4AWAA 2CBZA 3DHVA 1RQLA 4J0JA 4Z0NA 4MUKA 1ULUA 2J6HA 3A05A 4I55A 5EJMA 2HLDA 4FBLA 3PCXA 3UAZA 4N3GA 1F6DA 3DW1X 1B93A 3IPRA 3L84A 4UUOA 3WNQA 1QG0A 3IEVA 5IXYA 5KHLB 2EDAA 2BEUA 4KWTA 4ZDWA 2AB0A 3E4CA 5EMJA 4DCCA 4WXEA 1YWGO 4RHEA 1L7VC 1WB9A 4KE7A 1CJTC 2NT4A 5J43A 1M2OB 4NENA 1Z4LA 1B2LA 2GK3A 1KSGA 4TL8A 3OQPA 4BO0A 3UJHA 3C4QA 1M2HA 4P31A 2ZM6B 2J0UA 3PNMA 5LIPA 5BRAA 2DH5A 3H5WA 3ISJA 1AQYA 4KPUB 2C07A 5HOEA 1JKJA 4C3OB 1PL0A 1HE3A 1LK7A 1A0OA 4PX3A 5IWCA 4PLVA 2X1MA 4FGJA 4GI5A 2JAUA 2QZSA 1EDBA 5I9BA 2A6PA 1XLWA 4QHSA 3WKEA 5H8WA 2OO7A 1X7HA 1TIKA 5AOAA 1JJIA 1XHLA 3EE6A 4TKUB 3NANA 2P9YA 5TMDA 3L6UA 1RSZA 4DC9A 2YMMA 1NZJA 1PEAA 2Z2IA 2Y1EA 2PIAA 2QD1A 4PANA 1OIWA 3D8RA 2YMLA 2ZULA 2JAQA 2Z57A 4NL4H 4BTEA 3L4BA 1S3SA 3A31A 4FYKA 2JFGA 1D2AA 1DCFA 4RPJA 3W5UA 2EVWX 3RFCA 4IUYA 4CUJA 2Q6LA 3A14A 1H85A 1YOVA 2FR8A 1W73A 2P6PA 1YHNA 3LXXA 5IZ4A 1RI3A 1LDYA 4IFEA 1NUTA 1RHQA 1Z7BA 3OF3A 4N7RA 4OQXA 5J2TF 3ZGXA 1YZKA 3PNPA 3OZUA 3CRZA 4X45A 2WNHA 1R0LA 3I6ZA 1HYQA 5HPYB 1GNVA 1LI4A 2Q50A 1AF4A 4YH1A 3QJYA 2V7QA 1I2ZA 3JAWA 3W1WA 2R6AA 4LNHA 2QP3A 4J49A 1Z0AA 5BVHA 2IS1A 4JVSB 2L69A 2NO9A 2BBSA 4LZOA 4DNFA 1HNWB 1BWRA 3OBIA 4TV8B 2A59A 4NOMA 1TM1E 3RVBA 5I7OA 1RWXA 1KMHB 1DO0A 3HQ4O 1QNFA 4R8VA 5CLHA 3RJ9A 4BCBA 2VATA 4MRNA 5DLQC 3EAFA 5C8YB 1O6CA 4L51A 1EGAA 4RXMA 4D9FA 2Y1LA 5TMEA 5EGNA 2O57A 2R1TA 3QVJA 2J85A 1MX3A 1C8BA 3EJWA 3KR9A 3V4OA 1RP7A 2SECE 5BPFA 3HVRA 3ANMA 1HPLA 3H9QA 2R5NA 4YN3A 3HYTA 2NU8B 5JXGA 1XZQA 3EGDB 3WKDA 4JYZA 1E3MA 3ZW8A 2OGZA 1TJYA 3Q11A 4YUYA 4IDBA 3ZWPA 4B3XA 5I7RA 5FTKA 3SS7X 1DQPA 3M2TA 2XUZA 2YHIA 1NRJB 5A1TA 1KK0A 4G67A 2PH3A 4FFOA 4OLJA 3NR2A 5DV9A 4GC9A 1P29A 1PJBA 1R0RE 1JFFA 3PFBA 4RZ3A 3V6LA 4UTVA 5C1OA 5JWOA 3HE3A 5D3ZA 5K6RA 4UQOA 3D3WB 1ZLYA 3SX2A 1EQUA 1GAQA 1R10A 2EFJA 3HABA 4CL2A 4NXNB 4JV5B 5EJ4A 1ORIA 3PXAA 1E89A 3VV3A 4BWFB 2I9KA 4H4EA 5HX7A 2VTBA 3ZJVA 4C4YA 3G89A 1YQDA 4KEAA 4AROA 3KLMX 2BDEA 4DSTA 5BOSB 5FPKA 1TD1A 4MARA 5L53A 1NI4A 2D5CA 3LWZA 3IO3A 1CDZA 2GYYA 3E3MA 3I6MA 4XJSA 3D3NA 3OU6A 4KPUA 1NQOA 3JZMA 4TMKA 2W11A 5JEDA 1CY7A 3L9WA 1QG6A 3PB3A 4QDZA 3VZSA 4I3HA 3I0MA 1WZIA 4JB0A 3M5CA 3E7FA 2JFFA 4CV2A 3ZDZB 1BE8A 4YRSA 5BSUA 1JIJA 2P79A 3NI2A 1M6YA 1UZUA 4IJWA 4DLAA 4FR5A 5I47A 3R74A 2VIIA 3PE3A 3E8XA 2AFRA 3IUNA 4D8VA 2P6RA 6YASA 1USIA 4B8ZA 2VP2A 2VT7A 3V7NA 3LBFA 4KIWA 5KKAA 4HDMA 1IRXA 1IUNA 3KJIA 3LBAA 4M53A 4O8CA 4F21A 3IMGA 5HKAA 2A0FA 3HDTA 1WSBA 5JJIA 4N0QA 3OD1A 2ZAGA 2OO3A 1Y3FE 3KJZA 4ND5A 4PTYA 2QLFA 4K9QA 3HN6A 4RWZA 2RHJA 3ETCA 5AK6A 5E8RA 2VRBA 4HQNA 3TFQA 3ZCTA 3DVLA 4RHXA 2IYAA 2ZFUA 4BZPA 1W36D 3TS1A 1V9SA 2F7SA 3BGVA 2OCXA 3EG9A 1PEDA 3QOWA 4LOKA 2IA5A 4I4LA 4ZVSA 3S2EA 4Z7QB 4GZ5A 1RYHA 1HDXA 2ZM5A 1PV1A 1RI4A 1H8ED 4O25A 1SXJD 2JLYA 1VIDA 3KU4A 4M0PA 3S40A 3RT9A 3BKWA 1YE8A 5BYAA 1W9HA 3M9XA 3RBXA 2OGWA 1HDCA 1OPXA 3JALB 3QZUA 1SQSA 3MTDA 2IW1A 3MRXA 4ZI7B 5JS7A 2Y8EA 1YQEA 2AYZA 1EFPA 4LJ4A 4AULA 1R9MA 1U4OA 2PLWA 4ZZ2A 5A9SB 5K8VA 4INJA 5BN5B 1L8LA 5T4EA 3JATB 3EGXA 3EEBA 4RTRA 2QORA 4FNGA 3Q88A 5C34B 4D9JA 5B1IA 4JGIA 3R09A 1YCFA 4PFQA 4HQ6A 4UMDA 1NJ8A 2PMCA 4E3ZA 1QHGA 3SXPA 1GZHB 5GZ1A 4UUNA 4L3OA 5KCMA 4CDRA 1ODJA 4OQFA 5FHRA 3A58B 5JMWA 3QXHA 3K70C 1DC4A 5D3MB 3ZWAA 1MC8A 4JC5A 3CRW1 3OKCA 4DT1B 2WINI 3P9NA 1MAWA 1V8PA 4TQ9A 1XGKA 4RFSA 4DLZA 4K3UA 2PYIA 4LNAA 1UXKA 1GP2A 4AKSA 3ZS8A 3JS5A 2XCLA 2X8WA 4Y6OA 3ID6C 2CYAA 4RXTA 4XJVA 4Q18A 4BLVA 1SC1A 3FVVA 5FWNA 3EXHC 5HQTA 1ZQ9A 4L0DA 1RJFA 4RIFA 3TW8A 4Q9LA 1JWBB 3IA7A 1SKAA 1EQAA 3FCYA 4BVEA 3NX4A 3WYEA 1IATA 4WZBB 3VR6A 4OAQA 4PVDA 4K5QA 4FILA 4UDYX 3VMFA 4QGSA 2VF5X 4EI2A 1QE5A 9ABPA 1G42A 5KO2A 4PINA 2EFEB 2E48A 2XVYA 2Q2WA 1FQOA 2DQSA 1KYZA 1PQYA 4JQOA 3SKVA 5B7GA 3K71B 1BTOA 2RBGA 4A2QA 2DHQA 1JH8A 2B8WA 4MXDA 4RQTA 4OI2A 2V58A 4L7VA 3CC8A 1QHXA 421PA 1WXDA 1Z3CA 3SQOA 3DPSA 3I72A 1RQ7A 4GRIA 1TO1E 2JFNA 3NBXX 4NBKA 4JENA 5FPQA 4MV3A 1NQTA 1W8DA 2PWPA 4GO1A 4Z86A 3CWCA 1SKUA 5C0OE 3M3HA 4NCKA 3DV2A 4P0TA 4V03A 3UPUA 1N3LA 2Y6VA 3D6VA 3ZQ4A 1O7JA 2C7PA 4ZAXA 1RAAA 5K0JA 1M6EX 3ZD8A 5JXJA 1PWXA 2NU7B 4HRVA 1AB6A 4BAGA 1EFVA 2IT1A 3WLQA 3RGGA 3CEAA 4TPKA 2R4TA 4TSKA 1A9XA 4OQZA 4BFUA 3DZJA 3ZIUA 2FPSA 3F6BX 5IHPA 2AMFA 2ZSUA 2AYXA 4NZMA 3JVDA 2YBDA 4NDZA 2YS7A 3VJKA 2RGYA 4DPMA 1I7DA 1DKLA 3O2QB 4XKJA 1IMJA 2VBFA 4WLUA 4LC9A 2BKEA 1NOIA 2I2FA 3TSYA 3UICA 3WWDA 1E4YA 4RDHA 4NZ9A 2WUWE 5FR2A 4TLCA 4ZD6A 1YZUA 1TEHA 5HS6A 5LQDA 3PC7A 3I9LA 1RD4A 3GT4A 1PFGA 1Z62A 1ZFNA 4P34A 2JLXA 4RDXA 1DKMA 4IO1A 4RACA 4HGRA 4UXJA 3PHHA 1JU3A 2IYWA 1L1FA 4RYDA 3ZLVA 4C0LA 1Y48E 1XCLA 5B58T 1V6AA 2X6QA 3EXEB 4DJDC 4ZGBA 1LJUA 2F3RA 2AFIB 3JALA 2C7QA 1E9VA 1SVNA 1GUAA 1VFPA 3WV4A 3G2OA 4DIOA 2ZJ8A 4QARA 4ZJZA 2JI4A 4L4ZA 1VL0A 2J0EA 3H2JA 2RGXA 3OQJA 1U81A 2AVDA 2G77B 4D1YA 1OREA 1T1IA 2D0DA 1EFLA 1XJQA 4EO9A 5JTTA 4JLNA 1HOTA 2VNAA 3AU9A 1Z22A 3HYSA 3PC6A 3PCRB 4HAYA 4CQMA 4YCMA 1Z2OX 1NZFA 1WKCA 2G8NA 3IQEA 3C6BA 3P9KA 4L8WB 5BT8A 5DYNA 2E6KA 4LZLA 5JZMA 2AXQA 4P2BA 4JMLA 4QSMA 1EAYA 2B4KA 5IYZA 1T3SA 1CZKA 3DAHA 3O8DA 4MUGA 4MINA 4UARA 3G85A 1R0BA 2QW1A 2G9UA 1XTUA 2VHZA 3DBLA 3DO5A 2IRWA 3KT6A 5GM1A 2QZZA 2Q1UA 4OHZA 4JT8A 1A9OA 1QTNA 1ZN7A 2A88A 3EVNA 4KXLA 5FI1B 4KREA 1BH2A 1LPMA 2WJJA 4FGKA 4V0OA 4XEHA 3VKGA 2EG9A 2V0GA 1U8EA 1T8UA 2QJTA 4GL2A 3ON5A 2I54A 4QFCA 5CDHA 3HCPA 2QLLA 3IP5A 5F9HA 4I1UA 1PTJA 4QATA 3K2QA 4WNAB 2QRVA 1PDWA 4JJKA 1DMSA 3T1VA 3LCCA 1YL7A 3RYHB 1DUIA 1DIBA 1Z4IA 1KH1A 1JYEA 2ID9A 2MYPA 3PVZA 5DYIA 1C1DB 1YRAA 2PJZA 4R0VA 4KR3A 3K31A 4V0QA 2O05A 3HDQA 1DIAA 1CD5A 1O96A 1T2VA 2BFOA 2R65A 1YQWA 2JHCA 2JD2A 2FUNB 2OV8A 4C0HA 4NBTA 4CMEA 2GSDA 4F46A 4AJIA 2XDYA 4KXFB 4PM4A 1ZUWA 1GILA 3OIUA 4FKMA 3DXXA 3STXA 3UWMA 3WYFA 4E11A 4A7PA 5JPDA 4LDNA 2VZEA 2UZ1A 3L0BA 3OOHA 1OH7A 2GLUA 1GNRA 2W98A 3UK1A 5CFZA 5JS6A 4Q7EA 1G291 1T5BA 3SYKA 2WKQA 3QMWA 1GA6A 3RHTA 2QZ4A 4IMRA 4CLHA 4PZZA 2C9MA 1C7RA 4HB0A 3ANYB 3ZW7A 5JSZA 1O96B 2Q8QA 3JR3A 2PGJA 3DMFA 4RA6A 1ZH2A 2ZZKA 4R7TA 3W04A 4G0MA 1TCVA 5EQJB 3NBZC 2ST1A 1PI3A 3WP0A 1PYGA 3T4EA 4J4BA 4JSYA 4DJTA 1KJJA 1A97A 1KVSA 3MB5A 1Z56C 1DLJA 2AS0A 4QGAA 4P80A 3ROXA 4F2PA 2WLTA 2P68A 5LDHA 3VOTA 1FP1D 4BMCA 1W1UA 2G1UA 4IM7A 4MW0A 2IS4A 2BFFA 2Z5LA 5AI0A 3OE4A 3JQGA 5KJ6A 4RORA 1ZO8A 3VUFA 4E2FA 1S02A 3PL5A 2ZW9A 1UOOA 1ZD2P 1YGYA 5ICGA 3GLGA 1Z2EA 2H4WA 2FZEA 4JSTA 4MPRA 2W42A 3PJDA 3R77A 2C82A 2YTZA 2HC9A 2PZMA 3GH3A 4YAEA 1UPXA 1YS6A 3GJ6A 4ZV9A 4E31A 2VUTA 1RKBA 8AT1A 4ARCA 1YRQA 4MYDA 1OGIA 4RKRA 4YI5A 2PT5A 4D3XA 1E79A 3N2KB 2SBTA 2XYPA 3GJ8A 3X1ZA 3HCWA 1P1HA 2BWJA 4RSGA 2QL7A 2JFHA 3D7NA 5DCYA 5FPTA 5C8DA 4AS1A 1XQVA 1Y8CA 1E92A 1Y8QA 2PGOA 3E5RA 2V59A 4EARA 4PG8A 3EPRA 1T5OA 3JQAB 1H42A 1KS9A 4HWOA 2YX1A 4Q3AA 4UNNA 5JR3A 3AHFA 3W3AA 1GPDG 1PJCA 2PUJA 5HVNA 1AS3A 1T9ZA 4M9QA 1V96A 1V3QE 2IIPA 3SM3A 3DOHA 4J9VA 1GNSA 1PFVA 5B3JA 3P94A 4HGQA 3UB3A 1I7PA 2EJUA 2XRMA 1XEFA 4P98A 1Y6GA 2CFSA 4PO9A 4MV4A 1C9KA 1VXOA 2A9JA 4URWR 4YX9A 3M82A 3NUZA 1K8XB 3QIVA 1WD7A 4Z5XA 5DBFA 1L5SA 3AV3A 2XGJA 2J6IA 4EB0A 3U09A 1ZY2A 4H3HB 4MVJG 2P1DA 3BH7A 4I5EA 3K6SA 2YZ7A 1N2CB 3WBKA 2O8EB 1U3TA 2AR9A 1AZWA 1QPGA 3R0JA 1QV7A 4Y7DA 4K1XA 4Y2GA 3SZLA 1BD4A 4F56A 4BNDA 1RC8A 2Y27A 2E2WA 5ALKA 2OHIA 5AQ1A 3K4HA 1PJQA 1Y3AA 4JOSA 3D4BA 2FWMX 1QHNA 4OQYA 1OTHA 3E2MA 4YCBA 3ZQ6A 4UPEA 2SCUA 2GAJA 5IWAB 3WR5A 3ZLTA 1FMJA 1I30A 3EDQA 4NAVA 3TBKA 4KH1A 4C4SA 2I0FA 2QRMA 3DLHA 1EH5A 3GVCA 4JIMA 1ZGHA 3WL5A 1OBCA 4E5PA 4BNDB 3H97A 2GSWA 4C7VA 1HDOA 3AP1A 5LYJB 2FZLA 2DWUA 2Q6KA 2PFKA 2P4UA 4XSVA 1JG2A 2FZCA 4G37A 4IAOA 2ZB8A 3SKYA 1GLVA 1WAMA 1C7QA 2OV1A 4CL0A 1NJ2A 1ULSA 1J23A 1EX1A 1R6AA 4OXYA 5BQPA 4IZIA 3NHFA 4YR9A 2G9VA 4N76A 1NAHA 1BA2A 3F7NA 2CYBA 4IJ5A 2V5VA 2HX1A 4FW8A 4UKDA 3SKXA 1RRCA 1CF2O 4UNSA 4WZAA 3ZBQA 4DMMA 4F3KA 4R98A 5HILA 5J5VA 5IF3A 4ID3A 4BFTA 5KQRA 3R76A 4JB3A 1UK9A 3FVWA 4W8OA 3RU3A 1WXFA 2FR8C 5C8XA 4MGKR 3DMHA 4FGWA 4ZU6X 1G20E 1P9LA 2PCLA 1E1RD 1SCJA 1ATIA 4RH3A 4URZR 3VNBA 3TINA 4BQFA 3B2QA 3FSGD 4EVRA 4OAPA 5DHRA 4TSFA 3RRXA 4ALKA 4BO8A 1H8EA 3IHTA 1WHTB 4JC0A 5I48A 1Z07A 2J9XB 3MT8A 2SNIE 3WB9A 4I4IA 5JCJD 3UXHA 5BXQC 1NW6A 2JGDA 2J32A 4NPHA 4MKFA 4TX1A 5KTMA 1XXHE 3JZDA 4RUKA 3JQFC 3PP8A 3V2IA 3VJMA 4LXQA 5BNTA 4BKUA 1I0ZA 2NZ8A 2HYIC 2VR1A 3QEBZ 2JKYA 1K2WA 2AF4C 4S1TA 1EWKA 1MC4A 3DL7A 1CUYA 4TRRA 2J9ZB 5E4TA 1I2AA 2C8VA 2LW7A 4DGSA 5AP9A 2FN7A 4PY2A 3JQGB 3V4RA 1FMLA 3R7NA 5H59A 2VJLA 3V3TA 3BWDD 1DKRA 1I3KA 1QWOA 5KZMB 4MWSA 2O8FB 1RYFA 1CZHA 3P0RA 3WXBA 4DF3A 2E5LB 4GKBA 3OAAA 2XZOA 1IULA 4QELA 2NZUG 3IAS1 5LUBA 3U9SA 3PNQA 3FBWA 4N18A 3E7PA 3L92A 3W5SA 3L4EA 1BWSA 3Q0EA 4BZXA 4EGAA 2XYHA 1B76A 4OKNA 3SHOA 4ZJPA 2H11A 2P0EA 4IGFA 3TG2A 2WRZA 3VRHA 2ZCUA 4C04A 5A3QA 1PR5A 1CVIA 1T3ZA 3AETB 3A6JA 1GAEO 2IEGA 1K6JA 3BIWA 2NNWB 3PFCA 3T5MA 1XZGA 3FCCA 4UBIA 2FUKA 1OV6A 2DSTA 1Y4ZA 1ORHA 1G6KA 3TVYA 1XRRA 4HNHA 3GZJA 1LH0A 1QTRA 2ZYTX 3FIJA 2XSZA 3O8OB 3QYFA 4RK5A 4LWOA 2CW5A 3CRRA 3AEUA 5DHUA 1W4AA 5FEMA 3THSA 4TXJA 1TD9A 3DC7A 3E53A 5CA0B 3ZW9A 4FVTA 1EBFA 3LD9A 3RSOA 1B6RA 2FW0A 2YJ6A 3RRZA 1NVEA 4A2PA 1GAWA 4HEA6 4NV0A 3KVVA 5HJEA 1NP6A 5HM8A 4QM6A 1T3GA 3GLKA 2YXLA 2KQUA 3DZCA 3U49A 1RLJA 1X9HA 2VPQA 2R8RA 2AF3C 2HBQA 4NZNA 1ZG3A 5FI0B 2NMVA 4J0GA 5AVZA 3NTXA 2EQ5A 2H0RA 2JJMA 4RLFA 4W9MC 4TV9B 3IEXA 4A6DA 4D41A 1IN5A 3VISA 3LQ1A 1N5KA 2GBGA 1KRXA 1Y5NA 4Q24A 4H27A 4FYIA 4QPPA 3H2KA 3JASA 4KO8A 3MQ2A 1FRFS 4KCGA 4OV6B 3HI4A 2NPFA 3NVAA 4OGWA 5IFLA 3T15A 1N6RA 1A8UA 2JIDA 4HADA 4WBNF 2IVFA 1Q3HA 4K0RA 1NSYA 2FMKA 1YSCA 2OCGA 2WEKA 5GJWC 3IV7A 3WICA 4U7HA 1DFGA 3OQMA 3UUGA 2GILA 1Z7YA 1W48A 5FULA 3FOWA 2Y9PB 2H5JA 2ZR9A 2GZ1A 3RYFB 5BSHA 3M6AA 1JFRA 1TYAE 2VJMB 1TQ6A 3FIUA 3UK7A 2EZTA 2FUEA 1Z8DA 4QX6A 1B8UA 2PYDA 1TMKA 2P2DA 2QLJA 3AW9A 3LECA 4INPA 4EPRA 2BHTA 5KVVA 5FBWB 1R88A 1WABA 4YMGA 5B3JC 1UEXC 1JFLA 1MT0A 4TWRA 1KEEB 5KWSA 4F96A 1GEGA 4BFVA 4U0JA 4PSKA 1B8PA 1ILEA 2Z6UA 1POXA 1Z16A 3BDAA 2LIVA 3FBTA 4LJ6A 4CQMD 4DOMA 3WAGA 1MJFA 1LBEA 4R51A 2R6GA 2DWOA 2AN9A 3W4IA 4QHYA 4KFRA 3PIRA 5DWVA 3ZE8A 1RVDA 1QQAA 4LDPA 1BXKA 5BW8A 2KWIA 2QQGA 2GEJA 1DTEA 5A05A 1ISRA 4Z3OA 1E5TA 1H2EA 1ZN8A 4QUJA 1PJ2A 4GUAA 1TQ8A 4O1IA 1ECJA 1JG6A 2OHFA 1RWVA 3NXSA 4HEA1 4M9RA 3SD7A 3VR5H 1FZTA 1MO6A 3L40A 2BFNA 4FFRA 4LJRA 5B12A 2B1IA 3OOYA 5KQPA 3ZU2A 3AUJB 1L4GA 3OH8A 3RTCA 2IH5A 1XU9A 3BE8A 1HV8A 3A1SA 3EXHA 4K6FA 4M1YA 1X7ZA 4RKQA 1NJ1A 4WZAE 4O2BB 1JJBA 1F2VA 1OLXB 1ECBA 1ZH4A 5IM5A 4A73A 4QBTA 5LMZA 4UULA 4UTRA 3ME5A 1IAVA 1Y3CE 2AMYA 4X97A 4LKRA 4M46A 3RWOA 2SHKA 2XTMA 3L4KA 2W48A 2ZBEA 3F2VA 1RTTA 3ECAA 1EWYA 2YFYA 2VT3A 5E38A 4HAIA 2DETA 4O6VA 2MSKA 3WP1B 1UKBA 3P2KA 5J4HA 4Q4JB 4BAZA 5DTQA 1SHLA 4M6WB 4CM3A 2YOFA 4LMAA 3FJOA 2H31A 1P8JA 3PD0A 2YJZA 4K81B 5J1TB 3SSAA 5C9ZA 4MGEA 3PJRA 1UDXA 2WF6A 5IUJC 2IF2A 4M60A 1EM8A 1KHHA 5ES3A 4NZZA 1UZAA 2PCJA 3QKWA 5G0TA 1UINA 3AWDA 1OWLA 2CXHA 2PX3A 2WWGA 3I9FA 3I64A 2BGMA 1PEYA 3S44A 3VKWA 4XWTA 3G5TA 4J0HA 4IDFA 2GXAA 1USVA 4UBOA 3X3HA 1RYNA 3BWMA 1N7JA 4YHHB 5IDVA 4Q9HA 1H6BA 4GOMD 4AJKA 2PX0A 4ZAGA 3DGEC 2BGNA 4P7JA 1FFYA 3OMXA 1OF1A 5F9MA 4DCOA 3GDGA 1DV2A 1KDVA 4Z1MA 1S0UA 3R9IA 2GZSA 4K8RB 3CV3A 2NO6A 2UYYA 3SF8B 1R4NA 4L9WA 5C1PA 2IIVA 4ALJA 2WIKA 3ITEA 4BGUA 4WASA 1YD7A 5CLQA 2ZRIA 4GPBA 2IBSA 4HB3A 3VR3D 3EC7A 3HYNA 2WIFA 4JHLA 4LYDA 5E0OA 2IBMA 3TNLA 1EG7A 1FYEA 2CNDA 3M33A 4LJYA 1OILA 4X1IB 2NP7A 4PO3X 1KKLA 3FR7A 5FV7A 5J3JA 3W6OA 4J1TC 5JECA 2ORED 3PC2A 1F4LA 1E2QA 4UU1A 3HKBB 3GG2A 5EJAA 1SC3A 3UTDA 5J2TA 1JR3D 2PL1A 3KEQA 2JGRA 2FV8A 2WT9A 1I5RA 2N3ZA 3GJXC 4DNPA 1LVHA 1QK3A 3KR2A 5HZMA 4RTMA 4Q15A 4UATA 3E3AA 4ASUD 4OFZA 4X85A 4EG3A 3QBEA 2OAQ1 3IUBA 1KGSA 4P4LA 3AHEA 4HNUA 3AUYA 3ZDQA 3PJGA 4GUDA 5KDLA 4ZALA 3TIXB 1EFAA 5GONF 3UB2A 3BL8A 4KQGA 1O6GA 2NZXA 1HNZB 5EZ6B 3NHUA 3Q8XB 4HNGA 1VHJA 4PIMA 4ZCMA 2GZDA 1CF9A 2UYOA 1TC2A 1CNEA 1E1CA 4Q1CA 3VU3A 3UNXA 4EPXA 5JDIA 5G1OA 2WD7A 4XEUA 1SHTX 1KK1A 1L1RA 5BV1A 3TPCA 2JCGA 1PT7A 2I2CA 5ICEA 1NBHA 2PA0A 2N42A 3DZBA 3HBLA 3HYLA 3NYQA 4N4AA 2AJ8A 4RV4A 5KS2A 5B6JA 5CVCA 1HT2E 5G3ZA 5BQ3A 1PFQA 1V8BA 3OT1A 1SKYB 4P4UA 1CP2A 2PRSA 2W2TA 2XUJA 1KYXA 3ND6A 3HM2A 5CLFA 2OCDA 4UE2A 2ZAOA 3UBTA 1GKKA 1NXVA 3WK4A 3L77A 4B3HA 4Q4JA 3M4YA 3GAFA 5BP7A 5JAOA 1IN1A 3NOQA 1A9QA 1NY5A 2FRDC 4MA4A 4ZAWA 3WXMA 2D5BA 3CPEA 1GKLA 2QHXA 2XYRA 3DMTA 4ZRNA 3X1XA 1YZGA 1I7SB 2JHAA 4HDKA 3KOUA 3GU3A 1V6CA 3F3MA 5BSRA 3WJAA 4YUAA 2JZCA 2G82A 2AHRA 1OFHA 2Z04A 3K1ZA 3RR2A 1CXZA 3AY3A 1IY8A 3UAGA 1PVOA 4L4RA 2EXXA 4JSRA 1IBSA 1ZBQA 2RHRA 4LPKA 5BRNA 2FPWA 4BVBA 4D8TA 3FOEC 5LM3A 4PCAA 2D4AA 5AHWA 3AKDA 3TM4A 2PH7A 4CLRA 4LRUA 4CL8A 2ZU0C 3WYDA 5CH3A 1OQAA 3T3EA 3T06B 3HKEA 1O5IA 1UBGA 2OBBA 3IR6A 2J6CA 4RZQA 5CB0A 4ZT2A 4N03A 1SQ5A 3KUXA 1QFXA 2P67A 4NNOA 4XPIA 2XWPA 4I8DA 4UW9A 1UXIA 1UBRS 4D4KA 5SICE 2YZGA 3RODA 4FR2A 3VBCA 2FXIA 3FVTA 1RIIA 1DB3A 1YIDA 2XVMA 4B4UA 5L3QB 2PD4A 1AE1A 3WVNA 3GLFB 3O90A 3VI3B 3H11B 5DXAA 1YB6A 4AJPA 3H8JA 1DWOA 2PO5A 2ZAIA 4MUMA 1OWPA 2AZDA 1V26A 3JYOA 3U1TA 5IZCC 5EPUA 2FMUA 2RHTA 1NNUA 4OX9Y 1RLMA 3NJRA 4XARA 1F4PA 1WHSB 1R4MA 1H2ZA 2QNRA 4KXWA 4G1FA 3IP1A 3KHSA 4NFYA 4RU1A 4WECA 4HN2A 4OK5A 2ODNA 1T8RA 3D4IA 3JTMA 4DMKA 4X9XA 4G0QA 1FSGA 4QDXA 3C6MA 5CCXA 2FFQA 4W9RA 1GPH1 3CVVA 3R7WA 2IZ7A 1YNOA 9ATCA 5HG0A 1XEAA 3LCUA 2PQ2A 2G4CA 2QJRA 3DOJA 3N2GB 3GIDA 3QBJA 3OLXA 1ZGGA 3PX2A 5TQ2A 2OYRA 2O8CB 2C98A 2V9ZA 4AQ7A 1JIQA 4R84A 3QPUA 4BLOA 3BXPA 2F43B 3LKBA 5THQA 3BS4A 4LNUB 4ZOQI 4GMXA 5IT9A 1BVRA 1VDMA 2X8LA 5CNJA 5DXJA 3HR8A 4C3UA 4XPIB 1YKGA 3Q2KA 4BP1A 4H7HA 3W8NA 3GELA 4IG4A 3GMIA 3HJFA 1PR9A 2EW2A 1ES9A 2FSVC 4URHA 5E6SA 1WV0A 4Z1MD 2ONCA 1U2QA 2AJCA 4MQMA 4WOCA 3LHFA 5TR9A 1DHRA 4B73A 2HPHA 1D2HA 3DWIA 4Y1GA 1SHKA 3W34A 4RL4A 3UT5A 1U2ZA 2P4QA 5KOIA 3ONNA 4W7HA 1G6OA 1SCKA 4HQLA 2CMDA 1G2OA 2I7TA 1V8OA 1MX1A 3EZNA 4OG2A 1ESNA 1EK6A 4FDVA 1W88A 4RDCA 2A35A 2HA7A 1ULTA 2QR2A 2XOXA 4CM4A 1ZIOA 2GEBA 4EUFA 3CNEA 2QDXA 2ADOA 1ZPDA 2H1RA 4PO1A 5EHZA 3EIWA 4G89A 4WV3A 1X1TA 4MZXA 3BMCA 3E3OA 3U61B 1QGDA 1TNDA 3TLJA 1COWD 2RH5A 3MK31 4JBGA 3OQ6A 5B1SA 1G19A 4QKQA 4IDCA 4QRHA 2IXBA 4A6XA 4HH3C 2WM8A 1ULBA 2YHIB 1W47A 4JWTA 1W88B 4X24A 4DJJA 2HBYA 3U3RA 2GN8A 4A26A 2DSNA 1VGVA 2BEKA 2AFHB 2Q2NA 5TVGA 2A3RA 4CI0B 2JIZA 4D96A 1FJGB 1QR6A 2ZR0A 1PIWA 3HA5A 3NNNA 2XGMA 2LE0A 4JEHA 2PD6A 1KA9H 1L7PA 1JZQA 4OL0A 4LTNA 4BO3A 2E1PA 4CGYA 1T9GS 2M6SA 2IDMA 2VAWA 3IOYA 4YRQA 2JFBA 1Y37A 6GPBA 4QPJC 1V45E 3STYA 1PHRA 1T5DX 4EG0A 4HBZA 1P4AA 1OKKD 1VHQA 3ORFA 3WDKA 5I7FA 2VUSA 1JDNA 3AY6A 5CEEA 2C96A 1EE1A 2QS9A 3ZLJA 4IWXA 3H75A 1DDIA 3PIDA 3Q98A 4U0KA 4GOKA 3RBZA 5CFMA 4JBHA 1UBEA 1CUAA 4HAZA 4IIUA 2O23A 3I52A 3COZA 5A9SA 4ZEXA 1PJSA 3FMIA 3KK0A 1STOA 4MCIA 3DBLB 1NUHA 3NT2A 5FLEX 4F91B 1ECFA 4OQNA 2QRGA 4TSRA 2JFOA 3I53A 5J40A 3BFPA 3A10A 3PFKA 4MV0A 5AYVA 2V4MA 2ZRKA 4FZVA 4KLAA 3RADC 3PWSA 3B8HA 3AUFA 3M6FA 3NAZA 4YREA 2WB4A 4ASUA 2IOHA 3C41J 3CH6A 1UPCA 1VIAA 4D4HA 1L8XA 1UMBA 5JAHA 4XWYA 3WRXC 5JSHA 3JYLA 4BCCA 1I3MA 2Q5IA 3A06A 3I23A 4NJEB 1E63A 3QG5A 1LZLA 3GNTA 4MP8A 4DM4A 2DCUA 4EYOA 1RM0A 4J43A 1SZDA 4G5GA 4L8FA 4M88A 3QQPA 4NEQA 1JQ3A 2V55B 2ZDGA 2QG6A 3PPIA 3ZUGA 4C01A 5K0GA 3IC5A 1PTKA 2CLIB 4JWKA 2AEMA 3DHNA 1JLLA 1XQ6A 4KIUA 4NHEA 4MULA 4EJ2A 4XWAA 5H80A 2YJTD 2NSYA 1X7YB 2ZS7A 1V7ZA 1U0HC 4MO2A 5A2GA 5K0CA 2AOTB 3OPMA 4NSNA 3BOSA 1CK4A 7GPBA 3D4OA 2YV5A 4NJEA 1BYUA 3OY2A 3FOBA 2TS1A 1DEHA 4OJYA 1WCIB 1CFJA 1BFUA 3SF0A 1NG9A 2DFKB 1A9TA 2XCTB 2BFEB 1T91A 3VAAA 4HB2A 4NARA 1UJBA 1EXWA 2NP6A 2Q5FA 3F67A 3FFWA 1W0JD 1W59A 2IP4A 1QIGA 5AVJA 2CBXA 2WVGA 1NOJA 1QCZA 3DTYA 1CR6A 1Y4SA 3UA4A 4EP1A 3BMQB 2GPJA 1ZC4A 4X7BA 3H6HA 2F1IA 2IS6A 1FTYA 3ENWA 3SX4A 3UYLA 4JAVC 2OZLA 2ZE7A 2WE7A 1SCUA 1W52X 5ILOA 2WLSA 2XY4A 3GJ5A 4OK6A 1FYVA 3QUAA 3GUVA 4XOIA 3VDNB 3QLJA 4LF6B 1VJRA 3FPCA 3RUFA 4MVJH 4I1VA 1F1JA 3DYIA 3KSZO 5REQA 5I4KA 3K09C 4PZYA 5E7MA 3TCNA 1ZW6A 2HTFA 3UT0A 4ECEA 1EVYA 4P22A 3E7DA 5HQJA 2XSZD 1JUDA 2NSJA 1U0OC 4LK2A 5EZYB 2WYVA 1NF3A 5K8TA 2C2YA 1UH5A 2VWQA 3EGDA 4GLJA 4DR2B 4F3TA 1WMSA 1YQTA 2BSXA 2B3DA 4YAJA 2FR0A 3KAJA 3L05A 1T0JB 4B3JA 5C7IO 1SHZA 3MGKA 4J2TA 3LAWA 4KXUA 1KYWA 1K4YA 1XDSA 2QG4A 3O2SB 4MX8A 1MHTA 1C30A 2EJVA 5LYYA 4AJNA 1DQNA 3HVKA 4CEHA 3O74A 1SQ6A 2RK3A 5E0KB 4JI0B 3L5KA 2B4YA 3T7IA 4XUCA 2DG2A 3DULA 2BCGY 1QHSA 1T25A 2WPNA 5IG2A 5LP6B 4C4PA 2OK7A 3KPVA 3NATA 2X86A 2X5KO 2QLTA 3CLSD 1DINA 4CQJA 2YS6A 3AJEA 1GKIA 5H81A 5AW7A 5CCEA 2ZIEA 2V9CA 1Z8FA 2J3LA 4N7BA 4MYUA 4TUYF 1XVIA 3R1IA 1D7AA 4Y1FA 2P11A 1TK3A 4ZCTA 5JJBA 3M7IA 2GFQA 1NPYA 3H1AA 3Q8LA 5JLAA 1ML3A 3A28A 3B89A 3CZQA 3FKSA 3PXCX 3SM9A 3LVBA 3Q87B 3ZNNA 5TLSA 5IUNC 1J0EA 3M4NA 3BDVA 2XNKA 2CCGA 4Y98A 3QU2A 2FN9A 4Y0NA 5J5AA 4CCAA 4RHYA 4PGAA 4D42A 4PBTA 5EVCA 2ODWA 4D4LA 2BOVA 3CINA 1IZ7A 5TB5A 2BJWA 2BGIA 4TKVB 2FB9A 1QH8B 1T8YA 2IDKA 1ESMA 4XX0A 3WNVA 1N9ZA 1M2JA 5CFOA 4M89A 4Z4EA 3JQ7A 3L8FA 3U9LA 5K4GA 2YZMA 1JECA 2EW8A 5F1YA 3QKSA 5F2NA 1Z39A 1MAAA 4I50B 4BKOA 4IIFA 4A8JC 3V8MA 2XLCA 3A9VA 2JLRA 1R9JA 1KZ6A 3Q7QA 3EH1A 2H2AA 2B61A 2GF2A 1TUGA 1JDZA 3NC1C 4OGGA 4U7WA 1FFBA 5LZ8A 3KR0A 2TECE 4RMHA 1P61B 3V34A 4EAAA 4O2AA 4F4FA 1GQFA 3AP3A 3PHIA 2C92A 4G2TA 4S2UA 3QKSB 3FSGA 5AVUA 3BMXA 3KALA 2GCOA 4JNKA 4WK6A 5KVCA 3JD1A 3WIEA 5ALSA 4NS1A 4B8YA 3BA1A 1L9KA 3EA4A 3RGWS 1WEHA 2ZQYA 1FNBA 3IKTA 4AZVA 1TKBA 3EZLA 1C7JA 4TVOA 4LDQA 3R0VA 2LKDA 2HTEA 4ND4A 3W2GA 3QPCA 5DI9A 1EFHA 5AESA 4DDUA 2ECOA 4KQJA 4I0WB 1TC1A 1R5NA 1ZI9A 3V4FA 2X6RA 1CKEA 1K4MA 1F5NA 1L5KA 2Z1NA 5GV7A 1TGVA 2TMYA 6REQA 1ZRMA 2HM7A 3A4VA 4I4TF 1V8DA 3NWJA 2P9JA 4NF2A 1BIFA 4P7FA 5HFAA 3TW6A 1VB3A 3K92A 2ZJ5A 4LZJA 4RTNA 1PYOA 3HCBA 2GM3A 2WC1A 4BV2A 3AKCA 5G1NA 1QKJA 4W4TA 2VYQA 4NHOA 3DOEA 1ODIA 2BTQA 3OECA 1SBQA 4BY9E 4LDRA 4XR4A 1KOGA 1D9ZA 1NI4B 3ILHA 3MXOA 4Q9DA 1GGNA 4CEHB 3A36A 2NXEA 2GMWA 4H1HA 1SCIA 2FE4A 3GJ7A 2ZZNA 1HQCA 3EOAI 4C76A 1PNOA 4M8IA 2FW1A 3LT2A 3O26A 3CZAA 3R6TA 3L7OA 4FHCA 3GEHA 5CMLA 3ROZA 3TEJA 2GASA 1ZWKA 2AFIA 2O7VA 1EBUA 2VEOA 3B3FA 4MKXA 1QZUA 1SD2A 2ZVDA 4PRZA 4WN9B 5EZYA 5TPWB 1Y5MA 3VH4A 4D0GA 2Y0EA 1EUCB 4HZUB 3DSRA 3F5SA 2Q4DA 3DLPX 1OSNA 3RUCA 2VXYA 3NCTA 4IMJB 2E82A 2D8AA 5DTJA 3A6PC 1BE1A 3B1WA 1RHJA 5FRDA 3QEMB 3OETA 4I1IA 4MMXB 4YP6A 3GNSA 4BZZA 3NQ41 1DKUA 4HRAA 4Y1EA 2LZ0A 1E3QA 5ALZA 3D8NA 5JSFA 1NY6A 5AI6A 3HP1A 1X13A 4ZYWA 3FUXA 3OIWA 1DXQA 1PKEA 2Z8YA 4OQLA 5JAMA 1VLHA 5KJFA 4JH0A 4BVAA 3OJLA 1Q0RA 2FSGA 4EG5A 2BY4A 3BJEA 1N2CA 5KWJA 3I9NA 4CMCA 5FBQB 2EFDB 1YR7A 1FYWA 2W93A 3VZRA 3PQ2A 3Q7RA 1T8TA 2ATXA 4Y6QA 5KAMA 4YQYA 1WXXA 1E6LA 1SCAA 3BXFA 3PFIA 2I3ZA 5B58C 5HJ5A 2QRQA 3U4HA 2QZPA 4AO7A 4ZI7A 5BSVA 1HL3A 2B69A 2YV2A 1ZM9A 3BJIC 2XMQA 1EVQA 3HYRA 3V48A 1XRQA 1J21A 2GK7A 1ODLA 1UMDA 3DAGA 2XAAA 2FETA 1O4WA 4PZ9A 1MLDA 3B85A 1OJLA 3AXSA 3FN4A 4ZO6A 4ZOLF 4ZOEA 3FGZA 1RM3A 4Y2HA 1QIJA 3VOBA 4FT4A 2YH2A 3R24A 4MV6A 4GECA 4IVQA 2UZ1B 3MUNA 2UUAB 1VRVA 1G66A 4TN5A 4XLLA 4ENWA 3EVDA 1VCIA 3DFUA 4HDSA 1YMUA 4UE6A 4PQGA 3VV2A 1VBNA 2VA9A 2WIJA 1HETA 3T9EA 4TYMA 3WK5A 2ZJ0A 4HAWA 5F51A 4RLSA 4A0SA 2YUIA 4UBNA 1J1IA 1NR7A 3HSSA 3NEPX 2VJAA 5FNVF 3UN1A 3RWBA 3WDMA 4JJ4A 3E2PA 2V7BA 1XMPA 4PLHA 4RHCA 1UR5A 2EKZA 2O50A 2QVCA 2XT6A 5K8IA 3JRXA 4LRTB 7YASA 8ABPA 4WLOA 5KI6A 5BVGA 1B3BA 4MGZR 3VR4D 4C9BA 4K9RA 2XOKD 5BW6B 3TUZC 4AMUA 4YCJA 4LF7B 2BLLA 4R68A 4LFAB 1GPBA 3W2FA 3FHLA 2VSXA 3L46A 3LDGA 2G5TA 2CXRA 2P62A 3L0YA 3IQWA 3WE7A 4AM8A 3G49A 3NTLA 4EOGA 1NYLA 5KX5F 3CYFA 4LCJA 2RGWA 2VRCA 3P45A 4IDNA 2VP5A 3X2EA 4HDNB 2BJVA 4PC1A 4UVDA 1ZHOA 5BMVA 1P9OA 2ZS9A 1R6VA 3E61A 1C41A 1ESCA 5IZCA 3NHKA 1OYOA 1XQ1A 2IYNA 3ILXA 4OYLA 1V71A 4FOLA 2V7TA 4UZEA 5H9VA 2GA8A 3R20A 3PPYA 4J03A 3RYCB 3IBFA 4LF4B 4OO3A 4MWGA 1S3GA 3DWFA 4O5AA 4TVKA 5GJCA 3PPVA 4TKVA 3KKKA 4IDEA 2BRUC 4N3AA 3P0EA 4Z2YA 1CJCA 1SOMA 1MDBA 1YRYE 2IBTA 5AM3A 1LC0A 2JAXA 2PMDA 1V2GA 2GN0A 4EJMA 1YKSA 1LW7A 3EZ2A 3NBKA 1WMFA 7REQA 1E2FA 1QOZA 3A0RB 3ZDYB 2FUG1 5F2OA 4RWEA 4DUGA 4FCWA 5A3JA 2YWHA 4GKKB 3TLGB 3GEBA 1EMDA 2GT1A 4ZEOA 2HMUA 1GUYA 2VDWB 3MOGA 2CWDA 2AOUB 4UOEA 4Q4HB 3V8QA 2RB5A 3BXGA 3PDJA 2ATIA 3IPCA 1DAGA 3QKRA 3IL2A 3SQNA 3FDZB 1RM4A 1I5OA 3STHA 2YYSA 3PFFA 3U0BA 4MSUA 3D1JA 1EVZA 3VTZA 1X15A 2R97A 3AO0B 2C7BA 7REQB 2WKPA 4YDSA 3G7SA 2LPMA 2ZSEA 1X1EA 5FJIA 3ROFA 3ITKA 3VKVA 1HEUA 2XZPA 3JQ8B 3Q7EA 2O54A 4R8KA 3RIGA 1BHQ1 1U80A 3TOCA 4ZQHA 5HZKA 4ZIRB 2IXGA 3KQWA 4BYGA 1DIGA 4HQ0A 1GQOA 3ZWYA 3MGAA 4EG1A 1MABB 1AZSC 4EUNA 1B7GO 2R3SA 3R9WA 3JYQA