3LG3A

1.4a crystal structure of isocitrate lyase from yersinia pestis co92
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
419
structure length
419
Chain Sequence
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTASSMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isocitrate lyase
publication title 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 144
structure length 419
sequence length 419
chains with identical sequence B
ec nomenclature ec 4.1.3.1: Isocitrate lyase.
pdb deposition date 2010-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lg3A00
5TAOA 3VAVA 2VWTA 4HYWA 1PKMA 1VBHA 1GGOA 3T05A 2XZ9A 1F8IA 1E0UA 1M1BA 1XG4A 3BJFA 4TV6A 4WJ8A 1PKNA 3SRFA 2DIKA 3QV8A 1OY0A 4L7ZA 3M0JA 4KCTA 4FXFA 2HWGA 3P0XA 3QTGA 2QIWA 4B5VA 1KC7A 4LSBA 2G50A 3B8IA 3T07A 4L9ZA 3SRKA 2X0SA 1A3XA 3PP7A 2XDFA 3KTXA 2KX9A 5JVLA 4QG9A 1UJQA 1ZLPA 3EOEA 1O66A 4FXJA 4TV5A 4B5UA 4IMAA 4KCWA 4ROQA 3T0TA 1O5QA 1A5UA 3GR4A 3IS4A 2L5HA 4B2DA 3HQOA 4RPPA 1F3XA 1S2VA 4B5SA 1U5VA 4KRZA 2VGIA 3EOLA 1IZCA 1T5AA 4KS0A 3U2ZA 4MG4A 1F61A 2E28A 1KBLA 3ME3A 3GQYA 3SRDA 3I4EA 3QLLA 1F3WA 1AQFA 2V5KA 1PKYA 1JDEA 3FA4A 4IP7A 4B2DD 4DRSA 1XG3A 3LYEA 3OYXA 1U5HA 1DIKA 3QQWA 4HYVA 4IQDA 4QGCA 1DXFA 4B5TA 2DUAA 3FA3A 1F8MA 1IGWA 3G2GA 3KHDA 3E0WA 1OQFA 3N25A 4KCVA 3PUGA 1PKLA 1A49A 2V5JA 3OQ8A 4QG8A 2HROA 3MA8A 2XZ7A 1MUMA 3OYZA 1DQUA 1A3WA 3QV6A 1S2WA 4L9YA 2R82A 3R4IA 1ZJHA 1Z6KA 4KCUA 3H6OA 3SRHA 4B5WA 2OLSA 4IQEA 3M0KA 2HRWA 1PYMA 1S2TA 2BG5A 1E0TA 2VGBA 3EOOA 2HJPA 3GG8A 4G1NA 4L80A 1DXEA 4YNGA 3HQPA 4MF4A 3E0VA 3E5BA 3BJTA 3HQNA 4YJ5A 4B5XA 2VGFA 3QV7A 2ZE3A 2WQDA 1VBGA 1SGJA 1O68A 2VWSA 2VGGA 3QZ6A 3LG3A 4QG6A 4JPGA 1M3UA 3QV9A 3EZ4A 1S2UA
chains in the Genus database with same CATH superfamily
3B3DA 2GJRA 3ALGA 1UD8A 4BI7A 4YTRA 1N2VA 2R1PA 1PKNA 1TWIA 3FYOA 1ZBWA 4BEUA 3DAQA 2OEKA 3RCMA 2X1UA 2PDHA 5D02A 1K1DA 3W7RA 1XDLA 3A22A 3EOUA 3RHGA 2A21A 2ZZ3A 4UFJA 4B91A 3STFA 2YA0A 1F3XA 4I3GA 2ZOXA 1OK4A 3KBJA 4GY1A 1T5AA 1E5NA 3BOFA 3EDFA 4IGNA 4L5ZA 1FWNA 3MY9A 1K9FA 2YZ5A 1F5ZA 2W67A 1IEIA 5FF3A 3EWDA 1A53A 3QQWA 4Q4OA 4J3WA 5HOSA 4NZJA 3TZFA 4E2VA 4PA8A 2YXGA 3KWXA 4WK9A 2FGZA 3LPPA 1SR9A 7XIMA 4AX6A 1MZHA 4EP8C 2J78A 3IJ7A 3HZ3A 3GW3A 5AVHA 3VIMA 1ODZA 1WAUA 4ONVA 4ZODA 4HPGA 4DWSA 1I9CB 3B0YA 3LCHA 2WHLA 1Q63A 4PMVA 2XSAA 3W6YA 1E55A 2Y61A 3DXIA 3AWOA 1BG4A 3IK2A 5GJNA 5E5CA 3G3MA 2VEPA 4Q4SA 2PFHA 2X09A 3O0FA 4D8LA 2DV0A 3QN3A 2NVAA 1V3JA 5FF2A 3LRLA 4V27A 1BVZA 4FX8A 3WUBA 1W8SA 5ECUA 4A22A 3MZ2A 4K7VA 3KL0A 2WPBA 2C16A 3W26A 1YYAA 1NARA 2GQ9A 4GGBA 3PJXA 4DZIA 3E2RA 3LHZA 1CT5A 2R8WA 3T07A 3TCEA 4RCXA 2EGZA 1XWYA 5FEXA 1N7KA 1P0EA 2WBGA 2XFFA 5FF0A 1M7JA 1MDLA 4PZVA 4CCCA 4DUXA 3H4WA 3BICA 4PYSA 6REQB 3LTSA 1Q66A 3LK6A 3CM4A 2CLLA 4UUIA 4E6MA 4JTQA 3EGJA 2KAUC 4G7EA 3WQOA 4DBSA 3PJWA 2XYLA 3E9AA 4GI9A 4R27A 4M51A 3UWQA 2VDGA 5F4WA 3SQMA 4O28A 4DWDA 2OMAA 1VFLA 3B06A 3CUHA 3C0SA 4ZQCA 2YIHA 1NWRA 3N17A 1DWGM 4Y9MA 5CCZA 3C3UA 2Y8UA 4O0ZA 3CHDA 1BPLB 5G1MA 3ZJ7A 1ZAJA 1RP9A 4C6NA 1TSIA 3O16A 2CLEA 2YYTA 5E0KA 4H8VA 4NJJA 3ZZ1A 1UR2A 1FHVA 1EF3A 5D9OA 2OKOA 3CT7A 4H8HA 2GSHA 3G1AA 4NI8A 3UG4A 4NZFA 9CGTA 4OUEA 3SUWA 3E38A 1VPQA 4HGXA 1S2UA 3K1GA 2BLEA 3CPRA 4ERGA 2PDKA 2C79A 3IJ6A 4ADUA 4RR4A 3W6LA 4OECA 2Z1XA 3MW7A 3DYMA 4I9JA 1FWWA 4GXMA 1XDMA 4GVHA 4TMBA 3KBMA 4JFTA 4BEQA 1GUVA 1HIZA 3NWRA 2ZUSA 3CO8A 1C90A 1CGXA 1OFOA 5FEZA 3T0CA 2Z24A 3MBFA 5CPSA 4QDMA 1MDRA 3N34A 3MCOA 5JUVA 1UWIA 2XIJA 4KEVA 1K03A 2EKGA 5A95A 3UR7A 1TPDA 2XVLA 4Q8VA 1F73A 5HWJA 1H2JA 2DZBA 3KOZA 1NDWA 3SQSA 3CYVA 3LGGA 3G6MA 3V1PA 4IUOA 1LROA 1QPKA 3BO9A 3PTDA 5I3FA 4J2MA 4LBSA 3LHWA 3R5EA 1SO5A 1OD0A 4C6JA 4FNQA 4XZHA 4FAMA 1VQTA 2Q09A 2HV5A 3PPHA 1GOIA 1XLDA 3STGA 3GG8A 4CQ9A 1YNPA 4IISA 3AROA 1D2KA 5CSSA 5C9RA 3AFBA 3F2CA 1MSSA 4QEHA 4K1WA 1YTKA 3EWUA 4OFCA 5FAJA 1QHOA 3E2SA 3L5AA 4DJFC 3NPUA 5LIWX 2WJZA 1R3WA 3N18A 4C7GA 3RPMA 2E5BA 3RRAA 1NQ6A 4RZ6A 4FXFA 1MWOA 5REQA 4GKLA 4NVTA 2UV8G 3TJLA 2XM1A 2NV2A 2Q02A 4IQJA 5LA0A 1PJ9A 5I3DA 4O10A 4GRSA 4BWLA 1ISXA 1E5JA 2QVNA 3EWYA 4DXXA 3A4WA 3OLGA 3JRKA 5SWUA 3U4FA 7TAAA 1VYRA 3CEUA 5AHNA 1MEWA 1HFBA 1F9CA 1IT8A 1QBBA 3TA6A 1JAKA 1LORA 3MKKA 3O0KA 3M9YA 1IT0A 2HNHA 4LRSA 4O54A 4XV0A 3H54A 3CASA 3ITCA 4C6PA 4XZIA 4JQ4A 4NKCA 4ASTA 1H4PA 3WEMA 3DFNA 1IIGA 1XIDA 4WDWA 4HU4A 3EA2A 5B80A 3MT1A 1F4AA 1TPB1 1US0A 4MGGA 4ZA0A 2V5BA 3D6NA 4AFYA 1WDSA 4PR4A 3L4XA 3LI1A 4EWND 1KBJA 5A69A 1HG3A 3QZ6A 2W5FA 2GJPA 2O9TA 2R14A 4F0RA 3BZGA 4WCJA 2J88A 3FJ6A 3ECQA 4UNKA 3BMWA 4X0VA 3THUA 5BWFA 1XGEA 4ICMA 2FZBA 8A3HA 2PWEA 1GKPA 4A3HA 4FK9A 4N0RA 3EX6A 2P8CA 1XLAA 3D3FA 4MB3A 1XH0A 3PZVA 2WYSA 1FWHC 3W02A 1CXKA 1L2UA 3QW4B 5HQLA 3ARVA 3BWWA 2O7SA 1G67A 4KWUA 3SIMA 1W0MA 1QPRA 2ZUWA 2PUZA 4WSHA 5I3IA 2ATSA 1QOPA 1ZFJA 4LV9A 1B54A 5GVJA 1W1A1 1F8MA 4M1RA 2FZ8A 3LNPA 4JTUA 1SZFA 1N8WA 2BMBA 1XIJA 3KOFA 1SFTA 1GOXA 1H7OA 2YBTA 3D47A 3LXAA 3S42A 4XAPA 3IGHX 1RR2A 3P84A 1LLWA 3ZLGA 7REQB 6REQA 4LALA 3G1VA 3WBXA 3AU2A 3WMSA 3O6DA 4W7UA 1JUBA 1QTWA 2Y7DA 3DOPA 4MF4A 1SO4A 3OW1A 5D2WA 3PWAA 1EHAA 4S39A 3G8RA 2QCGA 5CBJA 1O68A 1SW7A 3W73A 3AIRA 3FLUA 1TA3A 3GO2A 3MO7A 2PBOA 3AHXA 2J25A 1PYFA 4L61A 4W4QA 3DEQA 1LQAA 3GXPA 1QNPA 4JOMA 4GNJA 2GDUA 4MB1A 2QCDB 4DEFA 3U48A 4DO4A 2D24A 2E6YA 3GDLA 1XBVA 2FJUB 2X0SA 3M0LA 3R2GA 2VZUA 2RGMA 4GYPC 3W7LA 3CB8A 3QHOA 1EIXA 2X0HA 1J11A 4MB4A 2YGYA 4O1CA 4D6HA 1N82A 1MFVA 2Y63A 1Z41A 3ME3A 1UWRA 4RKAA 3UP8A 3Q94A 4GMEA 4PL1A 3OYXA 5BZAA 5AYIA 2AMXA 2FDMA 1J0JA 4UIOA 1JNEA 3AS0A 1QPNA 1Q45A 4G9PA 2GVGA 1ENUA 3VUPA 5D05A 3TV8A 1XLBA 3V1HA 2CLIA 4X60A 3UXAA 4CNUA 5D9MA 2VC9A 3QF0A 4JN6A 3GDBA 4WR3A 3WMBA 5U4NA 2X1IA 5DBTA 5D4YA 5HJYA 4KQNA 4KERA 3OLIA 2Z1VA 1V6TA 2WC3A 3T2PA 1YADA 3STPA 1F05A 2QVHA 4J28A 5D8WA 1TV7A 5F1UA 1V08A 3QHMA 1R3VA 4QJ3B 3SY8A 4JTRA 3EZ4A 2CC0A 3UZYA 4ZR8A 1ITXA 3W25A 5MKGB 4N02A 1BKSA 3H4XA 3BJFA 4GO9A 3W37A 3QV8A 1RJRA 1EHNA 3S5YA 1H11A 1BRLA 3AO0A 2O9RA 3A23A 2G41A 4MWAB 5ENLA 3W71A 2QUTA 1IEWA 3NOEA 1KM3A 4EXQA 4CCDA 2I9EA 3WJZA 1KKRA 2WBKA 4U2YA 4HNLA 4NILA 4A8LA 2W79A 4BY3A 2C1HA 2CKSA 3TEVA 1E43A 5F4XA 2YL6A 3GNOA 2ZTKA 4MZYA 3CL6A 1H7NA 3EEZA 3IACA 1ZP3A 3SCRA 3RG6A 1QDSA 3RM4A 2ZZ4A 4OGZA 3UFYA 1IF2A 4L9XA 3KRSA 1S5MA 2FTYA 1OX5A 4Q8MA 4IUGA 4XVDA 4V1YA 2B31A 3BG5A 1Z69A 4H6KA 3HMCA 1RA5A 5I3GA 1L6WA 1S3TC 4KWWA 3GXNA 1EBHA 2VGGA 3M4HA 1MW1A 1FWRA 1CXFA 3WQFA 3OTRA 4O0QA 1E4NA 2QXWA 3GE7A 5I0DA 3NQDA 3QY8A 3UZXA 3ZFHA 2GYIA 3LHYA 1LRQA 3QR1A 3P2VA 1SJDA 4JXCA 2BXZA 4L4OA 1OWQA 1XLFA 4G6CA 3C5QA 4O0KA 3VOIA 1NTHA 2Z2UA 4PTMA 3FKKA 4XISA 3NM1A 1G5AA 1B9ZA 2VRKA 5TBOA 4C6BA 2GZXA 1V77A 3DG6A 3W72A 1GZ1A 4UMAA 5CPMA 1HJXA 2CEQA 2CWXA 3S6TA 3I7SA 1K7FA 2REQB 1RVGA 1R7OA 5C7VA 1XFBA 3WNKA 4O53A 1UYQA 3MYOA 5J04A 2YCIX 4PTDA 4DN1A 1BYAA 1TV5A 1G94A 4IIHA 5EBUA 4QNEA 3R8RA 5BRQA 1DQUA 3T0AA 4TVCA 1DHKA 1DWHM 2W66A 4JFVA 3DERA 2HTMA 3M0HA 1PEZA 3OVPA 1B4EA 3J7HA 2E68A 4OBRA 1XSIA 4AWEA 3FDKA 3NTYA 3LS9A 3PB0A 3H7RA 3PULA 1Z42A 4EWJA 1WXZA 3GG1A 2JKEA 2QZRA 3NZ1A 3SCWA 1V3MA 1CGWA 3BQ5A 3NGJA 1CTNA 2BGSA 4MIMA 3CV1A 1FHUA 3O2LA 2O9PA 3CMFA 5K2ZA 4AWUA 3B8IA 1B3XA 3TCSA 1UR0A 3SRKA 1HJQA 1HL8A 3AHVA 3ARSA 4IXHA 4PRRA 3VIKA 7REQA 1BYDA 4J3UA 1M03A 2MANA 3PHAA 3RCNA 4GYJA 3UYCA 3AXKA 4ES4A 1VJSA 1V8EA 4XVEA 2Z00A 2X40A 3E6EA 1DE5A 4N6EA 2PLCA 3S83A 3AQUA 1T96A 3RCYA 4ERIA 3NSNA 4GFSA 3G1SA 5D04C 1SW0A 3Q4DA 4ZFMA 1W1IE 2DPEA 4MMWA 3N11A 1JZ8A 1JG9A 3WQEA 3KFTA 3M44A 3R7MA 2D22A 3HO8A 1KKOA 3LHUA 1E0TA 3BLPX 1OZMA 3SZ8A 2OODA 1IXNA 2DSVA 1S3HA 1EDGA 2XIQA 1M6JA 1KBBA 2EQDA 3B03A 3QV7A 4IMDA 4LCQA 5H91A 1WA3A 3CS2A 5I79A 1AW2A 2F61A 3M0YA 2WVTA 5HMSA 2X7VA 4HHHA 3GS6A 3DBNA 4UOJA 2O4MA 1EGMA 4H8UA 4HPXA 4XAFA 1T41A 1DEDA 4PCTA 1XC6A 3JS3A 1GWJA 1XRFA 1RCXB 4AISA 1P43A 3BOXA 1QNSA 1ADSA 1IYXA 4NRSA 3TOPA 3IUIA 2ZA1A 5DCDA 3VGFA 2XVGA 4GABA 1QATA 2ZICA 4BF9A 4QG9A 3O1NA 1TYGA 2YW3A 3OGSA 3F1QA 3P80A 3WF0A 2PCQA 2VT0A 2OYLA 3LV6A 3DN5A 3GU2A 4HOWA 3UWUA 3ZSSA 2CETA 2WJFA 3S8HA 1Q4NX 1F61A 3DU0A 5D9PA 5HR7A 4JY9A 2YXOA 3PPFA 1ME7A 1IZJA 1B2YA 1RCOB 4E4UA 4D6DA 1YW1A 1Q3NA 3RU6A 1PTAA 3W7EA 5MKGA 1MRQA 5A8QA 1UZ4A 2VVNA 1XSJA 5CZKA 3E02A 3LZ3A 3T2QA 3KAOA 3B8VA 3ORWA 4P8XA 3SN1A 4MWAA 3UVAA 3WNMA 3NDYA 4QDPA 4PE8A 3KLLA 4FIQA 3E96A 1DJZA 2CLMA 1EJUC 2Q3OA 4KF1A 3W22A 3DG7A 3PSWA 4D6IA 1HJSA 1TZZA 3L0NA 3TW7A 1C8QA 4C6FA 3T09A 1PAMA 5JH2A 1UMLA 2VYOA 3MS8A 1V02E 2J66A 2ALRA 1RXOB 4GJJA 3MV01 1VFTA 4Q4MA 1A5KC 2WNNA 1SZRA 3VPLA 3BV4A 2VO5A 1LP6A 1K8XA 3L4WA 1G01A 3EXRA 2BGQA 3BAIA 1J01A 3VGGA 1A5BA 2JGQA 4HPNA 3R12A 5CGQA 2ZVRA 1H7XA 2CHNA 4XWUA 4BS0A 2J7DA 1OT2A 4CNTA 4B2DA 1WP6A 2GVEA 3UZ5A 1HO4A 4QNWA 3VIJA 2OWXA 3HPZA 4HMDA 3HGSA 5JH1A 5KINA 3EDDA 4NT0A 2QEZA 2TSYA 1W3JA 1UPMB 2CITA 2R94A 2PC8A 3AIQA 1I2QA 2QKFA 5A6KA 1JDEA 1TRDA 5EKYA 3NZQA 2YSWA 2Z25A 2WMIB 1TV8A 3EWBX 3TOYA 3PFRA 3UVIA 2VCCA 3PPGA 4JNZA 1G4EA 1AH3A 1W1VA 4PCNA 4C6IA 3AXIA 3A5VA 1L6SA 3DCPA 1GKQA 4YHEA 1FDZA 2FDSA 1U22A 1J2BA 3JW7A 3W2MA 2C7FA 4MJZA 1SMAA 5AOUA 3KRBA 5F2MA 1IE7C 1UZ1A 2ASHA 1V7YA 3HQNA 3CHEA 4US6A 4M6UA 4XZLX 3HM7A 4OIFA 4RNHA 4R53A 2CNCA 4MZ8A 2V5DA 1R2TA 2CKRA 1FCVA 4PFMA 1OK6A 3NOYA 3N14A 5A3HA 1K7EA 4YYFA 4M3PA 4FOJA 3W76A 3UQNA 4AHPA 9XIMA 2H9AB 3RLVA 2GLKA 1VFFA 2PWDA 2FPTA 5BXSA 3GDKA 2J7BA 2JEQA 3ITTA 1UP2A 3MDUA 3OZMA 5J5DA 4XQ6A 1XISA 3AHYA 2INEA 1FH8A 1A4MA 1Q2SA 3TTSA 3ZYZA 2Z1WA 4A3YA 4E8GA 3UG5A 3RLUA 3WK2A 3GTHA 2V5CA 2WM1A 1OJXA 5KITA 4GYFA 4GBDA 3UCDA 3P82A 4D6CA 3VCCA 3U3HA 2VQUA 3O3RA 4D71A 4RX0A 3VD4A 1H5VA 5JMUA 2ZFAA 1XLEA 2V3FA 3EYPA 4GWEA 3GXTA 3UESA 4MUPA 1R2SA 2I5QA 2CBIA 1IWBA 1OCBA 1RLCL 4F8XA 1XBXA 3AZSA 4HD5A 4JKKA 1GCYA 3WKZA 1RPXA 4FR6A 4MNJA 3WNNA 1A5NC 5I2UA 1XD0A 3FXYA 3DI0A 4WJXA 2CBVA 3WF3A 3HTWA 1ICQA 4DJDC 3EPOA 6ALDA 4LUYA 4LUJA 1GVFA 1R3SA 1DWFM 4WX2A 4P8UA 2NWSA 1S5TA 5E6YA 3ARTA 4HNVA 3R1ZA 3OVRA 2PWUA 3AWNA 3FXGA 3IIZA 2BNJA 3F5LA 3QHNA 1GQKA 4OJYA 2J74A 3OVQA 1KRMA 1RLDA 3VK5A 4HHLA 4AZGA 4BZYA 4EPDC 3GIPA 2VEGA 4IIGA 1R3TA 1HL9A 3I3BA 3BGJA 2HXUA 2XM2A 2QQ6A 2WMHA 3U7BA 4B2DD 3CLMA 1JL8A 2RH9A 2Y62A 3ITOA 2ZA3A 3KTSA 2J47A 1RVKA 5AECA 1CYGA 2FPVA 3NCOA 2Z26A 1AA1B 2C71A 3RXZA 3II1A 4G5DA 5G1TA 2HCVA 1MRAA 3NFUA 3PUGA 3W3OA 5A2AA 3PTQA 3HB9A 5EY5A 1LQ2A 2DT0A 3EX4A 2FVKA 3MCNA 4LAOA 3SADA 3N19B 2XHYA 3MCMA 3MA8A 3P81A 2YCJA 1UA7A 5XIMA 4AD3A 3EMQA 1XLMA 1K8YA 4KCUA 3APGA 3N04A 3LV5A 3U5UA 3TW6A 1PX8A 3WBEA 3RN6A 3S4TA 1DJWA 4DQWA 3USZA 4MJ2A 3LSBA 2PDPA 3ATYA 4UCGA 1VBGA 2A3LA 2Y88A 2ZUUA 1WDRA 1XH1A 4GGHA 5RUBA 2P50A 2FHBA 3UG8A 3E2VA 2ZZ6A 4Q7NA 3TNBA 3W24A 1PPIA 1RD6A 2DVUA 4H9ZA 4GQ0A 4L7ZA 2WCGA 4X0NA 4E0CA 4RXFA 1RH9A 2ZRXA 2OX1A 4I5RA 1KXQA 1E73M 4HU0A 3CL8A 4QLLA 4ROQA 3T0TA 1G7VA 1HVQA 1WKFA 4ALDA 2WAGA 5E0FA 4O4WA 2W3ZA 1M65A 3SCQA 4YS1A 3W70A 1OIFA 3F4WA 4W93A 4LYRA 1J4EA 2A7RA 2FB2A 1U5HA 4AD4A 1KQZA 3NEVA 3EWWA 4AHQA 1X1NA 4HK7A 2AMGA 2HE5A 1K9DA 2DY3A 4MVAA 1CLXA 2JFEX 3CC1A 1UC5A 4IMFA 3N6JA 4AVOA 1A3WA 2HVMA 5HWNA 2ALDA 3AALA 1KWKA 1EC9A 1V51A 1XYBA 4DLMA 3F4NA 1TUXA 4PUNA 1BWLA 3L4UA 4L80A 4CNSA 5C8BB 1EJTC 3K4AA 4DNMA 4S2BA 1ISWA 3G6LA 3WF2A 3R8GA 1XQLA 1UKOA 2WNQA 4H2CA 1O4UA 3R25A 2PE4A 2WK2A 3C56A 3TQ0A 1AH0A 3N1AA 4C1KA 5FD0A 2UWFA 4FLRA 1JFXA 5C7HA 1FXQA 3LI0A 4DM1A 2WMJA 3GYCA 1OGGA 4P8VA 2XN1A 4E8CA 5H8MA 1MXGA 1U83A 4NQ1A 4O17A 1TTJA 2G8ZA 2ICSA 1EC8A 3PBWA 3W1UA 4KGJA 2FYMA 2CLFA 2WHJA 1EX1A 1KLZA 1JULA 4P61A 4HBKA 3TC7A 3QPYA 3MKCA 4DJFA 1FFRA 1ZRQA 3BCFA 3AOFA 2B7QA 3P7YA 5GNYA 4E2DA 3A4JA 4B5TA 3FX4A 1NEYA 7TIMA 1B9BA 3BW4A 2QAPA 3MSDA 2WPGA 3RITA 1VS1A 1SJAA 2J77A 2QUUA 1LT7A 3VCNA 5HA7A 3PTKA 4HNTA 2DJXA 3ZIZA 1NDVA 1J0HA 1HGWA 4N9BA 5TF0A 4CD5A 1TJ2A 1NP2A 3SY5A 1TPUA 3HJEA 5LA2A 1IWPA 1OF6A 4YJ5A 1K6AA 3JZEA 1XW8A 4GC3A 5DX7A 2E1WA 2YA2A 2J27A 3CIWA 1D3HA 1GYNA 4AWSA 4FP1A 4RW5A 5H2ZA 2CU0A 4NNCA 2PZ0A 5IHSA 2CLHA 2OG9A 1JAEA 1AD1A 3FY1A 4EX4A 1ZCOA 3RX4A 4L4PA 2RKXA 5FCZA 5CEWA 3NNTA 4KMQA 2DIKA 4GI8A 2FPYA 2NSXA 1RJPA 2X0YA 5EPDA 3TN4A 2V6AA 3K1DA 3LSCA 3OBEA 4D8AA 3WLRA 3ES7A 4U3CA 4IIDA 5ABFB 1GW1A 4JTKA 5DO8A 3MP5A 3B8DA 3M0VA 2BHYA 2ZC8A 4MDOA 4DBDA 3C6CA 4L6OA 1JYVA 3GAYA 5DEZA 4NY2A 1JZ4A 3TR2A 3QGKC 3CPUA 3EOSA 3M1ZA 4NZ1A 3UJFA 3R8HA 4HNUA 2GVLA 4IP7A 3DI1A 3L4ZA 3G22A 3TXZA 1Q85A 2Y2WA 5K7JA 2ZRYA 3MHFA 5E1QA 4K7YA 4UR7A 1RBOB 5BOOA 1KRCC 3LEPA 4AZHA 1XYZA 2ZX6A 3TYBA 1RQEA 3K4WA 1ML1A 4FXSA 2PODA 1LOQA 5KETA 1T0OA 4H41A 1SO6A 9RUBA 5CJ5A 4ZSUA 3VNIA 4LGXA 2VTFA 1GOQA 3P5YA 3OG2A 1HJVA 3VKBA 1MEHA 3WK1A 2J7FA 3NJ3A 3BLEA 2WOQA 2QUVA 2XIOA 2R1LA 2YKKA 4HCLA 2J7CA 3GH5A 3W7NA 1E4MM 2G0WA 3EPMA 4FNRA 1IXPA 3H2NA 1E0XA 2NVDA 3UJ2A 2CZDA 3PY2A 2ZIDA 3OJGA 3IIOA 2IPJA 1KM5A 4HYWA 1L9WA 3RUBL 4BFAA 1GJPA 3L9CA 2NVCA 2WSRA 3I4KA 3LQLA 4F0KA 1JNDA 1OX4A 1WXJA 2A4AA 4I5UA 1D3CA 3CAVA 5KZDA 5AHIA 4WY0B 4RNFA 1OIMA 5F1VA 1SMDA 3C8NA 4LUSB 3WDPP 3W2JA 1E1EA 3I10A 4RDYA 3VA8A 4DZ5A 1W2VA 1R38A 4AZCA 1SSGA 4HSHA 4IT1A 3C3NA 1H61A 3QMTA 3TUUA 2C8NA 5A6LA 2XH7A 1OM0A 3MP4A 4KEMA 4Q6JA 4RXGA 3BAKA 1JD7A 4EPKA 4DAFA 1A47A 1SO3A 4GYPA 2SFPA 4PODA 4D1IA 5HPCA 5I78A 3N9RA 4IX2A 5J8LA 2DW7A 1UQZA 1EIBA 4E3TA 3EB4A 4HMNA 3N2CA 1VRXA 5TD4A 4WEVX 5CJNA 4US5D 1X97A 4CCEA 2ZX7A 4R3UA 1KW1A 3WMLA 3TNOA 3KP0A 5FESA 3SN0A 5K9XA 1ITUA 3N2OA 3NL3A 5C55A 1SVDA 2DH2A 2QS8A 3GHUA 3EDJA 4O14A 1PKMA 3WFLA 3ZLFA 1TTQA 4GCXA 1UROA 3OOQA 3NEHA 4MPKA 4GACA 3WD2A 4IP4A 5D30A 5AYZA 3R89A 3EB2A 3BLDA 1A3XA 2KX9A 2O9OA 4R34A 4TV5A 3WN6A 1BKHA 5GNZA 2F6UA 4Z1CA 1UWTA 3QEZA 2WSPA 3TN3A 5DN1A 3QQ0A 3KHJA 4V15A 1T6MA 3EXTA 3OO2A 1I8JA 1OCQA 1DOSA 3KVJA 1VFOA 5FIPA 2V5KA 2E9LA 1GKRA 3BH4A 3GWQA 2NQ9A 2OSXA 4OUIA 2DZVA 1XXXA 1E1CB 4HKPA 1UUOA 3V36A 1VEPA 1ZJHA 5LHEA 4NXKA 3S5NA 1J79A 4FZIA 1JDAA 4FNSA 4NX5A 4LW7A 4Q8UA 2VGBA 2JIWA 1UD3A 4G1NA 5EA9A 3SUTA 1BVWA 4Q4RA 4R88A 3MYPA 1FUYA 4XUGA 1H50A 1RSCA 1TELA 2XFWA 3KBWA 3VTRA 2HPIA 3H55A 4YVPA 1OADA 2QJJA 3RFAA 2E40A 3OBKA 4FOKA 2OGJA 1XM3A 4LNCA 1CXLA 4ERAA 4TV6A 5T9CE 2YDSA 3LHTA 1PX3A 1GPFA 2NV9A 2GWGA 1FP8A 1Q6QA 1EH9A 5LIXX 4HNNA 2TYSA 2HMCA 3VIFA 1GQLA 4U33A 1BQGA 4EKJA 1P1XA 2VHLA 1B3WA 3AHZA 3PNUA 4Y6GA 1A80A 2OXNA 5BU6A 3A24A 4FX6M 3AZTA 5ABEA 2OB3A 5ABGA 1QK0A 1OVDA 1FDJA 1EP2A 4DO7A 3WK3A 1SFLA 1O95A 3ARPA 4AXNA 5K4XA 2O0TA 1PDYA 4HYVA 1UC4A 2DT3A 4MY1A 1ICPA 5A8NA 5I3KA 4D2JA 6TAAA 3P67A 1CPUA 2ZADA 1H51A 4IOTA 3G5EA 2HVOA 3S2NA 1DJNA 2DUXA 3GVGA 4MY9A 4JDBA 5I02A 1HL2A 1E15A 4GY0A 1Q6FA 1ZZMA 2HJPA 3G8EA 2HNEA 4YNGA 1F3EA 5C54A 3FW6A 4MLJA 4E5TA 5DY3A 4ZTXA 3TW9A 4O8AA 3W01A 4LCRA 4OV9A 2ZRWA 1RUSA 1HZYA 2VUNA 4XK2A 4JEJA 4YPJA 4IM4A 8CGTA 1O7AA 4WOZA 3TKFA 1QO2A 3EA3A 1KM6A 3WD0A 3WL1A 4O50A 4XSMA 1W5NA 1OFPA 1VF8A 3LPGA 1NELA 4IPJA 4AIUA 4PMXA 2WVVB 4UTWC 3LENA 4JKMA 1CZ1A 5JVLA 4EOUA 3KOWA 1VAHA 2ZXAA 3UXKA 1HUVA 2I5GA 5AYYA 3CAKA 3F7JA 1FWFC 4KW2A 1QT1A 4FX7A 2XVNA 4XZ9A 3WDRA 3O6CA 4FO4A 2ZZ1A 1AQFA 5BXRA 4N42A 3BC9A 3GU1A 4LJ3A 4Z1AA 4QGCA 3E12A 3TYUA 4S3KA 4NI3A 4GZIA 3HPXA 3PZ9A 2WZIA 2YYUA 4JN7A 4ATWA 5AHFA 4NASA 1LZOA 2C1IA 4FNPA 4NIRA 1ZTVA 2QNEA 1WCGA 4P7RA 2G95A 1EJWC 3H2AA 3XISA 1FDYA 2D73A 3P0WA 4WY0A 3ITLA 3WH5A 4LU0A 3G24A 5D2XA 4NJHA 3W2KA 3S47A 2PTXA 3GLCA 2WC4A 3AICA 2GJXB 1V6VA 1ZBVA 1WZLA 1DPMA 2D69A 3PBYA 2QR6A 1J2WA 1XKYA 1QNQA 1LBFA 4PEEA 3QC3A 4LB4A 3EKGA 1VCFA 5BXTA 1MW2A 3W88A 2J7HA 2X30A 1J9YA 3U4AA 5I7GA 3NQMA 1H49A 5EL1A 4HPHA 3ABOA 3IIXA 1R87A 3PJUA 2FZMA 1FTXA 1S5WA 1I4NA 3A4XA 3EB3A 4S3EA 3EWXA 4Q22A 3TH6A 2DW6A 3WELA 5JXQA 1CW2A 4DI9A 5M3WA 1V3LA 2CYGA 1D7KA 3MTWA 3GTNA 5A2CA 3CQKA 2PTWA 3CTTA 5BOEA 1JCXA 3L23A 2ACRA 1S2VA 2BVTA 3CHCA 1JYWA 1XRTA 4KRZA 3SSJA 3VFCA 1VIZA 2ANUA 1LBMA 2R1KA 4ZB0A 1POJA 1K7XA 4DRSA 1V7AA 5CPNA 4OTKA 3REQB 3PZTA 1EDTA 1VENA 2XUCA 3ABXA 3ZOAA 5D2YA 1GOWA 4IFRA 3O7UA 3BE7A 3TZNA 3W28A 2V3DA 3MI6A 3QJAA 3SDOA 2XPKA 4JX4A 3CXOA 4A8NA 2EO7A 2RDUA 2WM0A 3SBFA 1XIGA 3B8UA 2WVSA 2QDDA 3BG9A 3GHSA 5JQ9A 2NQHA 2INZA 1EYWA 1SFSA 3BMXA 1YIXA 1WKDA 3WY1A 3A64A 4FPSA 4A6GA 4WKAA 1W3TA 4GUJA 3ISIX 3WZ0E 1A5CA 3SAZA 4DUOA 1A5OC 5AN7A 2WQDA 1XDJA 2VWSA 1ZAHA 3C8FA 1H0GA 5CPOA 2HSAA 2OGYA 3URBA 3TX9A 2A85A 3EPNA 3KS5A 3CV6A 3GDMA 1R3QA 2Q71A 3NDOA 1V0LA 4WJ8A 1GZGA 1KXHA 3N6QA 2VMFA 2Y0FA 3RO8A 1XYLA 2G3MA 2VUYA 4A3UA 3AYRA 4FXJA 1UR1A 4QE4A 1EYEA 4Q4KA 4QS6A 2YPIA 4RPPA 1GVOA 4AEOA 1KR0A 1KLYA 2YDAA 1QW8A 3QSTA 2Q8LA 5CPLA 5I3HA 4AH7A 4S3AA 3V0TA 1V6UA 1KM4A 2D3LA 1GG0A 2IQDA 4CVWA 2BVYA 1XLKA 5AZ1A 1OGBA 1KR1A 5DANA 1TTPA 4K2SA 3MP3A 1IEVA 3IARA 4PSPA 4J3SA 3SO7A 3WDJA 1EUNA 5BU9A 2GSEA 1WUEA 3CWOX 4H83A 4M6PA 3TWBA 1EXBA 3GFXA 3W7HA 3EAUA 4GD0A 4GNVA 3M0KA 1GYMA 5A94A 1J0ZA 1S2TA 1I75A 1GOMA 3VKJA 1NU5A 2E6AA 4ZO8A 3PF3A 5IBXC 4DO5A 2AGKA 2X7WA 6XIMA 4HK6A 3VKCA 1QMLA 2G37A 1W1PA 2ZBTA 3CEPA 1EP3A 3MVTA 3ZVHA 5C2CA 3LCIA 3OA3A 1XD1A 1P0BA 4IFKA 5A8OA 1P6WA 1E6XM 4KPLA 3AMGA 5DCBA 4OZOA 5FL0A 2OQYA 2ZCGA 3WJYA 3I7QA 1GORA 3VGDA 1BHGA 1ZLPA 2NQ5A 3SCVA 3N6HA 4K1GA 3IS4A 2P5NA 4LVDA 1O60A 2OT0A 2HVNA 1X8FA 4B5SA 1IHIA 1BF6A 3KXQA 4JIHA 4F2UA 2QDGA 1W54A 2I7GA 3GW0A 1FOBA 1ICSA 4HN8A 3ANUA 3UYIA 1NFGA 5FAGA 3C0QA 3CZGA 1EJXC 3SI9A 5AC5A 4AZIA 4D9PA 2OWCA 3MPGA 4QROA 3E0FA 2UY3A 4V1XA 4CQBA 4D6EA 3TA9A 4ZO9A 5G2WA 4TQTA 2HQAA 2PP0A 2QF7A 4RE2A 1LRTA 2WVVA 2EHHA 3FYYA 4S1FA 1XIIA 4ZTYA 3MZNA 2XWDA 1F07A 5CSUA 2XG9A 4CU7A 2AQOA 2ZWYA 1ZJAA 2VFDA 2EEXA 3GK0A 1W3HA 3VZXA 1JI2A 1QXLA 4M80A 3CUIA 4GX9A 4R7WA 3EDEA 5GJPA 5DFAA 5FJOA 1W56A 5D9NA 1SGJA 3BXWA 4XZMX 3VM5A 1LLOA 2J6VA 3LBOA 4UTTC 2V5LA 2QLYA 3VAVA 4JICA 1VBHA 3GIQA 2HS6A 2A2IA 2I5IA 2P88A 3ZLHA 3ARRA 4DF2A 3TSBA 2PLKA 1G69A 3ENLA 1ISYA 2HWGA 3HV9A 4LY4A 1QI0A 2PTDA 4NU7A 4ZE4A 3NVTA 4G56A 3ID7A 3FV9A 5IOBA 1WDQA 3P93A 1EGZA 3VKDA 2WKGA 4IZGA 4P7LA 2FFIA 3VOFA 1W91A 4DJEA 1WQ5A 4DZHA 3QGVA 4I8YA 3IWPA 4DJDA 1Q8JA 3H7UA 1WO2A 3S2CA 3PM6A 4BI5A 1ALDA 4QJ4B 1HF6A 2DORA 3LBMA 4UR8A 2H90A 1DWAM 1I6NA 1MNZA 3WBWA 4FSAA 1ZCCA 1H3GA 2J8GA 3CZEA 5MHBA 4C6CA 5M2FX 1OCJA 4JHMA 1EOMA 5AC7A 3KOYA 3SFWA 1GVEA 4MADA 4NAFA 3RYSA 1VEMA 1FHDA 1C91A 4JYDA 4WDUA 3K5XA 4HCHA 2O92A 5B7ZA 2BOEX 3DFQA 4B9ZA 3LM3A 2JK2A 2P0OA 3BJTA 4HIBA 4DBUA 3U6WA 3VM7A 3MWCA 1E3ZA 3BJSA 1S5NA 2YX0A 4F3HA 3G1YA 1H7PA 1ADDA 3BAYA 3TC3A 1KGXA 2A79A 2V3EA 4JX5A 2OYKA 2NUWA 1DL3A 2W61A 3PZOA 4X22A 3VYLA 4I90A 4LYPA 4Q4PA 3MC5A 1R9YA 4DAIA 1OCNA 1I2PA 5CZTA 3NO3A 5FSEC 2D0FA 1XR2A 1IEQA 3RIKA 4ZZ9A 1DQWA 3IJLA 1OABA 1R5YA 2E6DA 5DF0A 4ZE5A 1JYNA 3QFEA 5LIYX 1TZ9A 1LLZA 1XBZA 1K70A 5EMUA 2ZKMX 1E4IA 2OKTA 4KWVA 1P7TA 1XPYA 4W8BA 3K8KA 4O52A 3L0KA 4ZO7A 4QSFA 3E1F1 1DWIM 3O05A 3MJMA 3VDBA 3NQ7A 3G77A 3CQHA 2PDFA 1Q6EA 1U5JA 1TTIA 3CUFA 4W5ZA 3AHTA 3B05A 4UOZA 2F6KA 3ZJKA 3MUAA 1C7SA 2FHFA 3L0GA 1TVPA 4ZOAA 3JVAA 5AKQA 2QYGA 5HNRA 3K2GA 3NQ8A 3W7CA 2VEMA 4TVUA 3UG3A 1I0BA 2GVJA 3TC6A 4AY1A 3BGGA 2A6NA 3VZYA 1UBPC 2Z6JA 4IPNB 1ITQA 5LNSA 3BGAA 3SCNA 1Q2RA 2QF8A 3GR8A 1GVYA 2XGIA 4HZMA 1LF1A 5BW6A 1PCWA 4JGDA 3T8LA 4TX6A 3WX7A 3KOXA 1R7AA 3TJ4A 3RM8A 3DG3A 3VDCA 2VXNA 1J0KA 5JIPA 2ZA2A 1XLHA 2DQXA 1AUSL 3O15A 2ZRVA 3U2CA 4C7DA 2AQWA 4XZBA 4NNAA 4DYEA 4ACYA 2VURA 3WQ8A 2YCLA 2PDJA 2DT1A 2VOTA 1D8CA 1E71M 1AL7A 5LGXA 3IK4A 2YW4A 1CGYA 2PDXA 3SCTA 4K6AA 2FMNA 3FJNA 4UTIA 4DJED 4FEZA 3RU8X 2H8ZA 4DJDD 1K4HA 1XIMA 2VD8A 3O6YX 4UQBA 4P7NA 3POCA 1DIEA 1KV5A 3DC8A 4C6OA 1XP3A 2D20A 3G3DA 3LB0A 1P4CA 1GTHA 4GH1A 2OQLA 2E3ZA 2J24A 3HGRA 3TIMA 4ACZB 5HWMA 1OFDA 1XLLA 3AYSA 1E6NA 1ADOA 3HU7A 3IIVA 3R13A 3ZJ6A 1GQNA 1EBGA 2J8FA 1K8ZA 1PO9A 5F2GA 4J2PA 4RDWA 2WC7A 5HMEA 1TWDA 2QPUA 4P7QA 2PDUA 1XGZA 1EPVA 4RV3A 3ARUA 2WZMA 1R86A 3WMCA 4TU1A 1JF6A 3WD3A 4KCWA 2IPGA 1DJGA 2WKJA 5D8ZA 3L65A 3KP1A 1VR6A 5E9AA 1EEPA 4BK9A 3BANA 4S23A 3CTLA 3QLLA 3D46A 3DESA 1W3NA 4P7OA 4CLMA 1JZ3A 4GY7A 1KBIA 4W84A 1C8YA 1A0CA 4IL2A 3KL5A 1LL4A 1QI2A 3CPGA 1YMYA 3UA3A 3ICJA 4H9YA 3DIPA 4LANA 4JIRA 3V7PA 3NL2A 1Q7ZA 3P60A 3UA4A 1PIIA 5AC6A 2GPTA 4JQ2A 3ZWTA 4MAVA 4K36A 3KDOA 5M1TA 2PDNA 2WLZA 1NQKA 4LYQA 3PNZA 2HDJA 3W38A 5C9UA 4HCDA 4Q3MA 1NM9A 1QCWA 3MU7A 3ERPA 1K8CA 3LCFA 4PULA 3S5SA 2QMJA 2IKJA 4W88A 4H9TA 3CMGA 3MO4A 3S2LA 3W7JA 3LMZA 1TJ1A 3CAQA 4X9SA 4RL3A 2B7PA 1YBQA 3GUWA 3AC0A 3IJ9A 5BRBA 1KQYA 2VFIA 3P0XA 3QTGA 4XO7A 4XUYA 1EZWA 4WHBA 1GHRA 1BWKA 5CAHA 2ISWA 1WKEA 2GUBA 1IGSA 4PGLA 2D23A 4RV8A 3WJXA 4LEQA 4XBKA 2XH2A 1Q8AA 4Y9PA 1BEUA 2Y85A 2E9MA 1ZHAA 3HA1A 1I2OA 1Z89A 4D6JA 1K9TA 2VENA 4WXYA 4ZMGA 1FKXA 4U10A 2DSZA 4AMCA 2O7QA 5AC4A 3E0WA 1EXPA 4BQ4A 4RW3A 4FXRA 4OQVA 4NUWA 2I57A 2PURA 2PP3A 5FF7A 3CQJA 3CJPA 1JJKA 2VCBA 5CBBA 4PRTA 1VBRA 4Z17A 1FVPA 2I14A 2Z29A 3P5ZA 3TMQA 3S6OA 3TSDA 5TIMA 4F0SA 3W1AA 1L0PA 1Q6DA 1W17A 2XVKA 3XINA 2FH8A 4NZCA 2FZ9A 1VD6A 2J7GA 1OFAA 1QNRA 1X1OA 1JPDX 4LAMA 4QTGA 3C0LA 3MHUA 3QSRA 1LWIA 2BY1A 5E70A 1IEXA 3LXCA 3VUSA 3WQGA 1M5WA 4F0HA 4OHQA 5C5YA 3VNKA 5D03A 3W1QA 4RDVA 2GL5A 4IIBA 2QIWA 1KC7A 4LSBA 4W8LA 2GGGA 1OFQA 3PPCA 3VO0A 4C6MA 1H1ZA 3H2OA 1FKWA 3NYZA 1KNWA 1GVSA 1BYCA 1SYTA 1UW9A 3VD5A 2GQAA 3NO1A 3GRIA 2EBNA 3IGXA 1R0MA 1P1MA 3V3WA 1PTGA 5LXXA 3TN6A 2QJGA 5M17A 4OWGA 4MG4A 3W7OA 4NZ3A 2J4GA 4DM2A 1TJRA 4N7QA 2OU4A 3BL3A 3P62A 2BDQA 1YRRA 3VC5A 1XG3A 1BSIA 5EMMA 1DIOA 3WEZA 3E74A 3O63A 2EG7A 3RGTA 5DY2A 1E40A 4AEFA 2E0PA 3HOJA 4NYUA 2OLAA 2VFHA 3ZT7A 4UC5A 2EF9A 1UD5A 6A3HA 3AIWA 2DZAA 4W89A 1REQB 1F4HA 4S3DA 3SUVA 4Y96A 1I45A 1Z9AA 2A3HA 2NX1A 1JF5A 4AU0A 4C6LA 3CBWA 5GNXA 2PRMA 2MNRA 4C60A 4NNBA 4L6DA 3N13A 1IIHA 3GFYA 5D2TA 3RILA 5FJIA 1FWDC 2DVTA 4H3DA 4P5UA 2WSYA 5D2VA 1GVRA 4IMGA 2NXHA 3WDQA 2YL5A 1R6WA 3N2TA 1OHLA 3BLFA 2Y7EA 1JEZA 1OG6A 4ADTA 1G6CA 3TFCA 3KLKA 1TWSA 1Z44A 2OSYA 3GUGA 5FSDC 3M0JA 4KCTA 1FP9A 3NGFA 1A5AA 3RRXA 4KESA 4X61A 1E4LA 2VEKA 2A3CA 5BROA 1YDVA 4C90A 1B30A 4U3AA 4GYKA 3FCPA 4FOUA 4AZ7A 1TV4A 2PWFA 2GFTA 3G1XA 2PGFA 1RV8A 4IP5A 2BVDA 2DIEA 3PBUA 4A4AA 4C1NA 3RPTA 2ABAA 4GBUA 3W9ZA 1Z7AA 1H5YA 3BLIA 1KFJA 1R46A 4PCSA 4GXPA 3NQ2A 3IGUA 2WVUA 1PX4A 3WLPA 3OZOA 2EJAA 4NAEB 3WDIA 3CV2A 1R30A 3HV8A 3RDKA 3E49A 4GQGA 4DWSD 5F7UA 2V67A 1B3OA 4L65A 3B4UA 1OX6A 3CHFA 4GJ1A 4LTSA 3AXXA 3HG5A 2C14A 4AIOA 3S9ZA 3VX1A 3B0PA 3UCCA 1NDZA 4LUTB 4WKFA 4Z2KA 5CGMA 4ZB5A 1H41A 3VMPA 1ONEA 4ILSA 5F2IA 3EMCA 3PZIA 3MMTA 4UTLA 3HJZA 3VD3A 2NUYA 1RALA 3SGUA 1DV7A 3E5BA 1DJIA 1WB0A 3W1MA 4IICA 2RDTA 3POHA 2C19A 1KFCA 2F2HA 4F79A 1YXYA 1V3HA 2PDMA 1EB3A 1A5MC 3V5CA 1PWMA 4ICCX 2LLEA 4C5YA 3VOGA 2BVWA 3EBVA 1UKPA 3DFHA 3WH6A 4J9JA 4PMYA 1OY0A 4UQAA 2PU1A 3O9NA 3VABA 2VX7A 1H62A 5CJMA 5DCEA 5C9XA 4FMVA 4LVBA 2BBFA 4K8EA 2BSLA 4B5UA 4Z2GA 3F4VA 4I5XA 4KIEA 1LQ0A 3AI0A 4NG3A 2Z1BA 1WBJA 3PZNA 5I23A 4PMZA 4UXDA 4X63A 4FR1A 4FNTA 3VOJA 4H9MA 4LVAA 5BMWA 3TROA 3FEMA 3RF9A 5CH9A 4JNYA 4UTWA 3QMSA 3W1LA 4EXBA 3GG0A 4LV4A 3TAOA 1L6YA 6ENLA 2NW0A 5JBDA 1TPH1 2DQWA 2OFJA 5IXEA 2E5CA 3OPSA 1NFPA 1ZGDA 4R33A 2AKZA 2OLSA 4IG2B 1F74A 2R1MA 1FCBA 1K77A 1XIEA 2QJMA 4AWTA 1TE6A 4HA0A 4AAJA 1PS9A 4CNNA 1BFNA 4UBPC 4YTTA 4TX9A 1XJBA 2HK1A 4HA4A 3T44A 1O5RA 1X98A 4ORMA 2BS9A 1KO0A 1YE4A 3N2MA 1RY0A 3M16A 3T78A 1F8IA 4CN1A 3IANA 2AQVA 3W2LA 2ZZ7A 5HJLA 4HJWA 2F6XA 1FH9A 4LAZA 1PZ2A 1XYFA 3S9IA 4XKYB 1SUXA 4GIRA 1KB3A 1UMYA 4JNMA 3HQOA 3TONA 3I6EA 4QAIA 1FA2A 1TFVA 3GH7A 4AD1A 4F9JA 3SQLA 4WDTA 1BYBA 4WJEA 4I7VA 1B1YA 4A2SA 4DY1A 5A5WA 3S1XA 1L8PA 4P8WA 5IDIA 4L64A 4Z2LA 2G3NA 3NSXA 4D72A 2PMQA 1OBAA 3WF4A 4XZNX 3STEA 4PMOA 4B3LA 4WIWA 1QJWA 3MUCA 1QPQA 4PTWA 3ES8A 4RZ4A 2A7PA 4CNOA 3CU2A 5ABHA 4LBUA 3NQBA 5PTDA 5EMJA 1PWLA 3FHAA 7A3HA 3UPBA 3UWEA 5AB3A 2PGWA 3CL7A 3ZT5A 4GH3A 4O19A 3DGRA 2OSWA 4V2XA 3EDKA 2BY2A 3IAPA 1NWSA 3ABQA 2WWCA 1I1WA 4MNKA 2CHRA 3DX5A 9XIAA 3G0UA 3AMCA 1TX0A 1PBGA 2IUZA 4HSNA 2B7OA 4X9YA 4POCA 1FWTA 2PDCA 5M5DA 2CZFA 3K4DA 5CG0A 3LHVA 1ZJBA 2G50A 4QM1A 4DYJA 2WHMA 2XH0A 3GC2A 3VIHA 4UMCA 2A3BA 5KTLA 1UJQA 1EKOA 3CV7A 1D8WA 1PV8A 3IRDA 1TMQA 1EUAA 3GR4A 2FTWA 1TIMA 3O07A 3T2OA 2OEJA 4C6DA 3Q37A 2CHOA 3C4UA 1DJYA 4H2HA 4AXKA 4L4LA 1OC6A 3GQYA 4I7WA 4QR6A 3V35A 1J18A 3W00A 1QRQA 3H8AA 1H1NA 1A5SA 1UD2A 1UA3A 2UZ9A 1RCQA 3SCPA 4JTEA 4DF1A 5DMMA 3Q2DA 2QCHA 4Z42C 4MFDA 1LM1A 3AU6A 3R4IA 3F4CA 2EJ1A 1V6XA 4PL2A 2YXXA 2Q8ZA 2AKMA 5FKYA 7ODCA 3UJRA 2EPHA 2PWHA 3GDTA 3EX2A 2VGFA 1UUMA 1S2CA 1E6RA 3APTA 1F3TA 5FOOA 1GZJA 4Q32A 4JQ1A 3F2BA 3THQA 1E70M 1AJ0A 2NXGA 6XIAA 1W32A 4JX6A 1E1FA 3FFSA 4XO6A 2O4QA 4ZBCA 3CWHA 5BMXA 1ONRA 3NQ6A 4QX4A 4NYYA 2ZUTA 1HX0A 1EA9C 4FI4A 4Y90A 4B4FA 3DHUA 3FGCB 2BHZA 1EQPA 3KVLA 3UGVA 3R6IA 3H22A 2ZDRA 2J9XA 4M7SA 1M53A 3L4YA 4DBWA 1W5QA 4K8HA 4H9VA 1VKFA 2YDRA 2WNWA 2ZVIA 5KZMA 5I00A 1KGWA 3AIVA 4C6KA 4R85A 2VD9A 1PL9A 2QCCA 3S6DA 4PN2A 4XZWA 1TPC1 3SM0A 3FSTA 1W9DM 4Z08A 3T4CA 2V5JA 2FMOA 4Q7BA 4LYKA 2AAMA 2VR4A 1B90A 4JTTA 1RHCA 2WZHA 2HRWA 3WF1A 1S46A 4Q8NA 1B3YA 1Q7MA 1IWAA 3NQVA 2NQLA 1JPHA 2VM8A 4W7VA 4MWAE 3QZAA 4JY8A 1YQ2A 4QIUA 2V2CA 2ZDSA 1HW6A 1AQHA 1HKMA 2WQPA 1LWHA 1C3FA 2W63A 1NDYA 4BR1A 3XIMA 3MB9A 1X6UA 5T8GA 2XN2A 4AZ5A 1I2NA 1DJQA 4NXSA 3S2JA 4LWWA 3T40A 3OODA 4CD7A 3KM8A 4ZQOA 1V3IA 3HPSA 2BX7A 1GEHA 3NQFA 4F48A 2P3EA 4F40A 3S9YA 3AMKA 3LN3A 4FLSA 1JZ5A 1AJ2A 1VCVA 4UTTA 1NF7A 2J9YA 3NURA 5CZSA 3QFWA 3C2VA 3T9PA 2C0AA 2CBUA 1M9HA 1TZ7A 4H00A 3TMLA 2OOGA 1OSEA 1NH6A 1S1RA 2X1RA 3BSMA 5A6BA 1B31A 1EWDA 2JQXA 1QFEA 1DIDA 2DUAA 4FF7A 1GHSA 1IGWA 3LRKA 2OWWA 2FVLA 4AIBA 1V3KA 3Q65A 3VMNA 2VR5A 1DP0A 3TYCA 5E93A 1SW3A 5I3JA 3IV3A 3R0UA 1JIBA 1MUMA 3AS1A 4HN4A 1OT1A 3GXIA 3B9AA 4DBEA 1VFMA 2R91A 3PC0A 3LX9A 1XICA 3THCA 2HBXA 1PIFA 1EWEA 1QASA 1BG9A 1KFBA 2WZEA 4FS9A 4JYEA 1I60A 2PDGA 2CLOA 4UTKA 3P8JA 2I1OA 5J5RA 4XX6A 1Q5MA 3PBGA 5EYWA 5HUOA 1ZALA 2ZZ2A 3PAOA 4JTGA 3C2RA 1SQ7A 2Y1HA 3VNDA 5FJPA 4WDXA 3T81A 4XD3A 3UXIA 1W1ZA 3T08A 3GTXA 4XKMA 3SR7A 4ROPA 1ZL1A 2ISDA 5BRPA 5BOFA 1RK5A 4G7EB 1CIUA 4DB7A 4YL2A 4ZQRA 1KCXA 5C71A 2ZXDA 4PBGA 1S5VA 4G7FA 1CI1A 3P14A 4TIMA 4D6GA 1E0VA 2QCDA 3IV8A 3DYOA 4MY8A 5T9BG 4EACA 1WDPA 2E8YA 2CZEA 4UFLA 4PC8A 2PU0A 4NJKA 3S3GA 2G4FA 2P10A 1RBLA 3KUMA 4FF5A 3OHMB 2DSUA 3HN3A 1V0MA 4AD2A 1FWBC 1H63A 3JUGA 2ACSA 3CMJA 1UR9A 1EGVA 3IVUA 1JGMA 3GB6A 3PZQA 5CLWA 3BZJA 4C1LA 2AAAA 1LDCA 1UR8A 3ZM8A 2X42A 1FWIC 4O16A 4XSLA 3WNLA 3T8QA 4HP5A 4M56A 2E09A 3B8SA 2ISSA 1UQYA 1VHNA 5CG7A 4FLQA 3T42A 1ONXA 3S46A 3VDGA 1IV8A 2HISA 2R9RA 3FDGA 3U9IA 3HBLA 3PANA 3M47A 4LQ1A 4JD4A 1P0KA 5A6AA 3GFZA 4OKDA 3G1FA 2ZUVA 5CAKA 3QBUA 2XIIA 4CVUA 1HJUA 1QHZA 2F8QA 4UZSA 3VGEA 1K3UA 1YPIA 1Q6LA 4EE9A 1VEOA 2GUUA 3Q67A 2IW0A 1V6WA 3QQ1A 2YLAA 1GVQA 4LS2A 4O1AA 3T4WA 4HU3A 1RAKA 4K3ZA 5DMNA 1VYSX 4UQEA 1F76A 1TE1A 4JQAA 3H2EA 1FRBA 1AK5A 1QOQA 3MHGA 4O1BA 3SN4A 4Z2IA 3ALFA 4OE7A 4RNJA 3I4EA 1Y5XA 3H26A 4H8NA 1XLCA 4LS1A 3A3WA 1CWYA 4TTGA 3AISA 3L4VA 3QYSA 1WYIA 2ISFA 2QGHA 1FWEC 3HMJG 1B4KA 3N2XA 4MNLA 4AY8A 4BI6A 2OELA 3UJSA 3WENA 4A29A 2JIEA 3KRZA 3LQGA 3W75A 4MZ1A 3C2FA 3TAKA 3OQ8A 1GW9A 4ZL1A 4E2BA 2QV5A 3GD6A 4UWMA 1AMYA 2FZNA 4IQEA 3HG2A 5I06A 2IPWA 4DPQA 4XD4A 2CCRA 3LY0A 4WGXA 4AZ6A 4XAZA 3G1HA 2OZTA 2V0TA 1O5KA 1VP5A 4REQB 4B3KA 5REQB 4N9DA 5I6SA 1YPFA 3Q58A 4H6RA 1VFHA 1KXVA 4BHYA 1MUWA 1QR7A 3GTIA 5MF5A 1JCJA 2Y8VA 1MMFA 4U31A 3I3DA 3W23A 1KRAC 2WW5A 1R3YA 4H01A 4KEUA 4N9EA 1GNXA 1DTUA 4AIEA 1RZMA 4JZ5A 4QQUA 1NFBA 4W7WA 2CERA 3S1GA 3U2OA 3NA8A 3L4TA 5I07A 3ZJ8A 1XRVA 2VJXA 3DH7A 5XINA 1P5BA 4W87A 3WBYA 5EMLA 3MMDA 2Y89A 1UJPA 3RPDA 5DT7A 4HMEA 1ISZA 4GC4A 5CZ0A 4MM1A 1G7UA 4S3JA 2VQTA 3TTYA 4ZO6A 1QWGA 4LOCA 2IQTA 4UFKA 4ZSTA 3WLOA 4JIQA 4KWSA 4EPEC 4LXFA 2OX4A 1D3GA 5HQEA 1VBJA 4NZ5A 3S0CA 5LNWA 1CXIA 3BLLA 2REQA 2EG8A 5FJUA 2V82A 4CD6A 4JTSA 3RJYA 3GNNA 1NOFA 3W1XA 1H7RA 3PZMA 4Z0JA 1JQVA 3Q45A 2V2HA 3OZYA 2GJNA 1X1ZA 5GPRA 1VPXA 1EOKA 3GNDA 4QG6A 3U8GA 1Y8BA 4GVFA 4J40A 4LBRA 2YCKX 1K4GA 1TX2A 3CZ8A 2QDEA 4CU6A 4YMZA 4Z1BA 1W3KA 2B81A 3WG6A 3GNPA 3ELFA 3S5OA 2HZGA 2XWEA 3UZWA 3KTXA 2ADAA 4S3BA 3GKFA 4PCPA 3RNDA 1WDDA 4UNIA 4WD0A 2ZX5A 2DU2A 2V81A 1MYRA 2QCMA 4BCEA 3AZRA 3LLDA 4GE8A 3ITVA 3NVDA 4DZAA 2P1FA 4IWWA 1JUKA 1JDDA 1P48A 5LSMA 3SECA 1PUDA 3CZKA 4DYKA 3DKLA 1FFQA 4JCLA 3KS6A 4GI4A 3EX3A 1OQFA 4NJGA 4F2BA 3SJNA 3QRHA 3M5ZA 4MWAD 3V0SA 4XB3A 5AC8A 1W1TA 2NXIA 3GTFA 2BY3A 1MO0A 4PB4A 3IGSA 4LS0A 1ESWA 1TA3B 2CIPA 3VE9A 2WCAA 3N9SA 4YHGA 1CEOA 4IIEA 1O6IA 1Q65A 1XYCA 2A7NA 4AZBA 1W3LA 3GH4A 5HK4A 3PTMA 4UTHA 2Z1KA 1RJQA 4LVGA 2UY4A 3ZMRA 2QHAA 3ABZA 3WQ5A 3G0SA 5T91A 3IPWA 4GISA 4FB7A 4BA0A 4W5UA 3RM9A 1JD9A 2IKHA 3GR7A 5C0QA 2YOCA 7PTDA 2ISVA 3DENA 2RDWA 1QO5A 1BAGA 1KV8A 3ITGA 1I2RA 2XDFA 3EOEA 4JTCA 1IT7A 5KEZA 5HNUA 1B0IA 3N3TA 2PRHA 1C9DA 2VDIA 4HPJA 5EU9A 1JVNA 1W9PA 4FNUA 2ONEA 3TP4A 1EJRC 4QQ3A 1GJUA 4LNYA 3LERA 3M6YA 1J0IA 2PDIA 4CQCA 4JTLA 3W7GA 1ZUAX 4ZQNA 5C2GA 1X8CA 1DXFA 5E09A 2XSBA 5A8MA 2XGZA 5C9WA 1M7XA 4MB5A 3UW6A 2AOSA 3LLFA 1VC4A 1BD0A 2BXVA 1F6PA 1DYSA 3KL3A 2V2DA 2WANA 5DRCA 3PVFA 5IHRA 1CGUA 2BP1A 3DZ1A 3CIVA 4WXZA 4U2ZA 4EVZA 5D32A 4X2RA 1ZSXA 1LYXA 3NQGA 3MANA 4UFIA 1NWUA 3RR4A 4O11A 4QP0A 1BRLB 1ZPTA 4GPNA 1XBYA 2RGLA 2J75A 2VRQA 1AL8A 3NPWA 4RE0A 3V5FA 1JCMP 1AFSA 4CEUC 2WLYA 1RPKA 2C13A 4ZEPA 1HKWA 3ARZA 3NL6A 4QJ1A 2JBMA 2PD5A 1E3XA 1M7PA 3MSRA 2RJHA 4AX7A 1UBSA 5BNKA 5C2XA 4L56A 1UH3A 3KRUA 1YPXA 3PUDA 4ZENA 3QTPA 4N2YA 1KCZA 1PVNA 1U5VA 2PDLA 3V0UA 4HNOA 1XIHA 1CDGA 4REQA 4HJFA 1TMHA 1VGAA 4GUFA 4C7FA 3QMRA 2WKLA 1HTIA 3W27A 3FA4A 3TTEA 4PTNA 3BTNA 3UR8A 3RAOA 2DGAA 3APYA 1LRNA 4KEZA 4UTUA 5LYRA 1X7FA 4ADSA 3LNMA 4HA3A 3VKKA 4CEXC 2ABBA 2OZ0A 1DQXA 2E8ZA 3HURA 2MUCA 1FXPA 8RUCA 1W3IA 3GSMA 4FIRA 2WMIA 3NAVA 3M0MA 1A0DA 1CLVA 3GYEA 3QLDA 3THAA 3TQVA 4DELA 4PBEA 3MUY1 1LJYA 2C3ZA 3F4DA 1DORA 3E0VA 1XL9A 4PRWA 1TQXA 3VNZA 1MZRA 2F2KA 2HBVA 4MJMA 5H1WA 3B9NA 3R0KA 1P0NA 3WQ4A 2C18A 1YTDA 2QCLA 3QV9A 2PD9A 4F9DA 4M0XA 4QISA 2X1SA 2YZRA 4B15A 1C92A 2I16A 1EEXA 2VR2A 5TQLA 5LIUX 3CH0A 2E7FA 1P0DA 3VOHA 3MUZ1 2V38A 2IPFA 5DXXA 1JUEA 3BLKA 2G96A 4QITA 2VGIA 4PEKA 2H9AA 3SGZA 3U2ZA 2NQJA 1XQKA 3W87A 3M5YA 1J0YA 2FJKA 2FQIA 3VIOA 4Q6XA 3UY8A 2YFOA 4JHOA 1EQCA 3B4YA 4IGMA 3P8IA 1OB0A 1JRBA 4GUGA 4DXKA 2WJEA 1UIOA 4MFEA 2NT1A 1ITCA 2Z4GA 3H2FA 3UCQA 1EFZA 5AFDA 1WZKA 3ANVA 1NF0A 2G4JA 3C86A 1YXDA 4W8AA 3FK4A 2RJGA 5CGTA 3LRMA 3ARYA 2YB1A 1ODUA 4JTDA 3QKZA 2ZQ0A 2WSQA 2EPMX 2QGYA 3AYTA 4HZ6A 4MLRA 2IMRA 4PUMA 4MKNA 1QNOA 3BUVA 2G3FA 3GHRA 5CPTA 4JS3A 3W7DA 1EF2A 4OOUA 3MSYA 4ATLA 4F0LA 1I0DA 4QEEA 2HPMA 5CC7A 1T8XA 2GWNA 3KBSA 2NUXA 4J3TA 4TUFA 2Y5EA 3LUTA 3MMUA 2VX5A 4B90A 1KFEA 1K9EA 4Z2JA 3F2DA 3MSGA 1YXCA 4XBJA 2C15A 4XG1A 1H60A 3CWNA 2X2GA 4MDPA 4B9YA 3WD4A 3A5FA 2VX4A 3WQ6A 1UHVA 1TR1A 1PKYA 4J35A 4JKLA 3FYPA 3TFXA 4HOZA 3EKLA 4IPPA 4B5NA 3W86A 1ZS2A 1A0EA 1SZGA 6TIMA 3TU9A 1JZ6A 3W7QA 2QJNA 5D37A 4WUIA 3U2EA 1XUZA 3DKJA 1MVYA 2XZ7A 1U33A 4C65A 5EGRA 1WBHA 2XISA 4AC7C 1C8XA 3T6CA 3DUGA 4H7CA 4HHMA 1Q6RA 3WLHA 3ARWA 2VFEA 1VH7A 4QXIA 1EX5A 3IJDA 3VIPA 2VC6A 4UQCA 4Q4QA 4RZ5A 3QH2A 3CHVA 1KFKA 5FEWA 1I1XA 5K3VA 3KBNA 1KTCA 1Y7VA 1RBAA 2NX9A 3O06A 1T40A 3L2LA 4KRTA 3KVMA 1EO5A 2PWVA 4AC1X 1R2RA 1AW1A 1HKKA 1SZEA 4L1GA 1E0UA 1M1BA 4PMJA 3CT2A 3OBAA 3CIXA 1FWCC 5HANA 4GXWA 4O15A 4WOQA 4X2PA 2WXDM 3MQTA 2VP8A 1AVAA 2YBVA 4CCZA 3R0DA 5G2IA 3WD1A 4TX8A 4DJFD 3BV7A 1JXJA 3USBA 1E72M 1U2YA 2PP1A 3FHQA 1V79A 1OC7A 1CENA 4BQ3A 3VDAA 3DBPA 2A3AA 1AQMA 2FTPA 4AEEA 2BOFX 1JZ2A 5D38A 1WUFA 5K9CA 4F66A 2WWDA 4MUZA 4UZUA 5L9FA 1TPWA 2XGBA 3VGBA 2YR1A 5HR6A 1QBAA 3S1VA 2GQ3A 3B0XA 1EJ7L 3OVGA 1OFRA 3I65A 3WIJA 3LGEA 1T8QA 3COTA 1TWWA 4B5WA 3B9DA 4CQ8A 4J4KA 5HMFA 4CD4A 4MJ4A 2FZDA 1TV3A 3W7MA 1YNQA 4M6VA 1DXEA 1AMKA 4S3CA 2GOUA 1O12A 1JPKA 1NAL1 2ZX8A 3G0XA 1HN1A 5LNVA 2CZ5A 1AQ0A 3NXFA 4IHCA 2CXGA 4E4PA 1KA9F 4INFA 1QPOA 1M3UA 2YBUA 3MDWA 4NZ4A 4UOQA 2V8ZA 3L21A 4AUBA 5K9DA 3K30A 1H09A 3W7IA 1YX1A 5C6MA 2POTA 3GVWA 5M03A 4YCOA 1HKIA 3C2YA 1AD4A 5HDRA 4PMRA 4AD5A 5IFTA 5DLCA 2EXOA 1KCKA 2PGRA 2Z0IA 4LAUA 1KD0A 1AZ2A 3FSUA 2G97A 3WQPA 4MAZA 4JFWA 2YLLA 2PSNA 1PDZA 1TCMA 5D09A 1GEQA 4K39A 3SUSA 4DX3A 5KMYA 1JR1A 2OCZA 1TJPA 3ITXA 3SIZA 3NXLA 4JL2A 8XIMA 4H7ZA 4ENLA 1GPWA 4HSOA 1F3WA 4CUCA 2OTDA 5LNUA 1X38A 5DT5A 3AUOA 4RUBA 3FA3A 3JR2A 4GQQA 2J9ZA 3CZJA 1Z3NA 2GGIA 5BXPA 1S39A 1XGDA 4WVXA 2J8TA 3CB3A 1ZNNA 2W92A 3TN5A 2Q3RA 3VCRA 4QDWA 4RE3A 4KGLA 1LL6A 2FHCA 3GM8A 2VCAA 4LAKA 4GKTA 1MXSA 3NZRA 4TR9A 4ML4A 1DKWA 2XINA 4AW7A 3D0CA 1UP0A 2ODOA 1KCLA 4J27A 4IFOA 2CLKA 3A9BA 4GUHA 1ZQ5A 2VVSA 3UF9A 4ZOBA 3VNJA 2V69A 2VOMA 4ZOCA 2R24A 5LNRA 3TLQA 4Y7EA 4ICNA 1POKA 1WKYA 1O94A 3VNMA 1JYXA 3PG9A 2PC4A 3BVJA 1KM0A 4W86A 3AJ7A 4NRRA 3WUEA 2QCEA 4A3RA 1TRIA 1W8GA 3B9EA 4IGHA 5FI8A 4YVXA 3V5OA 3GBDA 3A13A 4I9MA 4ML9A 5JBFA 3RX2A 4PCFA 2VC7A 1JCYA 3DFYA 3PZGA 1QK2A 4ZB2A 4WF7A 2TRSA 4H04A 1ZAIA 2W9MA 3LDVA 1J5SA 4PB5A 1F2JA 4LB3A 2H3DA 5FA5A 5ABFA 3LGDA 5FF4A 4NJIA 4X3ZA 2D2OA 1FWAC 4KKXA 7ENLA 3WUFA 3VNLA 3FEQA 2EG6A 2JKAA 3H23A 4CQAA 1RA0A 3PJTA 1GOKA 1THFD 3UR5A 3HIJA 1VYPX 1EJSC 3U0HA 5AHMA 4Q7IA 3PSVA 1U30A 4JQ3A 1EO7A 4GUIA 4AQLA 3B0UX 3O8AA 2V30A 2ZUNA 5ABTA 4FLOA 2ATMA 1HKJA 3W1RA 2QJIA 3NUKA 5DQPA 5AYXA 3UXLA 1JZ7A 1ZBKA 1IR1A 2WSKA 5CSRA 3P6LA 4Q8OA 3BARA 3R11A 2DVXA 5E6ZA 1FQ0A 2YJQA 3BSHA 3N3MA 4LF2A 1UCWA 3CUXA 4YXGA 3L67A 3NQCA 2XZ9A 1AZ1A 5JBEA 3W84A 2YCEA 3NR0A 2VFFA 4GJIA 3ZSTA 1WZAA 1LTDA 3WQWA 3UWWA 1VIWA 1O66A 3MJYA 2NLIA 1U1HA 1MW3A 1QNVA 4KWOA 3B8WA 2H8XA 1PZ1A 4R5EA 4GZJA 4QSHA 4GHRA 1JDFA 1B3ZA 4K37A 3VILA 5U7SA 3UWVA 4CN4A 4GZEA 4ZXLA 4GQBA 5TNVA 4ZOEA 3LD5A 2XTKA 4KH2A 5B7YA 4PUKA 1LOSA 3GNXA 3EA1A 4JBRA 5LA1A 3HGOA 4LUSA 4JDYA 5AZ0A 2PB1A 2TODA 1W9VA 3UGRA 1JCTA 3I6RA 2DIJA 3AIBA 4GOAA 4QE5A 1Z6KA 3EXSA 4R9OA 2Q8XA 4B3ZA 4QHRA 4UR9A 4J5NA 3T7VA 4IGSA 3TR9A 2YL9A 3ARQA 4I7UA 1NWTA 2PGEA 2FKPA 4J3XA 2VZVA 3HPAA 3AYVA 3GXMA 3VU2A 1XINA 1XS2A 4JR5A 2IS7A 2V68A 4GCAA 4G8TA 4GVGA 4UNLA 1R8LA 4PMQA 1IZKA 1VZWA 3DC0A 5TAOA 3LPOA 2E9BA 3T05A 2J62A 1ZB5A 4XD6A 1HNYA 3BW2A 4L9ZA 1C7TA 4M5PA 4QBXA 3L66A 1ZU8A 2B0MA 3GU9A 2ZC1A 3TQPA 1WNOA 5FACA 3HG4A 4H4IA 3PUEA 3CUJA 2V63A 3U7VA 3N9KA 4BF5A 4U4MA 3FIGA 1YTEA 2VZSA 3VFLA 1XHGA 2HXTA 1QW7A 2OO0A 4PSRA 4UFMA 2AGTA 2FGLA 3QZEA 3IJ8A 3W6MA 1LT8A 1RQBA 4QG8A 1KM1A 8XIAA 4UB9A 3K13A 1L8NA 2ESCA 2DFAA 3RLHA 3ZQ9A 3WEOA 4HTBA 2V3GA 3UWYA 3RK8A 3BK0A 1E1CA 2DT2A 1UKSA 1YNYA 5FEPA 1LCOA 4YCPA 3LU2A 3VINA 3FVMA 1QU4A 1T99A 4PMUA 2DZUA 2KZHA 4XBSA 4LUIA 2QJHA 3G1RA 3RR1A 4K68A 3LTYA 2J6XA 1UR3M 3PK7A 1WOAA 2QULA 4HZ7A 3WLLA 1JCNA 2EAWA 2BY0A 2PS2A 3W81A 3RLGA 1XIFA 4M29A 1IR2A 3KCLA 4WQ6A 2G3IA 3CAWA 4AVNA 4H1ZA 1C9WA 1XV8A 1GYLA 3INPA 4URIA 4F2TA 3ITYA 3OB8A 3A47A 1C93A 2A5HA 5HULA 1RP8A 4O57A 4GIEA 3D5HA 1KFWA 5AVNA 4J7RA 2CWNA 2VZTA 3BAXA 3V75A 3MBDA 1F6YA 1UUQA 2NV1A 4KCVA 1HT6A 4MSSA 3DFPA 2Y4SA 4Y8EA 3WBAA 1Z48A 5LZLA 4EF9A 2IXVA 3QV6A 3FAXA 1Q6OA 1XI3A 1W1YA 1XCFA 1R9XA 3TE9A 4A05A 2Y7FA 2PZNA 5LKYA 2BG5A 1UOKA 3RO6A 2YFNA 1VJIA 3VE7A 2PF0A 1SJBA 3SB0A 3T55A 3GHTA 3B0VC 2NWRA 3THDA 1NVMA 5G5IA 3IEBA 3OQEA 4I9AA 3ZVIA 4OOZA 4E38A 2GGHA 2INFA 4Q8WA 5E0CA 1BVNP 4JPGA 4M24A 3W74A 4EAYA 1VB9A 4BF7A 4YYCA 4Q8QA 4Y2WA 4MKVA 1FWSA 2OOFA 2PCEA 5L6UA 2BWGA 1HKVA 2XFRA 3WSUA 4OV4A 1CB2A 3W83A 2CXEA 2WV8A 2NSOA 2WMFA 1QI5A 4DJEC 1O5QA 5CZJA 5LHFA 2VFGA 3UXDA 1PB0A 2J79A 3GVVA 3TSMA 4WKHA 2PA6A 4PMNA 2AL2B 4PUWA 4XIMA 3VC6A 3BAWA 1OEPA 1AW5A 1CNVA 4TO8A 4LFYA 4L4MA 4GVIA 1RD5A 3K8LA 3QW3A 3S5ZA 3ZXWA 2W4XA 5A8PA 2Y70A 4LC6A 1XRSA 2HROA 4M6QA 4UMBA 3M6DA 3WO8A 1HXJA 3M46A 4QRNA 3MVIA 1UD4A 1ELSA 2F7FA 1JRCA 4ZFCA 1V02A 1GT8A 3VDHA 1VLIA 2G3JA 1V5XA 5G1YA 3WJWA 1HGYA 3DHFA 4RE4A 4GFIA 1OX4B 5CPQA 5HQMA 3MUXA 3S1WA 1VBUA 4S38A 4Q8PA 2FIQA 1CCWB 1CBGA 2GJXA 2E1DA 5KSWA 4LEFA 1Q6CA 4EF8A 1XYMA 1H7WA 4AZCB 4ZVJA 4QLJA 4YVVA 3UJEA 3KBVA 1TG7A 1UPPA 4GNKB 3ABSA 3OIHA 3WH9A 2BHUA 2BFGA 3TYEA 3NL5A 1ME9A 3DDMA 4PBFA 1BWVA 5XIAA 1NIUA 3GIYA 2FGBA 4GZ7A 1OINA 4LC8A 4A35A 3MWAA 2F84A 3AXMA 2POZA 5H6HA 3ARXA 1W5PA 4RDZA 1X39A 3RJXA 2AL1A 1FCQA 4CNPA 2X2YA 3KCJA 3E2QA 4DHGA 2D1ZA 4DO6A 2VELA 4S3GA 2RUSA 4LH8A 3REQA 4NHVA 1X6LA 1TPVA 3NSMA 4M82A 3DFTA 1BXBA 3EWZA 3PR2A 3R79A 1YE6A 3H70A 4GA8A 4XD5A 3UETA 3CUZA 2XH4A 2X8RA 4R9XA 2QCFA 4JIIX 2ZE3A 1KXTA 4DI8A 2VNCA 1WZMA 3N73A 3TLLA 4O13A 3UY7A 1CB7B 1KGUA 1JCLA 1J6PA 1TPEA 3GNRA 3WDHA 1OC5A 2PRLA 3TQKA 4M81A 2XVPA 2G5WA 4PUDA 2IXUA 1JI1A 3YPIA 1XUUA 1QI3A 3WNOA 4HTYA 5HJXA 1W37A 3LXBA 1O5XA 1A5UA 2W27A 1YLVA 3BSGA 2JF6A 3LCLA 5KZ6A 2BB0A 1EZ2A 1KTBA 3C52A 3K8MA 2RDXA 4W9TA 1UWQA 2D3NA 1NY1A 3M0ZA 2P0IA 3S1UA 3W0KA 1Y5WA 2YDQA 3SFKA 1FWJC 1QI4A 1HO1A 1EPXA 2CESA 2FLIA 3GC4A 4ZXOA 2I17A 3JU2A 1JGIA 4GX8A 2CFFA 1Q13A 3TK7A 1Y65A 4QCFA 3BDKA 5DELA 4HHPA 4WZHA 2C6QA 3H6OA 1K02A 4O12A 3UD6A 3UPMA 3BPWA 4H6EA 1OG0A 4PH6A 1FBAA 5HXMA 3CUGA 2F38A 1W5MA 4B5XA 4JCMA 4MNMA 4ZGYA 3RMEA 4TTUA 4US5A 4JTIA 1C29A 3ZR4A 1J96A 2PDYA 1UZHA 3KWSA 2BGNE 4IX0A 1JFHA 2DZTA 5FJRA 3VOCA 1E51A 5FJJA 3H2MA 4K38A 4FA3A 3MUIA 4RZBA 3NDZA 3LTPA 3WL0A 4WSJA 4DLFA 3M0IA 2HEJA 1ISVA 7CGTA 3PWGA 4JHZA 4MYAA 3PS7A 3EWCA 3U57A 3FJ4A 1XC4A 2C91A 1Y0EA 1MNSA 1FH7A 4M8UA 1OGSA 3P74A 5CBIA 2JF7A 2Z2AA 4UTJA 3OGRA 4IXXA 1G1YA 2ZE0A 3VZZA 5HAOA 4B92A 1YDYA 5LGZA 2GDQA 3WLNA 5DBUA 4IMEA 4J3ZA 2IKGA 1TCDA 4Z2HA 3OP2A 3PZUA 1PKLA 2VDHA 1Q4WA 3VMOA 1BGGA 3DHPA 3E3HA 3VNYA 1NP0A 2DH3A 3E0IA 2WO5A 1S2WA 2QT3A 2VL4A 3MKVA 1MW0A 3NQAA 5HUPA 1BTCA 3UERA 2B7NA 2DZSA 3IAQA 3F5JA 1H0IA 4AD0A 3STCA 1W5OA 1HP4A 1RY8A 5KZEA 4MPQA 2AL2A 1E9IA 3OLEA 4H19A 4DPPA 4YWSA 1BXNA 3IJIA 4HOXA 5HATA 4HQVA 1TMLA 1WAWA 4DVOA 2Q6ZA 4O18A 4N9CA 3WQVA 4I9TA 4JTFA 3UBPC 2QPXA 2WCSA 3ONBA 3IRSA 3M43A 1OF8A 4HT3A 5H8UA 3AIEA 1WX0A 3HPFA 1VPYA 1UB3A 2OZ3A 3K46A 2CW6A 3W2UA 2Z7KA 4DWSC 3AMDA 1UASA 3VIGA 3ZR5A 1FX6A 4F4RA 1LG1A 3KEHA 2E28A 3R43A 3E0LA 1DXIA 3ABRA 2Z28A 1OFBA 4UTFA 3N15A 2PLJA 3URQA 4FHAA 1EP1A 5I5RA 3N25A 1DBTA 2D0HA 1R47A 4WRHA 2ZRZA 3NQEA 3OYZA 3L5MA 3NZGA 4L6HA 3PBVA 3C61A 4Y8FA 1F6KA 2W91A 3BCJA 4YTSA 1TWZA 3M64A 2OR2A 4D8ZA 2EPKX 2JEPA 4OT7A 2ZRUA 3KDNA 2PAJA 3WLJA 3R58A 2X41A 4MTVA 2Z27A 2QUMA 3L2MA 5A1AA 5I77A 4BKNA 2XIBA 3GAKA 1AG1O 3EX1A 8TIMA 3V16A 1GJWA 1XG4A 5CSYA 2A1YA 1WOBA 1BSLA 1LOLA 2JE8A 4RLIA 3W4RA 2H3BA 4PUUA 4NX0A 5LXEA 4QE1A 4AYSA 5LIKX 5T26A 2VEIA 4YTQA 3BAJA 5HNNA 3HFTA 1DWJM 3BURA 4QCEA 4LVFA 3L2IA 4KFPA 1GTEA 4KT2A 1BXCA 2ACQA 5FJTA 1FY6A 3BMVA 4H9XA 3BG3A 1AH4A 1D9EA 3UU0A 1K6WA 1L6GA 3FJLA 2JALA 1TV2A 1NOWA 2D2HA 2BV9A 1CLKA 3UZJA 3QR3A 3NYDA 1CXHA 4AB4A 1TKKA 2IQ0A 4ORIA 1ONWA 3IVTA 4PMDA 2GSJA 3FS2A 3MV11 2IKIA 2WMKA 3LZ5A 4B16A 2QDHA 3WQCA 4IMCA 4L9YA 2ACUA 2EPLX 2R82A 4DXVA 1TVLA 2H6RA 1ZBCA 3W1NA 1E6SM 3H12A 3W1PA 1OFEA 3L5LA 4JFUA 1VFSA 5FL1A 1V93A 4L1XA 2BODX 1J5TA 1HP5A 4E4FA 3AUJA 3LG3A 5A2BA 5H8PA 2XJ7A 4JAWA 3QPZA 1UIPA 1Y5VA 2BTMA 3O6AA 2B4GA 1CECA 1W2PA 1Z32X 3M7WA 1AJZA 2DJLA 1G9HA 4M7TA 1VLWA 1A4LA 2Z6IA 3WJSA 3LCXA 2W6RA 2EPOA 4O1FA 1J12A 3LCGA 5AY7A 4CD8A 2HK0A 1W31A 1JXKA 5G4EA 4U28A 2D2GA 1P6BA 2VC5A 3EOLA 2E67A 1IZCA 5G4WA 4D6FA 2PF8A 4H6QA 1QAPA 5BYWA 5CC3A 2BZNA 4W85A 4M1BA 2XFYA 1EDQA 2CPUA 4UQDA 4PFHA 4YWIA 3E5PA 3OA5A 3GXDA 4WGHA 3CQIA 1JPIA 4NF7A 3WQDA 3QOMA 1NSJA 3T0DA 3GVQA 4QS5A 1GQIA 2GGEA 3GBEA 4UCFA 1EJVC 3ZWSA 3SRHA 3ZVHB 3MI2A 4CQDA 3OHIA 2WJDA 4IFKB 3KE0A 3W53A 3LOTA 3OIXA 3TJIA 5ECVA 2Y24A 4LF1A 3EMZA 4V33A 1W9XA 4PUEA 1UR4A 2JGYA 3BW3A 3NPVA 1C8VA 3A4AA 1R9ZA 1XPGA 3N2BA 4BWLC 2VWTA 4JYFA 2DSKA 2GK1B 4S2CA 3FA5A 1KWGA 1T7LA 4ACZA 5CLTA 1ECEA 1TJ0A 4IL0A 5CC6A 3VD9A 4QJ5B 4K8GA 3V18A 4MOZA 3NPXA 1S2AA 4MKSA 4HYRA 3WLKX 3AS3A 3LA4A 4IIFA 1G0CA 5JU6A 1MFUA 4IMAA 4DNHA 1WE5A 4H9UA 3FVDA 3WK0A 1Q6GA 2PPGA 1NOUA 4HNCA 2OQHA 5IRPA 1WV2A 5HINA 4JL1A 4QAWA 5EMYA 1YEYA 4E2OA 3NG3A 2PDWA 2VX6A 4WY0F 4LX4A 1XFCA 3CO4A 2TAAA 4IQDA 4N6FA 4RNIA 2PDQA 2I9UA 2Y5JA 2TPSA 1J6OA 3TWAA 2GVYA 1E9YB 3T0BA 1PCKA 2XN0A 4OBTA 2NQZA 1DTNA 3L68A 4U5IA 2D0GA 3H21A 1QUMA 3UPWA 3LM7A 4D1JA 3FOKA 2Z1SA 3SSZA 5DXYA 1HVXA 3EOOA 3DECA 5AHEA 1J93A 5A6TC 5I09A 1QVBA 3LLXA 4BQ2A 3PN8A 3DYPA 1YDOA 1PHQA 4HMCA 6CGTA 2Z7GA 1XLJA 4C91A 3QC0A 2Z2BA 2QCNA 4GG9A 4LCSA 3HG3A 1TVNA 1N55A 3GXFA 1BF2A 1E9LA 3OZPA 1OYAA 4EXAA 3CQ0A 3WLTA 4MHBA 1MI3A 5F2LA 4Q8TA 3WLQA 2WMGA 3EKZA 1E6ZA 2PDBA 2PLMA 4GIYA 1PE1A 3PP7A 3FNDA 1RQHA 2FFCA 3I6TA 4A8RA 3L7RA 4WSKA 1J8VA 2VKZG 3H2CA 2GUYA 4IJCA 4PB3A 4TXEA 1L6FA 3UZZA 3PWIA 1XYAA 4KRUA 1JPMA 4NAFB 1YKWA 3GDRA 1E6QM 2CZVA 2J7EA 4XTIA 4AVFA 4JEQA 2ZXBA 3WH8A 1IXOA 3I7RA 3AAMA 3W82A 1PHWA 3UNTA 5CKSA 5JIWA 4FALA 1R85A 5IFPA 4OBSA 3URAA 1NJJA 3HQ1A 1JQXA 3S2MA 3R10A 4OU1A 2OZ8A 2DZWA 3FKRA 4B4HA 2FH6A 3KW3A 2CLPA 1XH2A 1VJZA 2JKPA 1SPQA 1DHPA 3H7VA 1XF0A 2UY5A 3PFMA 4LPCA 2TMDA 4CKQA 2VZOA 2EKCA 3SGGA 1VFUA 1DJXA 2BXYA 1BTMA 3JZUA 1TR9A 1X6NA 2X1TA 3UNDA