3LG3A

1.4a crystal structure of isocitrate lyase from yersinia pestis co92
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
419
structure length
419
Chain Sequence
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTASSMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
molecule tags Lyase
molecule keywords Isocitrate lyase
total genus 144
structure length 419
sequence length 419
chains with identical sequence B
ec nomenclature ec 4.1.3.1: Isocitrate lyase.
pdb deposition date 2010-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lg3A00
1F8IA 4HYWA 3OYZA 1OQFA 1S2TA 2VGFA 4KCUA 1PKNA 4IQEA 3BJFA 4QG8A 1DXFA 1U5VA 1F61A 3GR4A 3EZ4A 1PKYA 2L5HA 3QQWA 4KS0A 3MA8A 4B2DA 1M1BA 3R4IA 1E0TA 3PUGA 4IQDA 1OY0A 4WJ8A 1PKMA 4B5WA 2HROA 3T05A 2HWGA 4TV5A 3ME3A 1F3XA 4L9YA 3QZ6A 1A49A 4FXFA 2G50A 1S2VA 5TAOA 3E0VA 2VWSA 4B5UA 2VGBA 4KCTA 2VGIA 3M0KA 1DIKA 2OLSA 2R82A 2XZ9A 2WQDA 1XG3A 1VBHA 1U5HA 3N25A 3QV6A 4G1NA 1KBLA 3KHDA 3IS4A 3HQOA 2DUAA 1VBGA 3E5BA 3G2GA 3HQPA 4MG4A 1GGOA 1UJQA 3KTXA 4HYVA 5JVLA 4KCWA 3QLLA 1A3WA 2QIWA 2XZ7A 1T5AA 4QG9A 2E28A 3T0TA 1O68A 4B5TA 1MUMA 1JDEA 3EOOA 3QV8A 4TV6A 1IGWA 4LSBA 3I4EA 4JPGA 1AQFA 4B5VA 4RPPA 3LYEA 2X0SA 3GG8A 3M0JA 3PP7A 1ZJHA 1DQUA 2VWTA 3SRFA 1S2WA 1F8MA 1Z6KA 3H6OA 3EOEA 1O5QA 3U2ZA 4MF4A 1SGJA 3OYXA 1IZCA 4L80A 3QTGA 4KCVA 1E0UA 3E0WA 3BJTA 2DIKA 1XG4A 4IMAA 3SRKA 4FXJA 1KC7A 3OQ8A 2BG5A 4KRZA 2HRWA 3T07A 3QV9A 2V5KA 3GQYA 3SRHA 2ZE3A 1F3WA 3EOLA 1PKLA 3HQNA 1A5UA 1M3UA 1A3XA 4YJ5A 4QGCA 3SRDA 1O66A 2HJPA 4ROQA 2XDFA 4B2DD 2VGGA 1DXEA 4L7ZA 4L9ZA 3P0XA 3VAVA 3B8IA 3FA3A 4B5XA 3QV7A 4B5SA 1S2UA 1ZLPA 1PYMA 3FA4A 4IP7A 3LG3A 2KX9A 4QG6A 4DRSA 4YNGA 2V5JA
chains in the Genus database with same CATH superfamily
3AISA 4Y7EA 2JKEA 3MKKA 4PB3A 5CC5A 4BQ2A 3TWBA 3DKJA 1YIXA 2P0IA 1E5JA 1A49A 3TVAA 3KCOA 3OODA 3CLMA 2PI6A 1CPUA 3P81A 3T1GA 3SJNA 4MHBA 4DX3A 2G4FA 4UNIA 4XKYA 4DM2A 1GVFA 7PTDA 2NX3A 3GYCA 3SCUA 4KPLA 4GVGA 4H9TA 5HQMA 5GQBA 1TIMA 5CG7A 3S5SA 5A94A 5B7YA 1NFGA 4DUVA 3KCLA 3LYEA 3UGVA 4LUYA 4JL2A 3U7VA 4XTDA 3K4AA 3JUGA 3TQ0A 4O53A 3PB0A 2JEPA 2RJGA 3OB8A 1U33A 3S5OA 2EKGA 3W9ZA 1UH2A 4B9ZA 2X40A 3A5VA 4R27A 2J75A 5AYZA 1WKYA 3MSDA 4IMDA 2YDQA 3S1XA 4PMRA 4YTUA 3BG9A 2EG8A 4AVOA 1GVOA 4RX0A 3BSHA 1TQXA 8CGTA 2WMKA 1XIBA 2ALRA 1NWSA 5BRBA 3A22A 3ZLGA 3IJ9A 1DIDA 3O0KA 2QJGA 1RHCA 3JRKA 3NAVA 3WBWA 3CUZA 1NIUA 4QROA 2ZRUA 4XUYA 1XLEA 1DEDA 3NZPA 1QBBA 2PBOA 3W02A 5HDRA 2EPHA 4G1KA 1VGAA 3IANA 3JW7A 2NVCA 1FWAC 4L9YA 1K8YA 2DPEA 1BTMA 2CZFA 2ZZ4A 5AB3A 1HZYA 2ONEA 2A3CA 4XV0A 3VIKA 5J04A 1I8JA 3A4WA 3CL8A 2Q01A 4DO5A 4J7RA 3F5JA 2A6LA 4FIRA 2VFGA 1W1YA 2TODA 3BSGA 4XZNX 3WLKX 3CEUA 1TV8A 2D0FA 5A2BA 3M9YA 4HSOA 3MCNA 2QPSA 2VEGA 1RJRA 4MY1A 4WCJA 1BG9A 3WF4A 3GH7A 4Q4SA 3HMJG 3C4UA 4KEMA 5G1YA 3EDKA 3HG5A 1IZCA 3PPCA 1SSGA 4QLKA 2IXVA 2I14A 3BXWA 3VKDA 5G2HA 1KRCC 1X8FA 5FJPA 2WM1A 3NEHA 1X97A 3O7UA 3GQYA 1DHKA 4NJIA 5D32A 4L56A 2CIPA 4LALA 1EGVA 3TYCA 5E0CA 4Z0JA 1HGWA 3WJXA 1ZAJA 3NO3A 1XKJA 3TUUA 3AHXA 1U5JA 1AH4A 3EMQA 5D2TA 3BLPX 1FH8A 3QHNA 1OGSA 3GIQA 1NDWA 1LQ2A 4YTQA 2C16A 3KL0A 4HA4A 3L12A 2Z1WA 1ZJBA 3AUOA 3UXLA 2CHNA 1W32A 1XRTA 1BRLB 2ZVIA 3I10A 3PF3A 2KAUC 1XFCA 4DWSC 3PZUA 4WDUA 3W28A 1E3XA 2QVHA 4G56A 4C1KA 4YVPA 3CWNA 3CZLA 3CMGA 3P62A 4P8XA 4A3RA 1JGIA 3S3GA 4B92A 2Y85A 2WBGA 2WJEA 1GKPA 3A6OA 4UQEA 3UYIA 2G37A 2X16A 3CEPA 4D8LA 2RGLA 3KWSA 3D3FA 5I7GA 4QP0A 4PB4A 5A6LA 3CXOA 2VHLA 3UPMA 3GTXA 3LPGA 3AZSA 4K7VA 4IFOA 5HNTA 2DP3A 1XWYA 1GOMA 1U30A 2V5KA 1W6TA 3PG9A 1E73M 1VD6A 5GNYA 1KXVA 3M07A 2VFHA 1Z44A 2VM8A 1VCGA 4YL2A 1G4TA 4HU3A 2CBJA 5KSWA 1QDSA 4KIRA 1UD8A 5HWJA 4A21A 4UZSA 1TE6A 1FWJC 1SO4A 4ZOEA 2ZTKA 2DZPA 4IZGA 3PZ9A 3QSTA 4Q7NA 5CJ5A 3NQDA 2OO0A 4H41A 4A3QA 2D3NA 3H54A 4WKFA 3DFTA 1Q3NA 3W2JA 3KBWA 1WO2A 1G0CA 1QUMA 3SCQA 3EPOA 4C6LA 1J5SA 4H19A 3GDRA 1GW9A 3SQMA 1MEHA 4DJFA 1LYXA 1ISVA 2J74A 4WK9A 1JPHA 1SW7A 2DSWA 3L0NA 4G1NA 3LZ3A 3THDA 4PC8A 5LHEA 5A8MA 1UB3A 3GW3A 4BF9A 4P8WA 1B9BA 1XDJA 1U22A 3VDGA 1O68A 4ZODA 2W27A 5GVJA 4LC8A 1KR0A 2NVAA 5SWUA 1JZ3A 5MKGA 4FNRA 2J47A 4X22A 3R58A 3UG8A 3AJ7A 3PS7A 4H2CA 4NJGA 4XIAA 3TN3A 2X09A 4NZCA 4DELA 4AZBA 3W2LA 2PWEA 3ARTA 1SGJA 1EJUC 3ISIX 3UBPC 1XG4A 4I5UA 1MQPA 3R8HA 2ATSA 4YVXA 5HMDA 3VU2A 3DXIA 2F2KA 4ZSUA 2FFIA 4P8VA 1CTNA 4HTYA 1KM2A 3O6AA 1FTXA 1FDZA 1LT8A 4KWUA 1IR2A 2OFJA 2BOFX 3JU2A 4O19A 2PDIA 4LFYA 1E6PA 3WELA 1C8QA 2VFEA 1EJVC 3G1FA 5FEPA 3ARQA 2G96A 3WBYA 3TQPA 1TSIA 2IS7A 4JN8A 2ASHA 5I24A 4DM1A 1LOQA 5EMKA 1TTIA 5HMEA 4KRUA 3VIMA 3FX4A 1JIBA 4Z2JA 3ZT7A 2J7CA 3F4WA 3RLHA 4ZO6A 1UP2A 3PZVA 1PPIA 4G6CA 1E6XM 3WDPP 5HJXA 3NEVA 1R5YA 3LZ5A 4KH2A 1FWWA 4UTWC 2WV8A 4NNCA 2FLIA 3G18A 2DZTA 3WX7A 4AWSA 4OHQA 3ZR4A 2I9EA 4MNLA 1HTIA 1P5BA 2UZ9A 1NDYA 4MVAA 4C6CA 1M01A 3SSJA 3UP8A 5BRQA 1UBPC 4GX8A 2A3LA 3WD2A 2VMFA 4KQNA 4DJFC 1DJXA 4IXXA 2VOTA 1K77A 1BFNA 3AJXA 4MDOA 5JU6A 4OECA 5HINA 3O6YX 3CMFA 1Q6QA 3EWYA 2CZDA 1L0PA 2WMIA 4H9YA 2X42A 2X2YA 1V7YA 3GYEA 3W25A 1FWHC 1U83A 4H01A 3BLOA 1E4NA 4CD7A 4PL1A 4Q32A 2WSPA 5J8LA 1J0YA 3DC8A 1KFJA 2VGGA 2E9MA 4GYPA 4C60A 2QMKA 3WY1A 2ZZ3A 3HPFA 2P8BA 3G5EA 1QXLA 3NR0A 4MDPA 3GTNA 1ENUA 4QNEA 2Y8UA 5IHSA 3A3XA 1ZBCA 3FKRA 3LCHA 4JTIA 3QHOA 1G01A 5DT7A 3RDKA 3SN0A 2BX7A 4XO7A 4M24A 1Z42A 3MBFA 3V5OA 4JS3A 5EB8A 4WIWA 2ZRVA 4LRSA 1B4KA 1L6GA 4DJDD 4B3KA 3PBUA 4C91A 2WLZA 5ABEA 2VP8A 5LGXA 5T91A 3GNOA 2E28A 3PR2A 1LJYA 3G1DA 1A3HA 6XIMA 1R86A 5H6HA 1YDYA 2HBVA 4Y9OA 1I6NA 1DTUA 1EJRC 3EX4A 4DWDA 2HVMA 1KM0A 1JPKA 2CKRA 1E0XA 3LHTA 4JTUA 1XP3A 5FEZA 4ZOCA 5CPQA 1FXQA 3ITYA 1I9CB 3GAYA 4F40A 4JHOA 2PZ0A 4TTUA 1ME7A 1HT6A 4C7DA 3AHVA 1FHVA 1M9HA 1O60A 4M0XA 2QHAA 4AZCB 1HP4A 4RK8A 1KWKA 7ENLA 1B0IA 5HANA 1W1ZA 2ZE0A 4MSSA 2FJUB 1DXEA 4D1IA 1O4UA 3C0QA 2BY3A 1L2UA 2A7RA 4DZAA 3QSRA 3COTA 1HO4A 2R9RA 4UUIA 4A4AA 4D8AA 3T0CA 1PZ0A 3OVRA 1E6RA 4UTJA 1D3CA 4TVCA 4GVHA 1M03A 4J3WA 3VFLA 5CJMA 2VI0A 1PCKA 3P80A 1ALDA 2QCFA 2XN1A 3AMKA 2F84A 4UTIA 3H7RA 2CW6A 1U5HA 4J5NA 5IDIA 3TJLA 2VEFA 4QJ1A 2VEIA 2WLYA 1VC4A 4O15A 2QZRA 4QDWA 3RCNA 4B91A 3TN4A 3O3RA 2C1GA 1XCWA 4K2SA 3VFCA 1GVIA 1RQEA 3W3OA 1ISYA 2UBPC 4XBKA 3I3DA 4XKMA 1VS1A 4JIIX 3QY7A 4K36A 5GNZA 1V3IA 3GDKA 3LGDA 3LERA 3CYVA 1GQLA 2D0GA 3EYPA 5EU9A 1SO5A 1VHNA 3GD6A 3S5YA 3P3BA 1SJBA 1EQCA 2PU0A 4CU6A 1TV2A 4M6UA 1N8WA 2TMDA 5K9DA 2HE8A 1A47A 3LRLA 1W0MA 3MWAA 5ECUA 1MRQA 3UWZA 2GFTA 3EDDA 2DT2A 1ZPTA 1XLHA 3C6CA 1YEYA 3VM5A 4M7TA 3BZGA 5TNVA 1E0TA 1RY8A 2GPTA 5IDZA 1GEQA 3PTKA 2ZRWA 1F3EA 4C5ZA 4O57A 1XBVA 3JS3A 3E0LA 4ZQNA 2I7GA 3OVQA 5A6MA 3TH6A 2OLSA 9CGTA 4GWEA 3RU8X 4MKVA 1TPWA 3G1YA 3L4TA 2V2CA 3REQA 3WBXA 3NO1A 3BZJA 1A50A 4D6CA 4UTHA 6ALDA 1UMLA 1DV7A 4QE1A 4RNIA 1C3FA 4P61A 2VZSA 1W9BM 1LT7A 1EYWA 1W2PA 1R3QA 3ITTA 1KR1A 1NDVA 1ZJIA 4WY0F 4BWLC 1P6CA 3TTEA 2PD9A 1CT5A 1OIMA 2GJPA 3XINA 3EKLA 1Z6KA 2Y4SA 4NRRA 4Q8NA 2GQ8A 1TYGA 3VILA 2JGQA 4PMXA 1TPC1 1QPKA 5KZEA 4J3SA 3SI9A 3N1AA 4W7WA 3WF2A 4GHRA 2VC5A 1E0WA 4RDZA 3VMPA 5HQLA 1GW1A 2QNEA 2EPOA 3W6YA 5AECA 1JCMP 3AROA 3ZLHA 4GC4A 3SW6A 1K9EA 3WLNA 2POTA 1VJIA 3ZR5A 4X3ZA 2X30A 3SCPA 2GOKA 4J9JA 2XIQA 3ONCA 4KKXA 5FJOA 1J79A 1QI2A 2HNEA 2OMAA 1H1YA 3WF1A 2W63A 1XBXA 4IPIA 4GIRA 4GO8A 2RDTA 1D8CA 4DJDA 1XRVA 4Z1BA 1XYFA 3BPWA 1ZALA 2E67A 4CQ9A 2YB1A 1QTWA 1I2RA 3A23A 1I1WA 1JCXA 2WC3A 3FJNA 5JVLA 5AC4A 1EOKA 4PBEA 3KS5A 1A3WA 5I0DA 1CIUA 3S6OA 2AKMA 3TLQA 3G1AA 2ZCGA 4A3YA 4EPDC 4AWEA 1UP3A 4XSMA 1H0IA 2H8XA 5LXXA 1CLVA 1S3TC 3LV5A 2FZBA 2GDQA 3NA8A 4JX4A 2CZ5A 3M16A 1KRBC 3KVJA 4DI8A 1WBJA 1HKJA 2ZA1A 1K3UA 2NXHA 3EXRA 5DMLA 3H4WA 3SIZA 5D03A 2YLLA 4UOQA 1S2CA 3DHPA 1ZY9A 4JTJA 3TN5A 3R10A 3K1DA 2G3MA 3WQ4A 2GVYA 3CBWA 3B8DA 2IMRA 4GX9A 1FA2A 4LXFA 4DJFD 3G24A 1GT8A 2O56A 3WQFA 3VNIA 4DPQA 4LUJA 3UR2A 3GRIA 3GVGA 1LBFA 4NX0A 2Y7EA 1E72M 4QM1A 1L9WA 1UR4A 1H3GA 3WDJA 3PULA 2WWCA 1PZ1A 4AC1X 4ASTA 4AD2A 2Y88A 3PHAA 1X39A 1KKOA 3K1GA 4HPNA 5CGMA 3LHUA 4QNWA 3FIGA 2DVUA 1FWRA 2AAAA 4GC3A 4D1JA 1YNQA 3KWXA 3SUSA 5K9XA 1FCVA 4IG2A 5HA7A 2IQDA 2PGEA 1N2VA 1RZMA 4NILA 1AQFA 2CBVA 1YE4A 4TIMA 5A5WA 4IQJA 3SY8A 3EOEA 4F0RA 2OWCA 3SCRA 3VD3A 5IRPA 1RLCL 3UJEA 4Q4KA 1FDYA 3L4VA 2F38A 2NV1A 4URIA 4UQBA 3SUWA 3T07A 5CBBA 1VBUA 3IPWA 3B8SA 1E9ZB 5DEZA 4A2RA 1BVZA 4WSJA 4S3BA 3V1PA 1K7XA 4M1BA 2XIIA 5A6BD 2FVMA 1TZ9A 3QC3A 2J9XA 5C71A 3PK7A 4AIUA 2I5QA 2H3BA 3ZVIA 2CXGA 5CPLA 2CFFA 3ZFHA 2GQAA 2B7QA 4S3JA 2X2GA 5D02A 3W37A 3G1VA 3LD5A 1GORA 4X9SA 2EO7A 3MQTA 2HROA 4N42A 4PEKA 1CXIA 4DYKA 4S3EA 3H2MA 4GCXA 5BW6A 3N15A 4H8UA 3VGDA 4R9XA 2QJHA 2DVXA 3PSVA 1RBOB 3NZ1A 1WDPA 2FZDA 3WEOA 4NAFA 1K02A 2FZ9A 4IIEA 4XD4A 3SY1A 4GZEA 5HK4A 1E9YB 2HTMA 3LOTA 1E0VA 3IUHA 1EJXC 4AUBA 2J25A 3NGFA 3MDUA 2FH8A 3TCEA 3DFQA 3N29A 5G1TA 4AHQA 2X1UA 3BE7A 3W70A 3Q58A 3ITOA 4IF2A 3CHFA 1FX6A 4W8LA 4HZMA 1ITXA 2E6DA 2R1NA 1TJ2A 5AHEA 2R1LA 2WNZA 1A3XA 2ZVRA 5AKQA 1OD0A 4IMCA 2FZMA 4XD3A 3N6JA 4RZBA 2WZTA 5LA2A 4FI4A 4ROPA 1KO0A 4ZO7A 2ICSA 3DBNA 3RR4A 3TA6A 4Z17A 3KRZA 1KFWA 3L4YA 2PRMA 3EDFA 3O06A 1SZFA 4PB5A 1SU5A 4JXCA 4MWAB 2CBIA 2Y89A 2J7GA 4H9ZA 4X61A 3STPA 4BR1A 4O11A 1TX0A 1ZU8A 3OPSA 3TKFA 1BD0A 4JTTA 2ZA2A 2F6XA 3E0VA 1V0KA 3GG1A 4KFOA 1IZKA 4FA3A 3T44A 4I9MA 4HHPA 1OD8A 3MTWA 3DKLA 1KBLA 3ABZA 1DJZA 4N4PA 1DQWA 2QCDB 1LBLA 3HQOA 1GGOA 2ZQ0A 3WD1A 3NL6A 4C7FA 2Y62A 3HPZA 3VD7A 1OFEA 4XZMX 4A29A 2ZDRA 4A8RA 4JIHA 2HE5A 1XINA 4JQ4A 3L21A 3IJ7A 3SZ8A 2QF7A 3WQGA 2ZZ2A 4TVUA 1LRTA 3G3DA 5DO8A 3QYSA 1SFSA 3UXIA 5LZLA 1XISA 3A64A 1E1FA 3VNJA 3ALFA 2NXGA 3OBEA 5E9AA 4RL3A 3I7RA 1K7EA 2C18A 4J1OA 3K13A 5JIPA 1C9DA 3ENLA 2BLEA 4J35A 4FOJA 1MEWA 1T40A 2V3DA 1M7XA 3B8IA 1WP6A 3A24A 3BG3A 4K39A 4W5ZA 5GJMA 2MUCA 5D2YA 3BGGA 1U5VA 3IVTA 3ARYA 1C93A 2AOSA 1R3RA 1RPXA 3F4NA 1BHGA 3LCWA 4XG1A 1MFVA 1EEXA 4GG9A 3RG6A 4CNNA 2OYLA 5KZ6A 3MT1A 1JI1A 2GL5A 1G7UA 3NPXA 4O8RA 1LQ0A 5JBFA 3RR1A 3L67A 5ABTA 1YADA 4LTSA 5JBEA 5ABGA 4JAWA 2G3IA 3M4HA 1JXKA 4BA0A 4ZB2A 4JFVA 3E2QA 1BQGA 1M65A 4QG9A 3W73A 1PIFA 1ICQA 2CWXA 4K7YA 3FOKA 1JZ6A 3SEPA 3GNDA 3FFSA 3CHEA 1H11A 5A6KA 3SIMA 3M44A 3NFUA 2FMOA 1OCJA 5HMSA 4M7SA 1BPLB 3H7VA 5HBFA 2YL5A 1FCBA 3U5YA 1EJWC 1E6ZA 5D05A 4NX5A 2NZLA 1WV2A 1MNSA 3S8HA 3WG6A 4LY8A 5A8QA 4ZQCA 4C6FA 4U31A 4XSLA 5LIYX 3HOJA 2XH7A 2XVNA 4PMUA 1Z32X 2A1YA 1XLBA 3OJGA 3VOGA 1ZLPA 2OELA 1C91A 1SFJA 3PFRA 1AL8A 1VBRA 3G6LA 4NASA 3W7NA 3PPGA 3UWQA 1TVPA 3GDBA 1J4EA 2REQA 2XN2A 4IPNB 1MEIA 3HJEA 5H8PA 3G8EA 3THAA 3GHUA 2CNCA 1YMYA 4PUNA 3LMZA 5FJJA 1XLIA 1NOWA 2Z2UA 4Z2LA 3OLGA 2W6RA 4AH7A 4GKTA 3WD4A 1THFD 3DFNA 1A5KC 3EOSA 4PRWA 1DE6A 3C2RA 3VPLA 3C8FA 4UIOA 4DBEA 5F1VA 1XLGA 4ZFMA 4L5ZA 4BQ5A 4YWSA 1K9DA 3BMVA 2A21A 3EEGA 2EXOA 5M03A 4INFA 3N4FA 3REQB 2YPIA 4GZJA 4DXVA 3BOXA 1H60A 1WZLA 1FY6A 3IAQA 1XJBA 1JCNA 2OJPA 2HPMA 2CLIA 3AYRA 3P67A 1YBQA 1Y5WA 3W1MA 3H8AA 4GJ1A 1TZZA 2BVWA 3T9PA 4CU7A 1AJ0A 4AXKA 4DJEC 5E93A 5T9BG 4XO6A 3VIJA 1BYBA 1MZHA 1XH2A 4IPPA 5HAOA 1HKVA 1Q6RA 4PH6A 2XJ7A 4AZ7A 3IJ6A 3EZ4A 5I3GA 3KRUA 4PMVA 3ARZA 3W1RA 1I2QA 1M5WA 2R91A 2YZRA 1BXNA 7REQB 1DXIA 4WSHA 5DY3A 5TAOA 3EKGA 1YHTA 3A4XA 1PYFA 2WB5A 1KCLA 4EF9A 3V4BA 1F7BA 3MI3A 4LVAA 4PBGA 1VIWA 2F6KA 1UUOA 4QDPA 3FDGA 3WH8A 1AFSA 5C6MA 1OFDA 3W7LA 3QZAA 1MUCA 3PBYA 3MI2A 1BAGA 2ZKMX 4JFTA 3RM9A 4HA3A 3TC3A 4HSNA 3TLLA 3HB9A 4ICCX 3P5YA 3WNKA 5LIXX 1FP9A 4UXDA 3PNUA 1XDLA 4JNMA 3TWAA 1Y65A 3HFYA 3AIVA 2PLKA 3EOUA 3RMJA 1WDWA 2FYMA 3JVAA 5DCBA 2OYMA 2QQ6A 1K1DA 2DJLA 2FVLA 3FV9A 3MS8A 1J0KA 1NEYA 2O92A 3ARUA 5I6SA 3WJZA 5K9CA 1S5NA 4UTTC 4UOZA 3TYBA 4QE5A 1WE5A 5TD4A 4NZ3A 2FKPA 2XU2A 1UWRA 1RJPA 2FDMA 1XYZA 5FF2A 3W23A 3K4WA 1DVJA 1HJUA 1NF7A 2VVNA 3L5MA 4MB4A 5IOBA 1XD0A 5TF0A 1Q2SA 1X6LA 4Z2GA 2UY2A 5F4WA 1QBAA 3NM1A 4CEUC 5AHFA 2R82A 3E0FA 4WR3A 1V93A 1AODA 1JULA 3V0TA 3MV01 4ZR8A 4FF5A 3MB9A 1JG9A 3PZMA 3ABRA 1FCQA 1WBHA 1UA7A 4HNCA 2XZ7A 3MHGA 4XZBA 4AQLA 2OOFA 1QHOA 3V0SA 3UA4A 3EWZA 3N17A 1XFBA 4JPGA 1F6PA 5TBOA 4HCDA 1GHRA 1NFPA 2VEKA 2WVVA 2EEXA 4Z1AA 2NQLA 4C6PA 1UJPA 3B8VA 3DUGA 5A8GA 2YSWA 3B9OA 4GJIA 1XYCA 5M5DA 3IACA 1UD6A 1Y5VA 2ZZ1A 3G22A 2BXZA 5B7ZA 4BK9A 2PLCA 2Q8XA 1TKKA 2WNNA 3NDZA 2FJKA 1Z7AA 2IPJA 2WHJA 4GYPC 1ONEA 3UFYA 4YPJA 5CC7A 2ZADA 4MUPA 1O66A 4OZOA 3EXSA 1J5TA 4GQ0A 4NNAA 1UD2A 1PSCA 3UWYA 5CZKA 1C90A 2W66A 2H9AA 3VOJA 4HNUA 2GJXB 4QG6A 4RNFA 3CTLA 5E6YA 1VENA 3WLJA 2YL6A 1IWBA 3EWWA 4AIBA 1CDGA 3W88A 1V6YA 1XLAA 4YTRA 2ZXBA 3E2SA 4JQ3A 3VGFA 1OY0A 3H2AA 4LAMA 3T81A 3AYTA 1B2YA 3WQ8A 4LWWA 3VIHA 1AG1O 2G50A 4M8UA 2ZTJA 3QGAC 4FHAA 1EJSC 1UKOA 3SB0A 4LB4A 1O5KA 1WZKA 2Z6IA 3STEA 1W1VA 3W2NA 4Y9PA 4Q7BA 2V38A 3IAPA 4IP4A 4GJJA 3GTIA 2OEMA 3KHJA 4FNQA 2PZNA 3AMCA 4GVFA 2WCSA 3RILA 5CGTA 4UFJA 3HG2A 2QCHA 3AHYA 3L5LA 5BWAA 4DZIA 3EMZA 6PTDA 4O13A 4AYSA 1V3MA 4DQWA 3U2ZA 1XQLA 4Z1CA 1GVQA 3N12A 3OIHA 1JD9A 2HISA 4R7WA 4KESA 1CWYA 3QLDA 3FXGA 4D71A 4QBXA 1BWLA 3MSYA 4RE0A 1VPYA 3UCQA 3DOPA 1SPQA 2SFPA 3QHMA 1GG0A 3FDKA 4Q4QA 2OT1A 2Z7KA 1ITCA 1GONA 3TSDA 1XLLA 2HPIA 4RLIA 1UCWA 1US2A 3P60A 4ZQOA 1XIHA 1R46A 3DU0A 1XIGA 3R4IA 5C5YA 3EB3A 1W37A 3KCJA 2FPVA 5I02A 1EIBA 2E9LA 1W9XA 5DBUA 4IUGA 1F5ZA 4AF0A 2QCDA 4JNYA 2WWDA 5DMNA 3QOMA 4DJED 5BOEA 2X41A 4MJ4A 2GQ9A 1XGZA 5CAHA 2XZ9A 2ZYFA 1EEPA 4UQ9A 3HV9A 2RGMA 4AHOA 3ZMRA 3O2LA 5F2MA 3KL3A 2ZX5A 3WH5A 1LTDA 3SUVA 1XIMA 1GG1A 3LCFA 5A8PA 3ARXA 4WX2A 4GI4A 1A0DA 3CC1A 4N9BA 1IGWA 1ME9A 2DZUA 2GJNA 1MXDA 4AEEA 5M3WA 1JYXA 2CLHA 5D09A 2Z6JA 2HK0A 2PWDA 3QTGA 1FVPA 1LLZA 3U3HA 5LKYA 4QX4A 4BJHA 3AXIA 3FJ6A 3OBAA 2ZXAA 3V35A 6CGTA 3CUXA 4FXJA 2WVTA 4FMVA 3SCNA 2ALDA 3IRDA 4TX6A 2HRWA 1NAL1 1R6WA 5XIMA 2G0WA 3BLLA 5BU6A 5I3HA 2E5CA 3B0XA 3AQUA 2XISA 1D3GA 4JIPA 3MYPA 8TIMA 3DI1A 4L6HA 1H51A 2J7EA 3GC2A 4GGBA 5AVNA 1H49A 4AEOA 2NLYA 2WHKA 4IM4A 4AZGA 1V6WA 4NSBA 3LTPA 1E6QM 3GFXA 4IFKB 4DF2A 4DO4A 1K9TA 3PZNA 3WH9A 4M6VA 4LPCA 3U4FA 4IFKA 1DJWA 4ILSA 4ERGA 3EWBX 3K8KA 1PWMA 3BW3A 4GABA 4OGZA 1QNOA 2RAGA 2VWSA 3SO7A 1AJZA 2A7PA 2QYGA 4JY9A 1VYPX 2Y70A 3W7KA 1GOWA 2GUUA 1IXQA 1XYAA 3LA4A 5I09A 6XIAA 4PMQA 4F2BA 1D3HA 4C6QA 3F03K 5G4HC 2QGYA 1V3HA 1W3NA 1QFEA 4M5PA 4B4FA 4C6KA 4HOWA 1OG6A 4W9TA 5A6SA 4W4QA 3VABA 5AYXA 4HU8A 5CCZA 1V4YA 1TVNA 3UR7A 3N13A 5J5DA 2OODA 3NDOA 1GYLA 5CG0A 2WVSA 3CL7A 3SRKA 4O28A 4FO4A 1TWDA 4W93A 1FRBA 1UPPA 4O0ZA 3NQ7A 4NYYA 5K7JA 1V0LA 5U7SA 4AF0B 3EDEA 3BURA 2ZUUA 4S3FA 3POHA 4MY8A 1M3UA 4XIMA 2A6NA 4OTKA 5MHBA 3UG5A 1DYSA 4ML9A 2VKZG 3BOFA 3ORWA 2YDRA 2ZUMA 1FWFC 1ZBWA 4NIRA 2WW5A 3BAKA 5I23A 3B0VC 4AG0A 3H7UA 2EG7A 4AU0A 4IISA 4LW7A 3TZFA 4ZCWA 3GM8A 4GZIA 2PUZA 5I3JA 4JTRA 2YYUA 1GOOA 1EUNA 3IK2A 3W29A 2CETA 5DLCA 3T4CA 2PS2A 3UERA 1SZNA 3M46A 1W5OA 1UWTA 1I1XA 1ISZA 3LHYA 3T78A 2Z1VA 1XGEA 4DZ5A 4M6PA 5LNRA 1ZAHA 1HG3A 2ZFAA 4GY0A 4RDWA 1GTEA 3IUIA 4ATLA 2VCBA 2PRHA 2QIIA 5CKSA 4HYRA 3D46A 1XKYA 2ACQA 4HA1A 1HKWA 2ZBTA 1AQMA 3DYPA 3NSNA 2VX5A 4OU1A 4NHVA 3NJ3A 4MGGA 3ZOAA 4U5IA 1QU4A 1XUUA 1TJ1A 1IR1A 2RKXA 2AQOA 1UIPA 3AIWA 4LCQA 2E8ZA 3S6DA 2CYGA 3V7PA 5CSUA 4C6DA 2JIWA 3CL6A 1PO9A 4IFRA 1J9YA 5AFDA 1T7LA 3QJAA 3VCNA 5JH2A 5CJNA 4A3HA 2YR1A 4BI5A 4I3GA 5LSMA 2NSXA 1NH6A 4JR5A 3W1QA 3ARPA 3DFOA 4FK9A 1Z3NA 4GI6A 1RPKA 1V7AA 4JN6A 4YNGA 5K3VA 2WYSA 5FJRA 3UF9A 4PTDA 2C1HA 2GWNA 3TV8A 1RVKA 4OWGA 3VUSA 1ZGDA 3EB2A 1VKFA 1W8GA 2OPJA 4Q3MA 2XH0A 3S1WA 2VNCA 3ZM8A 2DZAA 1GTHA 4ZZ9A 3DBPA 3H2OA 4GCAA 4IQLA 3CUJA 4IPJA 3STFA 2A5HA 3RAOA 1ZL1A 1LF1A 1VRDA 1E4IA 3FW6A 5KEZA 2PC8A 4JDYA 2J62A 4L6OA 1YRRA 4DYJA 4QJ5B 3VIOA 5G4WA 1VEOA 1SJAA 2A3BA 4E4FA 2PDJA 3M6DA 2VRQA 3W82A 3I3EA 3QR1A 4FEZA 2V81A 3MPGA 3M0HA 3E2VA 1IGSA 4LAUA 1E43A 2PGWA 2PDFA 3B4YA 3KBMA 1S46A 4PBFA 1SVDA 3O15A 4PRTA 5EMLA 3W7HA 5F4XA 4HP5A 3GU2A 4IWWA 5FL0A 2DW7A 3A12A 3CGTA 3EX1A 2VT0A 1UP0A 4LYRA 1V5XA 5DMYA 4LVBA 2HVNA 4IUOA 1X7FA 4M1RA 1E5NA 1DWFM 1HJQA 4H6RA 1M41A 3GG7A 3ZT6A 3W7GA 2ON3A 2NXIA 4QS6A 4C6NA 1RV8A 4GI8A 2B7PA 2C91A 2DV0A 2I57A 3CK5A 4EF8A 1OSEA 4H3DA 1H1ZA 1EBGA 1K8ZA 3DEQA 1OX4B 4RZ5A 2GSHA 1TPUA 3FEQA 3VGBA 2XINA 1YKWA 3S5NA 3JR2A 4LVDA 3G1HA 3CZJA 3KXQA 2HXUA 2R6OA 2VX6A 4BEQA 5AHNA 2DGAA 2YBTA 3DDMA 4CCCA 6TAAA 1B3YA 3T2QA 5C7HA 4KWWA 4PTXA 3WF3A 3CPGA 3ELFA 2C1IA 4DF0A 4UFKA 1TWZA 1LLWA 3WDHA 1GPWA 1X98A 4ATDA 3PNZA 3MUY1 3BO9A 1AL7A 1AD1A 5C54A 3QOKA 2JIEA 2J9ZA 2PDQA 3RPDA 4E2OA 2NV9A 2O9RA 3FJLA 1XUZA 2R1PA 4H2HA 3LCGA 1SFTA 4JFWA 2F61A 4NXKA 2QW5A 4WVXA 1RA0A 3IVUA 1XPYA 1SO6A 1DJIA 4HGXA 3UPBA 4E8DA 2INEA 1R3VA 3M0LA 4GH3A 3WNOA 1AUSL 2ZX7A 1SFLA 4IIBA 3L65A 1UOZA 2VZTA 4O1DA 4JIEA 3GG0A 3OYZA 2VGFA 2O9TA 2H3DA 3CQKA 1M7JA 1SZGA 3CHCA 4IGMA 1HGYA 4DO6A 3WFZA 2BGNE 4J28A 4MB1A 2UY5A 1OWQA 3VNMA 1YDNA 2OQHA 4UFIA 4J2MA 3TQKA 3HF3A 4AZHA 4O4VA 4LOCA 3C2EA 2P8CA 4D6EA 3VKCA 2CLFA 1VYRA 5G2WA 3AXXA 3BV4A 4Y9MA 2W3ZA 1W1TA 3LX9A 1A4MA 3NQEA 5DRIA 3T09A 4WZHA 3OLDA 2YCLB 3S47A 1UD5A 4F66A 4TX9A 2HBXA 3ATZA 4E38A 3M1ZA 1GPFA 4E4UA 3B8WA 2FTYA 2QEZA 1R2RA 3HGJA 1EC8A 1YQ2A 1F4AA 2NX1A 2CWNA 3B9DA 4IMFA 4JFSA 4NZJA 4GY7A 4EX4A 2ZC1A 4MB5A 1VHCA 4YHGA 2PDGA 1EHNA 1WA3A 4H4IA 3W6MA 4M81A 1H1NA 4LRTA 4S2CA 1R3WA 3QV9A 3N3TA 3S42A 1GVEA 5MF5A 4BHYA 1DPMA 1KLZA 1BKSA 4K8HA 1UZDA 4NNBA 1VYSX 3WLLA 3VIGA 3SY5A 2TRSA 2PDBA 1CNVA 2EQDA 4MFDA 2E09A 4IMEA 1I60A 4Z1DA 1N8IA 4HPXA 3ICJA 4TQTA 4LJ3A 1VIZA 3GTHA 3DYOA 3F5KA 3K8MA 1NY1A 2QCNA 3NYDA 1JYNA 4HA0A 3APYA 3W26A 3WLPA 5BYWA 2GVJA 1BF6A 5HMFA 2ZZ6A 3S1UA 1PTGA 4OIFA 1J0ZA 4QITA 2FGLA 2DT1A 3T8LA 3N4AA 3SN1A 3T0AA 1M7OA 4ZL1A 3W7MA 1SZRA 3OZMA 2BGQA 3VK5A 3RNDA 4J2PA 1LG1A 1TPEA 1ZBKA 4K6AA 2GK1B 5HPCA 2V5LA 3CWHA 1YTDA 4NI3A 5LGZA 2Z7GA 4U5KA 2X0YA 2Z1SA 1IEXA 1JF6A 3CV6A 2P76A 4KWSA 4PUWA 1LOSA 1YBQB 4HKPA 1VAHA 4K68A 3HV8A 1EBHA 3CHDA 3ABXA 4V33A 2GDUA 4X2RA 2XFRA 3WLMA 3B03A 1P0KA 2XSBA 3W1XA 1UUMA 3VNDA 1XW8A 5FCZA 1R0MA 5CSSA 3UNTA 3RO8A 3LENA 4KRZA 1AK5A 2QDDA 3SRHA 2CLPA 1I75A 2BS9A 1RCXB 2Y1HA 3CH0A 4QGCA 4EPKA 1FFQA 1UR8A 4YVVA 5AHLA 2WVVB 4L7ZA 5CBIA 4GD0A 3GNPA 1Q4WA 1GKRA 2ISSA 3VVGA 1FH7A 1TE1A 4HYWA 2OG9A 3NZRA 2Z29A 1ICSA 3QYQA 1HUVA 2GUYA 1KQZA 2CLEA 3WLSA 4N9DA 4BCEA 2VD8A 1NTHA 4K8GA 4KGLA 4Z2KA 4OT7A 2ZZ7A 2VFDA 2WNWA 1W9PA 3R0UA 3I6TA 1UWUA 5KZMA 4LGXA 4DBDA 3D47A 3KRSA 3WK0A 4DJDC 4YXGA 1QCWA 3NVDA 3AWOA 1TB3A 5E6ZA 4NRSA 3W00A 3KTXA 2RDUA 3QPZA 4LEQA 4QCEA 1UBSA 3APTA 4GUIA 1OGBA 4YN5A 4JKMA 4AMAA 3E1F1 4GXPA 3FHAA 3SBFA 4YS1A 4I7UA 1YE6A 4ORIA 4MF4A 2P10A 1K4HA 1TMQA 1PS9A 2WHMA 1PE1A 4R7OA 1KC7A 3VD5A 1Q45A 5CPSA 4Q4OA 1CECA 3GY1A 5HJLA 3L4ZA 4KWOA 1WPCA 1RK5A 2DIJA 3H55A 3SDOA 1GYNA 3DHDA 4YLWA 3NQGA 4W85A 4HJFA 2WCAA 1CXEA 5BXPA 5CSYA 4J3XA 1G4EA 5FD0A 1XQKA 1A5CA 2X0HA 4RPQA 2OLHA 4AB4A 1B31A 5AYYA 3KM8A 1VFOA 2JF7A 3LI0A 1YXCA 1JCTA 5FOOA 3N2MA 4Q4PA 5H8MA 3VM7A 6ENLA 2PWUA 3IIOA 4R5EA 1ZAIA 1KFEA 3IJDA 2EF9A 1QI3A 4CD4A 4CD5A 2EG6A 3KOZA 7XIMA 2XSXA 4LBSA 1QW7A 3P0WA 1YTEA 3B9EA 2W67A 3N2XA 4JICA 3VGGA 3ANUA 1FCUA 4GNJA 1QATA 1P1XA 3PAJA 1ZBVA 2PD5A 2P3ZA 3SSZA 1C8VA 4FALA 1H7XA 5RUBA 5ABFA 2R8WA 4FZIA 4F0SA 2PWGA 1XLKA 3A4AA 5GJPA 1DL3A 1KFBA 2YA1A 1QNVA 1W54A 4DBSA 4FF7A 3BLIA 1W3JA 1QWKA 3VIPA 1W9UA 1RCQA 4WY0A 2YCKX 4XAYA 3SQLA 1QNSA 5HQEA 3WQ5A 2WZHA 5DANA 9XIMA 3H2CA 4KCUA 1JUKA 5FACA 3BCFA 1NFBA 2WC4A 4PMJA 3PFMA 2XTKA 4MKSA 3QR0A 1TR1A 1MXGA 2PRLA 3M0VA 3R94A 4NJHA 1B57A 3PZGA 4XAGA 2QJJA 2BVDA 3MSGA 4RDYA 1TA3B 3OG3A 4KCTA 4Y90A 2EPKX 3VINA 4GLEA 5D8WA 3ITVA 1QVBA 4S2BA 2BHUA 4PTMA 1KM4A 1SW0A 2PLMA 3WL1A 3W81A 3H21A 3FK4A 1HN1A 4JTDA 3M5XA 4B9YA 1FHUA 4ECLA 2PDUA 2QIWA 3MZ2A 1PIGA 3VA8A 2DT0A 3OU8A 2YLAA 3PUEA 1HVQA 3AMLA 3VGEA 1GJWA 1DWJM 1K4GA 1DORA 3AHZA 4DNMA 4WSKA 2E3ZA 3TAKA 1EWDA 3WL0A 3SECA 3PBGA 3H23A 1KBBA 2DSZA 2OSXA 3AAMA 4CVUA 3HG3A 3M0MA 2PF0A 1NJJA 4IIGA 2D24A 1T0OA 3NL2A 4J4KA 1O12A 4ALDA 5E09A 3K8LA 4JGDA 1UWQA 2Y7DA 3FXYA 3PZIA 4AMCA 5HR6A 4OOUA 4DXKA 1OG0A 1JAEA 4KERA 4HN8A 1JYWA 3QKEA 4Q4RA 3A5FA 5C2XA 3MA8A 2OEJA 2DH2A 1Y5XA 3PWAA 4DWSB 3R6IA 2PPGA 4JCMA 1OX5A 1QNQA 1RCOB 1DQXA 3PTQA 1YXDA 1TWSA 5ABFB 3N73A 4LU0A 3UJ2A 2BTMA 1FDJA 1KM3A 4JTCA 1QT1A 1OC5A 3ZYZA 2XHYA 2WJDA 3IJLA 4MWAD 1JNDA 5FF3A 1AH3A 3BH4A 4QSFA 2PWFA 4LB3A 2W91A 1IEWA 4ERIA 2XH2A 3V5CA 3QF0A 3TC7A 1KV8A 4HNOA 1UZ4A 3DG6A 3CZ8A 3B9NA 4IIFA 1XLFA 5EFDA 4O1BA 1XICA 4MTVA 3MWCA 2OZ8A 4UR9A 2VWTA 2WSRA 4BF7A 3VUPA 4CQBA 4C6OA 1A0EA 5AC5A 2QCMA 3W85A 3QC0A 4MWAE 3AMGA 2VR2A 1V0NA 4DVOA 4GQGA 3LS9A 5AHMA 2ATMA 5D04C 1H41A 2GUBA 4Q8OA 1CGYA 3W2MA 3UETA 3KFTA 1JCJA 3RUBL 2FZNA 4CNTA 2VC6A 2PP1A 4N9EA 3FA4A 3HU7A 3TYDA 3MMWA 1FHDA 4ICMA 5HNUA 1VJSA 1F6YA 3RITA 5DFAA 3W72A 4A3UA 3GHRA 4PCTA 1EXPA 4H7VA 3TCSA 1QPQA 4PMYA 1OHLA 2QT3A 5E5CA 2DT3A 1R30A 2PDCA 2QJMA 1P48A 3VKJA 2VGIA 4O8AA 1L6SA 1WYIA 2IPWA 2PTXA 1LBMA 1Z69A 1P0EA 1UOKA 1AD4A 4AHPA 3M47A 1HXJA 2YOCA 1SYTA 3E3HA 1Q6OA 1W2VA 3GU9A 3TYZA 2CITA 3R2GA 2WMJA 1KBIA 1J2WA 3GX9A 3ARSA 3TC6A 1W56A 1JAKA 1TCDA 1S2AA 3H6OA 1NVMA 5ABHA 5C9RA 2E0PA 1F2JA 1LWIA 3BOLA 3G0XA 3W7IA 1MW3A 2DJXA 4K1GA 1MW2A 2BOGX 2WVUA 4M82A 4X9YA 1J6PA 1AVAA 2C19A 4M29A 4JHZA 4DBWA 2YXXA 1WXJA 4HT3A 4XVDA 1GOXA 4IL0A 2YDSA 2CPUA 2J7FA 4DIAA 1TQJA 3LLDA 3LTSA 1PVNA 2QAFA 2OX4A 2WZMA 1S2TA 3JZEA 3WEZA 3WIJA 2PFHA 1HJWA 1YLVA 2R24A 1KM1A 4I6VA 1HL9A 1S5WA 2NWRA 3O07A 3VOCA 5E9XA 4LF2A 3TR2A 4O17A 4FXFA 4LV4A 2Z28A 2IKJA 3LCIA 3E12A 2V82A 1ICPA 1UPMB 4O52A 3A21A 1Q6FA 1GWJA 4F2TA 4JD4A 4JQ1A 3CASA 3WJSA 5A8NA 4N6EA 1Q6DA 5CZSA 3T55A 4K1WA 2HDJA 4OBTA 4IG2B 1KW1A 1JDEA 4QEHA 4HHHA 2E4TA 4GI9A 5CC3A 2BY1A 1UR0A 1V77A 4R85A 3MHFA 4GA8A 5E70A 2JGYA 4KEUA 1TV7A 3TNOA 3KOWA 5FF7A 1IEIA 4UCFA 3AU6A 4XQ6A 1MNZA 3TYAA 1OFPA 4XZ9A 3BLDA 4LUTB 1C8XA 2IKGA 1E9IA 3GSMA 3NWRA 4ZE5A 4MYAA 1GQKA 5AOUA 4V2XA 1B3OA 4UMBA 5LA0A 4XWUA 5FA5A 3IWPA 3QY6A 1VFMA 2GGEA 3NL5A 4QLJA 5H2ZA 3T0BA 3BJFA 1OZMA 5I77A 4FX6M 1S1PA 4L64A 3BLFA 3W7DA 2X1IA 1N82A 1ZB5A 4MAVA 3W7JA 2CLLA 2H8ZA 3PZTA 6REQB 4FNPA 4F0KA 2HV5A 1E55A 2P88A 5BMXA 3WUFA 1BVNP 1GZGA 3TA9A 3M0KA 1Q63A 2BZNA 2OTDA 1VEPA 2DSVA 3BAIA 1ZFJA 2VCCA 3QV6A 2PDYA 4L1XA 1PUDA 3TTSA 4PTNA 3H2EA 3MVTA 1ZS2A 4IGHA 4B5TA 3MMDA 1QRQA 1QPOA 4RE4A 4C6EA 4MNKA 3E6EA 4PFMA 4Q8WA 2A85A 3IJ8A 2FGZA 2P3EA 3M0JA 2W9MA 2VVSA 3I68A 4MNJA 1MXSA 3WUBA 3KS6A 4JX5A 1XC6A 3NQAA 2Y5EA 4JN7A 4DZHA 1IT8A 1JPIA 1OZQA 4EACA 2ZUNA 2OLAA 3QFWA 2XVLA 2Y0FA 3LB0A 1Q8JA 4G7EA 2A2IA 3W1AA 4CQCA 2VJXA 3S46A 4AVFA 1WOBA 3VC5A 4DRSA 4S3GA 1S1RA 3KRBA 2DORA 4AEFA 3WFAA 3CYJA 4ZXOA 1KCXA 4X2PA 1A5SA 1GVSA 4MFEA 1W1PA 3AZRA 1MMFA 1W8SA 5A6BA 1Q8AA 1A80A 2PTWA 3LRKA 2UY3A 4N02A 3EAUA 2ZWZA 2QVNA 4OUEA 2B7NA 2BXVA 4OUIA 1UMYA 4H00A 5HJYA 1F6KA 1N8FA 4H6KA 1VR6A 4H8HA 2C7FA 4X60A 1WDDA 2H6RA 2QGHA 1Q5MA 2REQB 4JEJA 3PZQA 1SMDA 3K2GA 4DY1A 5H8UA 2GK1A 4F0HA 1ZP4A 3S5ZA 4UBPC 4Z0SA 3UESA 4KEZA 2JK2A 1FWTA 3W53A 4BKNA 1UKTA 2YYTA 3HZ3A 4DLFA 4MYXA 2C0HA 5AC8A 3UZWA 3R8RA 6TIMA 3DHFA 2GVEA 4WKHA 2XVKA 3V16A 1BSLA 4IQEA 2W0UA 1EGMA 3TX9A 4FXRA 1C29A 3QQWA 4C6IA 4FLOA 3Q45A 3FLUA 4MPQA 1A5AA 2XGBA 3ZSSA 3PUGA 4IQDA 4O1AA 3CJPA 2ISVA 2GGHA 4UQDA 1QI0A 1V0MA 3UY7A 2V5BA 1HIZA 4AX6A 3HGSA 2F7FA 3TSMA 1M53A 2Z27A 4NZ1A 4E5TA 4JTQA 4D72A 1EYEA 2DZXA 3TNBA 1KGWA 3S6TA 4PE8A 1UUQA 3GHSA 4HYVA 3I7SA 3WMLA 2F2HA 1DJQA 4ZQRA 1SQ7A 1I2PA 3MUZ1 4EP8C 2OXNA 1EP2A 1W3LA 4H1ZA 1KM5A 3B3DA 3BL3A 4DUWA 2Z1XA 4EPBC 2V2HA 4NP7A 2FH6A 4Q7IA 3P82A 2PCEA 3TOYA 3VZYA 3CU2A 4E3VA 4O16A 1OYBA 1DTNA 1FFRA 4L80A 4V15A 4HQVA 4FR6A 2OSYA 3BANA 3VI2A 3GH4A 1OJXA 3M0IA 4IPLA 4CLMA 2ZC8A 3NQ8A 2D20A 2RUSA 2CKSA 5AC6A 4AYGA 4NQ1A 4QJ3B 3PUDA 3VXGA 3PWIA 4EXQA 4RNHA 2JKPA 4ADSA 3O6CA 1J01A 2PE4A 3S9IA 2FQIA 1F8IA 1PAMA 5I2UA 1OQFA 2Q3RA 3S83A 1GUVA 1JZ2A 3USBA 4L1GA 1XLCA 1FQ0A 4IGSA 1TWWA 4GUGA 4Z08A 4ZVJA 3PVFA 3M5YA 3B8UA 4PUMA 1AA1B 3ID7A 5HWMA 5DT5A 1K7FA 3ZWTA 1GOKA 3NPWA 1E70M 4MPKA 1G9HA 2OWWA 3EA1A 5JH1A 5K4ZA 4WKAA 3GR8A 4QAWA 1UHVA 6A3HA 2QLYA 1FKXA 3S2NA 4KCWA 5GNXA 2FB2A 4O18A 3AZTA 3LHZA 3GFZA 1UH4A 1IHIA 1IEQA 3MP3A 3WNLA 4NI8A 1TWIA 4US5D 1OF6A 1ONWA 3W71A 3I4EA 4FOUA 1XPGA 1Y0EA 1F3TA 1MW1A 2EAWA 2DDXA 2V3EA 2VURA 4IMGA 4LS1A 5L6UA 3BCJA 4KEVA 4HPHA 3K4DA 1RQHA 2J27A 1ZCOA 4XAPA 4UTUA 1ONXA 3MP4A 1EWEA 1DKWA 1NF0A 3R43A 3NZQA 1V6TA 3OHIA 2PDWA 3TE9A 5BROA 2XVPA 4F48A 2XUCA 4M3PA 1SJDA 3W76A 3MANA 2XVGA 4DXXA 1GCYA 2E25A 3B04A 2IPFA 3AIUA 1NM9A 2QDGA 1J18A 4B4HA 3ITXA 5LIKX 4HPGA 2AMGA 1OINA 2EHHA 4P7NA 4P7QA 1PKMA 3C56A 1KV5A 3KUMA 2WMIB 2BSLA 4QEEA 4QCFA 6REQA 3QM3A 1V3LA 2C15A 5KETA 3RX2A 2E40A 1Y8BA 2FTWA 3LXCA 3NNTA 4WQ6A 3PBVA 3WJWA 4IL2A 3KEHA 3ONBA 4EKJA 2DUAA 1KTNA 4JOMA 3E9AA 3UYCA 4Y6GA 3UPWA 5LNWA 5C9XA 1C92A 3KZPA 3WQPA 2VEPA 3CZEA 1D7KA 1IV8A 1UR1A 4JL1A 2VRKA 4IXHA 1DQUA 1EZ2A 3RLVA 1F74A 1F8MA 3LQLA 4ADTA 3BJTA 3SGGA 4ZBCA 1R7OA 2J13A 1BXCA 3AS0A 1BKHA 2BG5A 4I8DA 1DBTA 3IGHX 3WDIA 1QW9A 2QXWA 3MMUA 3N6QA 4UFMA 4O12A 2NUXA 4K8EA 3C86A 1R87A 3P61A 2G97A 3UZJA 3GH5A 3E38A 1R47A 2VTFA 3TTOA 2C8NA 4IP7A 3LM3A 3F4DA 4U28A 3SCTA 3ZJKA 3DN5A 3OHMB 1QOXA 2QDHA 3NQFA 5TQLA 4C1NB 2L5HA 3WMSA 2QCCA 4KS0A 3WJYA 2NSOA 5M17A 4DPPA 1P6BA 3B40A 4LF1A 1UWAA 1TUXA 1UQZA 3N18A 1PWLA 4US5A 4YMZA 1UA3A 1HJSA 3E5PA 1PZ3A 1U1UA 2WBKA 4AIEA 3ZJ7A 1JR1A 4LC6A 4LVFA 4GUFA 3W27A 3SFWA 3DERA 3E74A 4QR6A 2ZUSA 1KXTA 1W3TA 4AVNA 3CTTA 1QK0A 1E15A 1GOQA 1WKEA 1G4PA 3DCPA 2QV5A 3FYYA 2FVKA 4E2DA 1E1CB 3W1PA 4US6A 3V0UA 4AY8A 1JVNA 1RXOB 4N0RA 3RHGA 3O0FA 2HXTA 4ZMGA 4LUIA 1W5NA 4S3KA 4CNUA 4WHBA 4CNOA 4IOTA 5I07A 1BRLA 2O55A 3BAXA 3KAOA 3EWDA 5FEWA 2QUUA 4IJBA 4GACA 4W86A 1UD4A 4LX4A 3ZVHA 5FSDC 2X7WA 3HMCA 1V02E 5AYIA 1JI2A 3PSWA 3QN3A 2NW0A 1CXHA 4NZ4A 3HGRA 1V3JA 3LV6A 4EWND 1I0BA 4RCXA 4I7VA 1ESWA 1V8EA 2LLEA 3M5ZA 1Z9AA 2H9AB 1JZ5A 4JTGA 4RKAA 3ES8A 1GQJA 1JFXA 1TG7A 4E6MA 1MDRA 1O95A 5D2VA 4O1EA 1TELA 1ISWA 3CNYA 1KCKA 3GZ3A 3H53A 4DJEA 3KDOA 1EB3A 3AUJA 3NZGA 4LH8A 4CQAA 1XIIA 5K2ZA 3II1A 4GYFA 5BRPA 3PJUA 3K30A 4HN4A 1JDCA 4E2BA 4GRSA 2DSKA 3PWGA 1ONRA 3GS6A 5TIMA 4OOZA 2AAMA 1H7RA 1TV5A 2QUVA 2YCJA 3U9IA 2Q6ZA 2R14A 3BARA 4MMWA 3WUEA 5C9UA 3FKKA 3CIVA 3KTSA 4C65A 1A53A 2FDSA 5IM51 1W31A 3KX6A 3TJXA 3GIYA 5HXMA 4ZO9A 1RH9A 3OEXA 4MZYA 3UCDA 1YNYA 1W5PA 2VFIA 3TTQA 1UQYA 3OYXA 3D0CA 3VE9A 3PPHA 3HJZA 4TUFA 5LNVA 4XAZA 3AHTA 1IIGA 1EX5A 2IQTA 3IJIA 1DWGM 1I4NA 1B4EA 4H6QA 4BY3A 4NYUA 5I06A 2VRJA 4UTKA 2WZIA 1HF6A 4CGTA 1CGTA 1LUCA 2WMHA 3ITGA 4XVEA 4CU8A 2NWSA 2WKLA 2YDAA 3GDMA 1QW8A 1JJKA 1PBGA 1HFBA 3FGCA 1PZ2A 2GQ3A 2ZX8A 4Z2HA 5A8OA 1DJGA 1GK8A 4REQB 5GPRA 2JKAA 1RQBA 4LCRA 4QISA 2IPGA 3LNMA 2YFNA 1E1CA 3FSTA 5LHFA 3BAWA 3CUFA 3OA5A 1X6UA 3AYSA 3WLQA 2TPSA 1SR9A 2VX4A 3GC5A 3OVGA 4U10A 4Q22A 3MVIA 2C6QA 1M68A 4L4PA 3NVTA 5IBXC 4IGNA 4DAIA 2B7OA 2Y61A 3WO8A 1MI3A 3C2FA 3FVMA 4ZSTA 3IV8A 3IK4A 4L65A 2EGZA 1QHZA 4K3ZA 1BWVA 3P8IA 1VF8A 3GG8A 4S3AA 3N2TA 5F4SA 1P6WA 1OIFA 4R3UA 5I3FA 2QPXA 1IF2A 1W3HA 1P4CA 3ITCA 4ERAA 2ZRXA 4UTLA 1BLIA 1EC7A 1R7AA 3V1HA 4JCLA 1EDTA 1MFUA 4OJYA 2VC7A 3U48A 1C7SA 3LLFA 1E4MM 1WUEA 2Z26A 1E3ZA 4PUJA 4QG8A 4UR7A 1Q4NX 4G7FA 4AWUA 1EX1A 2V2DA 2GDVA 1AZ1A 1VFSA 2HEJA 3OGVA 4R53A 4LUSB 5HOSA 3SCSA 1XRFA 3NIYA 3A13A 3L2LA 3DFYA 2Q71A 3CMJA 3KP0A 4JYDA 3M43A 3MU7A 4AY7A 4Y2WA 1VH7A 4NU7A 4C7GA 2AGKA 2XFWA 5A3HA 3H2NA 4MAZA 1JUEA 3V75A 1H5VA 3AWNA 4GXMA 2W4XA 4L9XA 3NYZA 2RH9A 5KINA 3VIIA 3N2CA 4MY9A 1KNWA 5F2GA 4FLSA 1XH0A 3W1LA 2WJFA 4PCSA 1U1JA 1P0NA 1XX1A 1GQIA 2BGSA 1WUFA 4AW7A 2ZA3A 1HQTA 3RO6A 3G8RA 4XB3A 3WH7A 3WEMA 3GKFA 1V6UA 4FAMA 1XCFA 4YCOA 2PTDA 3RM4A 1B3VA 3CO8A 1RR2A 1TPB1 1J6OA 3I6RA 4FNUA 3W07A 1J12A 5FJTA 2BODX 2FTPA 1L2QA 4ZOBA 2WKJA 4KIEA 4XTIA 2KZHA 1LCOA 3I7QA 1LL6A 1PYMA 4TR9A 3S1VA 3QXBA 1FWIC 3RRXA 2A79A 4Q8TA 1EDGA 4E4PA 2G3NA 4C6JA 4KMQA 2NLIA 5DMMA 3W6LA 4N7QA 4IT1A 4EAYA 4EXAA 1VZWA 3S9YA 1F3XA 2WSYA 2PP0A 2ZXQA 1SO3A 3TQVA 1T96A 3S4TA 3BJSA 4WGHA 1W1IE 4JIQA 4B15A 4WOZA 1GZJA 3O1NA 4GYJA 3LBMA 2YXGA 2QR6A 3LDVA 1GVRA 1VCFA 2J78A 4HU0A 1FWBC 3RJXA 3GVRA 3GB6A 3F2BA 2DQXA 4RUBA 1BSIA 2Y8VA 3RN6A 1RLDA 2X8RA 3EGJA 3EXTA 2WCGA 3WQDA 3GXTA 3TIMA 4CQ8A 2Y8KA 3PJXA 3QY8A 1SW3A 1K8XA 2P5NA 3MW7A 2OKOA 1XC4A 1ECEA 2G41A 4GQBA 4MZ8A 3VZXA 4JQAA 1B9ZA 1XIEA 5D4YA 3TYUA 1JZ8A 4GZ7A 1FKWA 1GKQA 4PCFA 4FLRA 3M0YA 1F3WA 3BQ5A 4C6BA 1P43A 1ZSXA 3TEVA 5BU9A 3G1RA 4N2YA 4FNTA 5HR7A 4P8UA 4F0LA 5FF4A 3TU9A 4UQAA 1O1ZA 1G4SA 3LLXA 5C9ZA 2VR5A 1CGVA 4GE8A 1IXNA 2O9OA 1CW2A 1R9ZA 2VXNA 3DFHA 2YL8A 4A8NA 4UNKA 2ZRYA 4Z42C 8RUCA 5A6TC 2VOMA 4HNNA 4I6KA 1X38A 4V1YA 3WUGA 3L4WA 3PM6A 2Z2AA 1TJ0A 1JL8A 1IXOA 2VEMA 2Z24A 4HK7A 2I1OA 2W5FA 4JTEA 1EP1A 3NQ2A 5I3IA 2ACSA 1UD3A 3CAQA 2WQDA 4IIHA 5FSEC 1DHPA 3N25A 1KRMA 2J4GA 3EX3A 3FEMA 2EJAA 3ABOA 1L6FA 2OOGA 3BV7A 3P74A 4DHGA 4AIOA 3FHQA 2R1KA 1BXBA 4HB7A 3T0TA 1H50A 1MUMA 3KL5A 1OFBA 2E77A 1A4LA 2PC4A 1XM3A 4B5VA 1KTBA 3CLWA 3G6MA 3GNXA 3O6DA 3WKZA 1XSIA 3EMCA 4PUDA 3RIKA 1VRXA 4B90A 1RK6A 1F07A 4G8TA 3D3AA 4WJEA 1LWJA 5EKYA 1X8CA 1S5TA 3UZ5A 4G5DA 2ABBA 3HQNA 4EANA 3NOYA 4LQ1A 3H12A 3MY9A 1EP3A 2FHBA 4FXSA 1X6NA 2FPYA 3CHVA 1OT2A 4PA8A 2D23A 4FR1A 2OSWA 5DCDA 1TTPA 3KOFA 4O0KA 2E5DA 1Q6EA 2NUYA 3W2UA 1PKNA 1TPDA 4X63A 2D3LA 5FL1A 4JIRA 5D38A 4B2DA 3EKZA 4QLLA 4D6GA 4UTWA 5HATA 4QDMA 1C7TA 2P1FA 3ARVA 5C70A 5C2CA 1TR9A 1W17A 2VZOA 5F7UA 1TREA 4UMCA 3ARRA 4J27A 2JEQA 2YBUA 1PX3A 3IIZA 4ES4A 2AGTA 1VEMA 1XL9A 3IS4A 5FAJA 4A05A 1EHAA 2Z1KA 2BHZA 2PU1A 4AZ5A 1BGAA 3GNRA 2GSEA 4XISA 1XCXA 3VOHA 3NG3A 3R11A 1EO5A 4MJMA 4GBUA 4GNVA 3C52A 3TP4A 1QNPA 2WNQA 1W9VA 2INFA 4FX7A 4N9CA 2V5CA 1ZJHA 5CZ0A 4GGHA 5CGQA 2VQTA 5D9PA 1UC4A 3T2PA 5LXEA 1S38A 1TV3A 1CX9A 3A9IA 1FWCC 1G5AA 2OQLA 2VELA 2F6UA 2PDXA 3CPUA 4CKQA 3AC0A 3KLLA 5DELA 1LM1A 3TW9A 5G4EA 1JEZA 1VLIA 1K6AA 1DJHA 1XF0A 2OX1A 3POCA 4AISA 4QHRA 3UZXA 3I4KA 1Z48A 4PMZA 4A6GA 3RRAA 1NWTA 1D7FA 3SN4A 3RPTA 1AMYA 2J24A 4ZQPA 2PEVA 5BXSA 3P8JA 8XIMA 2W79A 1NWRA 3LPOA 1B3ZA 2MNRA 3SUUA 1JQXA 1QASA 3EBVA 3QKZA 1WQ5A 4OE7A 1RUSA 1BYDA 3VOIA 3VMOA 3F1QA 4JZ5A 4V1XA 5BXTA 1Q13A 2DUXA 5JXQA 4CCEA 5F2LA 3DYMA 1Q85A 4D8ZA 3QTPA 2XYLA 3KHDA 5AZ1A 3N2BA 3R1ZA 3UA3A 1TO3A 1VBJA 1TJPA 2GVLA 3AS3A 3NXFA 4JTHA 3E0IA 2WSKA 1EPVA 2Q02A 3VMNA 3UGRA 4HIBA 1OVDA 4ZE4A 4RNJA 5H1WA 2DZVA 2HCVA 4KGJA 3W86A 3WQWA 3B0YA 5DF0A 2A4AA 5A2CA 3OLEA 1T8QA 1JCYA 3MP5A 5IFTA 1VPQA 5KITA 4MLJA 2ZWYA 2DIKA 2WZEA 3A3HA 3KBNA 5H91A 4F9JA 3L0KA 4JKLA 4DEFA 4IJCA 1JF5A 3GNNA 2FZ8A 4GQRA 3GDLA 3LXAA 3Q67A 4PFHA 4FOKA 2YCEA 2BVTA 1QAPA 2X7VA 1DP0A 2E68A 1HW6A 3Q4DA 1RJQA 2BHYA 3BUVA 5MKGB 4D6DA 3FCPA 4AD5A 2I9UA 5FI8A 1UR2A 3UJSA 4ZB5A 3VDHA 1QOQA 1HJXA 5KTLA 2QULA 3S9ZA 2ANUA 5F1UA 3F7JA 3B05A 5I00A 5EGRA 2NQJA 4WDXA 3GK0A 1R9XA 1JD7A 3QW3A 4TV5A 1RALA 1KFKA 4WGXA 8A3HA 1TFVA 2GGGA 3Q94A 2D22A 1RY0A 1KM6A 2NT0A 4PMDA 4YYFA 2XIOA 3WFLA 2OGYA 3N3MA 3RX3A 3CIXA 3U2EA 1CYGA 4IICA 4YYCA 1ZHAA 4C1NA 4H9XA 1AH0A 5JIWA 1VPXA 4DWSD 2QPUA 5C9WA 3LSBA 1TMLA 1F76A 4F3HA 1QK2A 1SSDA 4HMEA 5B80A 3QV8A 1KKRA 1WDSA 1C9WA 1YX1A 4OVXA 4M51A 1FWSA 4XD5A 4L4OA 4BZYA 3UY8A 2PODA 3SCVA 2D2HA 3LY0A 3ECQA 1TCMA 2W62A 4Q6JA 1EGZA 1YPFA 2HK1A 3BTNA 5EPDA 4XUGA 3RYSA 3WBEA 3TN6A 5AZ0A 1NQ6A 3OA3A 1JZ7A 2TYSA 4UQCA 4GOAA 5BOFA 1UIOA 1OCQA 3N04A 1QPRA 1PX8A 3NURA 4C6MA 4W5UA 3UWWA 4YIWA 3SCOA 3VGHA 2IUZA 3W38A 3OBKA 4QFUA 1H61A 1PJ9A 3MKCA 5A6JA 4DYEA 3ZJ8A 4I5XA 4F9DA 4GK8A 1DJNA 1YDOA 3OGRA 1IXPA 2GSJA 3MUIA 1H62A 4F4RA 1W3KA 1IT7A 5FIPA 3LUTA 4YWIA 4BI6A 3B0UX 4HMNA 2VGBA 2OEKA 2XG9A 5LA1A 3FYPA 3WYZA 3W1NA 3MJYA 2D2OA 2Y2WA 4GFIA 4ZEPA 2QJIA 3BW4A 4WXZA 4Q8UA 3DFSA 2POZA 3QVQA 4D6FA 4TU1A 2WPGA 5DXXA 1Q65A 2HMCA 1EZWA 3NQ6A 1LROA 4GFSA 1KA9F 2YA2A 3QZEA 3VO0A 1TUFA 4CVWA 5DN1A 3W1TA 4RJEA 3N6HA 1KFCA 2CEQA 2X0SA 3O63A 1UWSA 1TX2A 4LAOA 1YTKA 4F8XA 5LYRA 3BG5A 2AQVA 3ATYA 1CGWA 4KW2A 3CB8A 3T2OA 1J93A 1Q6CA 5CLTA 1EOMA 2OCZA 1CZ1A 3PBMA 1POKA 3FAXA 3RXZA 3WQVA 1OC6A 3LPPA 3HQ1A 1FXPA 2GGJA 2DVTA 1OYCA 3CQIA 2G8ZA 3MV11 3QBUA 1XV8A 1GJPA 3URAA 4H8VA 4KRTA 4MB3A 1KBKA 3VDAA 1RAKA 3KBJA 3MCMA 2QUTA 5F2IA 2KX9A 3STGA 4D2JA 4NG3A 3TMQA 1UC5A 4UTTA 3UZYA 5HPOA 3VNYA 4JNZA 3MHUA 5C55A 3LCLA 2A3HA 4AC7C 5AC7A 1ML1A 2RDWA 1W9DM 1H7PA 1MQQA 3MMTA 3PBWA 3SCWA 3LSCA 1W1A1 2A3EA 1OT1A 2V63A 3G1SA 1E1EA 2QMJA 2DUZA 4PSRA 3FA5A 3CUGA 4NAEB 3F4CA 4FPSA 2D69A 3GXIA 4ACYA 2WSQA 4FNSA 2Y7FA 4OBRA 3VDCA 1E56A 1VBGA 1TPFA 2D1ZA 1QHPA 1ZP3A 1E6NA 4MM1A 2EKCA 2YBVA 4GUJA 1W1B1 2Z1BA 3G1XA 1IEVA 5FAGA 5DCEA 2ESCA 4HU4A 3WNNA 2YW4A 3DENA 3EWUA 1E40A 4F2UA 1US0A 3GW0A 1AQ0A 5U4NA 1PXGA 1HX0A 4REQA 2YGYA 1EF2A 1LRNA 4I9JA 4IMAA 5D9NA 3UD6A 4BFAA 2C13A 2PURA 4CCZA 3UCCA 1GJUA 3PC0A 7A3HA 3NQCA 1E9LA 1O94A 3N9RA 5E1QA 2Q3OA 1XGDA 3LCXA 1AQHA 3F2DA 5DY2A 2VZUA 1HKKA 3BLKA 1MDLA 4ROQA 1OGGA 1Q7MA 4Y96A 4WY0B 3WK1A 1OF8A 3TTYA 3FNDA 4FLQA 1OCNA 4ZXLA 1XR2A 2IXUA 1WZMA 3V3WA 4JTKA 2HQAA 3IRSA 4QSHA 3BVJA 2OVLA 3UWEA 3E96A 3ZO9A 1T6MA 2AMXA 4NZ5A 1ZQ5A 2OYKA 1DWAM 2FB3A 3QRHA 4XBJA 3CPRA 3C0LA 2QCEA 4MWAA 3EB4A 5KMYA 1XYLA 1I2NA 3NXLA 3B8TA 2VDIA 4GNKB 4GMEA 3RGTA 3W0KA 1XYBA 3QW4B 1A5NC 4D6IA 1KXHA 3GVQA 1AW1A 4ZOAA 3DFPA 2YA0A 1MO0A 2ZOXA 1VB9A 3AYVA 2OT0A 1VFTA 3KW3A 2GOUA 1WKDA 3NM3A 4FIQA 4RDVA 3UVIA 3OZYA 4N6FA 4S39A 3G3MA 3E0WA 5I03A 2BVYA 4RXGA 3UVAA 4NZFA 4GINA 5BMWA 3W7RA 4JYFA 5KZDA 2WOQA 4G9PA 5EBAA 5J5RA 1M04A 1KRAC 4UCGA 1A5UA 3NDYA 3U5UA 4MKNA 4B2DD 5GJNA 5CAKA 1JDFA 3I65A 4UOJA 4PULA 5AN7A 4Q8QA 5C7VA 2CLKA 2QUMA 3ZR6A 4S23A 3CUIA 3WNMA 1LUCB 1GZ1A 3CV2A 1F61A 2TSYA 3P14A 4GYKA 1G1YA 1EDQA 2CERA 4MJZA 4QRNA 4WUIA 2DY3A 3SUTA 2DU2A 2BFGA 1GQNA 3GXDA 3CB3A 4XZHA 1SM9A 1PDYA 3IGUA 2FMNA 1PCWA 5JMUA 1TPVA 4Q8PA 3O9NA 4RXFA 3W7EA 4U2YA 5IBXA 3HPSA 1J8VA 3CUHA 4R88A 1RA5A 3A47A 3C2YA 5I3DA 4MG4A 2PGFA 4I8YA 1UR9A 2XSAA 3AU2A 3FGCB 1PHQA 3L2MA 1J0JA 2BXYA 2VR4A 1PEZA 1XYMA 3LQGA 4JTSA 4ORMA 4F0MA 1KXQA 4LSBA 4QE4A 2VYOA 3URQA 1QWGA 4QTGA 2G3FA 3EPNA 2VUYA 1F73A 1UW9A 3PZOA 4HK6A 3WENA 2VENA 3QMSA 4CNPA 1IWPA 5IHRA 2OQYA 1J0IA 3DHUA 3QGKC 4MADA 2ZICA 4XD6A 3AIRA 4RV8A 1EH9A 1WKFA 3DGBA 1G7VA 2BNJA 4E8CA 3QH2A 3TSBA 1Q7QA 2GWGA 1B30A 4BI7A 3TW7A 1M6JA 1CGXA 1X1ZA 2OO6A 1BTCA 1TZ7A 3THCA 3INPA 2BDQA 3TROA 2YKKA 3L9CA 2IQ0A 1X1NA 3MJMA 1OBAA 1JNEA 3BK0A 4HVXA 1EA9C 4RZ6A 4KFNA 1LZOA 2ODOA 5DX7A 3RMEA 1R2SA 3CAWA 1JPMA 3LGEA 4NJJA 2VC9A 2VCAA 4YCPA 3LEPA 1Q6LA 3VC6A 2B31A 1W5MA 2PTYA 2NT1A 3CQJA 2OKTA 3UT0A 2J79A 1P7TA 1EKOA 3AS1A 4RE3A 2G4JA 4GO9A 3VTRA 3GXPA 4UR8A 4DUXA 1QMLA 4E3TA 3AFBA 1L6YA 3NPUA 3ZQ9A 5CSRA 4RR4A 1H63A 1Q7ZA 3OTRA 1NP0A 3EOOA 3UG3A 5DRCA 5IFPA 1JRBA 2Y5SA 4DO7A 2Z25A 3PUOA 1P1MA 1XIFA 3STCA 4KT2A 1W3IA 3EPMA 4M19A 2JF6A 4NUWA 4H8NA 1O5QA 1J10A 4JTLA 4KCVA 3KBVA 4WF7A 1LORA 4HMCA 4UZUA 2XH4A 2CZEA 3WD3A 1LWHA 1PKLA 3C0JA 3N2OA 4P7LA 4W8AA 2HS8A 4R33A 2ABAA 2Q8ZA 4LBUA 3U2OA 2FIQA 1EA0A 1RBLA 1SZEA 2AKZA 2Z2BA 4B16A 3C3NA 2V5JA 3IIPA 3G0UA 2BB0A 4AD0A 2HSAA 1UR3M 2EJ1A 3QQ1A 7TAAA 3ZJ6A 2OGJA 4PEEA 4H83A 2OZ3A 2OZ0A 3ME3A 3MC5A 1F9CA 5HNNA 2ZUVA 3UJFA 3W84A 1ZJAA 3FYOA 3MZNA 3LBOA 2E1WA 3J7HA 1XG3A 2J8FA 5CPOA 3HIJA 3R79A 1MZRA 1PV8A 3VDBA 3IARA 3RX4A 4E2VA 3KZSA 4NAEA 1LRQA 4NKCA 4EXBA 2PB1A 2X1RA 2F8QA 1J0HA 3H24A 2DH3A 1HNYA 3W01A 2GYIA 2VX7A 3GU1A 1HJVA 2X05A 1RD6A 3BSMA 3SGUA 4H04A 3BGJA 3ERPA 3M5VA 4NAFB 3AIBA 4MOZA 2GJRA 2TAAA 2C3ZA 2XPKA 2RFGA 1J96A 4PTVA 3SGZA 2BV9A 3P7YA 3U4AA 2BMBA 3BAYA 2R94A 4CD8A 2G3JA 1RP8A 4OQVA 3BLEA 2I56A 4LYPA 2WANA 3H2FA 1P7TB 4AWTA 4LAZA 4CCDA 1YPXA 2HZGA 1BF2A 4YJ5A 3RM8A 3HG4A 3L0GA 5HULA 2VDGA 3S0CA 2DW6A 2E1DA 3C8NA 4DLMA 1XS2A 3M7SA 4XKYB 3FA3A 3S2JA 2Z4GA 1DWIM 4FSAA 1EJTC 1LLOA 2ZDSA 3AI0A 3FS2A 3GR4A 1V03A 5CZTA 1RSCA 3GE7A 3R25A 2VZVA 4LAKA 1WDRA 2PSNA 3CV7A 1S5MA 2GVGA 2AQWA 3U57A 4ATWA 3U2CA 5ENLA 1E4LA 5XINA 3R7MA 2ISDA 1PL9A 4B5UA 4L1WA 4LCSA 4MWAC 4X0NA 4DN1A 5PTDA 3NGJA 3QMTA 3WLRA 4H7ZA 1BVWA 2QJNA 3WZ0E 7CGTA 1IWAA 4W8BA 4ONVA 3OQEA 4OV9A 2VO5A 4S1FA 1UWIA 4HD5A 4AX7A 3AXHA 2Z00A 2BY0A 1E71M 5CBJA 1XDMA 2V0TA 4EIVA 2J77A 3PAOA 1AJ2A 3P6LA 5M2FX 4HNVA 3T4WA 1FWGC 1V02A 1NWUA 5EMYA 1GNXA 1TMHA 5LIWX 7TIMA 4ZENA 3W7QA 4RV3A 1BYCA 2C79A 4Y8EA 2WPBA 2E5BA 1ITUA 4HCLA 3TYEA 3QPEA 2XM1A 1R8LA 5BOOA 3W7OA 1US3A 2VDHA 4S38A 3TFXA 3QGVA 3R89A 4NF7A 4BF5A 2G95A 2YJQA 3GIPA 1I45A 2WO5A 3RPMA 3OO2A 1UZHA 2ISWA 4WDTA 4TTGA 4ADUA 3CO4A 2W92A 1CCWB 3CZGA 3SJ3A 4S3CA 4JHMA 3L23A 4FP1A 2GJXA 3PJTA 4RZ4A 2O7QA 1KD0A 3RCMA 4PUKA 2ADAA 4M56A 2J8TA 4GH1A 4Y8FA 1K6WA 4P7RA 5BNKA 1HVXA 1G6CA 3RLUA 1QR7A 2OB3A 1W91A 1IQ8A 1YXYA 1VFLA 3UR8A 1SUXA 1FH9A 5IXEA 1T5AA 3ANYA 4JTFA 2WKGA 4EK7A 1TRDA 4PCNA 7ODCA 1PB0A 1S39A 4YTSA 1LL7A 5CC6A 2YIHA 3VX1A 2J9YA 1OK6A 4PN2A 4MUZA 2D2GA 2XGIA 3DGRA 4PUEA 1K70A 3F5LA 4PUUA 2PF8A 1TTQA 4MIMA 3MUXA 2CU0A 2WK2A 3BAJA 4GIAA 2O0TA 1TVLA 1FWEC 2PAJA 2QS8A 2WXDM 3DI0A 4J3VA 3VAVA 3CH9A 3WLOA 5D33A 1XSJA 3HTWA 4FB7A 2OR2A 1R9YA 3ITLA 4J3TA 1UG6A 3T6CA 1FHLA 5XIAA 1O6IA 1YDVA 3DAQA 4UB9A 4H9MA 2ACUA 2CLMA 3ZXWA 3D5HA 1V3KA 4QXIA 2F9RA 4WJ8A 1KFLA 3USZA 1O1HA 3VE7A 3QZ6A 3WMCA 1B1YA 4WD0A 1QOPA 2UV8G 4EE9A 1JFHA 4EWJA 5E0KA 3VYLA 5G5IA 3ABQA 1AZ2A 1ZRQA 3AXMA 3E49A 4ZA0A 1R85A 2DZSA 4BWLA 3M6YA 3WLHA 1HKIA 3QLLA 2A7NA 3EA2A 1GHSA 4ZTXA 4R34A 3U8GA 1Y7VA 4ZQMA 3AICA 3WH6A 1OABA 2A3AA 5EMUA 4LEFA 4HBKA 1MWOA 3NCOA 1E0UA 1OYAA 5EY5A 2CHOA 4LS0A 4IX0A 4L4MA 4NXSA 2BBFA 2WMFA 5I3KA 3IJQA 3IEBA 4HZ7A 2PP3A 3GBDA 4HZ8A 4C5YA 1D8WA 2P0OA 3RF9A 2XDFA 4AY1A 3MO7A 2O4QA 5EBUA 4W84A 2ZRZA 4LUTA 4O14A 1CB2A 2VQUA 4U33A 4GISA 3AIEA 3WLIA 1XD1A 3EDJA 4ACZB 4ZGYA 1LL4A 4PCPA 2J6XA 2V9DA 4KF1A 3RFAA 3Q65A 4GY1A 3KVMA 3KLKA 3VNZA 1CXKA 4PMNA 1MRAA 1PDZA 2NQ5A 2FHCA 3N14A 3WQCA 7REQA 3QQ0A 3AIQA 1UKSA 3ALGA 2X1TA 2I17A 3NSXA 2YX0A 4ZB0A 2QF8A 2IKIA 3LHWA 5CH9A 4B5NA 1TPH1 4JBRA 3L2IA 3DG7A 1FBAA 3WNPA 4QJ4B 4PRRA 2YW3A 5D8ZA 2YZ5A 5CXPA 3KOYA 4HPJA 5AY7A 1ZTVA 4GVIA 1WX0A 3V18A 4HNTA 1ELSA 3OZPA 3C2OA 3CZKA 3SAZA 3KDNA 3D6NA 3PY2A 3LRMA 4PMOA 4TMBA 2EBNA 3GUGA 1CXLA 2E7FA 3GUWA 1G94A 1FP8A 1HL8A 2PWHA 4PYSA 1F4HA 3UEQA 2PDHA 2YB4A 3CIWA 4HHMA 1KTCA 5BZAA 4UFHA 5DXYA 1N55A 1B3XA 1SJCA 1CGUA 3AO0A 4MZ1A 3A4JA 3UXAA 1OCBA 3S2CA 1LDCA 3UR5A 4RW3A 1XIDA 1ZZMA 3W1UA 2J6VA 2J7DA 4IHCA 2PCQA 4POCA 1AW2A 1DIKA 4W88A 1XLDA 4LS2A 4NVTA 3CV1A 3GXNA 1DIOA 2C14A 4S3DA 3T0DA 1IT0A 5D30A 4LV9A 2E8YA 4JYEA 4WDWA 1JGMA 4A22A 3CAKA 3MBDA 3WQEA 3GLCA 3NQBA 1PTAA 3TMLA 3O05A 3WK2A 3IIVA 5C0QA 3W74A 4IH3A 1A5BA 1V6VA 1ODUA 1PHWA 1OX4A 3ZLFA 2XWDA 3GDTA 5D9MA 3NPVA 2QKFA 3QR3A 3HGOA 1R3YA 3W75A 4DAFA 1YW1A 5A1AA 1EFZA 1I2OA 2HS6A 2X1SA 4GXWA 3L5AA 1EO7A 2GLKA 1ME8A 2WC7A 4O4WA 4O1CA 5T8GA 5CLWA 3LGGA 4U3CA 2IW0A 2Q8LA 2J88A 1K9FA 4Z2IA 2INZA 1G69A 3P0XA 1KCZA 4K38A 2J7HA 3W87A 1LP6A 2O4MA 1FOBA 3QFEA 3QV7A 4QQ3A 3ZT5A 4B5SA 2WM0A 4I7WA 1UKQA 1CB7B 3A9BA 3ZVHB 9XIAA 1H0GA 5D2XA 2I5IA 3C3UA 3TXZA 1M1BA 4HHLA 1EC9A 3TDFA 3HURA 3LK6A 4B5WA 1WAWA 4CEXC 4QAIA 4EAMA 2J8GA 3BC9A 2Q09A 5CPNA 3GAKA 2DFAA 3H4XA 1T41A 4A2SA 4OKDA 3I3BA 4J3UA 5HNRA 2P50A 3ARWA 5EMMA 3E5BA 1T99A 2I16A 1TJRA 1GYMA 5DBTA 1GEHA 2YCLA 5AVHA 3BGAA 4AFYA 4H6EA 4TMCA 1LG2A 4A35A 2Y7GA 3E2RA 4GUHA 3FN9A 2AL2A 4P2VA 3U6WA 3DH7A 4NJKA 3U7BA 2W61A 3SQSA 4J3ZA 4GKLA 1XXXA 4G2DA 3LHVA 4IP5A 4DB7A 3MUCA 3C0SA 3B9AA 1G67A 2ACRA 3F4VA 5EFFA 5M1TA 1WCGA 5LNSA 2NVDA 4WLCA 1J2BA 1HL2A 3EOLA 1DOSA 4YU1A 4PSPA 3TFCA 4U4MA 2ZX9A 4AD4A 2OZTA 2JE8A 4HJWA 9RUBA 5I78A 1EF3A 3ANVA 1VLWA 4LT9A 2PMQA 2ZIDA 1O5RA 2XIBA 3I6EA 3T7VA 3LG3A 4IX2A 3TK7A 3WDRA 2E6YA 1UROA 2V30A 2WJZA 4P5UA 4Y9NA 1VFFA 1H7NA 2CESA 3GO2A 1BGGA 1PX4A 5G2IA 1R2TA 3THUA 2PA6A 3MCOA 1K8CA 4Q33A 3O16A 5EL1A 5LIUX 4W89A 4D9PA 4HTBA 1F05A 4W7UA 2BP1A 2CHRA 4GIYA 4X0VA 3F2CA 4M6QA 3LM7A 3HQPA 4O1FA 3OZOA 3EWXA 1MUWA 3LBCA 1K03A 1EIXA 2XWEA 3WN6A 4YHEA 2QAPA 3UWUA 3PP7A 3WDQA 1IZJA 3R0KA 1AMKA 1EQPA 4V27A 2CXEA 2YCIX 4I9TA 2RHGA 4Q8VA 1QI4A 1NQKA 4E0CA 1JCLA 1X1OA 2V6AA 5D37A 3V5FA 3VIFA 2FGBA 2QV4A 2P53A 1UYQA 2XIMA 3QMRA 1ZUAX 3R5EA 1V79A 3KBSA 4NT0A 3N4EA 2EPMX 4B3ZA 1REQB 1WOAA 5REQB 4UWMA 4A8IA 5D9OA 4ML4A 1VFHA 2JBMA 3CAVA 1OK4A 1R38A 1MSSA 3UXKA 3VD9A 1XHGA 3W24A 1DXFA 3KTCA 1C8YA 2PGRA 3UWVA 1NOFA 3CM4A 3DECA 4LYKA 4DNHA 1WDQA 3L4XA 5I5RA 3S2LA 3EEZA 1EL3A 1RP9A 2Y24A 2HNHA 1WB0A 2V67A 4WOQA 5FKYA 1ZENA 1JUBA 3RLGA 3PTDA 4WJXA 4DBUA 1EUAA 3MO4A 1OFRA 4OBSA 2BOEX 3LNPA 3BCDA 4R9OA 4LUSA 1CBGA 2AL1A 1JPDX 1CLKA 1P0BA 2GJLA 2ZXDA 3VCRA 4CQDA 3VKAA 3UNDA 4DF1A 1DWHM 1ODZA 2OU4A 3WLTA 2BWGA 4QIUA 2DIEA 1IYXA 1KGXA 3URBA 3GTFA 4HNLA 2PDMA 5FJUA 3XIMA 3SRFA 2CLOA 4BQ3A 3GBEA 2DZWA 3P5ZA 1GVYA 3RU6A 1H4PA 1TTJA 3OQ8A 1L8NA 3NUKA 3R12A 4NL1A 3ZSTA 2C0AA 1OEPA 4HOXA 3VNKA 4WEVX 4AD3A 2VUNA 1ZNNA 2VD9A 1TV4A 3OIXA 1POJA 3P84A 3Q37A 5E0FA 1JYVA 3P2VA 5JBDA 1ITQA 3SFKA 5EYWA 4I9AA 4ICNA 4PZVA 3KP1A 1XRSA 3IVSA 3ZWSA 2H90A 2QUNA 1QNRA 4BS0A