3LG3A

1.4a crystal structure of isocitrate lyase from yersinia pestis co92
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
419
structure length
419
Chain Sequence
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTASSMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
molecule tags Lyase
molecule keywords Isocitrate lyase
total genus 144
structure length 419
sequence length 419
chains with identical sequence B
ec nomenclature ec 4.1.3.1: Isocitrate lyase.
pdb deposition date 2010-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lg3A00
5TAOA 2HWGA 3G2GA 1XG4A 3KHDA 1F8MA 1XG3A 1KC7A 3FA4A 4ROQA 4MG4A 4B5UA 4L9YA 4QG8A 3SRFA 2DIKA 3EOEA 1GGOA 4FXJA 4IQDA 4DRSA 2QIWA 4B2DA 1Z6KA 3B8IA 1S2UA 4B5VA 4B5SA 2OLSA 3EOLA 4L7ZA 4B5WA 3PUGA 2R82A 2E28A 3KTXA 4FXFA 2V5JA 1PKNA 4HYWA 3H6OA 1VBGA 4B2DD 3E5BA 1ZJHA 2HRWA 4L9ZA 3OYZA 4L80A 1KBLA 3QLLA 2VWSA 1U5VA 4HYVA 1S2WA 3E0WA 2KX9A 2HJPA 2VGBA 1O66A 1T5AA 4IQEA 3R4IA 1ZLPA 1OQFA 3M0KA 2XZ9A 1F8IA 4TV5A 2VGFA 4IP7A 1S2TA 3SRKA 1SGJA 4QGCA 1DXEA 1DQUA 1JDEA 3PP7A 4WJ8A 3T07A 2WQDA 3BJTA 4KCWA 4B5XA 3QV7A 3I4EA 1AQFA 3FA3A 2ZE3A 4KS0A 1M3UA 1F3XA 3M0JA 1PKMA 1U5HA 3IS4A 4LSBA 3GQYA 2XZ7A 2BG5A 4KCVA 4JPGA 3QV8A 1PYMA 1F3WA 4KCUA 1UJQA 1E0TA 1DIKA 4YNGA 3GR4A 3QZ6A 1IZCA 1O68A 2G50A 1VBHA 3MA8A 1PKYA 1E0UA 2V5KA 4MF4A 4B5TA 1IGWA 3N25A 3QTGA 2XDFA 2L5HA 3P0XA 4KRZA 1DXFA 1S2VA 4TV6A 3U2ZA 3GG8A 4G1NA 1OY0A 3VAVA 5JVLA 2VGGA 3E0VA 3ME3A 2VWTA 3OYXA 2VGIA 3SRDA 1MUMA 3HQOA 3SRHA 1M1BA 1F61A 1A3XA 2HROA 3LYEA 3HQPA 1PKLA 1O5QA 3QQWA 2DUAA 4QG6A 3OQ8A 3QV9A 4YJ5A 4RPPA 4IMAA 1A3WA 3EOOA 3QV6A 1A49A 4QG9A 1A5UA 2X0SA 4KCTA 3T05A 3T0TA 3HQNA 3BJFA 3EZ4A 3LG3A
chains in the Genus database with same CATH superfamily
4CN6A 3H2EA 3ES8A 2OX4A 3AXIA 1LUCB 4TXEA 3H4GA 4WEVX 3MB9A 4OV9A 5HJLA 3V5OA 1VFLA 1NELA 3W9ZA 1Z6KA 3P14A 3NVDA 3M0IA 2WSQA 3VI2A 1KR1A 3LRMA 1MW1A 2WMHA 3VIJA 4PEKA 3SGGA 4OKDA 3MSGA 4C6FA 1SU5A 2J9ZA 3QN3A 2Q01A 2W61A 4LW7A 4A35A 2PTWA 2VRJA 2G37A 1EQPA 3EWWA 1IT7A 2PBOA 1XD0A 5H8UA 1V6YA 1BWVA 3FXYA 3KVLA 4LEQA 3WENA 3EAUA 1O94A 1J8VA 4RNIA 3T0CA 1DL3A 3PTDA 2BS9A 5H2ZA 1ISXA 3R79A 4F40A 3IEBA 3MP3A 3IGHX 2BNJA 3LD5A 3IPWA 3LGEA 1GQLA 2OWCA 1XLBA 1N8WA 3QV8A 5F2GA 1XBVA 1RY0A 2C13A 5AKQA 3W75A 1TX0A 4WKFA 3SJNA 2OWXA 2D2HA 2AL1A 2RDXA 1X38A 3W88A 2QNEA 3BV4A 2IQTA 3LTSA 5IFTA 4O19A 1T6MA 5FEWA 1H60A 5H1WA 1MEWA 3HA1A 4JL1A 5D2YA 2NX3A 1BKSA 3SRHA 2PWFA 1VFMA 4MAVA 4HPHA 4IFKB 4DJFC 2J8TA 3VM5A 4HYRA 4QEEA 2V5LA 2GJXB 1QOQA 3EZ4A 4HGXA 1AMYA 3CEUA 3KVKA 4GINA 1JZ2A 5A8GA 4D6CA 1A5SA 4D9PA 5M1TA 4CD4A 1JEZA 1QPQA 3VYLA 1DWJM 2ZCGA 5I3JA 4FNSA 3QPZA 2EG7A 3VFCA 2GUUA 1UW9A 1HJVA 3E38A 1GVEA 1LLOA 3R2GA 2Y5JA 2WVUA 2PRMA 4K1WA 3VE9A 1T8QA 3PBYA 4J3XA 3CMFA 2CXEA 3SQMA 2NXHA 3U7BA 1LG1A 1VHNA 3FYYA 3G77A 5T26A 2QCCA 3DIPA 3KFTA 3ABZA 1SR9A 1JG9A 2BGQA 1B3YA 4IH3A 3W0KA 3PVFA 3BCFA 4GRSA 1LTDA 4JKKA 6XIMA 4RDZA 2OYLA 4C6KA 1XS2A 4NNAA 1TPB1 1WXJA 3APTA 4MTVA 2QAFA 2CCRA 2YOCA 3RNDA 3O0FA 1ZZMA 3WF2A 1AL7A 5BXTA 1EC9A 3ZIZA 2GGJA 3N6JA 3CL6A 1U30A 1FKWA 5D9NA 5JH2A 4FHAA 3B9AA 1A3XA 2GQ9A 4G56A 4XZHA 3C8FA 2DT1A 1V3JA 5H6HA 3INPA 3HB9A 4HZ7A 3RK8A 1AJ2A 3RN6A 4RE3A 1ZL1A 3T05A 4BS0A 3R0KA 1TG7A 1U83A 2I56A 3CIXA 5BXSA 1I1XA 1OD0A 4P8VA 1DYSA 5T91A 4UTUA 3MI2A 3CHCA 3WK3A 1TWZA 2WCSA 3JZUA 1RBAA 2O9TA 3KDOA 1MW3A 1IZJA 3L5MA 5C9ZA 4Z42C 3ZJ6A 1XFBA 3VGGA 3QF0A 2VKZG 1DJIA 4ZOAA 3HN3A 5DCEA 5AHMA 3LS9A 1ZJHA 4GACA 4E8CA 3WQFA 4F9DA 2C3ZA 1P0EA 3M1ZA 4PODA 4PFMA 1DTNA 3M41A 3AMLA 3RFAA 4NAEA 1TWSA 4P2VA 5XINA 2ACUA 1BYBA 4U10A 4W5ZA 4BQ4A 3TWAA 1WA3A 5C7VA 4PMXA 3N11A 2BXYA 3G8RA 4MB3A 1V51A 3UY7A 1J6OA 3MA8A 3B40A 4BCEA 4EF8A 3URAA 2QGYA 3BVJA 4GGBA 2XU2A 1VRDA 4W89A 5C70A 5I77A 2JEPA 8RUCA 1Z3NA 3SRDA 4BFAA 1A5BA 2IPFA 4KWWA 3DKLA 3A64A 1YKWA 2CLOA 1YTEA 3B0VC 1KGWA 3N4EA 4JEJA 1MUWA 2XWEA 3KS5A 2OO0A 3KBMA 1KM1A 2F84A 3MT1A 2R6OA 4PRWA 5CKSA 1VEMA 2QV5A 1E4IA 1I1WA 9XIAA 5T8GA 3FEQA 2EG8A 3EDKA 5DCBA 1RCQA 4ATWA 2Z1SA 5IHRA 3NQFA 2ZZ7A 4KRTA 1W56A 4ZGYA 3OPSA 1H7WA 5I5RA 3QHNA 4LBSA 3W29A 5D9MA 1E1FA 1EJRC 1W9DM 1L2QA 3TYZA 3W7PA 4OWGA 1TCMA 4AWTA 1XYMA 2Z6JA 3MZNA 4O14A 1RPXA 1ZCCA 3UG5A 3DAQA 4ERAA 4HHMA 5LNVA 2CZDA 4AD5A 4HHPA 5JBFA 4GJ1A 4XZNX 3UWEA 2NX9A 4Q7IA 2QCDB 1TKKA 8XIAA 1AZ2A 4XAPA 4H2HA 4Y9MA 4GUHA 3IIXA 3N6QA 4BEQA 3LQLA 1LZOA 1VQTA 4IIFA 3DFHA 3GIYA 1IV8A 3R11A 4C6OA 3KOYA 3CU2A 4IMGA 4JHOA 3PZIA 3UU0A 3VDBA 3GHTA 1A5AA 3ARWA 3S5OA 3IARA 5IOBA 2FZDA 3NPXA 1YPIA 4U3CA 5C2XA 3HGRA 1ISVA 1IXNA 1UD8A 1D3GA 2GQAA 1E70M 3Q67A 1WDQA 3VGDA 5I06A 2J78A 1S46A 3ZVIA 3FVMA 3O15A 4B2DD 3VMOA 4FF7A 3WEZA 1U5VA 3G8EA 4J27A 4E2DA 1MDRA 1GQIA 2OGYA 1US3A 4PB5A 4E2BA 3MMDA 3T4WA 1G6CA 2XH0A 4FIQA 1JCTA 3B03A 2E0PA 2Y85A 1GOOA 1PXGA 1M3UA 3T55A 1TPDA 4Q3MA 4KF1A 4OZOA 3B8UA 3UJSA 1DWHM 1P7TB 3ZT6A 3T0BA 4M6VA 1XJBA 2VFHA 4FX6M 3UVIA 2WPGA 3WQGA 3WF0A 4JKLA 3NQAA 3IVTA 5EKYA 1V4YA 1XGEA 2ZUNA 2HBXA 2HEJA 3RG6A 4JNMA 1Z32X 3NO3A 4E3VA 3FW6A 4V33A 4IIEA 1I9CB 4UR8A 3K8KA 1UIOA 4CVWA 3BLFA 2HVOA 3QC3A 4XZBA 3UYCA 1K6WA 1OG0A 4K2SA 2GUBA 1PJ9A 2W9MA 3BARA 1TPH1 3ELFA 1S5NA 1D8WA 5G2IA 1IXPA 3BAJA 1UROA 4O0QA 4Y2WA 3U8GA 3B0XA 2YXGA 1E3ZA 3W70A 2QF7A 4E0CA 3B97A 5LXXA 4ZB0A 3APYA 4JD4A 3WLJA 2X0HA 4LUTB 4AWSA 3QW3A 4HYWA 3BK0A 4D6GA 4FALA 3U2OA 4GIYA 2VWSA 4ADTA 2DSVA 1UOKA 1EEPA 3JRKA 3VOFA 4I6VA 4DBEA 1I2QA 2DEPA 2PI6A 2V69A 3CT7A 5M17A 1O60A 2PUZA 1THFD 1ZP4A 2PDMA 2AQWA 3G22A 4K7VA 3HJZA 3KDNA 2OYKA 3H7VA 4LYRA 3DUGA 3E1F1 1FWEC 3H7RA 2VC5A 2QDEA 1ZJAA 2C14A 4JX5A 5AHLA 4Q8TA 1CB2A 3ABRA 4J7RA 4BEUA 1KTCA 1FWTA 4JYEA 3K13A 2AL2B 4Z1CA 1SFTA 3AIUA 5ABTA 2BVYA 2ZRYA 3QLDA 4S3CA 2XM2A 2E5CA 3PHAA 1N82A 1T7LA 2J8FA 3TONA 3UA3A 2IQ0A 2Y88A 4JTAA 3BXWA 4TX6A 1QW7A 1NF0A 2YXOA 2J27A 1KV8A 1LROA 4TX8A 2ZZ1A 2QJNA 3ZO9A 4GISA 5A8OA 2IPWA 2YL8A 1XYAA 2ZZ4A 3SZ8A 2O4QA 2OLHA 3MC5A 1LUCA 3SSJA 3TYEA 5FD0A 3W1XA 3FHQA 2UY2A 2KX9A 2DGAA 2P88A 4FF5A 5FEZA 2V9DA 3CO4A 5HMEA 1UB3A 1QU4A 1KW1A 4X2PA 1UBSA 4QQUA 4I8YA 4IOTA 1X98A 1U5HA 3U48A 1X96A 3WG6A 4GPNA 2WHLA 2ZA2A 3A24A 4DO4A 4WLCA 1UD5A 2GOKA 3NG3A 4I7WA 3WLIA 3OTRA 4W84A 3V7PA 1ALDA 3Q37A 5E9AA 1XQKA 2XDFA 3SFWA 1L6WA 4AMAA 4AZCA 3TX9A 4O28A 1JCXA 2BVDA 1JUKA 4J3ZA 3C4UA 4GO8A 1GZ1A 5HMDA 3CWOX 3QQWA 5A6JA 3VINA 1PPIA 2IKGA 4ATLA 4UQBA 1AQ0A 3W1AA 3GTNA 3SCWA 1GJPA 4XIMA 3ZLFA 2A3BA 3PANA 3UCQA 1RJQA 3NQ8A 2ZX5A 1DJGA 5DT5A 4Y6GA 2WZIA 2ZXDA 1PCKA 1XGZA 2DH3A 5U7SA 1UD3A 1XLAA 5JXQA 2R82A 1RUSA 1JL8A 2NUYA 5CC5A 3GRIA 4JOMA 4ROPA 2XPKA 4L61A 3G18A 2Z1XA 4UFLA 3NWRA 4WUIA 3ITCA 2YGYA 5FJOA 1B3VA 4OQVA 4V27A 1EDGA 3CB3A 4PUJA 4NJGA 4I8DA 2XTKA 3WQ8A 2EPLX 3SI9A 1VFUA 3LOTA 3CYJA 2ZC1A 2BOFX 4PTVA 5HQLA 3S83A 4AYGA 3BAKA 2POTA 4YXGA 1QCWA 4DXXA 4U31A 4ADSA 1SZNA 3ZR5A 5A8PA 4UCFA 1FCBA 1W3HA 1W1YA 4AG0A 3OGVA 3S42A 3LXAA 2WLZA 3NURA 3PJTA 1SO3A 2QKFA 2TPSA 1HF6A 5DEZA 2X0SA 2PB1A 1EJ7L 3GDRA 1R46A 2FDSA 3DXIA 2JF7A 5HINA 1DJYA 1UWQA 4Q7NA 2X16A 4GI8A 3EKGA 3B9EA 4R85A 1FQ0A 4DB7A 5LZLA 2ABAA 4W9TA 3RDKA 1XYFA 3WQVA 3TDFA 1KFBA 2EPOA 7XIMA 1ZCOA 2G3MA 3MBDA 1XIBA 3KX6A 2GVEA 1C93A 4MOZA 2X7VA 1VFFA 1JDFA 4PA8A 1VJIA 4BF9A 3RU8X 3MBFA 2A3EA 3M0YA 2VZVA 2IUZA 3G0SA 1WDRA 2Z2AA 4GXWA 3FA3A 2EJ1A 1QWKA 3EA2A 1U1JA 3LHTA 1ISZA 4XQ6A 3PZTA 3KCJA 3LHYA 4GK8A 1Y0EA 3WNKA 1ADDA 1GOQA 3RX2A 2WMKA 4UOQA 2BZNA 3W85A 2BY1A 2VHLA 4QLJA 1QNQA 3ARVA 4US6A 5JU6A 4MB5A 2XN1A 1J12A 1CGYA 1L6GA 3PNUA 1K77A 1HJXA 5CC6A 4O1DA 1ISWA 4MKNA 4WOQA 4Q6XA 3O8AA 4O16A 1SJCA 3MWCA 4GUJA 1WZKA 2V2HA 4HPXA 2RFGA 5HPCA 5EA9A 1Q85A 1G94A 4YTRA 3WH5A 5EY5A 1QK2A 1X39A 1TREA 1JI2A 4HSOA 4XTIA 1X6NA 3IGXA 4LUSA 3FLUA 2GVYA 1KGUA 3VNMA 4X9SA 2QUUA 4B92A 2F38A 3LA4A 3B3DA 1FVPA 4G7FA 1EJUC 5B7ZA 2HRWA 3ONBA 4X63A 2AGKA 2QHAA 3G1HA 1ITCA 1A5KC 3S2LA 3BAYA 2HJPA 1PWMA 3TTEA 3APGA 5EBAA 1XV8A 3HPSA 4DPQA 4NZ3A 1UZHA 4WJ8A 2WZHA 3TSDA 7REQA 4KCWA 2A2IA 3FN9A 3ZWSA 1W1VA 2DZUA 1R3YA 3OVGA 1SO5A 4W85A 3IAPA 3UXDA 2ZDRA 1D2KA 3C3UA 2DT3A 2EPNA 3H8AA 3PZVA 1V79A 4PTXA 5LA0A 4N4PA 3COTA 4XIAA 5JVLA 1UWSA 3SECA 2CU0A 4F0SA 1CPUA 1V02A 2PDIA 5GJPA 4R7JA 5AFDA 1XKYA 5CPMA 4MIMA 2Y89A 3WQ4A 1KCZA 2YBTA 3T0TA 2WZEA 4KFNA 4GXMA 4C5YA 3CMGA 1PX3A 5AYYA 1G4SA 1MI3A 2F7FA 4K8EA 3TTYA 3U57A 3WUBA 4FK9A 4XD6A 1GGOA 3MPGA 2XGIA 2DVTA 3GH4A 3E5PA 3PBUA 1WAUA 1OVDA 3BLLA 4XBJA 2WKGA 2Y4SA 1E15A 4A2RA 1I4NA 1K8YA 1LQ2A 1NU5A 4R33A 3HGJA 2CERA 4ZB5A 1LOLA 1OYBA 3G0XA 3LV5A 3O1NA 4XAYA 2P8CA 1BFNA 4WY0F 3W7NA 4AZ7A 3KP1A 3L21A 3TWBA 4KKXA 1E9ZB 2CBIA 2PLCA 3THDA 4ZA0A 1RA0A 2ON3A 3T2OA 3MHGA 5AC7A 1TJ2A 3N9RA 2VX7A 5HJYA 3RILA 1UC4A 2ZZ5A 4C6DA 2YA2A 3AMKA 1WOAA 1PX8A 2EPKX 3V3WA 1XRSA 2FZMA 3NAVA 3HG4A 3LBMA 2E3ZA 4JX6A 4BWLC 1EC8A 4YTQA 4RE4A 4Z0JA 1EL3A 3P82A 3VGEA 4HB7A 3OZYA 1HX0A 2L5HA 4I3GA 2I16A 5AC8A 2C91A 1UIPA 4G6CA 4NZ4A 3L68A 4TIMA 1PHWA 1W8SA 4XBKA 3WZ0E 3PWIA 4HU0A 2ZDSA 3E9AA 3UJFA 4Y9AA 4QSHA 2LLEA 1C7SA 2WWCA 4I6KA 3FA4A 3W1RA 4KMQA 1VIZA 2ZVRA 1O5RA 3WFLA 2YL5A 4MWAA 5LHEA 1E6QM 4MGGA 4WZHA 3DCPA 1UR3M 5JBEA 2CNCA 3DC8A 1NH6A 3GXDA 4XUYA 2YL6A 4IMCA 5A1AA 1XYCA 1IEXA 3VKBA 3WYZA 3UZ5A 1OFAA 3MP4A 1XLIA 3QTPA 4HCDA 4YWSA 4EIVA 2PURA 2J6VA 2C0AA 1XLKA 2PWVA 2Z7GA 2FJUB 2JKPA 4JPGA 4MB4A 4NILA 4AHQA 4Z08A 3GBEA 3TOYA 4DYJA 5A6KA 2J7BA 3VCRA 4C6PA 1NVMA 1XPGA 4KRUA 1XM3A 4B5TA 4QQ3A 3VIHA 1RCOB 1GW1A 1Q2SA 1DXIA 4RDVA 1ZBKA 1B5TA 4S3KA 3LM7A 2JQXA 1NDVA 4BQ5A 5EMJA 4Q33A 2CPUA 3PWAA 2J24A 1IYXA 4OGZA 6TAAA 4Z2KA 3OQ8A 4JTJA 3CPGA 2Z00A 1B3WA 1Z69A 3HFYA 1DHPA 5F4WA 1Z42A 4HYVA 3VIGA 3K4DA 2XIIA 3PF3A 3SY5A 1XIMA 2B7PA 2C0HA 2HISA 4CNTA 1P4CA 3HURA 3SUUA 4F8XA 4JAWA 2V3EA 1X1NA 3ZZ1A 1Q6EA 4L1XA 2OLAA 3CO8A 2E28A 3SN4A 3QGVA 2D0HA 2V2CA 1QAPA 5DY2A 1H7PA 2E6DA 3GXPA 3CC1A 1S2WA 3B8VA 2EKCA 1G4TA 3GXMA 4XTDA 2GJPA 3WQ6A 4AIBA 1OQFA 3KP0A 1B54A 1E1CA 3JW7A 3AHYA 1KM3A 2WMIA 3GTXA 2VFGA 1I0DA 3WNLA 1BG9A 3WK1A 3L4XA 3DU0A 3S9IA 3L4UA 2GJXA 1FFRA 2Q02A 4M1RA 3CQ0A 4QAWA 2ODOA 4DNMA 8XIMA 3E96A 3CL7A 1MZRA 4LB3A 4H4IA 1EGVA 4HNOA 4W88A 2Z24A 3ITLA 3VABA 1J2WA 4LS0A 2G8ZA 3FSTA 1TQJA 4FI4A 3HQOA 1F61A 4O0ZA 4BI7A 1GKPA 3U6WA 1TPUA 4TO8A 2Q09A 1XKJA 4MM1A 3VKAA 1VFOA 4C7FA 1V77A 2Y6ZA 3EMCA 3QZEA 3GIPA 4XG1A 1GZJA 1ZTVA 2OKOA 3L4ZA 1OHLA 4V15A 3TNOA 2E5BA 2OT1A 3QGKC 1OF8A 1K8ZA 5IBXC 1YBQB 4LUJA 4B2DA 1PDYA 1J0KA 2YL9A 4FB7A 3OQEA 3PJWA 1FDYA 4J40A 2Q3RA 3N04A 3CQIA 3POHA 5CGTA 1GQJA 4U2YA 5E1QA 1V8EA 5C8BB 3W7JA 2H3BA 2INEA 4JDBA 5BRPA 1YQ2A 3AZSA 1EUAA 2V63A 3URNA 4QS5A 4ALDA 1F6YA 4HK6A 5RUBA 2VI0A 2PDHA 3TFXA 4LF1A 4LAMA 3QHMA 5D37A 2P3EA 1FP9A 4Q8WA 3THCA 5HMSA 1KLYA 1XRVA 4DXVA 3CZ8A 5F1VA 3USBA 3JR2A 3TCEA 1RZMA 2ZE0A 2ATMA 3CUGA 4NZ1A 3VCNA 4C6QA 1BG4A 2GDUA 4PUMA 3S3GA 4N0RA 1ZQ5A 3K4AA 1XBXA 1IF2A 4M6QA 4PFHA 3WDQA 3B0UX 3OGRA 1KRCC 1AL8A 2PF0A 1MNSA 4XV0A 2PCEA 2YW4A 5DMLA 1E43A 2J9YA 3NGFA 4ML4A 2E6FA 1SPQA 5I7GA 1K8XA 1IEQA 3M0VA 4NYUA 3QFWA 1H63A 4GC3A 3AI0A 1GVSA 4K7YA 2YPIA 1CECA 4ZSTA 3W02A 4QIUA 2BP1A 3U9IA 3NXLA 3S8HA 5CZSA 1H3GA 4A3HA 3UG8A 3AALA 4HMNA 2XJ7A 4L80A 3H2CA 4GKLA 1YXDA 5C7HA 4CQCA 1SUXA 4GNJA 4MZYA 3W83A 4BKNA 4S2BA 1TFVA 2AMXA 1WBHA 3AISA 3W1UA 5DANA 3HV8A 4JNYA 3VU2A 2PZNA 3VGFA 2CLHA 1Z48A 4GG9A 3WBXA 4BQ3A 5FA5A 3QPEA 2OQHA 1WAWA 3P93A 2YZRA 1OCBA 3WY1A 3GR4A 3VOGA 4EWJA 1OADA 1UJPA 1US0A 4ZQOA 3LSCA 4YL2A 4KGJA 4MY9A 1G0CA 4IGMA 4HCLA 2ZX9A 3SSZA 4AQLA 5C5YA 3TQ0A 1A5UA 4DBSA 5AHEA 4GBUA 3SJ3A 5ABFB 3KE0A 4AF0B 4DM1A 3AMGA 1YHTA 3NR0A 3VC5A 4FNRA 3CQJA 4S3DA 4BY3A 4KEZA 3RM4A 3HJEA 4S3FA 3GYEA 5CPTA 1OT1A 2C1GA 1OCNA 3I6EA 1PTDA 3R8HA 3BOXA 3W7QA 4K38A 3ONCA 2WVTA 1QR7A 1DWIM 3E5BA 3W2MA 2VCAA 2G5WA 2YJQA 4YN5A 3M16A 4MZ8A 1GVQA 2WZMA 1S5MA 3WH7A 1YMYA 4AYSA 3UG3A 1YIXA 3QHOA 2FZNA 2DZBA 5I23A 3PP7A 4MADA 3DFSA 4QCFA 1W3IA 3V1HA 1XI3A 5LIWX 4DO6A 3GQYA 2QCHA 3TYCA 5DRCA 2CLPA 1E0TA 4CN1A 1VZWA 3IJQA 2CLIA 4FLRA 5EL1A 4B4HA 5AY7A 2ESCA 4KESA 2BXVA 4ZZ9A 2QVNA 3TLLA 3CUFA 4MUZA 3W7HA 3RX4A 2SFPA 3LPOA 4N02A 1PX4A 1WYIA 4WQ6A 3DH7A 4CD8A 5EMKA 2ACQA 1HNYA 4GY1A 4QJ4B 4JQ2A 5A6BD 2NVDA 4A8IA 2OEKA 4FXJA 3MI6A 3NOEA 4UMCA 3CGTA 3RR1A 2BWGA 2ZUMA 1BWLA 2Y5EA 3UETA 3IRDA 2NQ9A 2H3DA 1U2YA 1BTMA 1M5WA 3VVGA 1W8GA 3ABSA 3LSBA 3AS1A 4GVHA 5AN7A 4NNBA 3RJXA 1HIZA 1REQA 3L2IA 5M3WA 3I68A 3P81A 1JYWA 1E3XA 1WBJA 3CB8A 1ZHAA 3ARSA 4JN7A 4NXKA 4MY8A 3O9NA 3W74A 1DXEA 1J0YA 3PUDA 4O11A 3WLHA 4QE5A 3I4EA 4H83A 3TYAA 5D2VA 4OT7A 5GJMA 4HKPA 4PBGA 3VOHA 1H2JA 2NQJA 4RW5A 5AB3A 3N73A 4GH1A 4YPJA 4KWOA 3ZT7A 1W5OA 1XF0A 4MNJA 2J7GA 2G95A 9XIMA 1AJZA 3M43A 2XGZA 1BF6A 2ZOXA 6PTDA 3N1AA 1P6CA 4LUSB 5MF5A 3ME3A 4LAZA 2CLFA 1U1HA 4IIGA 3UXAA 1PKLA 3R1ZA 3V16A 1T41A 3IJDA 3TW6A 2PLJA 3GSMA 1EP2A 1A5NC 3KW3A 3GTHA 1CTNA 4DWSC 4W93A 1JUBA 4GBDA 2PP1A 4GVFA 1WDWA 3GK0A 4H7VA 3LCLA 2VR2A 1JVNA 4JKMA 1FWJC 3CUHA 4I5RA 2Y24A 2XFRA 1UKTA 2QCDA 2W91A 5KITA 4A3UA 3B8WA 3T0DA 3K1GA 3EWDA 3KL5A 1KD0A 2ISDA 4RCXA 1K4GA 1P1XA 2XIQA 3U5UA 3DGBA 3VO0A 1HKKA 5F2IA 2RHGA 4AIOA 1NJJA 4XZMX 3DBPA 1M68A 4ZOCA 1ITUA 3SQSA 4FO4A 4DLMA 4ZQRA 2A85A 3UCDA 4MWAD 4R9XA 2GOUA 3ARQA 3UBPC 2OSYA 1O95A 4B4FA 2VDHA 4X22A 4CN4A 2ZE3A 5HNUA 2W63A 2G96A 1E0XA 9CGTA 3S6DA 1WZAA 2R1KA 3B8TA 1PDZA 1XP3A 1MW2A 1CEOA 5KINA 2VUNA 3CNYA 4J3SA 2VTFA 4XAFA 2DZAA 3ISIX 2F2KA 3MUAA 1EX1A 1V0KA 1IWPA 3LGDA 5GJNA 3FKKA 1J0IA 3CLMA 4PMYA 2QF8A 3RO8A 2ZYFA 3WN6A 4DJED 2X8RA 5G2WA 2D3LA 1XRTA 3R0DA 1XDMA 4AIUA 1DJHA 1XYBA 3VKKA 5CBJA 1HN1A 1KTNA 3V75A 1M01A 4EPBC 3NQEA 1ESWA 2OTDA 1VH7A 2XFWA 4H04A 3WDIA 1MNZA 2W3ZA 3LHWA 2W62A 2GWNA 4GQRA 4H7ZA 2DZTA 4NAFA 2QS8A 3W4RA 3ZWTA 4U28A 3VIPA 5H8PA 3F2BA 4F0MA 3WDRA 3DFTA 3EWXA 3HPXA 3NZQA 1XSKA 3BUVA 2UV8G 1QO5A 1OD8A 1L9WA 3GFXA 4IQLA 1CGTA 3UGRA 2ADAA 5EMUA 1ZS2A 3MCOA 4PCTA 3DHFA 2QW5A 1J11A 2WJEA 4OHQA 2VEKA 2GJRA 3VD9A 3QYSA 4UFKA 4GYKA 2DVUA 1SZEA 4XAGA 1JPKA 3L2LA 4KW2A 3BDKA 1PIIA 3W2NA 1EFZA 1RP9A 1H09A 2GDQA 3EA3A 3M4HA 2C6QA 2ICSA 1GORA 5BOOA 1E6ZA 5C54A 3BSMA 2ZRUA 5FESA 3QSTA 2BSLA 3WJYA 3GKAA 3KRZA 4HU4A 3EDDA 1WCGA 4RW3A 3W76A 4TMCA 4CCCA 2QPSA 1QW8A 1DP0A 3HMJG 2HTMA 4LXFA 1OFQA 3MVTA 4XVEA 4PR4A 2VFFA 5FAJA 2CITA 2ZADA 4MLRA 3TA9A 2OVLA 3S1XA 1CCWB 1CZ1A 3NSMA 4TX9A 1AQMA 2OXNA 4ZQCA 4E4PA 2WBGA 3GNOA 3W1TA 3PUGA 2GDVA 3EX6A 1R87A 3M6DA 2Y8VA 1GTHA 4H9ZA 1G9HA 2J25A 3A5VA 3W37A 1XINA 4X0VA 4RNJA 1NQKA 1NWUA 3STGA 1LJYA 3I7QA 1WKFA 4HHLA 3UEQA 4KEVA 3VNLA 3A12A 4OV4A 1EPXA 3S1VA 3SAZA 1UZ1A 1FH7A 3WNNA 1D9EA 2R1NA 1SGJA 2C7FA 3VX0A 3LZ3A 4QX4A 3AIRA 4GUFA 4Q7BA 2JF6A 1XW8A 1XUUA 1DIEA 4S3AA 1EBGA 2D20A 1JRCA 5LNUA 5C0QA 1TPWA 4L5ZA 1F5ZA 2XUCA 1IZCA 1XXXA 1T8XA 2FJKA 3WEOA 4A29A 3U2ZA 3MUCA 4R7OA 3WQEA 3OYXA 4JCMA 3DFYA 1D3CA 5EBUA 4Z2JA 4AZHA 4C6EA 2CW6A 1KGXA 3MS8A 1CLKA 3P67A 1KKRA 3GO2A 3HU7A 3GWQA 4NL1A 5IHSA 1UG6A 2QPUA 3KLLA 1KC7A 1BQGA 4ROQA 4ZMGA 4O4WA 3DI0A 3UXIA 4EAYA 3BLIA 7A3HA 1NSJA 4U2ZA 3S47A 5KMYA 2YDRA 3SDOA 2J47A 3KXQA 2PDKA 3B04A 5LNSA 1GYLA 2D22A 3BAIA 1QXLA 1NF7A 1GCYA 3AZRA 4IF2A 3RPMA 3B06A 1UD2A 2V38A 1E4MM 2Z1BA 4IFKA 3MVIA 4K1GA 2X40A 1UYQA 4H9MA 4IPIA 3BLOA 2P50A 3ARYA 4PBFA 3QQ1A 4YYFA 3UJ2A 2PPGA 4Y90A 3P8IA 1MVYA 3KEHA 3IUIA 2J75A 4IPJA 2EJAA 4JBRA 4C6NA 3UWQA 3OVRA 4YLWA 4HPGA 3KVMA 1H11A 2W79A 4JS3A 3GXNA 4QM1A 2XISA 1S39A 1TO3A 2NWRA 4XAZA 4JIHA 4KRZA 4Q8QA 2ZICA 4L1GA 2VC6A 1SZGA 1GUVA 4K8HA 3ITTA 5CAKA 1A3WA 1RAKA 4D1IA 3OBKA 1GT8A 1BRLB 2Y8UA 3AIQA 4UBPC 2G0WA 1BWKA 4IHCA 4LCSA 5FL1A 1WB0A 1FUYA 2O7QA 3DKJA 1F8MA 3W7EA 1DJNA 1K9EA 3Q4DA 4B5UA 2Y2WA 5I0DA 1GPWA 3SRFA 3TROA 1FHVA 4HNLA 1AW5A 1R9ZA 3SURA 2QIIA 5L9FA 1VAHA 1W1B1 3M5YA 3RR4A 1LF1A 2CHOA 5K4ZA 3CHEA 5D02A 3S4TA 3B0PA 4S2CA 4R34A 3UGVA 2V3GA 3TEVA 2VZTA 3CUZA 1GG1A 1SO6A 4FX8A 2CIPA 3ANUA 1BEUA 3AHZA 4X60A 3W7LA 3NSXA 3B4UA 3OB8A 3KBVA 3EPNA 4LGXA 2YA0A 1TVLA 1XRFA 3ES7A 2YSWA 2HE8A 2R1LA 3O2LA 4C91A 1XLGA 4H1ZA 3UPBA 2VJXA 3EDEA 3NJ3A 4IPLA 3GTIA 4HNNA 3NO5A 1XLJA 1M6JA 3TAKA 5IDZA 1R3WA 3IVUA 3F2CA 1G7UA 1PE1A 2ZRVA 1M7JA 5M03A 3O07A 5FEPA 1Q6FA 4HK7A 4L6DA 1PZ3A 3MYPA 2ZA3A 2A1YA 1E5NA 3TUUA 4WSJA 4F3HA 2RUSA 2VWTA 1A50A 5MKGB 1MW0A 2EO7A 2VQTA 3AFBA 4Q4KA 3LYEA 1W3NA 2GL5A 4A3RA 1ECQA 4W7VA 4A3YA 3MZ2A 8TIMA 2NLIA 2ZWYA 5ECVA 4K37A 3Q2DA 3TN6A 2DQXA 3WF1A 3LK6A 1RJRA 1GOXA 3N2TA 1N7KA 1UKQA 1ZAHA 1OFEA 2GQ8A 2P53A 5IBXA 2W67A 3CM4A 4AXNA 1W3JA 3TSBA 5CJ5A 1AFSA 1HKMA 2YFNA 2PDYA 2HK0A 3C5QA 4B9ZA 3HZ3A 3M0KA 4M81A 1MWOA 3WLKX 1V0NA 2VM8A 2NVAA 4GZJA 4HSHA 3VOJA 4BHYA 2VRKA 3EYPA 3W1PA 4PMNA 1FHDA 1HO1A 1XDLA 3G1YA 3A4AA 2XVLA 1Z89A 1D8CA 4GC4A 1ZRQA 4KIEA 3VOCA 1E4NA 3IJ7A 4Z2IA 2I17A 3OZOA 1ZJIA 1BHGA 4A2SA 1YE4A 1TIMA 3N25A 1IIGA 1SFSA 1S2VA 4IM4A 2HE5A 1UD4A 3SCUA 1XICA 2BBFA 2PP0A 4AD4A 1MUMA 2ACSA 2G3JA 3AU2A 4DEFA 3TJIA 2I9UA 1CENA 1CWYA 5FF0A 5D09A 5ABHA 1VBJA 1R86A 5CSUA 1Q6CA 3G2GA 1EPVA 5HBFA 2PDJA 3HTWA 1F3EA 1TV4A 1W37A 2VUYA 1FP8A 3N18A 2D3NA 4PCPA 2FZBA 3GYCA 1B3ZA 3L2MA 4AISA 3QXBA 1R47A 3VE7A 1H61A 4UTTA 3BG5A 1J0JA 4WKAA 3I65A 4D6JA 2MUCA 1B4EA 1WXZA 2BVTA 3W2JA 1GYMA 2NV2A 1HJUA 4GY0A 2CHNA 1IEWA 2XSBA 1PWLA 3IUHA 4GFIA 4ZO6A 3E02A 1GVFA 3CHVA 3IIVA 3LGGA 4J3TA 4H8VA 3I6TA 2E1DA 4HD5A 4GE8A 4GABA 1K7EA 2GGGA 1IT0A 1LWJA 2YIHA 1KBIA 5C2CA 1UMLA 3UWUA 1GQKA 4F0LA 3AHTA 2VR5A 4JIIX 3QR0A 3GZAA 2OKTA 4GJJA 3C2EA 3NDYA 1NDYA 3SUWA 3IWPA 3SCPA 1FWDC 3EWYA 4LH8A 2PC8A 3K4WA 2JIWA 5DXYA 4LT9A 4AVFA 3WL0A 3IANA 4DO7A 3ITYA 3VKDA 4HZ8A 3V35A 3CZGA 4AD1A 3G6MA 5CZKA 1MEIA 4H6QA 1GEHA 4HP5A 2WNNA 1MRAA 3HBLA 3WUEA 1TUXA 2PD9A 3HOJA 3GUWA 4MFEA 3E49A 4LWWA 5I02A 2X2GA 3PFRA 4KCTA 1JCJA 4DI8A 3ZVHB 4LV4A 4N42A 1RSCA 3LN3A 1V6UA 3TA6A 3NOYA 4PUEA 3PM6A 4J28A 4PTDA 3EXSA 2PE4A 1OCJA 2OLSA 1E72M 4LYQA 1CXIA 2ATSA 1GW9A 3MMTA 2XSAA 5M2FX 1AUSL 4TVDA 1H4PA 4O12A 1KCXA 1OFRA 4P7LA 3LXBA 2HXUA 1J5TA 4QLLA 3WFAA 1DWGM 3VNKA 2E9BA 4GFSA 3PPHA 5AHNA 2RKXA 4CU6A 3PPGA 3RF9A 5FJJA 3U2CA 4FNUA 1KWGA 2OO6A 3CK5A 3E12A 3NQDA 3BJTA 4RJEA 3SCSA 4CD6A 2WC7A 2PDUA 1PTAA 1R3QA 1Q6LA 5BOFA 2INFA 1EH9A 4UZUA 3MMUA 2FTPA 1UA3A 2AQOA 2BGSA 2WVSA 3TR9A 1FHUA 4A8LA 3OHIA 1WDDA 1H5YA 3HPZA 1UMYA 1B9BA 1JFXA 4H9XA 3WKZA 1Z9AA 3UZJA 2GUYA 3UXLA 3FKRA 2ACRA 3KL3A 3UJRA 4X0NA 2HS6A 3N2CA 2OU4A 5HATA 4JGDA 3GLCA 4ZOBA 4PMRA 3RCNA 1OGBA 2OMAA 5BROA 3LRLA 1BVWA 3FDGA 1TR9A 3M0XA 3XINA 3GZ3A 4DRSA 2B7NA 3TOPA 3M0ZA 2PD5A 5AC6A 4HA4A 2HNEA 1I60A 4K3ZA 4U5KA 2Y7EA 2ZIDA 3N6HA 2EEXA 4IQEA 2OELA 3VIMA 2GK1B 3IV3A 3N15A 3CASA 3L0NA 1MQRA 2PP3A 4BQ2A 2X1SA 3WCZA 1W54A 3KVJA 5CBBA 4JR5A 2DZPA 5D05A 4BJHA 2E9MA 2CXGA 3LHVA 5HJXA 4KCVA 1R9YA 3VKJA 1F3WA 6ALDA 3BG3A 3VOIA 1N2VA 4UTKA 1L6SA 1HL2A 1PB0A 3DGRA 1PHQA 4LU0A 2J8GA 2HCVA 1Y65A 3TC3A 3SB0A 3MO7A 3USZA 1ELSA 1KXTA 4FAMA 5CSRA 1VRXA 4QFUA 5CSYA 3NL3A 1E40A 3KZPA 1TA3B 2DSWA 1S3HA 3HQNA 4UWMA 3KOXA 1US2A 2F61A 1V08A 4WSKA 4NSBA 1IEVA 2OT0A 4Q8OA 3DHDA 3GG7A 1BLIA 3QJAA 5I00A 4K6AA 2RH9A 4ZE4A 3ITOA 1OM0A 4MB1A 4O54A 2OZ3A 3CT2A 1QRQA 3UD6A 2BY2A 3GDMA 2Z0IA 2XFYA 4JTGA 2Z2BA 2PWHA 1CDGA 2WCGA 3W07A 5HMFA 2QV4A 4JDYA 2EGZA 4M6UA 1AG1O 3ABXA 5AC5A 3RLUA 1I75A 4OU1A 1X8FA 1JULA 4GY7A 1DTUA 3NVTA 3R12A 2AOSA 1MQPA 3T8LA 1IGSA 3GXTA 3OBEA 2X05A 5HR6A 4IMEA 1U33A 1W9BM 2PGEA 2WMFA 3CXOA 4H9UA 4YMZA 4F2BA 1YPFA 3BOFA 4XISA 1P6BA 3L0KA 4X2RA 4LVBA 1E1EA 1YX1A 4J2PA 1B57A 2OJPA 3LCFA 3PK7A 3V0UA 4WX2A 3FV9A 1C3FA 2V82A 4J3WA 2Z1VA 1IQ8A 3C2YA 2GZXA 3DN5A 2HWGA 4WIWA 3VZZA 2OPJA 3HPFA 2VVSA 1EJWC 3PZMA 1EYWA 4O1EA 3NQ7A 1SJDA 2YBVA 2ZTJA 5HXMA 2QVHA 1W1PA 2H8ZA 2WYSA 3W7IA 2GPTA 2PMQA 4AD3A 2NV1A 3CQHA 2O4MA 3C0SA 5TQLA 4QE4A 1KXVA 1DPMA 2X1IA 2TYSA 3AHVA 3PNZA 3WJSA 2RAGA 4EVZA 3QMRA 3MV11 4PRTA 1EWDA 3F1QA 3SIMA 1GKRA 5AYIA 3QZAA 4LUYA 4MJ2A 4NJKA 4ES4A 1A5CA 1WNOA 2EHHA 2QQ6A 3LNMA 5HNTA 5A2CA 1WUEA 3BZJA 2FH8A 1G4EA 1QOPA 2PC4A 6REQA 3BAXA 3O63A 1BD0A 4MNMA 1FWHC 3SCRA 3WBEA 5FAGA 3ARUA 2VFDA 4KCUA 1UJQA 4N6FA 2G50A 3HGOA 3OZMA 2X41A 2P0IA 1PYFA 3U7VA 5A5WA 2G4FA 3LLFA 1GZGA 1KRMA 1MXGA 2Y7DA 1MXSA 2YZ5A 5I3FA 2HMCA 4I7UA 1NOWA 4JL2A 4YTSA 2Q6ZA 2HNHA 1UR8A 2C71A 2WLYA 4DAFA 1W9PA 4KFPA 4N9DA 4C6BA 3V1PA 3ARXA 1W91A 4PTMA 5BYWA 3GC2A 3VNZA 4F0HA 1R6WA 3KHDA 1CGVA 4Q22A 4KT2A 2VD9A 5J5RA 3VD4A 4A05A 3RRXA 5GQBA 1DQXA 2GFTA 3HMCA 2XH2A 4L7ZA 4HZ6A 3STFA 1KO0A 3I3BA 3LY0A 4UTTC 1ADSA 3UERA 4L6HA 2BB0A 4DJEA 3TJXA 3PTQA 5C55A 1Q6RA 1ZBVA 4UNLA 5HULA 3S2NA 4E5TA 3MSDA 2V5CA 3NL2A 4WJXA 3AIBA 5D2XA 3S9YA 4LY4A 1X8CA 2C19A 3R94A 5A3HA 3H7UA 1M7XA 3TXZA 2VGFA 1OFDA 1H49A 1A5LC 2DVXA 4PSRA 4P5UA 4HNUA 3QYQA 3V4BA 3T40A 1QJWA 1XR2A 5KZDA 3GNXA 4RNFA 4Q8MA 1L6YA 3UR5A 1LL7A 3V5FA 2FTYA 4PCSA 3VMNA 4WDTA 1FTXA 4M3PA 2ASHA 4PCNA 1LCOA 2PGWA 4P61A 3FK4A 2GLKA 1BPLB 2PGRA 2POZA 3CH9A 2OGJA 3N34A 3LNPA 5CAHA 4NZFA 2EKGA 2VEPA 5A94A 4K8GA 4FNQA 1HL9A 4ZTYA 4UTIA 4QNEA 4QG9A 3P5YA 3XIMA 4IWWA 5JQ9A 4Z1YA 4AXKA 1B3XA 1FFQA 2D73A 1H7OA 1XG3A 1HKIA 4LVAA 1V0LA 1SFLA 1W32A 4ICNA 4DJFD 3LCWA 3AYSA 1C8YA 2ZUSA 1XPYA 3M46A 1C8QA 3LCIA 3RLHA 4DJDD 1LQ0A 4A6GA 2Z7KA 1WUFA 3P7YA 1A0DA 1JGMA 5B7YA 2W27A 4JFUA 3OIHA 1ITXA 1FBAA 3H6OA 3OYZA 1AW2A 2GWGA 1WE5A 2F8QA 4MYAA 5HPOA 2VEMA 5E93A 3GFZA 4PMOA 6CGTA 1SJAA 2J74A 1HT6A 1PZ2A 1S5WA 4LRTA 5IDIA 3W22A 1TV2A 3SCNA 2PDLA 2MNRA 4JQ3A 3E0LA 4JIEA 2Q8LA 1NEYA 3DFOA 2CKRA 3C6CA 1OT2A 1G4PA 2XINA 2QCFA 4DIAA 3CZEA 3F5LA 3FY1A 4C6CA 2WC4A 4E38A 1FWWA 5AHFA 1F4HA 1ISYA 1BQCA 4JIQA 1NTHA 1L0PA 3N2BA 2IKIA 4DYEA 3GIQA 4D2JA 2E8ZA 3WLPA 3KOWA 4I7VA 5DF0A 5D8WA 3KUMA 1C9WA 4IIHA 4O17A 3HO8A 3GTFA 1AH4A 4OUIA 2A21A 3BJFA 3SIZA 1XHGA 3EOUA 5FJIA 1A80A 1A5OC 3PG9A 4WXZA 3GHRA 4NJJA 4QDMA 3H2MA 4I9JA 1K8CA 1JXJA 3B8IA 3E0IA 4LV9A 4B5SA 3BLKA 2IPGA 3GU1A 4H19A 4P7RA 2UZ9A 3IUDA 4OFCA 1XH1A 1V7YA 3IRSA 5BCAA 4UB9A 2WO5A 4MYXA 4JFWA 4FMVA 1XISA 4BZYA 3WQOA 1V93A 1P0DA 1XIDA 3IIZA 5E9XA 3OIXA 3WD3A 4IUOA 3OP2A 1N8FA 4NU7A 4PUKA 4NQ1A 2ALDA 3FJNA 4Y7EA 3K8MA 1GOKA 4JFTA 3T07A 4PMJA 4BI5A 4JN6A 4ZO9A 5G1TA 5LNRA 2IXUA 1ICPA 2BASA 1K7XA 1JCNA 4J2MA 1PTGA 4KWVA 1YTDA 4K39A 4LVFA 3G1AA 1TCDA 1I2OA 4YTTA 1JD9A 4NY2A 3THAA 1F73A 4LS2A 2X7WA 2XVGA 2BY3A 1KFJA 4AZGA 4PMUA 1KQZA 4DZAA 3W2LA 4M80A 4UUIA 1VR6A 4GZ7A 5PTDA 1JGIA 1SW3A 3NA8A 2X1TA 3AIWA 1EP1A 4IGNA 3GR8A 3E2RA 2EBNA 4RZ6A 1C8XA 4Z0SA 2DORA 4RK8A 3C0JA 5CLTA 4C65A 1F76A 5I78A 1AVAA 1XX1A 5HQMA 1Q8JA 3I4KA 4L6OA 3F03K 3M47A 3STCA 3S1GA 3UYIA 3ARPA 1KB3A 2D69A 3EOLA 3GC4A 5CLWA 1TWWA 4QCEA 2YCJA 3N3TA 2JBMA 3GKFA 1JZ7A 4H00A 2GSJA 1TQXA 2A7RA 2YA1A 3NQBA 1LLZA 4CQDA 4DJEC 4L64A 2XIOA 2DY3A 1O5KA 1M7PA 3K5XA 1A3HA 3AXHA 4XO7A 4IP4A 1Q6GA 3S5YA 5C2GA 2QDHA 3BZGA 3BPWA 4N9EA 5A6AA 5A6BA 1KKOA 2G41A 1Q7ZA 1BYAA 1VCFA 2WANA 3IIPA 1JZ3A 1XLDA 2OFJA 1G7VA 5I03A 1DWFM 5I3IA 2YDAA 5C9WA 4TTGA 3AO0A 2NQLA 3RCMA 1UWAA 1O68A 4GXPA 3F4VA 1IGWA 3OHMB 4Q6JA 1WZLA 2RJHA 2NLYA 1KBBA 4X61A 2GVLA 3VAVA 6REQB 3PG8A 1BAGA 2ZTKA 3VD3A 2ZUVA 1E0WA 3B8DA 4ZTXA 1Z44A 2E67A 3W82A 2BY0A 1IWBA 3FYOA 5E09A 2EPMX 1TPEA 5A69A 5FCZA 3KOZA 2R1MA 3CZJA 4WY0B 4Q32A 1DIOA 1YLVA 1ECEA 5CXPA 3AMDA 1FKXA 1J2BA 3EX2A 5LIYX 2YB4A 2WCAA 4JICA 1JPHA 1QOXA 3VILA 5K7JA 3WBAA 5CPLA 5TF0A 2PGFA 1UKSA 1M41A 4Z2LA 3CV7A 3RO6A 1LRTA 2OOFA 5G4WA 3IIOA 4ACZA 4JXCA 2YB1A 3LX9A 2D0FA 4RXFA 3ZSSA 3TQPA 3H53A 1UA7A 3CTTA 1JPIA 1Q4WA 3SUTA 4IP7A 1XCXA 2C15A 2QJIA 4DYKA 1XLEA 1L8PA 5D9OA 3UNDA 1CXKA 3S6OA 1TTIA 1GWJA 3LI1A 4E2OA 1JXKA 5D8ZA 3CH0A 5EMLA 4JY9A 1E71M 4YU1A 1ZB5A 1L8NA 3EX1A 2ZRXA 4DAIA 2FZ9A 3RPTA 3T2PA 1VKFA 3W7KA 1FA2A 1AH0A 1B1YA 2JIEA 4B90A 3G24A 3EB2A 2V67A 2WVVB 3HQPA 4PSPA 3WELA 3PSWA 3NQ6A 1BXNA 4EPDC 4DN1A 3WD1A 5T9CE 2WOQA 5MHBA 3WF4A 2X2YA 4I9AA 1BVZA 1U1UA 1ZPTA 5BNKA 5KETA 1CIUA 3KAOA 2CZEA 3CWNA 2DIKA 3MCMA 3H55A 3AMCA 3W7GA 4XUGA 1MMFA 4PMDA 1C91A 3OA3A 5IM51 1CLXA 1X6UA 3YPIA 2VDIA 4M19A 3WLOA 5IFPA 3AUOA 4FP1A 1LM1A 1B4KA 1GNXA 1WDPA 3T81A 3GAKA 5FOOA 1ZBCA 1TMHA 3AJ7A 3W25A 1UKOA 2F2HA 3BCDA 4I90A 2V68A 4H8HA 1DBTA 2ZX8A 4OBRA 3EEZA 3EMZA 2OZ8A 4UQDA 5I6SA 3EXRA 4ZXOA 4IX2A 4HJFA 1S3TC 4AEFA 5F7UA 1R5YA 4LAKA 4CQBA 4GOAA 1XWYA 4LNCA 2V5KA 4I9MA 2VX5A 1QK0A 3L12A 4WOZA 1A4MA 3II1A 2HQAA 1J93A 2WHJA 4TV6A 4XZWA 4V1YA 3G1VA 4DO5A 1EXBA 2PU0A 3A3HA 3KRSA 4IJCA 1REQB 3AIVA 2J7CA 5TAOA 4PRRA 4IXHA 4Z2HA 2Z26A 2JGQA 4DWSA 1VEPA 3AXMA 5JH1A 2A3CA 4A4AA 1OJXA 1NARA 4B15A 5FF2A 4WRHA 1GHSA 1I2PA 1JDDA 3CAWA 2WKLA 4QISA 2RDWA 5DBTA 2YCLB 4F9JA 2GJNA 5C9XA 3UT0A 2VX4A 3PY2A 4HNVA 1W9UA 4FOKA 1UR2A 2ABBA 3AWNA 2VGBA 3FJ4A 5CQ1A 3Q65A 5D32A 1PAMA 2HVNA 2YBUA 4WK9A 5LIXX 3RJYA 1E6SM 1CX9A 3CTLA 1WX0A 3WDHA 4TR9A 3P80A 4OUEA 3DYOA 1ZU8A 5G1YA 3HPAA 1TZ9A 2VR4A 3LTYA 4EANA 3O6YX 3WLNA 1RPKA 1EO7A 3ZMRA 5FJUA 1K9FA 1YBQA 1OK6A 3KWSA 4NG3A 1UR4A 2R24A 1GONA 1F9CA 4E8GA 3OGSA 1CGWA 1U5JA 1AJ0A 1H1ZA 2B4GA 4INFA 4UQEA 1UBPC 5D2TA 3QVQA 3O05A 1EF2A 1EJTC 4IG2A 3DFNA 3W1LA 1RR2A 2H8XA 2UWFA 1IEIA 1SQ7A 1YDVA 2ZFAA 1P43A 1R30A 2WKJA 1HVXA 3PAJA 1MO0A 4LVDA 3UF9A 4MFDA 3I3DA 3GDBA 1KRBC 3GW3A 5MKGA 1UOZA 1O12A 1QI5A 1XBYA 3CPUA 3MSRA 3BICA 5BWAA 2NUWA 5CPOA 3WQ5A 1ZAIA 2NW0A 4LYPA 3FIGA 1HJSA 5FACA 3NZPA 2DIEA 4N4QA 1TRIA 1RY8A 3ZT5A 3W24A 1P0BA 1CNVA 2J4GA 1I2RA 4JTKA 3RPDA 1UUQA 2FPYA 3EDJA 3EWBX 3T4CA 5DMYA 1VFTA 3URQA 1GVIA 2D23A 4MKVA 1EO5A 4GX9A 2FKPA 4RPQA 5KSWA 3SO7A 3QLLA 1KFWA 4H7CA 2ZRWA 4KH2A 1YDOA 4FIRA 2OWWA 3BGJA 1TWDA 1HJWA 1WXYA 4F4RA 2I9EA 4GIEA 4CNOA 1QI3A 1JF5A 4GI9A 2DZVA 1FXQA 4Q4RA 4BWLA 2J66A 3T9PA 4N9CA 4QTGA 3WSUA 4DUWA 2QPXA 4ZODA 4AAJA 1ZUAX 3GH7A 3RLVA 4CNSA 2B7QA 4PUWA 2CLKA 2X09A 3RRAA 2OSXA 4EPEC 4O4VA 4M7TA 2ZX6A 5DMNA 1E5JA 1KA9F 1SO4A 2IQDA 3BW4A 3H2AA 3STEA 1Q2RA 2BFGA 4YJ5A 1LL4A 1PL9A 4BK9A 2E68A 4H3DA 4ZE5A 4WDUA 1CXFA 2VOMA 3VZXA 4X9YA 3UR8A 4AEOA 1V7AA 1XG4A 1OSEA 5CCZA 3WUGA 2PDCA 4A8RA 4L9YA 4HBKA 2I14A 3WQWA 3A5FA 1FWIC 1OZQA 4HMCA 3N14A 4EXBA 5K9XA 1DOSA 1CGXA 2WBKA 4URIA 4AW7A 3WO8A 1MYRA 4C1NA 2CZ5A 2ZWZA 4AVNA 3W71A 3G1XA 5ECUA 3A21A 2OSWA 1RK6A 1OEPA 4L4MA 4LC6A 5HK4A 3HM7A 5AZ0A 1E0VA 1WKEA 3P6LA 3W7OA 2FVMA 1NWRA 3N4FA 1YPXA 3NCOA 1MFVA 4AU0A 3OA5A 2D2OA 1ADOA 2WHMA 4IIDA 4XO6A 4MWAB 3RHGA 3BO9A 3VX1A 2TMDA 3EWUA 3VMPA 1DIKA 1HW6A 4M0XA 5CZJA 4Z17A 4PE8A 3KRUA 1J10A 1W3KA 1OFBA 3P74A 4O0KA 2HXTA 1HKWA 5TBOA 2WJDA 2J13A 4AX7A 1PEZA 2E8YA 3TC6A 1MUCA 5ABEA 3PS7A 4C90A 5D33A 4P7NA 1LWHA 1M03A 1O5QA 5E0CA 2DUAA 3G1FA 2VCCA 3RM9A 4EK7A 3MY9A 1XCFA 4HIBA 3PR2A 2FIQA 4AH7A 1R3RA 3UWWA 4Z1BA 3BURA 1VEOA 1UCWA 2W66A 4IIBA 4ZQPA 4E6MA 2DT2A 3VC6A 1E9LA 2BXZA 3R25A 3NZRA 4LFYA 2NQZA 1KBKA 5I24A 3VDAA 4JCLA 3PSVA 1UR0A 2VENA 2XIJA 5A95A 3NEHA 1JDCA 1KM2A 4R5EA 3C86A 2WAGA 3TTSA 4MAZA 4NZ5A 2JGYA 2A7NA 4XBSA 2WC3A 4H41A 2NX1A 4LBRA 3VXGA 4C6IA 1XIEA 4AZBA 2WXDM 3TN3A 4D71A 3T7VA 5LGZA 3TW7A 4G2DA 2PTZA 3HG2A 3R4IA 1VPXA 1MZHA 1DQWA 5M5DA 3N12A 3R58A 1VFSA 4M82A 4OVXA 3H2NA 1POKA 4GWEA 4FR6A 4L4OA 3FYPA 4RE0A 3WJZA 2EF9A 4W8AA 4C7DA 3S5SA 4UQ9A 3S2JA 2R94A 7TAAA 4AC1X 1XH0A 3OO2A 5BMWA 4DUOA 3UESA 2XH7A 4QR6A 1H62A 1M1BA 5ABFA 1Y8BA 4RZ4A 3ZLHA 1D3HA 2OR2A 3PJUA 1TJPA 3TMQA 1RBLA 1H41A 1W9VA 4H8NA 3MQTA 4MPQA 3L9CA 4N6EA 4W86A 3B9OA 3LQGA 4WGHA 5FF3A 3IK2A 1ZENA 4H9YA 2A0NA 6TIMA 3ZLGA 2GJLA 2WSPA 4M56A 3EB4A 2QYGA 4B16A 5FI8A 3W26A 3AXKA 4GI4A 4O1BA 3T08A 4JTUA 2GYIA 3H54A 5GNXA 1QW9A 3DOPA 3MTWA 2PDPA 3BJSA 4AY7A 4U4MA 5BRBA 1K3UA 2H9AA 3ARRA 5LNWA 2Y63A 1CB7B 1KM4A 1VHCA 1BXBA 1FXPA 2WVVA 1P48A 2C16A 4LVGA 4GJIA 5BWFA 3PZNA 1RD5A 1WKYA 3BW2A 4DQWA 1I6NA 2X30A 2Z28A 3C2FA 4FLOA 5FJTA 4CEXC 2G3FA 2OQYA 2E6YA 4NRSA 3AS0A 2GVJA 3R10A 2PU1A 3V36A 2TSYA 2WNWA 1IIHA 4JN8A 3RIKA 5TNVA 3CQKA 3B9NA 4JQAA 5D03A 1HL8A 5FF7A 4GO9A 5I07A 4NZCA 4JTFA 1J0HA 5FEXA 1ZP3A 3P0XA 4REQA 4NJIA 4G1NA 3PULA 4PULA 4RPPA 3N13A 2W0UA 1VC4A 1UPMB 1M7OA 4JTCA 1XLLA 5FJRA 3TIMA 3WMCA 1EJSC 2NVCA 3LG3A 1R3VA 3BANA 3O7UA 3NIYA 2QUNA 2PTYA 1EWEA 4JTSA 2CETA 3WDPP 4YWIA 4TTUA 1V3HA 3LI0A 3FCPA 4W7WA 4M8UA 3IAQA 2VVNA 2XIBA 1B3OA 2WK2A 3ABOA 1XLCA 5REQB 4FNTA 3E2VA 4C1NB 5A6MA 1E6NA 5IRPA 3D47A 1JNEA 3W86A 3UY8A 2QJMA 4NP7A 1ZNNA 3BSGA 1HGYA 2CLLA 1KBLA 4F0RA 2DIJA 3L5LA 1OX4A 1ONWA 3IV8A 2HPMA 4QROA 5AVNA 4PBEA 2O7SA 4GGHA 3M5ZA 3ZR4A 4R9OA 1BSLA 4UCGA 1TPFA 1P1MA 1Q66A 1YTKA 3OU8A 1F3XA 1LT7A 3BQ6A 2OODA 5ABGA 3TCSA 2YYTA 4GQQA 3BGAA 5HR7A 3DC0A 3QRHA 5A6SA 3QZ6A 1G69A 3KBNA 4OBTA 4NZJA 3NZ1A 5T9BG 1W1A1 3G1SA 3L67A 2J79A 5F2LA 2IS7A 1PCWA 1MQQA 1MRQA 4EX4A 1Q63A 4E3TA 3UXKA 5BU9A 3VNDA 5FSDC 1XSIA 1RQHA 2BHUA 3KCOA 2WMJA 2FGZA 4RUBA 3QV6A 1LL6A 1FWRA 3BE7A 1XDJA 1W9XA 3AYVA 2WJZA 1XC4A 2GGIA 2Y7FA 4HVXA 3W23A 4OBSA 5JBDA 2VFIA 3WL1A 2BHYA 2QEZA 3C2VA 4IQDA 5SWUA 1F6KA 3TYUA 1IR2A 3M07A 4PL1A 3SM0A 4NYYA 1EZWA 5A8MA 2FPTA 3ZXWA 4ECLA 4Y9NA 2DZSA 4P8WA 3PFMA 3D46A 4V2XA 1WP6A 4CD7A 3V0TA 3MUZ1 3ID7A 3VTRA 2E1WA 2PTDA 2VEFA 5E6YA 3GDTA 3GVVA 4IMFA 4ZR8A 5I09A 3QC0A 4HT3A 3NZGA 3OEXA 3T2QA 1BRLA 1XD1A 1BGGA 2XZ7A 4UC5A 2CBUA 3ERPA 5HANA 3V18A 3W7MA 1GVYA 4B3ZA 5JMUA 4YVXA 3Q45A 4MUPA 3ARZA 3A3XA 3DZ1A 4D6IA 4ERGA 1J5SA 3GHSA 3O3RA 2I7GA 5XIAA 1E1CB 4XVDA 4D6DA 3HV9A 1ZFJA 4MPKA 4FLQA 2VZSA 1EQCA 4TQTA 1QPKA 3FDKA 1KV5A 4PZVA 2NSXA 1VLIA 3VM7A 3H70A 1KWKA 1ODZA 3B05A 1EDQA 2WM1A 4AWEA 3AICA 1UWRA 3WH6A 3EOEA 4D6FA 2AQVA 1YDNA 4HPNA 1O7AA 1Q4NX 4HA1A 4KEMA 2QJHA 3RYSA 2CHRA 3WLRA 1F6PA 2PDXA 4RV8A 1NWTA 1OB0A 5H91A 3WX7A 2J7DA 1JYVA 1VCVA 2NSOA 1T5AA 4NUWA 3MDUA 3M0MA 4TV5A 3SQLA 1Q8AA 2VX6A 1M65A 3RGTA 2TRSA 1J0ZA 3T09A 2VURA 2WQDA 1T0OA 1LORA 2HS8A 2J6XA 6XIAA 1JQVA 4LSBA 3TR2A 3ATYA 1FCVA 1EF3A 1TE1A 3TQKA 2QLYA 4C60A 1BSIA 3B9DA 1PYMA 1SZFA 2GK1A 4IFOA 1PUDA 5BOEA 1OCQA 3H2OA 4HTYA 4PYSA 3LUTA 4CUCA 4GCXA 4DM2A 1TV5A 2AAAA 5HQEA 2YW3A 3NQVA 4TMBA 5GVJA 5D38A 1FRBA 2CLEA 4MZ1A 3ZSTA 3NSNA 5EB8A 3F5JA 4O50A 3SCOA 3AUJA 3QY8A 1YDYA 2Q8XA 3S5NA 3KBSA 3C2RA 2NXGA 3HG3A 2Y70A 3L7RA 2KAUC 4NX5A 3W7RA 2ZRZA 2PDFA 2I5QA 4B5VA 4UFJA 2Y8KA 3RITA 3CIVA 3IJLA 5CPSA 1V03A 1UH3A 3ATZA 3EDFA 5A6LA 1CBGA 2FHFA 3L4WA 3RCYA 2NXIA 1YNYA 1E9YB 2VNCA 1XYZA 2G97A 1W5PA 3MSYA 5I3KA 2O9OA 1O1HA 4DBWA 1ONEA 1M9HA 1ME8A 4ICCX 1QPOA 4Q4MA 3GNRA 3W84A 3ZR6A 3ZS4A 1TVNA 1L6FA 2O56A 2EXOA 2BDQA 1UUOA 4GQ0A 3BW3A 4EF9A 1SMDA 4DWSD 1TJ0A 2DDXA 2P76A 3ZFHA 3D3AA 1T40A 3WBWA 1JUEA 5DO8A 4W5UA 1YRRA 3TTOA 1OFOA 5A6TC 5C9UA 4EAMA 1QASA 1EP3A 4U33A 3SN0A 4F66A 1W1IE 1UWTA 5EMYA 1V6TA 3C3NA 5KZEA 1XIFA 4PMZA 4RL3A 2FPVA 4EXQA 4PL2A 3SUVA 3EEGA 4CKQA 5DRIA 1AA1B 3AWOA 4YS1A 4HN8A 4CLMA 5CG7A 3QEZA 4QG8A 4S39A 4L9XA 3C2OA 5E70A 2VYOA 5AZ1A 1X7IA 3G5EA 3W00A 2E7FA 2GQ3A 1BVNP 3FS2A 1G5AA 4Q8UA 2V3FA 3P2VA 1QT1A 1GK8A 1JAEA 3E74A 4O57A 3FFSA 2DFAA 3T78A 1PKNA 1ZJBA 4M1BA 2XWDA 4MDOA 2B0MA 4Z1DA 1ODUA 2X42A 4NHVA 3VD5A 4S1FA 3SGZA 4AF0A 3CS2A 5AVHA 1VPQA 1YXYA 3UVAA 2B81A 1DIDA 4RV3A 3D3FA 2R9RA 3UQNA 2WWDA 2INZA 3OG3A 1W0MA 3H2FA 1K7FA 4ZL1A 2QJGA 1PBGA 3RXZA 4LTSA 6A3HA 3CZKA 3VDCA 3IJ6A 2E40A 4RDWA 4IJRA 4O53A 1HUVA 4YNGA 3M64A 4C6LA 4WKHA 4S3GA 4ENLA 5K9CA 3H12A 4YIWA 1QBBA 1E55A 1YADA 3IGUA 2FTWA 1XLHA 3OVPA 3R89A 3RUBL 3N2XA 4WVXA 1RALA 3O6CA 2YXXA 1GJWA 3DHPA 3F4CA 2YCEA 2UBPC 1W5QA 5EMMA 4O13A 5REQA 1W6TA 1JJKA 2OZ0A 2C1HA 1AW1A 2PAJA 5KTLA 1XIHA 1GOMA 1UWUA 2ZUUA 3KLKA 4IQJA 1ZALA 2G3IA 1KLZA 2YLAA 3U2EA 1SSGA 3R8GA 4F48A 1LRQA 3VA8A 1G1YA 4J4KA 4AEEA 5B80A 4UTWA 4LQ1A 2CLMA 3F4WA 3P62A 3U4FA 5HWNA 3SCQA 1TPVA 1BXCA 1XIIA 2NUXA 3UR7A 4ZVJA 1V6VA 1R2SA 1E51A 3BAWA 1CI1A 3AYRA 5K9DA 5EPDA 1OF6A 3UCCA 1J6PA 1RK5A 5HUPA 3A22A 3DECA 7ENLA 1S2TA 4IJBA 4OOZA 1FWFC 3FAXA 1XLFA 4LBUA 2F9RA 4J9JA 4DVOA 4UTLA 3MV01 4F0KA 3GU9A 4W8BA 3WD2A 2QCNA 3H24A 1GOWA 1OX6A 4CEUC 2R14A 1RQEA 3GHUA 2X1RA 4JTTA 2YDSA 1WPCA 1OGSA 1EZ2A 4PTNA 5LSMA 2O0TA 4AX6A 4XD5A 1W17A 4GHRA 4XB3A 3GNPA 1O4UA 3ALFA 3KTCA 1S38A 2Y62A 1S2CA 3VK5A 1TIWA 4MWAE 3TYDA 3B4YA 4KPLA 3AXXA 3TP4A 1DVJA 2VQUA 2IPJA 3PC0A 4DY1A 4FEZA 4L1WA 4JTRA 3W73A 1FY6A 4Y9OA 1H50A 1V02E 3NPVA 1OINA 4QJ5B 4JFSA 4HQVA 1JPMA 2A4AA 5I3HA 1I0BA 5D04C 5D4YA 2J9XA 1QATA 1LBMA 2R91A 3WF3A 3QY6A 3FAWA 4DBUA 4GLEA 4CD5A 1HZYA 1CLVA 3GAYA 1I2NA 4W4QA 3PN8A 4CU7A 1Q45A 4FXRA 2JEQA 3AIEA 1PO9A 3LBOA 3O06A 1ZLPA 3ZJ7A 1EHNA 5LHFA 3DBNA 3QBUA 3PPFA 4NF7A 3WNOA 4LAUA 1Z8AA 3MKCA 2UY3A 3K46A 3BH4A 2ZX7A 1KCLA 3NL6A 2QULA 2X1UA 4L4PA 5DX7A 1SJBA 2IXVA 1ICSA 1YYAA 1PKYA 4UFHA 4RKAA 3EXTA 1KXHA 1VF8A 3GU2A 3PZOA 2RDTA 3EKZA 3A4JA 3RLGA 1R2TA 1A53A 5A2AA 2P5NA 5AECA 2ZZ6A 2F6UA 1NQ6A 1K6AA 3CV1A 3UA4A 1W1TA 4LYKA 4ZB2A 3EOOA 3IJ9A 4G9PA 3FJ6A 4M7SA 1XC6A 3O6DA 1O6IA 4C7GA 3U4AA 4OJYA 3EOSA 3MUXA 2QDGA 3WD4A 1DE5A 2FYMA 3AQUA 4MWAC 1YXCA 2ZZ3A 3QOKA 4C5ZA 4GH3A 4LX4A 1K03A 4C1KA 3XISA 4HU8A 4Q8NA 4S38A 2BX7A 4HMEA 3DFPA 2DUZA 3BCJA 1NDZA 1K9DA 1CXHA 5FL0A 3WLTA 2OCZA 4JEQA 4D72A 5K3VA 1H7RA 4XX6A 1B2YA 4DF1A 4GQBA 1C29A 2D0GA 1D7KA 2CYGA 3AOFA 1HO4A 2E4TA 4HMDA 1NFBA 5E0KA 3E6EA 1JD7A 5F4XA 3E2QA 2QJJA 3E3HA 3F7JA 4CCDA 3W87A 2QCGA 3LMZA 2VCBA 1KCKA 3SR7A 3TJLA 4I5XA 2DW7A 1LT8A 1R8LA 3MHFA 3W2KA 3PAOA 3WJXA 4IX0A 1UP2A 3MKVA 1ITQA 2IW0A 1TYGA 5HA7A 5TD4A 3WNMA 1E0UA 2DZWA 3TW9A 3G1DA 3S1UA 3TLQA 1FDZA 2QUVA 3P5ZA 3LU2A 2PF8A 3A47A 1XBZA 5EGRA 3ZVHA 1OZMA 1GG0A 1UZ4A 1MEHA 3THQA 2WMIB 3ANVA 3WQCA 4YVPA 5FIPA 1E73M 4PH6A 1NFPA 5KZMA 1E9IA 2PLMA 4DZHA 2CBVA 1AODA 5LIUX 1TZ7A 1DEDA 2MANA 2YX0A 4UOZA 2OQLA 1TE6A 3T44A 1YE6A 2A6NA 2NZLA 3FJLA 1QPNA 1F2JA 2VO5A 3QFEA 1IZKA 2CZFA 4QHRA 1W5MA 2A7PA 3ITXA 2EG6A 4AHOA 4ZFCA 4IXXA 3MW7A 1QO2A 3GY1A 4B5NA 4EKJA 1PZ1A 2V6AA 1XH2A 2I57A 4HK5A 4FR1A 1TTPA 3VPLA 3UR2A 1R38A 4EP8C 2CESA 3WK0A 1O5XA 3GH5A 4R3UA 3I6RA 4FPSA 3DYMA 2DW6A 2HV5A 1FOBA 4EXAA 4G1KA 2VEIA 3KL0A 3KRBA 1QWGA 3DEQA 4HCHA 4ZQNA 1DQUA 1TV3A 1IXOA 2WHKA 1EDTA 4NIRA 3EX4A 4ERIA 4R88A 5LKYA 4ZQMA 1ZBWA 4GKTA 3BC9A 1R7OA 3SCTA 2ANUA 3U3HA 3THUA 1S1PA 2XIMA 4JQ4A 2QCEA 4IPPA 1SSDA 2Q8ZA 3DDMA 3NO1A 1MXDA 1IE7C 4IGHA 4GX8A 4ACZB 5F2MA 1V6XA 3CV6A 2CFFA 4KWUA 2AKMA 4KETA 1DORA 4JTEA 4MJ4A 3TE9A 3P3BA 2C18A 1HVQA 1CGUA 1KXQA 1Q13A 1R2RA 1NP0A 1Q3NA 2VT0A 4PUDA 4D8ZA 3TZNA 1V3IA 1FWNA 3NL5A 3CPRA 3T8QA 3HF3A 4R53A 3O6AA 3W3OA 3SGUA 2XH4A 3TSMA 1H0IA 4YCOA 3EWCA 4NASA 1WZMA 1TX2A 4DJDC 4LALA 4BF7A 3W28A 3G0UA 4LOCA 4Q4SA 3CIWA 1KM6A 4AY1A 1RV8A 3S5ZA 5DBUA 2V5JA 2ZVIA 1UHVA 4P7QA 5F4SA 3NQGA 1TA3A 1EGMA 3E0WA 1HP5A 1G01A 1T96A 2EAWA 3CHFA 1O66A 2FZ8A 3ABQA 3PZ9A 4AZIA 1KRAC 3LENA 3K8LA 4IGSA 1P0NA 2Z2UA 1JZ4A 4FA3A 3I3EA 2OYMA 2V8ZA 1FH9A 1JIBA 4LEFA 3MJYA 4RR4A 3ANYA 1VS1A 3G3DA 3ZJ8A 1AQFA 1WDSA 1TTJA 4G5DA 2BHZA 5GNYA 3WMBA 4ZEPA 1QI0A 1IWAA 2QXWA 2Y0FA 2DSUA 3LV6A 3PTKA 4D6EA 3UWYA 3LPFA 3NTYA 1TMLA 1CXLA 1DXFA 5H8MA 1GOIA 3SY1A 5BW6A 3BOLA 4S3EA 1X7FA 4OE7A 4OECA 1JNDA 2Y7GA 1JF6A 1EGZA 1TJ1A 4GUIA 1ONXA 4IMAA 2FMOA 2Z1WA 1Q6QA 3PB2A 2WV8A 3QH2A 3W6YA 3DYPA 1MFUA 3VZYA 3C0QA 3EMQA 1VCGA 4I9TA 2PDBA 2AGTA 4AFYA 4IZGA 4CCEA 5CC3A 5FSEC 1TUFA 3GX9A 1ZY9A 1I8JA 4AHPA 1B30A 3T0AA 3GR7A 3REQB 3U0HA 2A79A 4ATDA 1XGDA 2V81A 1R3TA 4NI3A 4D8LA 2J62A 3WH8A 1FWGC 3CBWA 4QJ3B 1JYXA 4WGXA 3K2GA 3GFYA 2XZ9A 3VNJA 1H5VA 4LAOA 1K1DA 3W7CA 1RA5A 4QGCA 2WJFA 4QSFA 1E56A 2DUXA 4IL2A 2GSEA 4UFIA 3HFTA 3UPMA 4B5XA 3AS2A 1PS9A 1JCMP 5AHIA 2BMBA 1NP2A 1E4LA 1AD1A 4LJ3A 5DT7A 4O52A 4P7OA 3PUOA 1Y5WA 2A3LA 1KTBA 4NJHA 2AAMA 3I7SA 3CLWA 3KS6A 2Y61A 5D30A 2O92A 3LLXA 4W7UA 1OIMA 3VGHA 4KGLA 3W6MA 3P0WA 4JTQA 2PWGA 1XL9A 3B0YA 2C8NA 2OEMA 3UJEA 3EB3A 4UTJA 3EBVA 3PB0A 2V2DA 3TN5A 2IKJA 3PZGA 2VRQA 4WF7A 2WZTA 2Y5SA 2WM0A 1X1ZA 2JALA 3GE7A 1KFKA 3LPGA 2E6AA 2QIWA 3AJXA 4EPKA 3T6CA 3NYZA 3WEMA 3L66A 1OX4B 1Y7VA 2Z29A 2ISVA 3LPPA 3NDZA 4CCZA 2F6KA 1R0MA 3TTQA 2YFOA 3RU6A 2F6XA 1W2VA 1V3LA 3BV7A 2P8BA 4JHZA 3M0HA 1SW7A 4YVVA 1DJZA 2NWSA 2RJGA 3A6OA 1HG3A 4FXSA 2VDGA 1V3MA 3OBAA 3FEMA 1PZ0A 4AD2A 2NV9A 3W1MA 3EPOA 3QSRA 3UZYA 2HVMA 3SUSA 1Z7AA 3TK7A 2JFEX 1H7XA 3TZFA 8CGTA 3GG0A 3H21A 1F07A 2FB3A 4ZBCA 1P5BA 3D5HA 1C7TA 1V0MA 3MJMA 4DBDA 3LRKA 2REQA 2A3HA 1JZ5A 2VGIA 4NVTA 2NT0A 4ZOEA 3WBYA 2EQDA 4PMVA 1VIWA 2QZRA 5G2HA 3MHUA 3L0GA 2WMGA 2Q3OA 3JUGA 5GNZA 3N2MA 4L65A 4G8TA 3UFYA 2UY4A 4B3LA 5I2UA 3EGJA 4WDXA 3AU6A 1EYEA 3MUIA 1QUMA 3NUKA 2W4XA 4BA0A 2FGLA 1SM9A 1X1OA 4DI9A 3IJ8A 5C6MA 2ZXBA 2REQB 1QBAA 1EKOA 4KIRA 1RCXB 3QM3A 4MVAA 1XQLA 5EFFA 3EWZA 4HSNA 1XLMA 1N55A 1DJQA 2PODA 4M51A 3G1RA 2XVPA 4FXFA 4RXGA 1HKVA 3RMJA 4LUIA 2VELA 1BGAA 4R27A 3M0LA 7TIMA 3IVSA 3ICJA 3WQPA 4GCAA 1UH2A 5CPQA 3TU9A 4HJWA 5JIPA 4JIPA 4LUTA 4QLKA 3PPCA 3UW6A 2FB2A 4GZEA 1QI2A 5AYZA 3QGAC 4K36A 2OOGA 3CL8A 3FHAA 2BOGX 1FCUA 1YNQA 4US5D 4GNKB 4M24A 1TJRA 3GM8A 1UH4A 1DJXA 4NAFB 3VIOA 1QHOA 2GSHA 2C79A 3LMYA 4XK2A 2FHCA 4UZSA 4PUUA 1EJXC 3DENA 3N3MA 2DSZA 1F3TA 3IGSA 3GXIA 4FS9A 3E0VA 4Y96A 3CUJA 1UZDA 3G6LA 3VKCA 5CPNA 3BMVA 1JQXA 4KFOA 3KZSA 1OK4A 1JAKA 3A13A 3VGBA 3BGGA 3N9SA 5AOUA 4D6HA 1GVRA 1QVBA 1I45A 3N4AA 3LERA 2J88A 1Y5XA 4YHEA 1LG2A 4IUGA 4QDWA 1XIGA 4BR1A 2QUMA 2WSRA 2D2GA 1LDCA 3LXCA 1RLDA 2BVWA 2PA6A 4HTBA 1NDWA 3GW0A 4Z1AA 4XKYA 2RDUA 4HOWA 5KZ6A 1IHIA 3TN4A 2P10A 4KQNA 5A8QA 1GQNA 2PS2A 2VP8A 2ONEA 3HGSA 2V5DA 4ORMA 1TRDA 1QMLA 4JFVA 3GB6A 1PV8A 1QPRA 1S1RA 3ITGA 2A3AA 2G3NA 1AK5A 3N9KA 4HA0A 5J04A 2QMKA 2ISWA 2BLEA 1ICQA 2WSKA 4DPPA 1RVKA 1VYSX 3UPWA 7CGTA 1R7AA 1H1YA 4J5NA 4PGLA 1JZ6A 3SN1A 4Y8FA 3FGCB 4MNKA 2V0TA 4MNLA 3VNYA 4CNNA 4QDPA 4UQCA 3MKKA 3C61A 3M44A 4TVUA 1UQYA 1QNOA 1SFJA 1N8IA 3TC7A 1UP3A 3QKEA 1VENA 4S3BA 4CNPA 4W87A 3W72A 4QJ1A 3SCVA 4O8RA 1GYNA 2XFFA 5GPRA 2PDWA 1K70A 5HNNA 1JRBA 4J35A 2E09A 4A8NA 2DJLA 3S46A 1AQHA 5AC4A 1ME9A 4UMBA 4LCQA 3NQMA 4GD0A 5CG0A 1SVDA 2VC7A 1EJVC 4S3JA 3WDJA 3VUSA 3DG3A 3PBVA 1W5NA 3GC5A 3R8RA 3CUIA 4E4UA 4ZXLA 4J3VA 2ZZ2A 4JIRA 4US5A 4GUGA 4UTFA 5JUVA 3M7SA 4AD0A 1RJPA 3NDOA 3BL3A 1RHCA 4GVGA 4N2YA 1OX5A 2R8WA 4LCRA 3GXFA 5FF4A 4XWUA 4UR7A 4S23A 3W53A 2Q71A 1UD6A 2D24A 3Q94A 4BI6A 2AKZA 1H7NA 1VJSA 4GVIA 1MDLA 3CAQA 4WSHA 4LRSA 3A4XA 3ZJKA 2XN0A 3BMWA 1MSSA 3M6YA 4J3UA 3H4WA 1IR1A 2VEGA 3OOQA 2FVKA 1KBJA 4H8UA 1GVOA 2P1FA 4TOQA 4MJMA 4E4FA 3DG6A 3BSHA 4ASTA 3N2OA 3L65A 4G7EB 5K4XA 4NI8A 1ENUA 2JK2A 3GBDA 5LIKX 1UP0A 3V5CA 4DF0A 4B3KA 3L4YA 1NOFA 1RLCL 3NPWA 4PN2A 4W8LA 5AYBA 2O55A 2XSXA 4M5PA 4CQAA 1HFBA 3VFLA 2I5IA 1YEYA 3QQ0A 3UWVA 4XSLA 1FX6A 4WDWA 3WLSA 4ZENA 1NY1A 4B5WA 2VD8A 3POCA 1B31A 4IT1A 1GHRA 3LCHA 4C6MA 4MKSA 3BLEA 1UKPA 4NX0A 4D8AA 1QNPA 3MO4A 3AC0A 2PDNA 4QITA 1JZ8A 5XIMA 1UQZA 4PC8A 1P6WA 2RGLA 1C9DA 1PVNA 1KNWA 1SR0A 3S1WA 4GQGA 3UG4A 3MANA 1Q6DA 1EC7A 1Q65A 2JE8A 4L56A 4P8XA 3KBJA 1WOBA 4RLIA 1LWIA 3BTNA 3CYVA 3W1NA 3M9YA 4KS0A 3GDKA 1K9TA 3CWHA 3MMWA 1VGAA 1J9YA 3ECQA 5I79A 1LBFA 4UNKA 5HDRA 1XFCA 4UMAA 4HHHA 3DHUA 2J77A 5HWMA 4V1XA 1QNVA 1VBHA 3LHUA 4YYCA 2W92A 1HXJA 3DESA 3J7HA 4EE9A 3VNIA 4N9BA 5E0FA 5DXXA 4Y9PA 3L4TA 3T1GA 1T99A 2VGGA 5LXEA 1F4AA 4JTDA 4FOJA 5EFDA 3ARTA 2B31A 3UZXA 5CJNA 1SYTA 4MDPA 3EX3A 3PWGA 4Q4PA 3A9IA 3NXFA 1POJA 2FHBA 1WKDA 4MG4A 2V5BA 5D9PA 3BWWA 3C0LA 3UZZA 1O1ZA 1Q6OA 3BG9A 2TAAA 4EOUA 1TV8A 5DLCA 1JFHA 1TSIA 1XYLA 4QEHA 4CVUA 3PTMA 3LM3A 4MSSA 2TODA 1F05A 3LLDA 4OOUA 4JYDA 4XZLX 2PRHA 2O9RA 2CBJA 2WNZA 2PLKA 3I7RA 4JQ1A 5G1MA 2E9LA 2VL4A 1S5TA 3MI3A 3C52A 3P8JA 4IL0A 3MYOA 1QHZA 3WMLA 4DWSB 2CKSA 1UR1A 2DT0A 1EXPA 3C56A 3FXGA 4MMWA 4NKCA 3WQDA 2FMNA 1Y5VA 2OZTA 3MDWA 1BYCA 1FWSA 3ZYZA 3EA1A 1V5XA 2GGEA 3ZM8A 3REQA 4HOZA 1NAL1 1JCYA 1WV2A 1R9XA 3P84A 2J7HA 4DZIA 5BZAA 5HAOA 1H1NA 1J79A 2BV9A 3GVGA 5BXPA 2HK1A 2CWNA 4PUNA 1B0IA 3AHXA 3QY7A 2ZXQA 4UFMA 1EA9C 1Q7MA 1EIBA 1SMAA 3P60A 2FGBA 4FNPA 4UR9A 4DX3A 1A47A 5CC7A 4XKMA 4O1FA 1FHLA 1H0GA 1EUNA 1A0EA 3VDHA 2YLLA 1HP4A 4LNYA 4WD0A 1EEXA 4RDYA 4IISA 4A22A 2AL2A 2Z4GA 3AYTA 4PTWA 4I5UA 4JHMA 3H23A 5TIMA 5E6ZA 1ME7A 2ZC8A 2OX1A 3IJIA 1B9ZA 4GYJA 4L9ZA 1EB3A 5EU9A 5A8NA 2BGNE 2NQHA 5FJPA 3AS3A 3QR3A 3H26A 4Y8EA 4QBXA 1OG6A 3OLGA 3N17A 2QGHA 5DY3A 1TMQA 1ML1A 3S2MA 3R43A 4ICMA 5BMXA 2AMGA 3FSUA 1A4LA 1UASA 3BQ5A 2XYLA 1E6PA 3W81A 3IS4A 5BXRA 2WSYA 4XKYB 3LEPA 4JTIA 4QRNA 1RD6A 2YCIX 1LOQA 5G4HC 3BMXA 3SADA 3CAVA 1FWCC 3W27A 3R6IA 4LY8A 4YHGA 5CEWA 4RZ5A 1TV7A 1JCLA 3QTGA 3LDVA 2CEQA 3GG8A 4PEEA 1GPFA 2HPIA 1A5MC 5CBIA 3D6NA 2VC9A 5CH9A 3GVRA 4WCJA 1TWIA 5L6UA 1V6WA 1DE6A 4AVOA 3TFCA 1AZ1A 4Q4QA 4CQ9A 3M5XA 3VIFA 1QNSA 1CW2A 3IACA 2O9PA 4OIFA 1BTCA 4QNWA 1NFGA 4UTHA 5HUOA 1S2UA 1S2AA 2Z27A 3HQ1A 2Z1KA 3KWXA 2ZKMX 4R7WA 3L4VA 4WY0A 4BF5A 2PEVA 3LBCA 1GEQA 3VIIA 2CWXA 3OW1A 4NXSA 4WR3A 3OLDA 2HSAA 4O18A 4QP0A 1VD6A 1XSJA 2XN2A 3NM3A 4XD4A 3DERA 1OABA 3C8NA 4AIEA 3ENLA 3W6LA 3DI1A 3DG7A 4GYPC 2D2JA 4PB3A 4U5IA 1CYGA 2J7EA 3ITVA 4KERA 5ENLA 1J18A 1GKQA 2EPHA 3L23A 2DP3A 2WB5A 1VYRA 4H01A 2PSNA 3M0JA 1EOKA 4HU3A 4NAEB 4XZIA 1DJWA 2DH2A 2W6RA 4MF4A 1YW1A 3D0CA 3N19B 1RVGA 2BODX 2PWUA 4UXDA 1NM9A 4FSAA 3K1DA 3GNDA 1GTEA 4U3AA 1EBHA 2FH6A 5CGMA 2PTXA 4HOXA 4QG6A 1QI4A 4HNCA 5CSSA 7ODCA 2NQ5A 5LYRA 3JU2A