3LG3A

1.4a crystal structure of isocitrate lyase from yersinia pestis co92
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
419
structure length
419
Chain Sequence
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTASSMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isocitrate lyase
publication title 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 144
structure length 419
sequence length 419
chains with identical sequence B
ec nomenclature ec 4.1.3.1: Isocitrate lyase.
pdb deposition date 2010-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lg3A00
3FA4A 3T0TA 3G2GA 1F8IA 4FXFA 2XDFA 3QV9A 1ZLPA 3R4IA 3E0VA 1O68A 4LSBA 4IP7A 4B2DD 3QV8A 4B5UA 3QTGA 4L80A 3BJFA 2G50A 3QLLA 1SGJA 1S2UA 1Z6KA 3M0KA 4MF4A 4HYVA 2V5JA 1E0UA 1PKLA 2VWTA 4B2DA 4HYWA 4TV6A 1M3UA 3M0JA 3E0WA 3HQNA 2L5HA 1JDEA 2HJPA 3P0XA 1AQFA 5JVLA 1S2TA 1MUMA 3IS4A 2WQDA 1U5VA 1F8MA 4QG6A 1S2VA 3QV7A 1A49A 4FXJA 3EZ4A 3ME3A 4B5XA 1OQFA 4JPGA 1DXFA 3GQYA 4IMAA 2VGFA 1KBLA 4B5VA 2XZ7A 4RPPA 1O5QA 4L9YA 4QGCA 3LG3A 1PKYA 2OLSA 2BG5A 4QG8A 3OYZA 2HRWA 1DXEA 4TV5A 1PKMA 1IGWA 3T05A 4KCTA 3PUGA 3B8IA 4B5WA 4IQDA 3I4EA 4KS0A 4IQEA 3VAVA 1T5AA 4L7ZA 3H6OA 4WJ8A 3FA3A 1E0TA 2ZE3A 3QQWA 3SRFA 2DUAA 2VGBA 1OY0A 3QZ6A 1S2WA 3U2ZA 1A3WA 4B5SA 3SRKA 2V5KA 1A5UA 1IZCA 1O66A 4KRZA 1XG3A 1VBHA 3KHDA 4KCWA 1F3XA 3HQPA 3PP7A 2VGIA 4KCVA 2HROA 3SRDA 3EOLA 1VBGA 4ROQA 4L9ZA 4G1NA 1GGOA 2X0SA 2VWSA 3HQOA 3E5BA 2QIWA 1DIKA 2KX9A 1DQUA 1PKNA 1PYMA 3EOOA 3GG8A 1M1BA 1ZJHA 2E28A 2HWGA 4MG4A 3N25A 3OYXA 2VGGA 3OQ8A 1F61A 3BJTA 4QG9A 3SRHA 4B5TA 2DIKA 2XZ9A 3GR4A 3EOEA 3KTXA 4KCUA 1KC7A 3QV6A 2R82A 1UJQA 3LYEA 4YNGA 1XG4A 4DRSA 3MA8A 1U5HA 1A3XA 3T07A 4YJ5A 1F3WA 5TAOA
chains in the Genus database with same CATH superfamily
3GXIA 4GY1A 1JUEA 2GGJA 1ADSA 5IBXA 4K7YA 5F2GA 3QBUA 4JGDA 1EL3A 3P80A 1E9IA 3PZ9A 3WBEA 2QDHA 1SO6A 2XSXA 1HTIA 3WIJA 3BLPX 3VX1A 4W4QA 4GYFA 5DF0A 1RCXB 1OWQA 5ECUA 3BCDA 3UXDA 4CCCA 3RYSA 2DZBA 3A3WA 2OODA 3W7IA 4B5NA 3MUXA 3MUAA 4DO4A 3OA3A 1W3TA 2VI0A 3KS5A 1MWOA 3NL6A 2AKZA 4XTIA 1QI2A 3LK6A 5KMYA 1IIGA 4NJJA 3WMLA 4CN1A 4OE7A 1E5NA 4LH8A 1RSCA 4LVGA 4HKPA 2BVYA 4JOMA 4O18A 2J9XA 1VEPA 2IKGA 1ME9A 3KL0A 2QUTA 3GSMA 2XN2A 5GJMA 2Q71A 5E6YA 5K4XA 1OJXA 3WEOA 4WY0A 2WK2A 2WHJA 2D0FA 4LVDA 2R1PA 2JBMA 1QPQA 1EOKA 1BEUA 3LGGA 2PP1A 3VMNA 3UXAA 1TPC1 1XIJA 1UUQA 3NGFA 1BGAA 1RUSA 3E2SA 3AHYA 2F38A 1OG6A 2QYGA 5A6TC 5F7UA 3KRSA 2V3DA 3PBWA 3U7BA 4O13A 1SJAA 3L2IA 3ATYA 3NA8A 4DN1A 3E0VA 1O68A 4L4OA 2D3NA 3WBAA 3B06A 2NV2A 3BAWA 4AZGA 4O0ZA 1P6CA 4HOXA 1RVKA 5HJLA 4Z2IA 2Z0IA 1QHOA 4EF8A 4W93A 1IYXA 3N34A 2WKJA 2QCDA 1X6LA 2PGWA 1XIBA 2PDUA 2GWGA 1JG9A 2DSKA 3SY5A 1PV8A 3VKJA 4TQTA 3NPUA 3HGJA 1R3TA 5FJTA 1XKYA 3V36A 1XI3A 2PD9A 2INFA 1M53A 4UTKA 1BWKA 4PUNA 3ERPA 1IGSA 1KLYA 5GNZA 5LKYA 4ERGA 3GKAA 4HA4A 1V0LA 5FJIA 3RLVA 3C5QA 1PPIA 5FSDC 3M1ZA 3XISA 3FDKA 1A5UA 4HPGA 1XG3A 2OSYA 3GFZA 3P82A 3MHGA 5HJXA 4C5YA 3GVGA 1K4GA 1NDWA 4Y90A 1T99A 2W0UA 3KOXA 4S3AA 4REQB 3PVFA 4DY1A 1AH3A 4LV9A 1EIBA 1OADA 4KIRA 2FHCA 2VRKA 4MG4A 4QLKA 1DWHM 4JDYA 2XGZA 4QG9A 1J0HA 3N2CA 1SFSA 2C79A 3ABZA 4URIA 4ADUA 4NJKA 4XD3A 4J35A 4Y7EA 4AIEA 2Y88A 2VZSA 2XFRA 1GYLA 1RR2A 2J7GA 1YBQA 1JCMP 4YU1A 1TPWA 4JKLA 1YDVA 3QV8A 3CAWA 3U5YA 1TV7A 3NZPA 4GVGA 3BG9A 3NO5A 4OT7A 1PIGA 3S1VA 2HPMA 4PSRA 3LHVA 3RF9A 3W2JA 2WZTA 2WZIA 1L9WA 1ZU8A 1ZP4A 5LIXX 2E09A 3NZQA 2Y7FA 1ONRA 2WC4A 3FXGA 4UR9A 4DVOA 5JMUA 2DZXA 4I9TA 4LTSA 5CSRA 3GG1A 1E0TA 1O12A 4HU3A 5JIWA 4OWGA 3L21A 1DQXA 3LEPA 1J6PA 1QI0A 1IZCA 3KHDA 2Q3OA 2VUYA 5FIPA 1MNZA 3SRDA 4IF2A 5CSYA 2ZDRA 3W1MA 1YXCA 3AXKA 3QN3A 1ECQA 3HQ1A 1GEQA 1DIKA 3CEUA 2ZX9A 2F61A 3Q2DA 1E6NA 1HUVA 2VC6A 2Z29A 4DJED 2FB2A 3TTYA 2GOKA 4Q8NA 1P43A 2IQTA 1IWPA 2A6NA 2EEXA 3LN3A 1FWAC 1G0CA 3RPDA 3KBMA 3HMJG 3CV2A 1FOBA 4YWSA 1H2JA 3W7OA 1QNRA 4MUZA 3BQ6A 3EOSA 4M3PA 3EXSA 2ICSA 1XCXA 1EZWA 1C29A 1FRBA 4FS9A 1R3RA 3PZQA 3CJPA 5FSEC 2D24A 4D6IA 4JTHA 2ZWYA 2NUXA 5CZ0A 1CNVA 1VIWA 2VELA 3D3FA 2OQHA 1J0YA 2I5GA 1QFEA 4LANA 3FW6A 1D2KA 3JU2A 3OYZA 1XDJA 4PMJA 3RLUA 3UZWA 2ZRYA 1VB9A 1RBLA 4NZCA 1MI3A 2ZE3A 3DC0A 4H9YA 5BU9A 4ILSA 2Y89A 4GLEA 3BLDA 3TOYA 4QQUA 1B57A 2VJXA 4Q33A 3PP7A 3S5OA 1XGDA 1O5KA 1CLVA 3TAOA 2A4AA 1NFBA 4EOUA 1W0MA 3ZT6A 2OZ8A 1FWRA 3PWIA 4S3JA 1M1BA 3PJTA 4GNJA 3N2TA 4GBDA 5CSSA 3SW6A 2NQ9A 4N02A 4X61A 4U33A 4Q22A 5AVNA 1TJRA 4A8LA 4NZ3A 4D6CA 2BVWA 1JFXA 2C7FA 8CGTA 2QJIA 2E3ZA 1QO2A 5HR6A 4NRRA 1Y5XA 3PS7A 1VGAA 3ARTA 4UTFA 2DSWA 3LBMA 2PUZA 1GHSA 5HWNA 4FNUA 3I3BA 4FR6A 4O1BA 4GQRA 3GH4A 3H2OA 3TP4A 3BJSA 1BQGA 3P7YA 2O9PA 5JUVA 2B31A 2I17A 3WQ6A 1U1JA 4GACA 4TVDA 3VMPA 3SCQA 4KWWA 3FSTA 3QC3A 4GCXA 4PUUA 2V69A 2XIBA 3GZ3A 1Q85A 2B81A 4JIRA 1ZBWA 3QPZA 1POJA 5KSWA 1V6VA 1BQCA 2RDUA 2VGBA 2HISA 3CWOX 4H83A 1IHIA 4YVVA 1ITQA 5I09A 4MPKA 5EMMA 4ZO7A 4I8DA 4Z1BA 1EYEA 4ZXOA 1OCQA 4ZENA 1UWUA 3WNMA 3W76A 2JIEA 3L2LA 4NT0A 3MCMA 4O12A 1JJKA 4UNIA 1S1PA 2PI6A 2WJDA 4KCUA 3AMCA 1M01A 3M64A 1PZ3A 3IJQA 1Y0EA 3UA3A 3EWBX 5DCEA 2NV1A 3R4IA 1YADA 1V4YA 3IJ8A 5CXPA 1ZZMA 3BJFA 1GT8A 3D3AA 4HYVA 5MF5A 4FLSA 4B2DA 1Z48A 1A0EA 3QPYA 4JTIA 4K6AA 3L4XA 3LMYA 3TH6A 1PDYA 3AAMA 2PSNA 4PMOA 3DC8A 3R10A 3B8DA 2Z24A 1VRXA 1XUZA 1BYDA 4GVFA 2XH2A 3N9SA 1GOMA 4JZ5A 3A3HA 4C1LA 3WLIA 2E8YA 4HN4A 4U5IA 3S5ZA 3QMSA 3A4AA 2VRJA 3N3TA 4WQ6A 3VE9A 3GDLA 4DO6A 1JPMA 1VBGA 3RR4A 1NDZA 3FJNA 3EOUA 4IMCA 3S2MA 4W87A 1OIMA 4C6PA 2OT0A 2CNCA 4U3AA 3VOFA 2ZXBA 2FVLA 4DZIA 3G0XA 1QI3A 2WVUA 5J5RA 4BY3A 2DIKA 2ZC1A 3DFYA 1RHCA 4YIWA 1QHZA 3TE9A 3KM8A 4ENLA 4J3ZA 2EBNA 1WPCA 3EGJA 3P8IA 4TTUA 1U5HA 4M7SA 4MYAA 1N7KA 1KA9F 1WOAA 2Y5EA 3QYQA 2C13A 3W7EA 1H51A 1BSIA 1W9XA 2OOFA 2A3CA 3COTA 3SEPA 3AUOA 2P76A 2AAAA 2WPBA 3HGSA 4GIEA 2FZMA 4FXJA 3WCZA 2ZRZA 1VFUA 1E15A 3DHFA 2UZ9A 4X22A 3GX9A 1H7RA 3IV3A 4GC3A 1WV2A 1MZHA 2PDLA 3T0DA 1EZ2A 2NQZA 2PFHA 2J8TA 4JTQA 3T05A 2YDRA 1NOWA 3TJ4A 1T8QA 3ZT7A 2ZA1A 3N9RA 1NOUA 3HFYA 5AC8A 5HULA 5MHBA 3KUMA 4ALDA 2BHZA 1L6WA 2QCMA 4GINA 2WM1A 3UZXA 2ZKMX 3SECA 4AAJA 1C92A 5A2CA 3NEHA 4L1XA 1F73A 4MAZA 4NXKA 4F0LA 1J8VA 4PL1A 3NJ3A 4J3VA 2XTKA 3AS1A 3PUEA 4JTAA 3WQPA 1BF2A 1MW0A 4BHYA 4M19A 2PF8A 2Y5JA 1LLOA 1LZOA 1W3LA 2BV9A 1JGMA 4QSHA 1OX5A 3CZJA 1V79A 4S2CA 2VYOA 3W26A 3ZLHA 1XLAA 3TMQA 3LD5A 4IFRA 4H7ZA 4DJFA 3GU9A 3IRSA 1XSJA 3HPFA 3ITCA 1J01A 1UB3A 3NOEA 4ZO8A 2V81A 1FXQA 4F2UA 1ZLPA 1EPXA 3GDRA 5F1VA 5FJPA 5I7GA 4IM4A 1XRFA 1HW6A 1DJHA 1BTCA 1VIZA 3I6RA 1ADOA 4LUIA 1CGXA 7A3HA 3ORWA 1BD0A 1MUMA 2PTZA 3EDJA 2FHBA 1B3OA 1SZGA 4K1GA 3EZ4A 1LYXA 1XLJA 4D6HA 4JN7A 3Q4DA 3RK8A 5F4XA 3B0UX 2ZOXA 1A4MA 4GRSA 2VD8A 5CPSA 1BYAA 1RCOB 4L1GA 3WNNA 2V68A 4A3QA 5DMYA 3W23A 4M56A 3O63A 4GFSA 3SQLA 1EO7A 2VFEA 3UEQA 2VX6A 3VTRA 3UETA 1UZ1A 3RO8A 3FEQA 4KCWA 5EMUA 1WDSA 1RPKA 2J24A 2WAGA 4XV0A 4B15A 2PDCA 1GZJA 2X7VA 3PB2A 4FHAA 3WH7A 4C6CA 4B4FA 3O0KA 2CLFA 3TN3A 4ZR8A 8A3HA 4P7QA 5C7HA 5I23A 3OGSA 3THCA 3FV9A 2E5BA 3BJTA 1H41A 3VNJA 1VJIA 3POHA 2R1NA 3M43A 3EOEA 3AMLA 3IRDA 1CWYA 2O4QA 1GTEA 3URBA 3FA4A 3WDQA 2WBGA 2HQAA 5BXSA 3QQ0A 1QATA 3CL7A 1XSIA 3C0SA 2D1ZA 3MUCA 1VD6A 3VKKA 4UTUA 2VFDA 3VGHA 1PL9A 3OGVA 4TOQA 2WZHA 1GOIA 3CO8A 1TVLA 3PG8A 4ML4A 1TTIA 4QGCA 1PO9A 3FKRA 1K9TA 1KFKA 4KF1A 2INZA 3VVGA 3B8IA 3GNNA 3RDKA 2VL4A 4LALA 4LYPA 2XSAA 5HOSA 3RX3A 3QZ6A 2ZA2A 3TYEA 2RDXA 2VZVA 3IK2A 2CU0A 2CPUA 1PCWA 1D7KA 3EKLA 2PF0A 1GQNA 3G0SA 1HO4A 1HN1A 1WBJA 3ZSTA 1ML1A 2A7PA 4PUKA 4E3TA 2QUVA 1SM9A 2VGGA 3QLDA 3WMBA 3MC5A 5H1WA 3AZSA 5LHEA 2Z1SA 2AOSA 1BYBA 4K8GA 4GK8A 4HMNA 3QV6A 1EH9A 4M1BA 1RLDA 4HD5A 1F7BA 3T0TA 1I2NA 1E9ZB 3R8RA 1Y8BA 1V3JA 1W5OA 1B1YA 1LUCA 1G4PA 4N9DA 1W1TA 2ZUVA 3D0CA 3AMGA 4Y6GA 2PLMA 2OSWA 4Z1YA 2F84A 5D9NA 2YA2A 2YOCA 2GJNA 2QAPA 3LPPA 1U5VA 3WLLA 2Y62A 4PTXA 2WJZA 3TEVA 1ICQA 1X1ZA 3E0LA 3GVQA 2VMFA 1OSEA 3D5HA 2R8WA 4MFDA 1K70A 4N42A 4CN6A 5T9CE 5JBDA 4M80A 1PXGA 1HG3A 1Z69A 4JTSA 1EXPA 1Z89A 3ITGA 1XPYA 3O2LA 1W1VA 2D73A 3SDOA 2DSVA 3TQPA 1LF1A 3CTTA 4PL2A 4Q8UA 1J10A 5HNUA 1PX3A 2QCCA 3M5XA 3K4WA 1KBKA 1Q6FA 4PEEA 2QVNA 1TE1A 4JYEA 3AMKA 4RE0A 1PHWA 5A6MA 4HGXA 1B3WA 1TTQA 4S39A 4AIOA 3P6LA 1I75A 4L4LA 1QW9A 3CMFA 5CJ5A 3WO8A 1QHPA 2AGTA 3ZT5A 3CXOA 2A21A 3VGGA 3ECQA 2E7FA 2A2IA 3O16A 1YYAA 4KFNA 2ZWZA 1VQTA 3L0NA 4JIEA 4ERIA 2PDMA 1WZAA 4LRSA 1V6UA 4IGMA 3EXRA 4NZ5A 2ALRA 2RDTA 2ZVIA 3L5LA 2OVLA 1IF2A 3HJEA 2Y6ZA 2JK2A 3AICA 3OP2A 2DP3A 3UWQA 3IPWA 1OQFA 3VIIA 4YTSA 1TA3A 1I2OA 5C55A 2A7RA 1QPNA 4GJIA 1N8IA 1S2CA 3G77A 1GOKA 4H6EA 3W1PA 2W27A 1UR2A 3EX3A 1POKA 1A5NC 5BOEA 4Z1CA 3KCJA 3N1AA 4IL0A 3H21A 3SUSA 3ITXA 5D37A 2ZRWA 1FWCC 3NXFA 2FDSA 4ZEPA 3O3RA 1H7XA 3C2OA 4PRTA 1M68A 3GNDA 2X2GA 2WBKA 4Q4MA 3RM4A 3W2MA 2NVAA 3HPAA 4H7VA 2VQUA 1XLDA 1JAEA 3VKAA 1E72M 1VPYA 4HTYA 2BMBA 1GQLA 1THFD 3W83A 2RAGA 2AL2B 5G5IA 1WKDA 2QCEA 1KM1A 2D2OA 1R38A 4IIBA 3TROA 5AFDA 2J7HA 2FPYA 1H5YA 3VGFA 1R47A 3K1DA 1QNQA 4YJ5A 4PTVA 4LUJA 2DEPA 5EPDA 3HBLA 4OBSA 2BOGX 4JQ4A 3S2LA 4I9MA 3CIWA 4RZ6A 3UWEA 1PYFA 1PX8A 3HG4A 2PDYA 4ZE5A 1A4LA 4RL3A 1D3CA 3BCJA 4IMEA 4MB1A 4D6JA 3L4WA 3KVKA 4J5NA 3VD7A 4FF5A 3RO6A 4R9XA 2YW4A 3OZOA 4XVDA 4CD4A 2YA1A 4N0RA 1MRAA 4RV3A 4A8NA 3RHGA 4X2PA 3WD0A 2CHRA 4L1WA 5CG0A 1FKWA 1XFCA 3NYDA 2V63A 1N8WA 4C60A 4GXMA 4PFMA 2Z25A 2QCHA 3LU2A 3OO2A 4E2BA 1LROA 4ZL1A 3I6TA 3GTXA 4JEJA 4AHQA 3GU2A 1L6GA 2ASHA 1UR8A 5HMEA 4FI4A 3DYMA 4ZOAA 3H23A 2CZDA 8XIAA 1NSJA 1IEWA 5HJYA 4YPJA 5BYWA 4O4WA 4ZOCA 5LA2A 3WNLA 5I3DA 1OABA 5EBAA 3WFAA 4PULA 1Q5MA 1AJ0A 1E6RA 1ELSA 2HNEA 3CQKA 3OPSA 1JI1A 4LAKA 2C16A 2WW5A 4UFJA 4GKTA 3IWPA 3CASA 1KFBA 4C6OA 1OGSA 3IUDA 3PBUA 4FOJA 1X98A 3E9AA 2CHNA 6XIMA 2PZ0A 2YKKA 1E51A 3CYVA 1UP3A 4DJDD 2G3MA 3R89A 1WNOA 1O7AA 1KV8A 2ZQ0A 1PIIA 1MW3A 4MWAA 5CZTA 3ITLA 2A3AA 3PUOA 1JQXA 4RV8A 3B9EA 1JF6A 3LCLA 4XAPA 4H6QA 1IT0A 1Y7VA 1IEQA 3CS2A 4B3LA 3VOHA 3GHRA 4PB5A 1D8WA 2FVMA 2WC3A 1NQKA 3KVMA 5DRCA 2PWFA 1QCWA 3QY8A 3BTNA 4XZHA 4AXNA 4RX0A 3NIYA 3UXIA 2VZOA 2NXIA 1G5AA 1RY0A 3O06A 4S38A 3UF9A 1Z41A 3P62A 2IS7A 1OFEA 1IXOA 3XIMA 4KEUA 4DJEC 2IKHA 5C7VA 2VC7A 3W85A 3GZAA 2WZMA 5LA1A 1XRSA 1SZFA 2Q8XA 5KZEA 4XKYB 2VEPA 4H9VA 3BLOA 3WQGA 3W28A 1XYLA 4MM1A 4RUBA 3BK0A 1FXPA 1M03A 3OG2A 4XQ6A 3RPMA 2BVTA 3C0JA 3CUXA 1W1IE 1RAKA 3DFHA 3CK5A 1S39A 1AD4A 3BUVA 4GNVA 4F9JA 4FSAA 2J62A 2WHMA 2NLIA 1MRQA 1CX9A 4UZSA 1JL8A 5TD4A 3GTHA 1BLIA 1JFHA 4UXDA 3VC6A 4LU0A 4UQCA 4AZ5A 3CUJA 3L4VA 3TTQA 2XN0A 3NQBA 3GBEA 3OIHA 2BLEA 3NQ2A 1TPDA 1UR0A 2XN1A 3BICA 3M16A 3SRKA 1DORA 1OHLA 5LYRA 2G96A 5PTDA 3N2BA 1UOKA 3AIQA 1XJBA 1NM9A 2RGMA 5D2XA 4HZ7A 1L6FA 2QKFA 2QS8A 3NQFA 3LM7A 4JTJA 3CMGA 4LBSA 3ZZ1A 4M51A 2NQHA 2WSRA 3SRHA 1DWIM 2QUUA 2I9UA 5E0CA 2A3LA 3E12A 3F03K 1RBOB 3FEMA 3UZZA 2W62A 2R82A 4DAIA 1MW2A 5DANA 2XVKA 4FP1A 3TQKA 4JBRA 4HPHA 2PC8A 5D8WA 1VH7A 3PZOA 3M0MA 4DIAA 1ZUAX 5LHFA 3EMCA 1SO3A 3FHQA 1UZDA 1MUCA 4O1CA 5A69A 2HVMA 3CQHA 1EP3A 1W2PA 3M0KA 3WDJA 1FH8A 1CZ1A 4NILA 3SGZA 4Z1DA 4LNCA 3S3GA 4DYEA 4DXVA 2H8ZA 1W3KA 3VUSA 3B0PA 3NYZA 5CKSA 4A3UA 1LOLA 5D04C 2GVYA 1TUXA 4BF5A 5KZMA 2IXVA 4CNPA 2PGFA 3T81A 4LY4A 2ODOA 3GNRA 4QAIA 3EWDA 3GG7A 4WSJA 1CXFA 3ZMRA 5L6UA 2FKPA 3CHDA 3GFXA 2MNRA 3NFUA 3NQMA 1U30A 3WMSA 1PS9A 3SY8A 2ZICA 1ZS2A 1V6TA 4XSMA 4GYPA 2WLZA 4NNBA 2Z2BA 2PA6A 1M04A 3G1YA 1YRRA 4RZBA 4O52A 2AL2A 2PLKA 4MLJA 4MNLA 3URAA 3MSDA 1TIMA 1OM0A 5DQPA 2V5BA 4ORIA 2ZA3A 2D2HA 4RPQA 1Q6RA 3DN5A 2QGHA 4C6BA 1KNWA 4HMEA 5I07A 1FWFC 4XZMX 3REQA 2RDWA 3H24A 4GO8A 3ZXWA 3UYCA 2POTA 3K4AA 1AQHA 3MZNA 4ZGYA 3AIUA 3TR9A 1EA9C 3S5YA 2HSAA 2VHLA 1V3KA 2E5DA 2Q8ZA 3AALA 4S3BA 3QR3A 2WJEA 3GVWA 5K9XA 3T7VA 2A85A 2OCZA 1MFUA 3OVPA 3U3HA 2VCCA 1HNYA 2XFYA 4GXWA 4MDOA 2EG6A 3HIJA 1U1HA 1CW2A 1V03A 4WDTA 1QOXA 3M0HA 2G3JA 2EPMX 1DTUA 4AZCB 2GWNA 3KWXA 5B80A 1Q6DA 3LQLA 1EDGA 4JCMA 3OBAA 2QPXA 1H1ZA 3IIZA 1W5NA 3ME3A 2HE5A 2OQYA 2VGFA 3W88A 1BKHA 7REQA 4EKJA 1J6OA 1UD8A 1NWUA 4V1XA 3C2RA 5HA7A 4D1JA 2B4GA 1LLZA 3P2VA 1JULA 4H2CA 3HG5A 4N9BA 4H04A 2BODX 4Q8QA 2Z26A 4LGXA 1HJWA 1RZMA 1WE5A 5FEXA 3LHTA 1KXQA 1FDZA 3TFXA 4HHMA 1E6SM 1AW2A 4ACYA 4QR6A 5J5DA 3CWHA 3DKLA 4FLOA 4DQWA 2CW6A 1H7WA 3DHUA 2DV0A 4IQJA 1HKVA 4MAVA 3O8AA 3LHUA 1K8ZA 2XIIA 3EDEA 5A6BA 3OYXA 2J88A 3EX2A 5E1QA 3VNIA 1I6NA 3B8VA 2C8NA 3HPZA 4PCPA 2O4MA 1XICA 4PBFA 4F2TA 2B7QA 2PTXA 3DHDA 4LC6A 3FK4A 2QLYA 4WDWA 3PULA 4QRNA 4K1WA 5GJNA 4QFUA 1C7SA 4UWMA 1LG1A 3AISA 4PMZA 3ARQA 1HIZA 2HE8A 1ICSA 1LQ0A 5D09A 3MHFA 2W79A 2X1UA 2CLKA 2ESCA 4DJEA 1E4NA 3WQCA 5FEZA 3RAOA 1E0WA 2QVHA 1SPQA 3AYSA 2HJPA 1AMKA 4K3ZA 1OX6A 3PPFA 5IFPA 2XVGA 2VTFA 4G9PA 3FOKA 3TYCA 3V3WA 4RDYA 1EYWA 3K1GA 1UR9A 4NUWA 4OBRA 1L2UA 3VD4A 1GWJA 2VVSA 1XW8A 2P88A 1ZAJA 5TIMA 2R1LA 4D8ZA 3STCA 4ES4A 1EF2A 3MUY1 4UQEA 4JTRA 1KXTA 4PA8A 2ZZ6A 3ARUA 1WUEA 2BGNE 1M6JA 1VFHA 4C6NA 3P60A 3VK5A 4IIDA 2J8FA 3LM3A 3TC6A 5CG7A 4ZQRA 1EC7A 2IQDA 3SIZA 3WX7A 2BS9A 1ZNNA 4ASTA 3QFEA 3M7SA 3W24A 2VUNA 2G3NA 3IJIA 1XLHA 3W2LA 3LBCA 3WK3A 1F3EA 4LYKA 4E2OA 4DWSA 2A0NA 3A4XA 5CQ1A 3EA1A 2GQ9A 1EBGA 4U4MA 2IPFA 4E4UA 4IIHA 5G2WA 3E0WA 3E02A 1GYMA 1W1B1 2DUXA 1I2QA 4XD4A 4H2HA 3EB3A 5G2HA 4IG2A 3W7HA 3OGRA 3S8HA 5GVJA 5I02A 5CAKA 1DWFM 3TW6A 3PUGA 3D46A 2R1MA 4KS0A 1TE6A 1NDYA 4BF9A 5C5YA 5JU6A 3H55A 3WQ5A 2CXEA 4LEQA 2ATMA 3PF3A 5KINA 4JY8A 4JYFA 2J78A 4JAWA 4LS2A 4B90A 5G4EA 4LCQA 5J8LA 8TIMA 2P0OA 2Q09A 3TONA 4Q4KA 2ACSA 1LM1A 2ISSA 4X3ZA 3OA5A 3NURA 2OKTA 1DQUA 4QJ1A 3TYBA 4OV9A 1B4EA 1FWTA 4MJZA 1XL9A 1JEZA 1JVNA 4V27A 1QOPA 1Z9AA 1ONEA 3TSDA 1JI2A 4CU8A 5FKYA 4QNEA 4C6JA 3GLCA 3S9YA 1GUVA 3CEPA 1A5BA 2PGRA 1SQ7A 2CZVA 2IKJA 2VKZG 4Q8VA 5CC3A 3HZ3A 1XYBA 4LY8A 1XX1A 2E6FA 3NOYA 2DIJA 3GXMA 4G1KA 1R30A 3DYPA 1ISWA 4GWEA 2V5JA 4TV6A 3CM4A 3VD9A 4GZIA 4XZBA 4O17A 3N9KA 4GXPA 3NL5A 4PTNA 3GWQA 2E9MA 2XIJA 4D6GA 3GHSA 2G5WA 3G6LA 4YYFA 1PKMA 2NVDA 2D0HA 3MJMA 3PZVA 2WOQA 1R46A 3EEGA 4QE5A 1O1ZA 1W6TA 2OGJA 3W6YA 4P8VA 1OCBA 4NX0A 1KR0A 2AQVA 2VRQA 1XV8A 1M7XA 1M9HA 2F2HA 1K7XA 1XRVA 4GA8A 5M2FX 2BSLA 1ZAHA 3GXDA 5D03A 3CC1A 2DSUA 3UR2A 4KFPA 3QY7A 2VNCA 4LVFA 2Y61A 3USZA 3BURA 2PLJA 5DBTA 1BSLA 4RE2A 6ENLA 4PR4A 2OYMA 2PZNA 5C9UA 1FA2A 1WKYA 3STEA 3VIHA 3G1RA 3BLIA 2FGLA 3KRBA 2R94A 4LEFA 2E6DA 5FF4A 2VCBA 3MVIA 1JZ6A 2PODA 3SCWA 3KBJA 3URQA 4GX9A 3ZR5A 4JX5A 4W5UA 1Z7AA 2BY1A 1W5MA 1A80A 4PTWA 4AD5A 2RFGA 1BRLA 3UGRA 3BG5A 1V3LA 4TXEA 2B7OA 2YCLA 4M0XA 1QO5A 3EDFA 1FWNA 1FWSA 1WZKA 3TTSA 1IR2A 3DU0A 3HV9A 2Z1VA 3LENA 4IMGA 2YZ5A 1DE6A 5FJUA 2Z2UA 1O94A 3IGUA 1XD0A 4ZQCA 1XIFA 4MFEA 3INPA 2B7NA 4JFSA 4UOQA 2XIOA 1UYQA 3ZVHB 4PN2A 4IQEA 2X2YA 4JCLA 3A6OA 4EAMA 4CQ9A 1OY0A 5HMDA 1I45A 1QI4A 1JYWA 2A79A 1B3YA 4Y8EA 1VYSX 2Y70A 3W22A 4NAFB 3A4WA 4CQDA 3W00A 5EA9A 4ZB2A 3LRKA 5CAHA 3S2JA 4Q4SA 5HK4A 8XIMA 5I3KA 2FGBA 5CEWA 1JR1A 5G4WA 4MNJA 2YB4A 4TX8A 5JBFA 1GVOA 4A3YA 4AWSA 3PB0A 1AG1O 4XISA 2NT1A 1KXHA 2UY4A 3LHWA 3OHMB 1GQJA 1D9EA 2PE4A 3T07A 2FQIA 1RA5A 1LOQA 3B3DA 4WXZA 3OTRA 4KPLA 3CZEA 1E40A 2VX7A 3TJIA 4Y96A 2P5NA 2D2JA 3UFYA 3I7QA 1E0UA 5EGRA 1IZKA 2ISVA 3IS4A 3M07A 1AK5A 4W88A 2OWCA 4GQBA 1IT8A 4HU0A 3S0CA 1EXBA 1Z3NA 4EPBC 1UW9A 1PIFA 4C6IA 3VCCA 3JUGA 4ACZA 3FIGA 1FWBC 1ADDA 3K5XA 4IPPA 4A8RA 3VA8A 3KOYA 1U33A 1B3XA 5FF2A 2CC0A 3VYLA 5DELA 2ZBTA 2OQLA 2GVGA 1TV5A 1ZBKA 3UJRA 5LGZA 3UWWA 1KRMA 1R3WA 3HA1A 1PJ9A 5FESA 4FEZA 4ROQA 4UTTC 4B16A 4Q7IA 5ABFB 4Q8WA 1OF6A 2DZVA 4XBKA 4V15A 3G3MA 4NYUA 1RY8A 2UWFA 3P84A 1GCYA 4UIOA 4FNRA 1KC7A 1EA0A 3M5VA 3W72A 4RKAA 1QU4A 5LNVA 4RJEA 4NHVA 3VNDA 1GZGA 4NXSA 1TWIA 3P8JA 3W7KA 4E4PA 3OHIA 3W1RA 3GW0A 2DQWA 3RR1A 2GJXB 2WLYA 3FJ6A 5D2YA 2XIMA 4QHRA 3DX5A 3KP0A 1GHRA 4LF1A 2GGEA 3WQ4A 2VFIA 3CPUA 3W7CA 3FN9A 4K2SA 4EX4A 2RUSA 1B90A 1QPRA 3PAJA 1JZ7A 2P8BA 4Y9PA 1AJ2A 1M7PA 2PTDA 3BVJA 1XDLA 4QBXA 3P5ZA 5GNXA 3BC9A 1TMHA 1Q8JA 5M5DA 1QASA 3R5EA 4LQ1A 1H63A 2JFEX 2QF8A 1DEDA 5A6AA 3I3DA 3OLDA 2PDIA 3C52A 1ZCCA 3QOMA 3F2DA 3BAJA 3UCQA 4KWVA 3BV7A 3T4CA 1ZQ5A 1NFPA 4J3TA 1GVSA 4PUMA 2UY3A 3GXTA 4O0QA 3HQOA 4JTEA 4L9XA 2YCKX 1VRDA 1JDAA 5MKGA 4X2RA 1SMAA 4Z42C 1ZJHA 3CUFA 3OQ8A 2GGHA 2V38A 4B5TA 1CT5A 3C86A 5EFDA 4AVFA 3KLLA 2NQJA 1TKKA 3M4HA 1NELA 5FF0A 4GI4A 1GPWA 4FO4A 3OQEA 3O05A 4FR1A 4JN8A 2H9AA 4FXFA 1DOSA 1XC4A 2CBIA 5A94A 3W02A 4U2YA 4HHLA 3C56A 2PTWA 4ZZ9A 4UNKA 2BASA 1I1XA 3R11A 1XQLA 4I7WA 4Z2KA 4ZMGA 1ODZA 2V3GA 1GG0A 3H7UA 2ZZ5A 4DJDC 5HMSA 1ICPA 4PTDA 2NX9A 1A3HA 3N4FA 2W92A 4IP4A 3FXYA 5AZ0A 1PAMA 4G7EA 4AB4A 2W61A 3QKZA 1FFRA 5H91A 4AC1X 1G4SA 4B5SA 4LJ3A 1RJQA 4NAEA 4XTDA 1N2VA 3TA6A 2Y8UA 3TYZA 3VNMA 1XBXA 5E5CA 4FXSA 3TQVA 3VOIA 2IW0A 1YW1A 1SO4A 1XH2A 2QCNA 2KAUC 5I06A 3MMWA 2ISFA 3B8WA 2C1IA 1TX2A 2FMNA 1FKXA 4NVTA 1YDYA 1H7OA 2HK1A 1P0NA 4EVZA 2V3FA 4WKHA 4GH1A 2FB3A 3RXZA 3GUGA 3W9ZA 3WD1A 2CESA 3VNKA 4HNTA 4N9CA 4HOWA 5BW6A 3TYDA 1L0PA 1AL8A 3CLMA 2ISDA 3H2CA 1KW1A 2X16A 2VEMA 4LUYA 3UD6A 3VDBA 3RLHA 5EMKA 2CBUA 3GU1A 4QXIA 5A8QA 1K3UA 3TN6A 1KWGA 1X1NA 4ONVA 1CGYA 2GDVA 4CNSA 1ZL1A 2XWDA 3ZVHA 4ZSUA 4UZUA 7CGTA 2XINA 5HATA 3VOGA 3PSVA 4LAZA 3AXMA 3K13A 3F4DA 3R79A 1Q8AA 3CV1A 4NAFA 3C2FA 1SSGA 1TR9A 1QJWA 4QLLA 4F0MA 1ME8A 4ATDA 4AIBA 2UV8G 3CHVA 1YTKA 2BX7A 4R33A 3V75A 1Q7ZA 3BGJA 4KEZA 3ITTA 3HQPA 4WY0B 1SJDA 4L9ZA 3KRZA 5AC6A 3GTFA 4HK6A 5EY5A 1DWGM 1US3A 2O9OA 1ALDA 4HNVA 1VBRA 3W0KA 1EJXC 2RJGA 2EPKX 4YXGA 5DT7A 3L67A 4UTTA 4UQAA 5CZJA 3V35A 1FQ0A 1XLFA 3W6MA 4JYDA 4DPQA 4JNMA 3G1FA 2ACUA 2PCEA 4FOUA 4PBGA 2J9YA 4B5UA 2QR6A 4D71A 3EAUA 4F2BA 3ITVA 1KR1A 3AZTA 3GC5A 1PCKA 3AXXA 3WH6A 2REQA 5HWMA 1F6KA 4QG6A 3U0HA 3CHCA 2R1KA 1SMDA 2BOFX 2IPGA 2VEIA 3OLEA 2CIPA 4AHPA 1TIWA 4KCTA 4AHOA 3AS2A 4NG3A 3TK7A 2QUNA 2C19A 4UTWA 1WZMA 3WMCA 4M5PA 1AJZA 3EWCA 1NP2A 4W89A 2BDQA 4YTRA 5ABFA 4QP0A 1DYSA 4ZBCA 2X8RA 3MB9A 5H2ZA 5A8OA 3U48A 4R85A 2ZUMA 5XIAA 2E40A 2IKIA 1KB3A 3DG6A 2O55A 1R5YA 2G3IA 4HPJA 3RITA 2YDQA 1J93A 3B9DA 3MYPA 1VYRA 4NX5A 3B9NA 2OX1A 4C65A 2C3ZA 1YBQB 4RNHA 4CVWA 3TWBA 4JXCA 4FNSA 3CHEA 2W91A 4JX4A 3CLWA 3N3MA 1T8XA 3LGDA 1EJ7L 5IM51 1K8YA 3QMTA 5REQB 2OWWA 2E9BA 4J7RA 4AXKA 4JL2A 4LBUA 4PH6A 2E1DA 4NNCA 4N4PA 2G4FA 4WXYA 1Q13A 4MB3A 5F1UA 2YBUA 1A50A 3U2EA 3FAWA 3GRIA 2OZ0A 4LYRA 4MKVA 3NO3A 3APYA 4WOQA 6A3HA 3TSBA 3W38A 4GIAA 4DLFA 1ECEA 4C6MA 4RDWA 3WNPA 1IR1A 1JUKA 3LPFA 3GIYA 2PDWA 3WG6A 1O5XA 5FI8A 2W63A 4KIEA 2RH9A 3KRUA 1CBGA 4UR8A 3U2ZA 2WYSA 3ABXA 1GKRA 3G24A 3WLQA 1K6AA 4U28A 2FGZA 4GMEA 2BB0A 2QMKA 1WDQA 1EX5A 1S1RA 2PWVA 3O7UA 5FJRA 1XBYA 3GVVA 4JFUA 2NW0A 5IHRA 4O53A 2QUMA 3WQFA 3RRXA 2DVUA 4WK9A 2ZC8A 3SSZA 1JXKA 1S5TA 1JYVA 1C91A 4E0CA 3VDCA 4WY0F 2QZRA 1UUMA 2OEMA 5LIUX 5H8MA 2WMKA 2Y85A 4C7DA 3H4GA 1V0NA 5DMLA 2VD9A 2OB3A 3JS3A 1JD9A 4AQLA 2PDGA 1NWTA 1KCKA 3A5FA 3MWAA 2ZXQA 2PAJA 1TVNA 3LBOA 4OBTA 1EHAA 4YTTA 1SW0A 3UR5A 1ZB5A 1TMQA 3FYPA 3CV7A 3F5LA 4QDMA 2FPTA 3H2MA 1DJZA 3AXIA 3DBPA 4QNWA 3VOCA 5C9XA 1SJCA 5AC5A 5LNRA 4O16A 3BMXA 1DJXA 2L5HA 2UBPC 1RQHA 2AQOA 1OD0A 4UMAA 1FTXA 1KTNA 1MXGA 5K2ZA 1OFPA 2GVLA 1YLVA 2W4XA 1HJSA 2Q6ZA 5M03A 3RM8A 5FA5A 1UD4A 3R13A 1Z32X 4KQNA 1SUXA 1EBHA 3TV8A 3PBGA 3SZ8A 3BSMA 3QKEA 1BVZA 4AZ6A 2NWRA 4MZYA 2W67A 4QJ5B 5K9DA 3T44A 3U57A 4AY1A 4I3GA 5CGQA 2WSQA 4KESA 3URNA 4K7VA 3T0CA 4B9ZA 3FX4A 5CC7A 1TRIA 3EWZA 3U4AA 5C8BB 3W2UA 2WKLA 2PEVA 2CERA 3WNKA 3V7PA 3PBYA 2PRMA 3N25A 3W74A 2JEPA 2BHUA 3OLGA 3GDBA 4IWWA 2B0MA 2E5CA 6REQA 2PLCA 1GQKA 5D2TA 2VR2A 4LBRA 2EKGA 4TX9A 3WLRA 3TNOA 1F5ZA 3UWUA 1KRBC 3R94A 5LIYX 2ATSA 3CAQA 5CLTA 1WDWA 4LW7A 1RJPA 1FFQA 3M6YA 2PD5A 1F6PA 3O9NA 3AUJA 4RR4A 4IUOA 1X96A 2R91A 5DY3A 4DBSA 3Q65A 4Y9AA 3CAVA 1XYCA 3BW2A 3V5CA 4MB5A 4LRTA 2OU4A 1J2WA 3DIPA 2QGYA 1QPKA 5HNNA 1UROA 3HF3A 2BVDA 2YFOA 1W31A 1XF0A 4AZBA 3PJUA 6TAAA 3PC0A 3RPTA 4GH3A 1KGWA 1LG2A 2XZ7A 3MSGA 3W7NA 3LG3A 2OMAA 2BG5A 4NU7A 4H9XA 3BLKA 1EWEA 1UBSA 3MKVA 1UA7A 1OFQA 4ZQNA 4J2PA 4IJRA 1LJYA 1WXZA 1ISVA 4IOTA 1E71M 4C6FA 4E2DA 3L66A 1LBLA 2V2HA 4OQVA 3NNTA 3BAKA 2VFGA 2GFTA 3M9YA 4PMQA 4G1NA 1H4PA 3F4CA 4FOKA 3LLFA 2A3BA 4N6EA 4JTLA 4P7NA 3AYRA 3TUUA 3IVUA 2O92A 5AYBA 3HPSA 1R2TA 3RG6A 1IEVA 2YGYA 3B0YA 1B3ZA 3NXLA 3O07A 4EXBA 3S6OA 4KEVA 3H2AA 4U31A 3M0LA 1ONWA 3DFQA 3TCSA 4YLWA 3QY6A 3LSCA 1UCWA 1Q6LA 1Q6QA 2J79A 3R12A 3RN6A 4EIVA 5B7ZA 2OG9A 4KKXA 1SFJA 2MUCA 4UFKA 1J0JA 2J7EA 3WYZA 1KCXA 1T40A 3UR8A 1PKLA 5I78A 4R7WA 1EJVC 5JVLA 1JDDA 1NY1A 3IIOA 4RZ4A 2PU0A 1P6WA 5ABGA 5EMYA 3ARSA 3CZKA 1RP8A 2XH7A 1HJXA 2QIIA 1QPOA 4GZEA 3WLNA 3W84A 4JY9A 4XAGA 4JIQA 2QCGA 3C0QA 4Y2WA 1N55A 3VNZA 4RNIA 2TSYA 3E2RA 2JGYA 3KE0A 1T5AA 3WF4A 4AX6A 2HXTA 3SRFA 1YNYA 1A5KC 2X0YA 1O66A 4QS6A 1LRQA 1VC4A 4R7OA 4NASA 1XIMA 3GYEA 1FY6A 1VYPX 3E49A 1NOFA 3MV01 1RXOB 1E4IA 1D7FA 4L6HA 4MIMA 2KX9A 3AI0A 4CUCA 4J9JA 3WLHA 3ARYA 1XLMA 3MTWA 1GTHA 4XD6A 1QW7A 3O6YX 2EG8A 2PC4A 3M0YA 4ZOBA 3EWYA 3EPOA 2CXGA 3LCGA 2A1YA 5REQA 2XZ9A 1XRTA 1QT1A 3QGVA 1E6QM 1J11A 5D05A 4GFIA 4L6OA 3WUEA 3S46A 4KEMA 3R8HA 3M41A 3PHAA 1AW5A 2V9DA 1YDOA 5JXQA 1RA0A 4EXAA 2ABBA 3LCXA 4FALA 4O1FA 2Z6IA 2NQ5A 2GOUA 4B2DD 2WWDA 3P61A 3OEXA 2YBVA 4DPPA 3QTGA 4XVEA 3ZO9A 2EPNA 1E9LA 4IIGA 2DQXA 3N4AA 3VGBA 4FMVA 2QT3A 4Q7NA 1CXIA 1Q4WA 2AQWA 5DXYA 2PBOA 1LQ2A 4UTMA 2VM8A 4RZ5A 3SN1A 5F2MA 5BWAA 1ZPTA 9XIMA 4DB7A 1VLWA 2ZUNA 1XCWA 3CYJA 1ZENA 4UTIA 4H9ZA 3G22A 2WXDM 3I6EA 2VVNA 1H11A 1VEOA 4B3ZA 5BMWA 1J2BA 3NGJA 3CNYA 3IUHA 3PUDA 3RJYA 4MDPA 4CNTA 4G6CA 1NU5A 3H4WA 4QS5A 2JGQA 4TMBA 5D02A 4MKSA 4JTTA 4I9JA 2PDXA 4FPSA 4HA0A 4D9PA 1JCTA 2RHGA 1WZLA 3VXGA 2X30A 4PCSA 1GKPA 5CH9A 3H7RA 1HFBA 2TODA 4FLRA 3HJZA 1KKOA 3ZIZA 3CMJA 4PMYA 3ALFA 5K9CA 3VX0A 3U6WA 3WUGA 5LNSA 2ZTJA 3WLTA 4S1FA 4AG0A 4IGSA 3BE7A 4UUIA 2YW3A 1EGMA 1VAHA 2HVNA 2R9RA 2H3DA 1DJNA 2F6UA 3G5EA 1Q6GA 3E5PA 1R9ZA 4PMRA 4PYSA 2Y1HA 2FYMA 4PB3A 1WXJA 3EPNA 3MSYA 5HNTA 1E4MM 3KOZA 1NJJA 3TC3A 2QV4A 2F6KA 3A12A 3TKFA 1LOSA 1DVJA 3NM1A 3A13A 1KXVA 3W7PA 2JE8A 1XH0A 3QM3A 5CPNA 4WOZA 5FJJA 1GOXA 3MANA 4HTBA 4NL1A 2I16A 7ENLA 4E4FA 1RJRA 3N12A 2V6AA 2DH2A 5A5WA 1LL4A 4F0HA 1A0CA 4JPGA 1UWAA 4LAMA 4WDXA 1DV7A 2YA0A 3W53A 2V2CA 4EPDC 3FLUA 4JTFA 1DTNA 4S2BA 3MBFA 1B5TA 3TN5A 4Q8OA 2AKMA 2VC5A 4WD0A 3A9BA 1YE6A 3FCPA 4BEUA 4HQVA 1EGZA 3WJYA 1KCZA 4O11A 2EJAA 3VZZA 1PZ0A 1X8CA 3T2OA 3FVDA 3LXAA 5GJPA 4H1ZA 4N7QA 3MZ2A 3QOKA 4Z0SA 1OFDA 4JX6A 5DX7A 3SM0A 3RNDA 3II1A 1TZZA 5A8MA 1TX0A 3MP5A 1R85A 4X60A 2VT0A 1US2A 5T8GA 2DY3A 3UR7A 2W66A 5E0FA 1JYXA 2Y0FA 3LERA 4DJFD 3MI3A 1ESWA 2UY5A 2XFFA 3MUZ1 1JDCA 1R3VA 3LRMA 3LB0A 4WJEA 3ARXA 2HEJA 5E93A 4YVXA 1JDFA 2CYGA 5AVHA 1A47A 1JUBA 1EEXA 4GI9A 1AODA 3O0FA 4P7OA 4QEEA 4DBDA 3DHPA 4ZTXA 2NT0A 4C91A 4MF4A 1ZHAA 2VWTA 5HQLA 3L5AA 1EQCA 1LWHA 4P8UA 4GJ1A 1K1DA 5BU6A 3ARVA 3WQ8A 2WSKA 1TV2A 3BLFA 4A6GA 5F2LA 5BRBA 2GJLA 4ROPA 3E1F1 3H2EA 1O5QA 1TG7A 3ANYA 3MQTA 1PTGA 1WUFA 2YJQA 4QQ3A 1XCFA 3PSWA 5EMLA 4AEEA 4QM1A 3P67A 3OZMA 2WMHA 1M7JA 3LTPA 1C3FA 1MEIA 5E09A 4AC7C 3H54A 2YX0A 1DHKA 1TELA 4Q8MA 4LCSA 3W7JA 1KBBA 3W87A 2V5CA 1V02A 5TBOA 3IVSA 3UZYA 3E5BA 2VX5A 3N19B 4N9EA 5AC4A 2PS2A 2Q3RA 4Z0JA 2YPIA 3F5KA 2BOEX 4PCTA 4Z17A 4M29A 1C7TA 2CLEA 3TYAA 3N2MA 1E4LA 2DH3A 1HVXA 3AIEA 1ISYA 1LUCB 3GDKA 3LYEA 3UW6A 3QGAC 3ZLFA 4ZB0A 4FNPA 4F48A 2WZEA 4US5A 1Q7QA 3B04A 1EJRC 4PRRA 1D8CA 1B9BA 2H90A 1YHTA 1XUUA 1WOBA 4YHEA 3LCFA 2X1IA 2R24A 3A64A 4GI6A 1UKPA 3P0XA 4GX8A 4AU0A 3BG3A 3WF0A 2D2GA 5KITA 3PZUA 3T8QA 3N6JA 3WJWA 2HNHA 1SJBA 1H7PA 5DLCA 4OTKA 3WDIA 1UZ4A 4QEHA 1CECA 1KM4A 2DZPA 1EDTA 3GNPA 2OZ3A 3BGGA 3V5OA 4E2VA 1C8YA 4MZ1A 1NEYA 4LT9A 2PDNA 2YYUA 5E70A 3M7WA 3SFWA 4JQAA 2DUZA 3DFTA 4L64A 5DT5A 4H8NA 1SR9A 4H9MA 5I00A 4R9OA 4Z2HA 3RIKA 4OIFA 3S6TA 3WLOA 2O56A 5K3VA 1QW8A 1TPEA 4Z2JA 3SI9A 1ZAIA 3QQ1A 1PDZA 1DBTA 1C8VA 1UD3A 2QIWA 4CCEA 3K8MA 5I3IA 3VINA 4W7VA 1Z42A 3HGOA 1VPXA 3WQOA 4FNTA 4O10A 1BKSA 1QWKA 1RD5A 3GW3A 3KXQA 3S5SA 3SSJA 3GG0A 1TTPA 3FA5A 1PTAA 3AIRA 2ACRA 1YTDA 1UR4A 1V3IA 3MVTA 3ITOA 5D8ZA 4O14A 2EHHA 1S5WA 1TO3A 2VDHA 4UCFA 1DWJM 3SAZA 3W7QA 3PANA 3UY8A 1REQB 2I7GA 3ARWA 2QPUA 3CB8A 5JQ9A 3HB9A 4H4IA 4WF7A 4D1IA 1PX4A 6ALDA 1BGGA 4O1DA 4NZ4A 1TA3B 1TSIA 4MNMA 3FGCA 3BARA 3TVAA 4JFVA 4JR5A 3R25A 3B4YA 2DZAA 4GUGA 1ZALA 4FX8A 1I9CB 2C91A 3W2NA 2X42A 2E6YA 1QI5A 1S5NA 3PNUA 3WD4A 4OGZA 3S2NA 3MBDA 3WBWA 1TCMA 2WCGA 1RK5A 3NTYA 3OBEA 4AX7A 1DE5A 4IT1A 4DZ5A 1GG1A 2ZDSA 5H6HA 1SZRA 3FA3A 4WIWA 4AIUA 5HR7A 3WF1A 3HM7A 4HMDA 4BA0A 3PBMA 2PWUA 4QTGA 4KRZA 1JCNA 1E1CB 2P3EA 1TQXA 3CUHA 1ITCA 3IVTA 1I2PA 3QW4B 1DQWA 4MKNA 3SUVA 1MQQA 2BXVA 4DAFA 1ZBVA 4HNNA 1F4AA 2HTMA 3UNTA 1S46A 3ZVIA 5C2XA 3SUUA 1IXNA 1BF6A 4PB4A 3RM9A 3RMJA 1JYNA 2OEKA 2EG7A 3PNZA 1MVYA 3CIVA 4JQ3A 2YLLA 1W9BM 3LV5A 1UC5A 1OC5A 1KGXA 1FX6A 4GI8A 3LY0A 3FNDA 1HJUA 4BWLC 2D22A 3EDKA 2JKPA 3H8AA 1Q66A 2TAAA 2GK1B 3SN0A 2W9MA 4C5ZA 4DLMA 3G6MA 4XUYA 3JZUA 2FJKA 1TJ1A 4HSHA 4ZOEA 3LNPA 4IP5A 1CYGA 1E73M 1AQFA 4TVCA 3ONCA 1KTBA 3VC5A 4KRUA 5FF3A 4HHHA 2X41A 3LHZA 1TV8A 3VIGA 2I1OA 1V0KA 3E38A 3QZEA 2HZGA 3VIFA 4F8XA 5I6SA 3JRKA 3QJAA 5HWJA 3H6OA 2WO5A 2VDIA 3GXPA 4MHBA 1QTWA 1TR1A 3N73A 2CWNA 3MKKA 1VFTA 1SW7A 4C6LA 4IFKA 4AF0A 2HROA 1QNSA 1R7OA 4K39A 3VKBA 4Q8TA 5CC5A 1HF6A 1UG6A 4FF7A 4N4QA 2XVPA 4YCOA 1IXPA 3BAIA 3UJEA 3UYIA 3VUPA 1E9YB 1RQBA 1HXJA 1MMFA 3LI0A 1NWRA 1W3JA 4HA1A 4V1YA 5TAOA 5FOOA 4JNZA 1I60A 3TDFA 3G2GA 4U2ZA 3TW7A 1AQ0A 3Q37A 2FMOA 1DHPA 3RFAA 2XFWA 1J18A 3T2QA 4AYSA 3NQ6A 1OGBA 1C8XA 2E77A 3RRAA 1JZ5A 4NP7A 3CQIA 4HYWA 4AUBA 4H7CA 5G1MA 4G5DA 4R88A 4MWAB 2D20A 1V93A 4GD0A 2ZZ1A 1MDLA 3VO0A 3EDDA 1BTMA 4AYGA 4L5ZA 4IL2A 2AGKA 1LRNA 3NVDA 3C3NA 1RP9A 2IUZA 3WLKX 1QMLA 3VKDA 3DH7A 5FEWA 4HZMA 2F6XA 2NXHA 4HZ8A 1BVWA 4LVBA 1P0EA 3Q67A 3NPWA 3DENA 1GOQA 3OZYA 3IAPA 1BVNP 1W56A 3ARRA 2PCQA 4BK9A 1XFBA 3GXNA 4XZWA 5LIKX 3DG7A 4AWEA 1G01A 1NQ6A 4JNYA 1GOOA 2FIQA 5I03A 2OOGA 1C90A 4AWUA 1M65A 2FH8A 3SB0A 2PWDA 1VBJA 3NZGA 5I79A 2E1WA 3QC0A 3TJLA 4CU7A 4HJFA 2BGSA 1Z44A 3UU0A 3PTQA 2BZNA 3MW7A 4GO9A 1TPH1 3I10A 2AMXA 1XLEA 3PZIA 1PZ2A 3DFPA 3ITYA 4JKMA 4QDWA 5C0QA 3N11A 4LB3A 1O4UA 2J47A 4P2VA 5K7JA 2OT1A 1ONXA 3WK1A 3CL8A 3T1GA 1PWMA 1QDSA 4W7WA 2XSBA 3L4ZA 2P53A 3H12A 3ZOAA 2ZCGA 3BMWA 2J66A 1EJWC 1UD6A 3T8LA 1NWSA 4MWAD 4UB9A 1EC9A 3W4RA 1R2SA 3WFZA 1AA1B 1V77A 1I1WA 2ZRVA 4L4PA 1OYAA 5I3JA 4GUFA 2DW6A 3BLLA 5GPRA 1OZMA 3B4UA 4YS1A 5HUPA 1DXIA 4B5WA 2GSHA 3LPGA 3U4FA 3KVLA 3JZEA 3Q58A 4PCNA 4B4HA 2DJLA 1LWJA 3N17A 4PMVA 2GDUA 1CB7B 3L4UA 3GAKA 2CITA 1EEPA 4E5TA 2YBTA 5LSMA 4AVNA 3TLQA 3ZJKA 4L4MA 3PFRA 3G0UA 1XXXA 2CBJA 2OEJA 2XM1A 3BANA 5IDZA 5GNYA 4PTMA 3MO7A 2ZZ4A 2YIHA 1P1XA 4I7UA 3GHUA 1XR2A 1EDQA 3C6CA 1H62A 3VGEA 1REQA 3ANVA 4DYKA 2WANA 1UC4A 1RPXA 3TAKA 1KFJA 2PDQA 1EQPA 3U2CA 2V67A 1WB0A 1WX0A 1VPQA 4F79A 1B0IA 3PJWA 2JALA 4L80A 3O15A 1QNPA 4O8AA 1XSKA 1MSSA 2CZFA 2XISA 2DT2A 1UWSA 2JEQA 4B5XA 5A2BA 3A3XA 4IMAA 3AU6A 3M0VA 3RUBL 4OVXA 1G6CA 4QG8A 1GVEA 4US6A 3KTSA 3CUGA 1V6XA 3AWOA 1E1CA 4ZQOA 4LAUA 1BWVA 3WH5A 1EJTC 2FLIA 5BROA 3ZR6A 2ZIDA 3NSNA 1FWGC 1V02E 3ICJA 3SCSA 1OK4A 1EFZA 1BXBA 3R0UA 3SJ3A 3T08A 4OUIA 2VGIA 1G7VA 5CZKA 4DUWA 2GSEA 3REQB 1E6XM 3AWNA 2E67A 3WQDA 4CD7A 2ABAA 3LCHA 2OO0A 3IGSA 1E0XA 1JPKA 1XM3A 1QOQA 1S3HA 2J74A 2ZVRA 1KTCA 1XIHA 3GYCA 2GK1A 1TQJA 2VEGA 3G18A 3DDMA 4J40A 3GXFA 2QULA 3UWZA 4WR3A 5D32A 2ZXAA 1R3YA 1P48A 4E8DA 4WJXA 1NP0A 2Q01A 2ZUUA 1YDNA 3HMCA 4IP7A 3G8EA 4QX4A 3GDMA 4A35A 1DJGA 4HSOA 6TIMA 1TJ2A 4L6DA 4FX6M 4O28A 3M0JA 2J7DA 1B3VA 1TMLA 4UR7A 4OOZA 4UTHA 1UBPC 4DO7A 3UWYA 7REQB 2X1TA 4HN8A 4ZXLA 3CPRA 4GG9A 3KBWA 3AU2A 3C61A 4PUDA 3TJXA 2BY3A 1UMLA 4XSLA 3PZNA 3IGHX 4UQDA 3UXKA 3UJFA 2QHAA 1OYBA 1R3SA 2IPJA 4MTVA 3QQWA 4FXRA 3UP8A 4BQ2A 4DNMA 3QZAA 4ZA0A 4IIFA 1CXKA 1TFVA 3Q45A 2ADAA 2GJPA 1JNEA 3ABRA 4ZO6A 3OVQA 4XAFA 4LUSA 2Y7EA 2V3EA 3BXWA 2VR4A 3ZS4A 3E0IA 1M41A 3POCA 1OBAA 2E25A 2WHLA 3NQ7A 2WMIA 3GTNA 3Q94A 2VZUA 1AUSL 4ML9A 4J28A 1IT7A 1XIGA 3WUFA 1MUWA 4R7JA 3ZFHA 4WHBA 1H1YA 3THQA 3VPLA 1WDPA 4DNHA 4ZE4A 3TNBA 3G8RA 3AS3A 1X7FA 5FACA 5BWFA 4WGXA 4M6PA 4DF0A 1OFAA 2Z1BA 4ECLA 1SSDA 2VEFA 4CQ8A 4W85A 3V1PA 3SGGA 1TZ9A 3B05A 1V6YA 1N8FA 3WLJA 4J3WA 4ATLA 1LT8A 2XHYA 3TIMA 4OV4A 1OC6A 3B9OA 1KM6A 3KOWA 2I57A 2CLOA 5F4SA 2NUYA 1UWTA 2DW7A 2OR2A 3KEHA 2XVLA 2DJXA 3GH5A 3GY1A 3VAVA 2JF7A 9CGTA 3TCEA 1MZRA 2INEA 4KMQA 1CEOA 3VKCA 4NSBA 4HCLA 4H6RA 1KM0A 2UY2A 4PMXA 3EBVA 1ZBCA 1H61A 1GEHA 4F0SA 2ON3A 1NARA 1EGVA 3B97A 4PFHA 1LBFA 1UIOA 5AHMA 5D2WA 1TVPA 5A6BD 1UIPA 4W5ZA 4LV4A 4D8AA 3KTCA 3OODA 5J04A 3RLGA 1DIOA 3WELA 4ORMA 1XYZA 2YL8A 1Q63A 4XIMA 2V0TA 4DWSB 1E0VA 4Q6JA 2XM2A 4BQ5A 3S1XA 3L9CA 2QJHA 1K7FA 3W29A 3IANA 2J7BA 1CGUA 3KL5A 1VFFA 3VM7A 4C7GA 2HVOA 4K8EA 2G41A 1VCFA 3FSUA 2E8ZA 3BL3A 4JIIX 3B8TA 3TSMA 2WNZA 4CQBA 1Y5WA 3IK4A 2D23A 1K77A 4F66A 4A05A 3KDNA 4AMCA 4TU1A 3TFCA 1KD0A 1JDEA 4IG2B 5D4YA 2DVXA 4S3EA 1PEZA 2GGIA 2BNJA 1TRDA 3SCTA 2HV5A 2ZZ7A 3OLIA 2E9LA 4WSKA 3C0LA 2I56A 2Z28A 5BRQA 2DT3A 3VNLA 1C9WA 2J77A 4RE3A 5D33A 3TMLA 4DF1A 5FJOA 2QJMA 3M5YA 4OU1A 2XIQA 1TPFA 2ANUA 3R58A 4ZFCA 2J7FA 2LLEA 2DORA 3MMTA 4LUTA 4MJMA 2CZEA 5LA0A 4GQGA 1HP4A 2YDAA 3NL3A 3WJXA 1C9DA 5A8NA 1V6WA 2WQPA 3A22A 2OJPA 4OUEA 4BS0A 3VNYA 4MGGA 1SYTA 4GCAA 1XLKA 4DWSD 3N4EA 4KWUA 3LNMA 1ENUA 5GQBA 4BZYA 1QAPA 3BLEA 3MCNA 1OG0A 2ZX8A 4WVXA 4DJFC 3F2BA 3M44A 3MS8A 4HCDA 3L5MA 2PDPA 2DGAA 4C7FA 4CNNA 1FWDC 5M17A 3NUKA 3CPGA 1EB3A 1XC6A 1SGJA 1FWWA 4F0RA 1M3UA 4YTUA 3HQNA 1B2YA 1KM3A 3BQ5A 1SFTA 2CLLA 4JTUA 3GC4A 4Q4PA 2Y2WA 3C2YA 3F4VA 2FZ8A 2CEQA 1FHVA 4CEXC 2GPTA 4LOCA 4YYCA 2BWGA 2P8CA 1QK0A 2C0AA 1FWHC 1HKWA 1DP0A 2WB5A 4AVOA 3VFCA 3M46A 3W86A 3STPA 4MOZA 3E3HA 1W9PA 3BOXA 4S3CA 1P5BA 3IJLA 3SN4A 1X38A 3WD2A 3LXBA 4QCFA 2V5KA 3BSGA 1GQIA 3RGTA 4IJBA 1BAGA 2Q02A 3G1VA 4QCEA 1JCLA 4E8CA 3NQAA 5I3HA 5LXXA 4EPEC 4HA3A 3PPGA 4S3DA 3W7GA 1ITXA 4RLIA 2GUBA 4GUIA 1OEPA 5KTLA 3C3UA 3A9IA 4TIMA 1RALA 3AIBA 4ICNA 3SCOA 2C1GA 5C9WA 1RBAA 2WPGA 2FZ9A 1F3TA 2NLYA 2OXNA 3W70A 1XGEA 5A3HA 3R0KA 4GBUA 3CTLA 4JL1A 1JCXA 3DXIA 4E6MA 5HDRA 1W1ZA 4HOZA 4NNAA 5D9PA 1MDRA 1GONA 4W8BA 4FIRA 1BRLB 4V2XA 1OX4B 1XLCA 2XVNA 2YCLB 2G50A 1AFSA 1S2UA 3RX4A 2CHOA 1JPIA 3CZ8A 2QDEA 3CV6A 4K36A 3IARA 3MDWA 3UWVA 2D0GA 3SCVA 3EMZA 3OZPA 4S3FA 5C70A 1NAL1 4DZHA 3ARPA 1DKWA 3UVAA 4MY9A 3I68A 5C9ZA 1TYGA 4MVAA 3W81A 1FCQA 3WQWA 5A2AA 2A3EA 1ZJAA 3W1AA 1WQ5A 1AQMA 3GR7A 1A0DA 1TPB1 3HFTA 1ZP3A 4PMNA 3DGRA 2DIEA 2RKXA 2VEKA 1LBMA 4GKLA 2JKEA 1MXSA 2YDSA 1TB3A 4O8RA 3AROA 3DI1A 2VC9A 4FAMA 1DL3A 2VWSA 2OWXA 4GUHA 4HK7A 2CBVA 1RH9A 1NF0A 1WBHA 1XDMA 2PU1A 4REQA 7TIMA 3G1AA 1EJUC 1PSCA 2PBGA 3NVTA 4OZOA 3KTXA 2E4TA 7XIMA 3T0AA 3K2GA 1XG4A 3T40A 4DRSA 5E9XA 4LPCA 4P8XA 1VCVA 1OVDA 4GZ7A 2J4GA 3VZYA 3E0FA 3TC7A 3WEMA 5F2IA 3WENA 2FHFA 1O95A 4MLRA 4XX6A 4GOAA 4GJJA 3CIXA 1Q7MA 3G1XA 2C1HA 1R0MA 3WQEA 3ISIX 4JKKA 1KFWA 1W9DM 1Q6CA 4EWND 2Z1KA 1CGVA 1KV5A 4CEUC 3BMVA 4ACZB 1M7OA 1XQKA 3UPWA 1VEMA 4L9YA 4EWJA 1A53A 4XWUA 3VILA 2VQTA 1DXEA 3W1LA 1TWDA 3N14A 4HBKA 5EMJA 3NSXA 2ZRXA 2A7NA 3HN3A 5AYIA 3AHVA 2A5HA 3QEZA 4IGNA 1LLWA 4X9YA 2J27A 1R8LA 3DFNA 4HNCA 4V28A 4A8IA 5I3GA 1J5SA 3SCUA 3S1UA 2PDBA 2WMJA 1F3XA 2YL5A 4MYXA 1X8FA 3EOLA 4MZ8A 3WFLA 4NI8A 3F4WA 1G4EA 1M5WA 3T4WA 1V8EA 2X1SA 3LLDA 3AHTA 1PYMA 1DWAM 7TAAA 3EXTA 5IDIA 2BP1A 3U5UA 1SFLA 2EO7A 3V5FA 1ITUA 4GYJA 2J7CA 3H53A 3BZJA 5IOBA 4UOJA 5AYXA 3S6DA 3NZRA 1A3XA 2GJRA 2QEZA 2PWGA 3VGDA 1FCBA 3W7DA 4Z1AA 1A5AA 1S3TC 2YZRA 1S2AA 1EC8A 3PZGA 1WDRA 4OOUA 4HT3A 3NAVA 1Z6KA 1YQ2A 2EPLX 1OCJA 3NWRA 4RNJA 4QE4A 3IJ9A 1I8JA 4Z08A 2P50A 2F2KA 1CPUA 1W3NA 2ONEA 3PTMA 2GGGA 3WDHA 3MT1A 3FDGA 3CWNA 5AHIA 4M82A 4KW2A 3SQSA 3AYVA 3MDUA 3LTYA 3H4XA 2WHKA 3VU2A 3CH0A 1T41A 4AD0A 3WBXA 2FDMA 1SZNA 1W3IA 4J27A 2ZE0A 3K30A 4H8VA 2OELA 4GABA 4MJ2A 1AL7A 3SUTA 1E55A 4ZTYA 1Z8AA 4I6KA 1UWRA 1LQAA 1MQPA 1F76A 1TV3A 4ZCWA 3FVMA 2Z4GA 3QPEA 1VBHA 3SIMA 4DO5A 5MKGB 4IUGA 1ZGDA 3KZPA 4ZODA 3RCNA 1E70M 1XPGA 2YCEA 3IJDA 3E2QA 1Y65A 2WV8A 2XH0A 2XGBA 1KFCA 3WQVA 3FYYA 1VENA 3ZWTA 1D3HA 2H9AB 4F0KA 4EANA 3CT7A 3PPHA 1K8CA 4RW3A 1KRAC 1UHVA 2XGIA 2E68A 1F2JA 1GVQA 3NQ8A 5DCDA 1UJPA 3BW4A 1XGZA 3S2CA 4A29A 4RNFA 2R6OA 4OKDA 1I4NA 4JTDA 4UFLA 4ADSA 2Y63A 4PODA 3WLMA 4O1AA 3TZNA 4KERA 3IV8A 4LAOA 4DM1A 3G1HA 3PBVA 4XAZA 4AD4A 3LRLA 3WL0A 4AZ7A 1VKFA 5IHSA 2XH4A 3DOPA 4Q4RA 4CVUA 3GBDA 1QR7A 1P0DA 3HPXA 1EP2A 1K4HA 4G7EB 4CN4A 3BV4A 1ZFJA 2G97A 1HO1A 2HXUA 2G37A 1K9DA 3KP1A 4L7ZA 1P0BA 4NAEB 2V30A 3AO0A 1VFLA 4BI5A 3U2OA 4M24A 3UCCA 4AZIA 4JDBA 3W2KA 3A24A 3E6EA 2HDJA 5DMMA 1L8PA 4DF2A 3MJYA 3KFTA 3FJ4A 4G8TA 3TOPA 4RW5A 1FWIC 5BMXA 1YMYA 4BQ4A 1G1YA 3A23A 1JD7A 1XLLA 1U5JA 3HURA 3QYSA 3GTIA 4RK8A 1HJQA 3CT2A 4H8UA 4OHQA 1YPIA 4DUOA 1OX4A 2OLAA 1UJQA 8RUCA 5C54A 3B9AA 4HVXA 1F3WA 2PTYA 4I9AA 3LX9A 4K68A 4D8LA 1OFOA 3NL2A 1UPPA 2HBXA 3EA2A 4QISA 1PE1A 3EKGA 1DJIA 2Z27A 2XU2A 2IPWA 1KBIA 4O15A 3FJLA 3I7SA 2EQDA 2WQDA 1EJSC 1LRTA 1E1EA 1KKRA 2SFPA 3GQYA 3N6QA 4RPPA 4WSHA 4MWAC 1C93A 1P6BA 4TX6A 1P4CA 4CD5A 4TV5A 5TF0A 3PM6A 1V3HA 3LCIA 3IJ7A 2G8ZA 4D2JA 5HQEA 3GFYA 3GO2A 4J3XA 5FAGA 3O6AA 5BXTA 1U2YA 4Z2GA 1LP6A 3W25A 2G95A 4E8GA 3O6DA 2QPSA 3T55A 3EWXA 4F9DA 3NQEA 2P3ZA 3KW3A 3PN8A 3OG3A 2ZX5A 4WX2A 1VFMA 2CLMA 1X97A 2HBVA 3APTA 4CLMA 3EOOA 2J8GA 1F07A 1F4HA 3UG5A 4PUEA 1FCVA 3TLLA 2ISWA 2ZUSA 2J9ZA 3DFSA 3UBPC 5CPQA 4W9TA 2OLHA 4RXGA 4GYKA 3PY2A 3ANUA 2PP0A 6XIAA 5HQMA 2W5FA 2Y4SA 2CZ5A 3P5YA 3W1UA 1YNPA 4PUWA 5ABEA 2DSZA 3DG3A 3G1SA 2REQB 2OTDA 4WCJA 1GW1A 1QUMA 3WF2A 3NZ1A 5FEPA 4KFOA 3IAQA 1VF8A 2ZXDA 5EU9A 2V2DA 4JFTA 4LB4A 3N15A 3PZTA 4H00A 3ZLGA 1XINA 1YEYA 3EYPA 3LUTA 3TTEA 2EKCA 2GLKA 4C6DA 4JS3A 3UZJA 3TA9A 4XIAA 1IEIA 4H9UA 1KBLA 1UUOA 3UPMA 1U83A 2CLHA 5D9MA 4KGJA 1X39A 2Q8LA 1W17A 4EACA 3MSRA 5ENLA 1G4TA 1PTDA 1YXYA 3HG2A 4XBSA 2VURA 3W1NA 1XYFA 4CD8A 4BI7A 2DZSA 3MP3A 2NZLA 3BGAA 1XBVA 4H3DA 4HP5A 5ABTA 4AFYA 5A8GA 1J12A 1LL7A 3A47A 3ENLA 4CD6A 3PTKA 4UBPC 3CZGA 3PR2A 5HXMA 3LS9A 4IXHA 4JTKA 3DYOA 3QHOA 4NJIA 1F6YA 1FHLA 1OFRA 4PMDA 2I5IA 3GKFA 1H3GA 3T2PA 3WDRA 4KWSA 3BSHA 4PCFA 4P5UA 3GIQA 3I7RA 1P7TB 1GW9A 2HPIA 1H50A 3L2MA 1QXLA 1NTHA 3IIVA 5DN1A 1WYIA 5D30A 3VIKA 5HBFA 4S3KA 2I14A 3EX4A 4LXFA 3KBNA 4CCDA 4XK2A 1FWJC 1UOZA 4UQ9A 3SGUA 1E43A 3NPXA 1J0KA 3RCMA 4BQ3A 2PB1A 4Q6XA 1C8QA 3UG8A 1WP6A 3NEVA 1WAWA 4AY8A 3N04A 2VOMA 4UMBA 3GAYA 2P10A 2WVVB 3RU8X 1SU5A 1Y5VA 5CJNA 2FH6A 2GL5A 3CU2A 1FH9A 3A5VA 1PWLA 4ATWA 1IWBA 1W9UA 1A3WA 4HSNA 1VR6A 3T9PA 4GQ0A 4GYPC 1BFNA 1RVGA 5IRPA 1B31A 2VDGA 1EP1A 1MXDA 2TYSA 4GY7A 4O4VA 4S23A 1V5XA 1XH1A 3VIOA 4GVHA 3FHAA 4C1NB 4WLCA 1IE7C 1GVYA 1SVDA 3MU7A 4GQQA 2P1FA 4O54A 4XBJA 5LXEA 5C6MA 1FH7A 3RU6A 1JZ2A 2Z1XA 3KWSA 5AC7A 2VXNA 3BDKA 1BHGA 5G1YA 4H6KA 1H0GA 4P7RA 3RJXA 3TQ0A 1EUNA 1IWAA 3NDZA 4POCA 4RE4A 3VZXA 4ZQMA 1R9XA 3MCOA 1VP5A 1A5SA 5CBJA 3V0SA 4GVIA 4KRTA 4M8UA 1CGWA 3MI6A 1JZ4A 4B91A 1OFBA 2ZYFA 4DUXA 5HPOA 1IZJA 2X40A 3O1NA 2YCJA 2ALDA 4FIQA 5DEZA 3VE7A 1CTNA 4NRSA 1GYNA 3GC2A 4DBWA 3BH4A 3SFKA 3QSTA 1W5QA 4DZAA 2TRSA 1E56A 1LDCA 3HO8A 1XYMA 4MADA 3B0XA 2Y8VA 3ZR4A 4PRWA 4IZGA 4ICMA 4IH3A 4FK9A 4B9YA 1EUAA 3WL1A 2YLAA 4R34A 4Q8PA 1W1A1 1T0OA 4UTJA 4XO7A 3EMQA 1OIFA 4M81A 4HPXA 1G67A 1X7IA 4DI9A 3UG4A 1HKIA 4AEFA 1PKNA 1W91A 2A6LA 6REQB 2WJFA 3M0XA 3KAOA 1UR1A 4WZHA 3UY7A 3C2EA 3ABSA 1R87A 1FVPA 4HJWA 2ZTKA 1E1FA 3ZJ7A 4IMDA 1TTJA 1HP5A 3TZFA 5DFAA 4KWOA 2OKOA 2C6QA 4NJGA 3GK0A 3MMUA 1UKQA 4TR9A 4WKFA 4UFMA 1KBJA 1V08A 3H2FA 1H5VA 1SR0A 3W82A 4JHOA 4DEFA 1BYCA 3WJZA 5G1TA 1OT2A 4HNOA 1UZHA 3QV7A 2POZA 1ZCOA 4K8HA 1XIEA 4QAWA 3HG3A 5JH1A 2XG9A 4MMWA 3MUIA 3BO9A 3W1QA 3KOFA 4ADTA 5AKQA 2Z1WA 3B0VC 3NM3A 1JCYA 1ISXA 1WO2A 3MKCA 1LT7A 1EKOA 3QHNA 1LCOA 4O0KA 1JZ8A 1EOMA 3JVAA 2GVJA 4BF7A 3W01A 1XP3A 3FYOA 4C6QA 5D2VA 4AZHA 3L4TA 1BPLB 2X05A 1J9YA 3LSBA 5F4WA 4DELA 1CGTA 2WKGA 4QE1A 1F05A 3OIXA 4NI3A 1Q4NX 2WM0A 4WGHA 3VIMA 5RUBA 2VP8A 2EAWA 2HCVA 3GG8A 1LTDA 3OBKA 1E6ZA 3AXHA 3T78A 4O19A 1VJZA 5FCZA 1MYRA 2FTPA 4G7FA 4PC8A 5CC6A 1DIDA 1JCJA 1H49A 2YL6A 3B8UA 1W54A 2TMDA 1TJPA 2DU2A 3XINA 4DWSC 3SCNA 3EX6A 5XINA 3WSUA 3GUWA 4YN5A 1EHNA 4PSPA 2YB1A 1EO5A 4PMUA 3MHUA 3MY9A 1NVMA 4LYQA 5H8UA 1Q2SA 3R1ZA 1OGGA 2BXZA 3UNDA 3NQDA 3HV8A 2HK0A 2XJ7A 3UESA 2QCLA 1A49A 3U7VA 3S1WA 3W71A 2BXYA 1O6IA 3BZGA 3S83A 4U5KA 1SW3A 4G2DA 3LMZA 4FLQA 5KZDA 3ZWSA 3CO4A 1UH2A 3TYUA 2RJHA 5AECA 4UNLA 2GZXA 3QH2A 1A5MC 2ACQA 1S5MA 4MY1A 5SWUA 1G94A 3NPVA 2V5DA 4DBUA 5HMFA 1R2RA 4BJHA 5IFTA 4TMCA 1KM2A 3W7MA 2BY2A 1TJ0A 1X6NA 1X6UA 4NYYA 4CU6A 3LA4A 1DJQA 3TU9A 4HZ6A 3QF0A 4GIRA 3L65A 4KETA 1WCGA 1LORA 4H41A 3W3OA 1CLKA 1P7TA 3R0DA 3PTDA 4S3GA 2YXGA 1EIXA 5FAJA 3AOFA 3LI1A 3W07A 1RD6A 1JPDX 1Q3NA 3QXBA 1R9YA 1XLBA 1XHGA 3E2VA 3P14A 2NWSA 3L7RA 2C71A 5BRPA 1FCUA 3VFLA 5M3WA 5AHFA 3YPIA 4A3HA 3WNOA 3NQGA 4JIHA 5DO8A 4A3RA 2ZUWA 3PZMA 1F8MA 1DJWA 4GE8A 5I77A 4ZSTA 4DJDA 2PRLA 2WVVA 1YE4A 3QR1A 5T9BG 3VDAA 3HU7A 3IACA 4F40A 4NZFA 4PBEA 3ES7A 4QITA 2O9RA 3CZLA 1TUFA 1JZ3A 3AHXA 3SBFA 5AN7A 3S4TA 3U8GA 2GSJA 4B3KA 4WJ8A 1XD1A 1WDDA 3R6IA 1NH6A 4IPIA 4A4AA 2R14A 1J96A 1HGWA 2DZWA 4HNLA 3NDYA 4C1NA 2NVCA 2AL1A 1N82A 1VJSA 1KFEA 3DZ1A 1CB2A 2JF6A 3WK2A 2QXWA 1CXEA 2PWHA 2ZFAA 3DERA 4PE8A 4YMZA 4JEQA 4HIBA 1WXYA 5LGXA 2DPEA 2F7FA 2DDXA 3QGKC 4NZ1A 3VCNA 3M5ZA 1FUYA 5ECVA 1CIUA 3PAOA 1ZTVA 3NQVA 4HNUA 3W7RA 3GH7A 2YXXA 1F8IA 3QHMA 4HPNA 4XO6A 1MFVA 2XDFA 3SADA 2QMJA 4IX2A 4UCGA 1P0KA 5I2UA 1VCGA 2FZNA 5A6KA 1XIIA 3HTWA 2X09A 1AH0A 1OYCA 5HUOA 4LC8A 3U9IA 3WH8A 3USBA 1DIEA 4NY2A 3RILA 4UFHA 3BWWA 4F3HA 4AY7A 1OT1A 4IPLA 3VIJA 3V0UA 3ZM8A 3WUBA 3SURA 5DY2A 2XWEA 3KZSA 2QNEA 3H22A 4TTGA 3JR2A 3GHTA 4ZVJA 2WC7A 4AD2A 3BPWA 3KLKA 4KT2A 3CH9A 5G2IA 3M6DA 3OW1A 2I5QA 3I4EA 3L4YA 1T7LA 3MMDA 4Y9NA 1OK6A 3L68A 1P1MA 3S42A 3CUZA 3N29A 1QRQA 4IX0A 4FNQA 4EPKA 4Y9MA 5JH2A 3ABQA 1KRCC 4XZIA 2MANA 4TVUA 1FHDA 3W37A 4C90A 4Z2LA 2WWCA 4X0VA 2CCRA 4M6UA 3KX6A 3G3DA 7PTDA 4GGHA 4GC4A 4OJYA 3V0TA 4AD1A 3C2VA 2WSYA 1ZY9A 3VM5A 3DI0A 5U4NA 1US0A 3CL6A 2CLPA 3GS6A 2E6AA 2C15A 3EPMA 1EWDA 4DXXA 5FL1A 3WK0A 3GE7A 3R7MA 1E3XA 3ES8A 1HX0A 3ELFA 4YHGA 3MO4A 4WDUA 1KQYA 2Y7DA 1I0DA 1XS2A 4EE9A 4GGBA 1QNOA 5AYYA 4H01A 4BFAA 4XKYA 5T91A 3TXVA 3K8KA 3UCDA 3RX2A 1XLGA 3TX9A 4H9TA 1KFLA 1U1UA 2WMGA 5HINA 1IQ8A 2GUYA 3VDHA 1W1PA 5BXRA 1K9EA 3WKZA 4BKNA 3P81A 4DXKA 1K8XA 2BHYA 1UP2A 1BXNA 2PMQA 3CBWA 1GK8A 4A21A 4UMCA 2YYTA 1JXJA 1UWQA 2ZUTA 1KWKA 4F4RA 4O1EA 1Q6OA 3CQ0A 5KEZA 4K37A 1MEWA 3M0ZA 2CETA 1DJYA 5LIWX 2V5LA 2WCSA 2EXOA 1R7AA 4LNYA 2GQ8A 3AZRA 1GJUA 3KDOA 3SY1A 3MP4A 1VZWA 5XIMA 3MI2A 2PPGA 4W86A 2AMGA 2X0SA 3C8NA 1UH3A 4U10A 1VFOA 5I0DA 3KBSA 1CENA 1W8GA 2Y24A 1HZYA 5CGTA 2QCFA 5HNRA 4DBEA 4HCHA 3RCYA 1GKQA 4MSSA 4QDPA 3UJSA 1G9HA 1ZJBA 1YIXA 4Y8FA 1YTEA 4XAYA 2YSWA 4JTGA 1HL9A 3R8GA 2D69A 3W6LA 4HMCA 2V8ZA 2Z7KA 1LL6A 2D3LA 3LCWA 2DVTA 3UVIA 3UG3A 3NR0A 3QRHA 4TO8A 4P8WA 5CPMA 1R6WA 4LSBA 1GJWA 1B30A 1TWWA 2JKAA 1PZ1A 1TPVA 4HB7A 4TUFA 3W73A 1UD5A 2FZDA 4IPNB 4W8LA 3LXCA 3GM8A 4LCRA 4UQBA 5BCAA 4YVPA 1K9FA 3EB4A 4LS1A 2FFCA 2BFGA 4X0NA 3KS6A 2H8XA 3TWAA 3ID7A 2OZTA 3STGA 4L56A 2WNWA 4J3SA 2NUWA 1J0IA 1IIHA 4DX3A 1L8NA 2NX3A 3DECA 1IGWA 2ZX6A 3AJXA 4MWAE 5C2CA 1HL2A 3ZQ9A 3AIVA 3IEBA 3PFMA 3PWAA 4WKAA 1E5JA 2Z00A 3I4KA 2PDJA 3FFSA 2W3ZA 4E38A 3V1HA 1TWZA 4D6FA 1CLXA 1UWIA 1Q45A 3GB6A 3QR0A 4M1RA 5D9OA 1K7EA 4R5EA 5C2GA 3SJNA 1XYAA 4QJ3B 1KM5A 1EX1A 2BTMA 1Q65A 3DUGA 1V7YA 3EA3A 3FAXA 4BEQA 3L23A 1OINA 2B7PA 1LWIA 3IIPA 4GIYA 4W7UA 1J79A 1JAKA 1ZRQA 4JTCA 1I2RA 3WN6A 4O50A 1J0ZA 1HKJA 4US5D 3W75A 1BG9A 3E74A 3OOQA 1V7AA 2WVSA 1PB0A 4FA3A 3CB3A 4I8YA 2OX4A 4CNUA 3NG3A 4X63A 4BCEA 2NQLA 3FGCB 2F8QA 4GISA 4JHMA 1JPHA 4GZJA 1KCLA 1UMYA 4JIPA 4RDZA 2G0WA 4CQAA 3BCFA 1U22A 2WVTA 4AZCA 5JIPA 1JRBA 1FWEC 5E0KA 4IPJA 3NQCA 4H19A 3VOJA 3AQUA 1OB0A 4JD4A 3SCPA 4RXFA 2OLSA 2CKSA 3QW3A 2NX1A 1CDGA 4D6EA 1KQZA 4IMFA 1TCDA 1IXQA 1RV8A 1YKWA 1UKTA 3ARZA 4L65A 2DZTA 2YXOA 3VMOA 1L6YA 3LOTA 3GR8A 5D38A 3ONBA 3HGRA 4PZVA 2ZZ2A 4KCVA 5AHNA 5DBUA 1XIDA 1W37A 4ZO9A 3F2CA 4A22A 5EL1A 2PDHA 1RQEA 3S9IA 2BY0A 2OSXA 3PJXA 3QMRA 4KH2A 1S5VA 3N2XA 2G3FA 3L12A 3JW7A 1HQTA 1UQZA 4UTLA 2QDDA 2Y5SA 3GR4A 3WY1A 1VFSA 1YPXA 1TZ7A 1CI1A 1NIUA 3S1GA 5CCZA 3VIPA 4M7TA 4XZLX 4LF2A 4XUGA 1E3ZA 4E3VA 1L2QA 1B4KA 1CXHA 3QLLA 1DPMA 1H1NA 1IEXA 1MW1A 5A1AA 3MV11 3D47A 3W1XA 5FD0A 2DZUA 2J13A 1MO0A 2CLIA 4Q4QA 3F7JA 3F5JA 2YL9A 3MWCA 3SUWA 3BAXA 2JQXA 2TPSA 3QSRA 4JICA 1PKYA 4K38A 4XKMA 2ZADA 3HOJA 2QF7A 5I3FA 4MUPA 4IFKB 5M1TA 4AF0B 1W9VA 2VENA 4O57A 5E9AA 3H2NA 2C0HA 4D72A 3ZYZA 4AISA 1UA3A 3NSMA 2WNQA 1UASA 4CNOA 4JFWA 2GYIA 4R53A 3W27A 4UC5A 1GGOA 1BXCA 3OVRA 2KZHA 4BR1A 3SCRA 1O1HA 5CLWA 1TWSA 1MQRA 1AVAA 3THUA 2QJNA 1H09A 4CGTA 3QVQA 3A4JA 3N6HA 1B54A 3ALGA 4I5XA 5FL0A 3LPOA 4YCPA 1XWYA 1O5RA 3WZ0E