3LG3A

1.4a crystal structure of isocitrate lyase from yersinia pestis co92
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
419
structure length
419
Chain Sequence
b'MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTASSMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isocitrate lyase
publication title 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 144
structure length 419
sequence length 419
chains with identical sequence B
ec nomenclature ec 4.1.3.1: Isocitrate lyase.
pdb deposition date 2010-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3lg3A00
3I4EA 1F3XA 2X0SA 2OLSA 3T05A 1A49A 1PKNA 1O68A 2XDFA 1M3UA 3BJFA 3QV7A 4G1NA 3SRFA 2HROA 2G50A 1O66A 2XZ7A 4KCVA 3GR4A 4KCUA 3ME3A 1OQFA 2QIWA 3QLLA 3KTXA 4FXJA 2VWSA 1JDEA 4IP7A 3G2GA 4L9YA 4L80A 2VGBA 4L9ZA 3OYXA 1F61A 4B2DA 3N25A 1UJQA 1S2UA 4YNGA 4IQDA 1PKLA 2E28A 3EOOA 1F8MA 1VBHA 3M0JA 1DQUA 1XG3A 2V5KA 3QZ6A 4L7ZA 3MA8A 3FA4A 1E0TA 4KS0A 3LYEA 4HYWA 1KBLA 2VGGA 3IS4A 4B5SA 1DXEA 3KHDA 4QGCA 4LSBA 4MG4A 3M0KA 3SRDA 3FA3A 1O5QA 2VGFA 1OY0A 3HQNA 3PUGA 3R4IA 1XG4A 3GQYA 3SRKA 4FXFA 1A3XA 3E0WA 4ROQA 4B5UA 5JVLA 3QQWA 2HRWA 3QV9A 1PKYA 4TV6A 1MUMA 2DUAA 3EZ4A 2L5HA 3T07A 1S2TA 1IZCA 3E0VA 1KC7A 3PP7A 1DIKA 4B5WA 2V5JA 4YJ5A 1SGJA 1PYMA 3P0XA 1S2WA 2HWGA 3B8IA 3SRHA 2BG5A 3OQ8A 4KRZA 3T0TA 5TAOA 1F8IA 2DIKA 3EOEA 3QTGA 4B2DD 1E0UA 1AQFA 4IMAA 2WQDA 1T5AA 1VBGA 1A5UA 2VGIA 3E5BA 4DRSA 1PKMA 4QG8A 1DXFA 2XZ9A 3QV6A 3GG8A 1A3WA 3VAVA 1Z6KA 1ZLPA 4HYVA 2KX9A 3U2ZA 1U5VA 3LG3A 4JPGA 4KCWA 2R82A 2VWTA 2ZE3A 1IGWA 4MF4A 4RPPA 1GGOA 1M1BA 4WJ8A 4B5TA 4QG9A 4B5XA 1S2VA 3OYZA 4IQEA 1F3WA 3BJTA 4KCTA 4QG6A 3HQOA 3QV8A 4TV5A 3EOLA 2HJPA 4B5VA 1ZJHA 1U5HA 3H6OA 3HQPA
chains in the Genus database with same CATH superfamily
4WQ6A 3ZIZA 1QT1A 1RQHA 4M5PA 5BXTA 1B31A 2E1WA 5EY5A 1TTIA 3P74A 4IIFA 3M5VA 2V3EA 1JYVA 5T9BG 2VUNA 4TXEA 2C91A 1OVDA 1S1PA 1UUOA 1OINA 2B0MA 1F05A 1H09A 3LCIA 1KW1A 2Y6ZA 3GNPA 3C2VA 2EPNA 3WDHA 3W72A 2E8ZA 4W5ZA 1M53A 3DFTA 3G24A 3LGEA 2OTDA 5FEWA 3GU1A 1PHWA 2YB4A 3ZJ8A 2D20A 3R58A 5FKYA 3BC9A 2FPTA 3NZ1A 2G3MA 2EPHA 1UHVA 1M6JA 3L5AA 3VMNA 2PPGA 3AMGA 1EGZA 2ISSA 3L12A 3SDOA 1K6WA 1GHRA 3FYPA 3EX2A 4AHPA 3ONCA 3MP4A 4AU0A 5BRBA 3WLTA 1UR8A 3W7KA 2CXEA 3V5OA 2W63A 1JAEA 1PKMA 3MDUA 2Y7EA 4HMEA 1BEUA 2GVEA 4NZ5A 2PD5A 4ERIA 1UKTA 2IKGA 3AO0A 3JS3A 4NXKA 1D2KA 1ICPA 3LEPA 1RD5A 4WDWA 3A6OA 1B3OA 3K46A 3SCPA 2O9OA 1ZAJA 1UP2A 2A1YA 4LC6A 4D8AA 2GUUA 2DSVA 1WDQA 4DI9A 1DE5A 5EYWA 3ARVA 5DMMA 3OHIA 3EX1A 2BGNE 4LEQA 1R2RA 1RJQA 1W1IE 2RAGA 2E25A 4QAWA 3FOKA 1LTDA 4NRRA 1EDGA 1DJZA 4Y9NA 1XLJA 3CV7A 1UWQA 3ABXA 3U5UA 3M07A 1MW3A 3W71A 4BQ5A 1GVOA 4I8DA 1TFVA 2Z28A 2ZE0A 3O63A 3TOYA 3FA3A 4KRTA 5HWJA 3LRKA 3IJ8A 3MUAA 2FGLA 4MJMA 3WEOA 3IJ6A 1K77A 4Q8WA 1KV5A 1XM3A 4HZ7A 2Y5SA 3BSMA 3DECA 3DFYA 3TC7A 1SO6A 4YJ5A 3CHFA 3SURA 4FLRA 1OC5A 2CITA 4H19A 5ECVA 1ALDA 3HFTA 3NPXA 4AMAA 3F4WA 1E6PA 4RZ6A 2DZTA 3NURA 1E9LA 5FEPA 5JQ9A 1HG3A 3MMWA 3QGAC 2DVUA 1HJSA 1ICQA 2P0OA 4IQLA 5E0CA 2X1RA 2J7GA 1GG0A 1W1TA 3BARA 4FNPA 1ZBKA 3NDOA 3OLIA 3UWZA 2PODA 4GY0A 3TQKA 4AIBA 5G5IA 4C6FA 5C55A 3COTA 2E4TA 1IWPA 3FGCA 1SW3A 4BI7A 4LB3A 4L1XA 1UD8A 2V5CA 3KVLA 4ZEPA 4IP5A 1EBGA 4Z42C 2Y88A 3KHJA 5LSMA 1I4NA 1VBUA 2W92A 3T0CA 3PNUA 4JTRA 4HK5A 3DUGA 3BAIA 3PUEA 5I3HA 4Q8PA 2GDUA 3WBEA 3MI6A 3KBJA 4GE8A 1XYAA 2QYGA 3GG1A 3K5XA 3SRDA 4TU1A 1K9FA 2E40A 3HV8A 2ZDRA 1K1DA 3W7GA 1C9WA 2O4MA 4QITA 4PBFA 3WNKA 3BGAA 3A13A 2FB2A 4HTBA 4JHMA 4Y90A 4DUVA 2XG9A 1B57A 3G8EA 6REQB 2WQDA 5I7GA 2XSAA 4YWSA 4WCJA 1VZWA 3N34A 1BG9A 4NP7A 2FTWA 1TMHA 1TMLA 4MY1A 1TJ0A 2P10A 4UQAA 3PZMA 2FQIA 3MWAA 3UXKA 2EXOA 4GI4A 1WZKA 1B4EA 3TQVA 1W2VA 1VCFA 2Z0IA 1OFOA 1EXPA 5CEWA 1V77A 1N82A 1JPKA 2VVNA 1SJBA 1OSEA 4WY0A 5HUPA 3K4DA 4P7QA 1O6IA 1H11A 2E6YA 3SSJA 1ZP3A 4JX6A 3HMJG 3NWRA 2RGLA 1MEWA 1YYAA 4BHYA 2O55A 4NJGA 2ZUSA 3PSWA 2DW7A 3ITTA 3VOCA 3M5ZA 3ITGA 3GXPA 1Y5VA 4IPJA 2O92A 2RDXA 1GOMA 4JTGA 3GTIA 4Z1AA 3KS6A 2CZVA 4V27A 3SADA 2GJXA 3TYBA 1PBGA 1FH8A 5HJYA 3JW7A 4G8TA 1WAWA 2GYIA 3LQGA 5JIWA 3B9NA 2BVTA 2XVPA 3KWXA 3W4RA 1IHIA 4M6QA 3PAOA 2ZRUA 2I56A 2VGIA 3OZOA 1HUVA 3MC5A 5D2XA 3T42A 1BXCA 2H9AB 4XO7A 4JTLA 2QQ6A 4C7FA 2BWGA 2WNWA 3GC4A 3VVGA 1KM4A 4XZ9A 3VGFA 3TH6A 5K9DA 2ZRWA 5TBOA 3N3MA 2OMAA 4G56A 4IT1A 3WLQA 4QDMA 4J3ZA 3PWGA 3ITLA 2G3FA 1PE1A 2V5DA 3BJFA 2XM2A 4D6EA 2DZPA 3PR2A 5DCDA 1P6WA 3QRHA 1YRRA 3NM1A 3WL0A 2QF8A 3WL1A 1U30A 3H2FA 1FWRA 1SJDA 4KWWA 4O1AA 3BCFA 3BLFA 3AHZA 5E6ZA 2VL4A 4B16A 1ZJBA 5A3HA 2GJLA 1YNQA 4I7UA 4H7VA 1NIUA 4LS1A 1XDJA 3B8VA 1W9BM 2OZ8A 3PWAA 3DC0A 2XFFA 5I79A 3K4AA 4HN4A 4S2BA 4IIGA 3UY7A 3H54A 1ZL1A 1GJPA 2ZADA 7XIMA 2NXIA 1ZZMA 1EIBA 4Q7BA 2BFGA 1R7OA 4YS1A 1EJTC 4JICA 2YXOA 4LCSA 1R85A 1YHTA 3WLSA 4JKKA 1A4MA 1I75A 1UW9A 5HQEA 4L61A 1TELA 1LBFA 2RKXA 3E5BA 2NQZA 3IUHA 3IV3A 4ACZA 1YTDA 2PTYA 1I45A 1E43A 4IIDA 1MO0A 1N8WA 3AS3A 1AW2A 3WQGA 2HMCA 4FAMA 1SUXA 3Q45A 5FJPA 1J12A 4JKLA 2EF9A 3T05A 4OIFA 5LHEA 3AZRA 1FXQA 1E51A 3E2RA 1ESWA 1X98A 1K03A 1VEOA 4QRNA 2PDFA 3AXMA 4U4MA 3ZWSA 3SFWA 4AY7A 4KEMA 4DIAA 3SUTA 2J7CA 1TQJA 1GONA 1Q7QA 2UV8G 4H8NA 4KESA 3RLGA 4LF1A 1BVNP 1XYCA 2VX5A 1NY1A 3TLLA 1A5BA 3TNOA 1WKEA 3CHDA 1OCQA 3T7VA 4EAMA 3N2CA 2Y0FA 7ENLA 3IRSA 1AFSA 3GXDA 4DQWA 1CXHA 1IZCA 4IG2A 1LYXA 1B3ZA 1LWHA 3WF0A 4AZ5A 1GOQA 2WCAA 2O7SA 4N9EA 1JAKA 3SCQA 1UC5A 3S2LA 3BLDA 3UJEA 3TXVA 4H4IA 2C19A 4LUTB 4JTDA 4FSAA 3IJ9A 5HXMA 4PUUA 2OKOA 4S1FA 3QKZA 4PTMA 4AEEA 4UC5A 2MANA 1QNQA 4YCOA 3OOQA 5MKGB 2WZTA 5BXPA 4OWGA 3EOUA 3H53A 3NQ7A 4IPLA 2OYMA 3VMPA 4F0HA 2GPTA 5LIWX 3EDKA 2WZEA 1EHAA 3SEPA 1HT6A 2WVVB 7A3HA 2YLLA 2PAJA 4C6DA 2OOFA 4JTSA 1TZ7A 3NDZA 5DMLA 1RY8A 4OE7A 1CB2A 1KBKA 3RM8A 4G2DA 1UQZA 1IXQA 4D6DA 4K7YA 3EWDA 1PX3A 3CIWA 2QIWA 3WQ5A 1XINA 2VWSA 1D8CA 4UTUA 3GH7A 3M6DA 2VGBA 3TTQA 1TJ2A 2IQTA 4F4RA 3TROA 2WSPA 2ZX7A 3C4UA 2D69A 3DG6A 4F0LA 2V3FA 1V6VA 2XGZA 1V7YA 4WKFA 3Q65A 1TKKA 5I2UA 3U0HA 2ACUA 4DZAA 4C90A 1DBTA 3HM7A 3GDMA 1Q8AA 4R85A 3NO3A 3PJXA 1UASA 3CK5A 4XWUA 3PPFA 3VOJA 3WJWA 1X39A 3LNMA 2TODA 3NZRA 1DJXA 2A4AA 1Q63A 2YXGA 4MADA 1ZCCA 2UY3A 1K8ZA 4AISA 3KTCA 4NNBA 2CXGA 3W1XA 1V7AA 4JTKA 2OEJA 3FYOA 2PZNA 2XU2A 4J3TA 1RALA 4GISA 4HYRA 1YMYA 5HBFA 4U28A 2ZXQA 3ANYA 4O1CA 5CH9A 1JFHA 3AXXA 5A95A 2E5CA 4NYUA 1AODA 4YTUA 4C1LA 4O18A 5CQ1A 1KM5A 3P84A 3EB3A 3F5KA 1KLZA 3AZTA 4E8DA 4HZ6A 5C7HA 1BYCA 4ZMGA 5FF7A 3N11A 1J11A 4B3ZA 2QJNA 1G1YA 4TX6A 3D47A 1GOWA 4DWDA 1SSDA 4WXYA 1BRLB 1VEPA 3EOOA 3PZVA 4CGTA 2E6DA 1CGUA 2PGRA 2POZA 3HBLA 3VDHA 1YXCA 3WLNA 4TIMA 1JF5A 2JIWA 4NVTA 2VX4A 1OY0A 3N04A 4YHEA 2GVJA 3BOFA 1BVWA 1CXFA 1F73A 2FMOA 2I57A 4XIMA 1CXIA 1VEMA 3FNDA 3M9YA 4U31A 2HV5A 2E9MA 2XPKA 2BNJA 3W07A 5T91A 5A8NA 4ZSUA 2W61A 3RNDA 3V18A 1EA0A 4QSFA 2YXXA 4UR9A 3N9KA 5CPMA 3SJ3A 1X7IA 5EB8A 1U1HA 4TUFA 3F4NA 4BY3A 1SR0A 3KL5A 3VDGA 3ZQ9A 1YE4A 1UD6A 3HTWA 4HA4A 2J77A 5AHNA 3NNTA 4LQ1A 5REQB 4PFMA 3H7UA 4OKDA 3EKZA 4LBSA 4OU1A 1KXQA 2QVHA 3I3DA 1P5BA 3BWWA 2PU1A 4GRSA 4Q33A 2YL8A 3ZR5A 3LPOA 2YPIA 1JCJA 4JFWA 2V30A 3BAXA 1UC4A 1V6TA 3MI3A 3GTHA 2NUYA 1ITUA 1FDJA 2YCIX 3VC6A 3T2PA 2INEA 4C6BA 3L4XA 3SRKA 1T8XA 4UB9A 3CHCA 1SYTA 3UJSA 4TV6A 1J0JA 3F2CA 2DUAA 3B05A 7TAAA 3FY1A 2RFGA 3THAA 3P6LA 4F2UA 3LM3A 3W6MA 3CUHA 5H6HA 5K9CA 2WC4A 3G6LA 2BOFX 3BAKA 4BKNA 5K9XA 4AYSA 2D3LA 3C2YA 3QW3A 8XIMA 4YVXA 3AXIA 1GVQA 1EXBA 4B2DD 3VD4A 4IMAA 3VKCA 2V2HA 4P2VA 2JK2A 3GDLA 2CHOA 4AIOA 2CEQA 2D0HA 3LLXA 4GD0A 3S1GA 1JDDA 2A3HA 1K3UA 5D04C 2FIQA 3A64A 1PIIA 3NQAA 3ZFHA 4ZOCA 3B97A 4ICNA 4KQNA 2AKZA 3KEHA 3WJSA 1MQPA 1R3RA 1X1OA 4I9TA 4A22A 5BMXA 4HA3A 5AC8A 3CAVA 2VDIA 4XKYA 3RN6A 4M8UA 4DY1A 1NF7A 3S6TA 2XDFA 1JCNA 5A8QA 2YA1A 1J79A 1O66A 1CB7B 4KCUA 3TYAA 2OO0A 3SR7A 2R91A 4LS2A 4L65A 4PMYA 3M5YA 4X0NA 1G7UA 3GX9A 1F61A 1GYMA 3APTA 3TAOA 4MB5A 4K2SA 2DSWA 2VR2A 3H2NA 4XZIA 1M7JA 2DVXA 2YA2A 4NU7A 2WSQA 1T8QA 3FAWA 1DORA 4H6QA 3DX5A 2V6AA 3KBVA 2J47A 4QDPA 2QPUA 2MUCA 1VFOA 5EBAA 1W9VA 1ONRA 4C6JA 1I0DA 4AIUA 3LRMA 3P8IA 3TONA 3W7OA 3GY1A 2LLEA 3AWNA 4GOAA 4QCFA 2QZRA 4MWAB 3VIOA 2WB5A 3THUA 2DIEA 4BK9A 1MEHA 4LCRA 1CGWA 2PCQA 2Z2BA 5LIYX 4W7WA 3PFRA 3CL8A 4FIQA 2R82A 1KM6A 4GIYA 3U7VA 2VFHA 4US5D 2J9YA 3MSGA 4TV5A 4MZYA 1RLCL 4BFAA 3BH4A 3WO8A 3H6OA 4NZ1A 2DSUA 2X0SA 1CT5A 4FB7A 1MQRA 2WMIA 1VCGA 4O11A 1F6KA 1YDOA 3SM0A 4JCLA 3T2QA 3HN3A 4W88A 5DXXA 1QO2A 4N9DA 4CU7A 2C1IA 5EFFA 4JTUA 4L9YA 3IWPA 4E8GA 1HKVA 1R38A 2VR5A 5CPLA 4N6EA 4ORMA 3WF4A 2RDTA 5HK4A 2NSXA 3FDGA 1ITCA 1B3VA 2FFCA 1JZ8A 3E96A 1FFQA 1UBPC 1H41A 3G1XA 1QWKA 4GZEA 1G9HA 1UH3A 4L6DA 3BPWA 1VGAA 1OADA 3ARRA 3THQA 1O1HA 2IUZA 4W7VA 2NQ9A 1ZCOA 3BMVA 3IUIA 1G67A 2XN2A 4J3VA 1Y8BA 4MHBA 2TPSA 4WGHA 2WKJA 3OQ8A 5I78A 3FJ6A 3STGA 3VTRA 4DBDA 4KFPA 4JN6A 3LSCA 4RW3A 2R24A 2QDHA 4U2ZA 5HATA 5HANA 4UTKA 1DP0A 1AQHA 4A05A 4AVNA 3RR1A 3RRAA 2P1FA 3AU6A 2BMBA 1LOSA 3VGGA 3TJLA 3BOLA 4DJED 4R7JA 5FJOA 4RJEA 1H0IA 4YU1A 3VD3A 4IXHA 4KGLA 2E8YA 4HHPA 2HROA 4BR1A 3WLHA 2VFGA 3F03K 4JFUA 4LVDA 5DMYA 2NT0A 5FEZA 4HNUA 1O1ZA 4GQQA 4QE1A 2BOGX 1KFBA 4OV9A 1S2CA 5C0QA 4LUJA 1LORA 4PA8A 3LLFA 1UZHA 3PZIA 3OZPA 4GYPC 3M0KA 2VGFA 2VC5A 4S3GA 1LWJA 1AA1B 5DEZA 2Q6ZA 1WV2A 1AD4A 3RX4A 4O57A 1QNPA 1JI1A 2L5HA 3MBDA 4JCMA 3VK5A 5C7VA 1TR9A 4PMJA 3CAWA 4N7QA 2NV2A 5HQMA 5CC7A 1EO7A 1CENA 1FWWA 4FS9A 5HNUA 2JALA 1F74A 4WD0A 2G95A 2WZHA 4ROPA 2VM8A 2I5GA 2IW0A 1JYNA 4GJ1A 2FMNA 1NQ6A 2C8NA 4W9TA 3DBNA 1IEIA 3IARA 4F79A 1UMLA 3P0WA 1FKXA 5FJJA 4C60A 5DX7A 2NZLA 3QOMA 4IPIA 4UTJA 1QXLA 4QHRA 1GW1A 4H6EA 5AHIA 2UBPC 1S1RA 3LCWA 3SCRA 1ZB5A 3R10A 5CGMA 4OHQA 2FDSA 1XIBA 2NX1A 1XPYA 2A5HA 4UR8A 1K6AA 3TIMA 3A22A 2E1DA 2NVDA 3RCMA 3LM7A 4N02A 3V35A 1M5WA 4YLWA 3B03A 2Q3RA 2PTXA 1EHNA 2PDHA 1O60A 2FYMA 1EPXA 4BF5A 3VZXA 1LJYA 3UETA 3T0BA 1N55A 1TTPA 4PCFA 1C8YA 3AMLA 4NKCA 3VM5A 1WE5A 1U22A 3ITVA 3LYEA 3P2VA 2J7BA 1DXEA 1FWDC 2XISA 3NL5A 5I07A 1BYAA 1FWEC 4M0XA 1GOOA 1O5QA 5DXYA 2VZVA 3QC0A 4O0KA 3NPWA 2OQYA 4IMEA 1KKOA 3TOPA 4Y9AA 1D7FA 1MXGA 5BRPA 3HFYA 2DVTA 5LNRA 5A94A 2GGHA 1XSKA 5BU6A 1UWSA 3WG6A 4EXQA 4FO4A 4HOWA 2WBKA 3WQ4A 3IAPA 4MKNA 4YIWA 1JPIA 3XIMA 1D8WA 2ZICA 3GD6A 3TCSA 5I09A 5D09A 4XD3A 1QBAA 2Y7FA 1QW9A 2DFAA 1Z6KA 1QR7A 4R7OA 4QQ3A 1K9TA 3V3WA 1QK2A 2J24A 1EEPA 4IQEA 3TJ4A 4MNJA 4RV8A 4RE4A 1V6UA 5FOOA 1L9WA 1YBQB 4A29A 1HL8A 2F38A 2WNQA 4DZHA 4ATDA 4EPBC 3LD5A 1R2SA 2WK2A 3V5FA 4OUEA 5HWMA 1W8SA 1TCMA 1CLKA 3PBWA 1E73M 1UH4A 4Q4OA 2JEPA 4RKAA 5CPNA 1OGSA 3ABZA 1WAUA 1YADA 2Y8UA 5HAOA 2AGKA 1WBJA 5F7UA 3VABA 3GC5A 2PDMA 4BQ2A 1E6RA 4NRSA 2CZDA 4I3GA 4LYQA 4O4VA 4AEOA 1U1JA 3C5QA 2Q3OA 4WJXA 3GTFA 4O13A 3QEZA 3D5HA 4E4FA 4EKJA 2VVSA 2PDBA 3TZNA 2NUXA 3IVSA 1UH2A 5ABHA 2WC3A 2QUTA 2B31A 3B3DA 4XX6A 1JVNA 4KRZA 2QCCA 3N19B 2XVNA 1TV7A 3OHMB 3BW4A 3G1VA 4O17A 3TSMA 1P7TA 3IJQA 5CSUA 4X2RA 4O1DA 2YZ5A 1DXFA 3GG8A 2GVLA 3KRZA 1DIDA 2WXDM 4IX0A 2D73A 3WQFA 4QS5A 1E70M 2H3DA 2V38A 1TPEA 1GTHA 5D2TA 4M6PA 1J0IA 3PTKA 2OLSA 5ABFB 5DELA 3MMUA 1EDTA 1FHVA 1KBIA 4GNJA 1S46A 3V5CA 4MWAE 1ZHAA 1BXNA 4QDWA 5CG7A 4JXCA 2NLIA 3P3BA 3VIMA 1MMFA 3BDKA 4MJZA 2QAPA 3RX2A 1K8YA 1WZAA 2RH9A 4KWVA 5EGRA 1TIWA 1T7LA 4QROA 2WVTA 3KZSA 1FWTA 1QNVA 4O0QA 1AZ1A 3SCOA 1A3XA 1FTXA 3T9PA 1JQXA 2WWCA 1IV8A 1AH0A 3NZGA 1Q4NX 3GXNA 4UTWC 1KFJA 1PX4A 1YNYA 3BSHA 1EJRC 1GT8A 3HPZA 3T40A 1JPHA 4LX4A 3R0KA 4C6IA 3Q67A 2HISA 3R2GA 1C90A 3KOWA 4XD6A 3E3HA 5D8WA 1Q2RA 5ECUA 4XUYA 2IPWA 3RYSA 3LG3A 2AOSA 4HU8A 3GTXA 5KETA 1VIWA 2WNZA 3NQ8A 3G22A 2X1SA 2VFIA 5LIXX 1GWJA 2ZXDA 1BSLA 2CW6A 4FHAA 4Q4KA 3UZXA 4YTTA 3R25A 1GOXA 2IKJA 3CQHA 1OFQA 1IWBA 1S3HA 3JRKA 5JUVA 3GHRA 3ENLA 1H7WA 5D02A 2HPMA 2HSAA 1XYBA 3FEMA 4IP4A 1GHSA 3EMQA 5HR7A 1H7NA 3LK6A 1DJYA 3G2GA 4NJIA 3QR1A 2J25A 2X7WA 4GJIA 4HOXA 4GCAA 4U33A 3OA5A 3I6TA 5CG0A 4CVWA 1XHGA 1UA3A 5BWAA 3SIZA 3LTSA 4QSHA 3LV5A 3PZQA 5F1VA 1Z32X 1TMQA 8XIAA 1KD0A 2OVLA 1OCJA 4PCNA 1Z48A 3UXDA 5JIPA 1RCQA 3U4FA 4L56A 3T78A 2X7VA 1H7OA 3R5EA 1T6MA 1I2NA 3IIXA 1LRNA 3MMTA 2PDUA 3EWBX 1NH6A 3FGCB 1AQFA 3BICA 3RLVA 3CV1A 2BX7A 2EG8A 2J79A 1SW0A 2PRHA 3UA3A 1OGBA 3C2EA 3W37A 2A7PA 1FX6A 4UIOA 4RPPA 3N9RA 2XM1A 4DUOA 1C8VA 1QI0A 5B80A 3O7UA 3M46A 1HP4A 4EPKA 2XN0A 2OR2A 3FHQA 2YCLA 5DANA 3CZKA 1M03A 4ZQRA 4DBSA 4EWND 3T44A 3TSBA 4AAJA 6ALDA 3HGJA 3SGUA 5CPOA 2FB3A 3WQCA 3L5LA 3CQIA 4HPXA 2PDIA 2J6XA 2XIIA 2ABBA 3TN4A 1VC4A 4O1BA 5C2GA 3VDCA 4AD3A 2G96A 1QPOA 1OIMA 1VJZA 2NWRA 5DCBA 5I3JA 4PN2A 1QBBA 1NELA 1GKRA 1W56A 2J75A 4U5IA 3QGVA 1KV8A 1XYLA 3SY8A 5G2HA 3TFXA 1XGEA 1HW6A 5FL1A 3H22A 4TO8A 2CLEA 3C0LA 5D33A 3UPWA 3BCDA 3AUOA 3M16A 2QUVA 4WDUA 1V3IA 3PUOA 4WY0B 1EUAA 1IF2A 2YR1A 3UZJA 3C8NA 3KVJA 3PZOA 5LIUX 1TWWA 3EWXA 4GYPA 4O0ZA 3OLEA 4IJBA 5E0FA 2D2JA 4S23A 2I14A 2W9MA 2WWDA 3L0NA 4CD8A 3POCA 3K8KA 1OG0A 3TK7A 4G7FA 3KFTA 5HMEA 1UP3A 5BRQA 1Q45A 3STCA 2WMGA 4D6FA 1H49A 4GKLA 5KZMA 2GJXB 5K2ZA 4ZQNA 4MGGA 3QMSA 3E9AA 4ZE4A 3NO1A 1VFSA 2HBXA 1VFTA 2QGYA 1VP5A 3N4EA 3H4WA 2V81A 4QNEA 4QX4A 1Q6RA 1VFUA 4NZCA 5EPDA 3HMCA 1PDYA 2DZSA 3B4UA 3QC3A 3LCGA 1QMLA 1XPGA 3TMQA 3VUPA 4X2PA 4Y8EA 3FLUA 5DT7A 3WLMA 2VI0A 2EPKX 2W67A 3QV9A 1HNYA 1ZAHA 3VNLA 4O54A 4QJ5B 3KLLA 4FX7A 2F6UA 1TTQA 2OYLA 1QDSA 4ACYA 1C91A 4XSLA 3I4KA 3RUBL 2PDYA 5E70A 1XIGA 1EOMA 3W0KA 2GVYA 3DC8A 2OZ0A 2NSOA 4AHOA 2VOTA 3WNOA 3MANA 1WXJA 3LI0A 3PPCA 2JF7A 1ZENA 5C9WA 4EX4A 1OCNA 1MVYA 1UD3A 2QCDA 3TAKA 4O8AA 7REQA 1JZ7A 4AWTA 1C7TA 2Q8XA 4DNMA 3L2IA 5G1TA 1QU4A 3G18A 1J6OA 1XUZA 3O0FA 3ZOAA 2YB1A 4RNHA 2QDEA 3L4ZA 1OFAA 1UOZA 3NVTA 3VNZA 1MI3A 1D9EA 3QY7A 5CZ0A 3UCDA 1GKPA 3W53A 1AVAA 1ZY9A 1G94A 3FV9A 3WH9A 3ARPA 4DN1A 2A3LA 4XAZA 3LHTA 1VENA 5AYBA 3IVUA 6TAAA 3M0JA 1F8MA 1XG3A 4FLOA 4H8HA 1V3MA 5JMUA 1GW9A 4HYWA 3WMBA 2G0WA 1DE6A 3I7QA 4LSBA 4BA0A 2FTYA 1D3HA 1R9XA 3HF3A 1QOPA 4ACZB 4Z2GA 2H8XA 2XH7A 4V1XA 2Z1XA 2QDGA 2HK0A 3KE0A 2R1KA 2BY3A 1HJXA 1EFZA 3EA2A 1GUVA 1FH7A 1CLXA 3VA8A 4DJFD 4LF2A 3N13A 3KBSA 3E49A 3PBGA 2ZXAA 2R1LA 3OLDA 1WQ5A 3ABQA 1V8EA 1A0DA 2ANUA 4H9XA 4MWAD 6TIMA 4H6KA 4WLCA 2PDCA 4E5TA 2CYGA 5BW6A 1ODUA 3B0XA 1R2TA 2QS8A 4WJ8A 4QLKA 3PZGA 3CJPA 3CPGA 2JF6A 3L4WA 4GI9A 3KL0A 4ZBCA 1R0MA 2PBGA 5AYIA 2RJGA 5FESA 3MQTA 4OUIA 5FAJA 4LVAA 4ATWA 5LNVA 1RV8A 4AYGA 3VNJA 5FF3A 1EBHA 1ITXA 1GYLA 1SJAA 3KDOA 4HPJA 3L7RA 4EXAA 4IISA 1M01A 1TA3A 3P5YA 1C93A 3MHGA 4YMZA 4B9YA 1MUWA 3GQYA 2WYSA 4EANA 1W0MA 4EVZA 1FVPA 1XR2A 3GVQA 2ADAA 3M44A 1GZ1A 1K9DA 1DIKA 4NQ1A 1UR1A 4L6HA 2PWFA 4A8NA 4ASTA 5XINA 3MW7A 2NQJA 2PLKA 2HNEA 4Q8NA 3E74A 3GIYA 2J88A 1S3TC 3RAOA 3QFEA 4PMUA 4I8YA 4PUKA 2QULA 5CSYA 3AIUA 3TE9A 2FDMA 3AQUA 4AWSA 1E1EA 2A6LA 4XISA 1W8GA 3NSXA 3BJTA 5AKQA 3GDKA 3H23A 4QG6A 1B1YA 2HJPA 1V3KA 4IFRA 2OSXA 4B5WA 4UTWA 3WZ0E 3CTTA 4B3KA 1V51A 1TQXA 4UMCA 3MVTA 1JGMA 3TYUA 1Q85A 1PTAA 1MEIA 4CEUC 1M3UA 4G1NA 3SRFA 3AIBA 3ECQA 3KTSA 1KBJA 1KM2A 3GR4A 3W00A 5C9RA 4D1JA 1ZALA 4GO9A 5A2AA 4DJEC 1EF3A 2PTWA 3DFQA 4GNVA 2GJPA 1E6QM 2WHMA 3FKRA 3CT2A 3VNKA 1E9IA 4FXSA 4JGDA 4LTSA 3P60A 4CQCA 1VFHA 2ON3A 2P88A 2XIBA 2E09A 1T99A 3M5XA 1HL2A 1EDQA 2C15A 1POJA 4F0KA 3TP4A 4ROQA 1AJ2A 3AHYA 1TPB1 4JFVA 5F4SA 4I90A 1DV7A 3S1UA 4UZUA 2HS8A 4NT0A 1BYDA 3CQJA 1A5CA 2WHJA 2P76A 4NJJA 1K7EA 5A6KA 1ZS2A 3W1PA 4D6HA 2AAMA 1IWAA 4IIEA 2R9RA 4IIHA 4JTQA 3N3TA 3NZQA 3VCCA 3LZ3A 3LCXA 3D46A 4NZJA 2E9LA 5BWFA 4LC8A 4UFIA 5AHEA 2VRKA 2WOQA 3OVRA 1TX0A 1H4PA 1ZQ5A 4DAFA 3N1AA 3P0XA 4K38A 1NM9A 3OO2A 1V3JA 3W27A 1YLVA 2V2CA 3ZJKA 3MZNA 4JIEA 3O6CA 4TVCA 2W62A 4CQ8A 1E4NA 1H7XA 1XISA 1XP3A 1WX0A 2X42A 2NWSA 1VHNA 4RPQA 1E6NA 2I16A 1S5NA 1UR4A 4J5NA 3V7PA 1PKLA 1AG1O 2GSHA 5F4WA 1KWKA 1C9DA 3ZLFA 3MA8A 3KX6A 5HDRA 3M0YA 3UWYA 1OG6A 4JFTA 1D3GA 2ISDA 2VOMA 3CBWA 5AVNA 3TZFA 3ZLGA 4DO4A 2ZIDA 1FCUA 1OFRA 1X8CA 1XDMA 4KIEA 1Y0EA 4GZ7A 1REQA 4PZVA 4E4PA 3GG0A 1OIFA 3UPBA 2V3GA 3CHEA 5BXSA 2JKPA 4GVGA 4XAFA 2YDAA 2E68A 2OLHA 3ARTA 3BMWA 1UG6A 2PWHA 2PRLA 1B0IA 2PWUA 3L66A 2CPUA 2J7FA 1LWIA 1MWOA 5FJUA 3WLRA 1JCTA 4UMAA 3EOEA 5IDZA 1Y65A 2ASHA 1E0UA 4ZODA 1XJBA 2OZ3A 2Y89A 5D37A 1TV2A 4WUIA 4GVFA 1BGGA 4XD4A 3NAVA 3SQLA 3CYVA 3MJYA 2OT1A 3M4HA 4GXWA 3MKCA 4MKVA 1UKOA 5FL0A 1JEZA 4Z2KA 3CXOA 3S6DA 3IJIA 4WDTA 3TVAA 1JIBA 3W6LA 1OCBA 5H1WA 4JIHA 1PTDA 1YXDA 4LWWA 2GUBA 5HMSA 4KEVA 3MSRA 3A23A 1TB3A 1XCXA 1O94A 1DHPA 5BOOA 5AFDA 3GIQA 1ML1A 2FJKA 5BZAA 4GXPA 1OWQA 3VX0A 4GA8A 3EDEA 1W17A 4JYEA 3W7DA 6A3HA 5A6SA 3GBEA 2V67A 4KFOA 4X61A 3SY1A 1WDPA 4LH8A 2BP1A 4ERAA 3WK0A 3BTNA 2E77A 4CQ9A 4XZWA 4FR6A 4MUPA 4DBEA 5FF0A 1LP6A 2Y5JA 1Z89A 4W4QA 4M51A 4W7UA 5J04A 5HR6A 2I7GA 1E5NA 4LYKA 1O5RA 3M41A 3EXRA 4UFKA 2NW0A 3BAYA 3EXTA 4QJ3B 4PB5A 1R30A 3NQ2A 2GWGA 1IEVA 3PS7A 5GJNA 3WELA 2WCGA 3VC5A 4DF2A 3WMCA 4GIAA 4A3RA 2IPJA 3OIXA 5C70A 5PTDA 3WKZA 5IOBA 4Z2IA 3RX3A 1OK4A 3H24A 3RIKA 5K4ZA 1E5JA 1FHLA 4XKYB 4H7CA 2D0GA 3GU2A 2GJNA 4FNRA 1Q6FA 5LNUA 3LOTA 1FHDA 3BAJA 4M81A 2PDGA 4HPGA 3VCRA 1L2UA 2A79A 1IR1A 1CEOA 2CLHA 1Q6QA 1XDLA 4Q3MA 4HOZA 4UNIA 3WF3A 1JI2A 2Z7KA 3KCJA 1U5HA 3A24A 3S5ZA 3AICA 1VS1A 2WQPA 1XBYA 3M64A 2G37A 3I68A 1I8JA 2DZXA 3AJ7A 4PULA 5CLWA 2E6AA 3S1WA 3CT7A 4HMDA 2E67A 1EIXA 5E09A 5E1QA 1NJJA 3EEGA 2GQAA 1EJWC 3ONBA 1WDRA 4JTAA 3BOXA 4B2DA 2YL9A 3GNDA 4RDYA 4F8XA 3WFAA 3C6CA 3E2VA 3LERA 5DMNA 2XH2A 1E0TA 4PTNA 4Z08A 4MDPA 2JE8A 2ZZ3A 3VGHA 3D3FA 3GHUA 3F4VA 3TN5A 2PDQA 3DGBA 4CLMA 5JVLA 4Z0SA 1UWAA 4J1OA 4DWSC 4OT7A 1NARA 4PCSA 4D8LA 3EA1A 1SGJA 4O10A 3ITCA 4DXKA 1R3QA 4GIEA 3UR5A 3QKEA 1THFD 2O7QA 4G7EB 4DRSA 1HP5A 1WXYA 4ZA0A 2OGJA 3NM3A 5M5DA 4QM1A 4Z2LA 3K30A 4MB3A 5A69A 1V08A 3F4DA 2REQA 1FWHC 1O12A 3EEZA 5A8MA 2A7NA 3T0TA 4J9JA 1AW5A 4C5ZA 4J2PA 1US2A 2GZXA 3N2XA 3B9AA 3B0YA 4L1WA 4OOUA 2DGAA 1VFMA 4JQ3A 4UMBA 5JBDA 2CFFA 4JKMA 1QPKA 2J78A 4HNTA 2JKAA 3C8FA 3VUSA 2V0TA 3PB0A 3IJDA 3TNBA 4L5ZA 4JTJA 2VEGA 1SR9A 4E0CA 4CUCA 4XBKA 4PBGA 3WUFA 1UJPA 5IFTA 5D30A 2IXVA 1XG4A 3QGKC 2DZAA 5BROA 2FPYA 2QJJA 1DYSA 1BKSA 4R3UA 2W79A 2QF7A 3RPTA 3TDFA 1Z69A 3HPXA 2ZZ2A 2Z7GA 3UP8A 1MW1A 3USZA 1TPFA 1JCYA 3ARSA 3APYA 2WSKA 3V36A 3N2OA 2QV4A 2EKGA 1CXLA 2QMKA 1B3XA 3QPEA 3W7NA 4L4OA 1NF0A 3HPAA 4KKXA 4AC1X 4GZIA 5C2CA 4XAGA 3MTWA 1NTHA 4CNOA 4CVUA 4FP1A 1HJQA 1EC9A 1KNWA 1VFLA 3MPGA 1QPRA 1LG1A 4JQAA 3EYPA 2R8WA 5B7YA 1RHCA 2AQWA 3WD2A 3K1DA 2VD9A 5CJ5A 5K4XA 2VZTA 5EMLA 1AUSL 4PB3A 3VD9A 5EMJA 2WZIA 3I6EA 4LVFA 1H1ZA 3WK3A 3FN9A 4H00A 4PMXA 4HPNA 3TYEA 2XTKA 3ZJ7A 5CBJA 3TN3A 5M3WA 5K3VA 2ALDA 1JUKA 3UWVA 2GGJA 4PRTA 1FOBA 3QJAA 4M7SA 2QAFA 3B0PA 2ZZ1A 4V33A 1Z7AA 5HULA 3ZVHA 4AD5A 3RJYA 2J4GA 3DI0A 1HL9A 4AUBA 4DZIA 1F4HA 4QAIA 3ARWA 1TV3A 4NI8A 3UXIA 1BGAA 1OX4B 5ABTA 1CCWB 1E71M 1DJQA 4DJEA 5H91A 2O9TA 3TN6A 3W7EA 4TOQA 3WCZA 4E2OA 3MI2A 1ECEA 3OGSA 2OWCA 4J3UA 3AIRA 1D7KA 1P4CA 3NQEA 1R3SA 1XLLA 3KOXA 4AD1A 1AJ0A 1HO4A 1X1ZA 2E5DA 1OGGA 3BZGA 1TE6A 4X60A 1XRSA 1E0WA 4Y9MA 2VYOA 4HSOA 3N15A 2BODX 4KETA 4L64A 4RE2A 4GK8A 3MCMA 2XSXA 1TUFA 4LAKA 3SQMA 4GVIA 3NQVA 4O19A 1DJWA 3GXTA 4HU0A 5CC5A 3EOLA 5I3DA 3WUGA 3S2JA 1QW8A 2OZTA 2PRMA 3ARYA 1XIDA 1JF6A 3LXCA 1M7PA 4LW7A 2X09A 3CH9A 1ONEA 4ZQMA 4KCVA 1CNVA 2HXUA 4HB7A 2DZUA 3VMOA 3W7JA 3B9OA 3E02A 1YNPA 1TRDA 4YHGA 4NAFB 3N4FA 5D2WA 5HMDA 3QPZA 1XD1A 1OFDA 6REQA 3KL3A 4U3CA 3T8LA 4Q8QA 5EA9A 1RA0A 2WMJA 3BO9A 1RJRA 3RU8X 3SUSA 2GQ8A 4OV4A 1TWDA 4FX8A 2R94A 4PL2A 4MMWA 2VX7A 1T41A 1Q6OA 2HPIA 4C65A 3W82A 3QLDA 4M19A 3L2LA 4I9MA 4U2YA 3V0SA 4CNUA 3A3HA 2P50A 2NLYA 1HJUA 1KM3A 1CWYA 4PBEA 3KOYA 3ZS4A 3T8QA 4D71A 3W2NA 1DQWA 1HKKA 1A0CA 1PZ3A 1DVJA 1GJUA 4MKSA 3QMTA 1BTCA 3WEZA 3J7HA 3NIYA 4CQBA 2W3ZA 3NQCA 5AECA 1JCMP 1EF2A 1RK6A 1ONXA 4LJ3A 4KCTA 4F40A 3WNMA 2A3BA 3IVTA 1E6SM 2DZVA 1KWGA 1MZRA 4IMDA 1KM0A 3VU2A 4YXGA 4PB4A 1IEXA 4XZHA 1C92A 4RW5A 2YW3A 1E3XA 3M7SA 3URAA 5A8PA 4Y2WA 2XWEA 4LY4A 4NXSA 4C7DA 5CBBA 1AH4A 4Z1CA 4XB3A 4W8AA 1I1WA 1T96A 3AWOA 3VNDA 4XZMX 4UTIA 5GVJA 2AL2B 3UR7A 2XSBA 1A5LC 1B3WA 3DENA 1SZFA 3T09A 3EX6A 1DKWA 2NXGA 3WBXA 1XLFA 1P7TB 4XQ6A 3I3EA 1R9ZA 2KZHA 2CU0A 3FJNA 4MLJA 2G3IA 1BFNA 3MHUA 4HT3A 1VB9A 2MNRA 3GVWA 4GPNA 5FEXA 3UYCA 3POHA 4J40A 3UY8A 3A12A 2VP8A 3LHYA 2WVSA 4J3XA 1XW8A 2OKTA 4W8LA 4GZJA 1KRCC 1H1NA 4REQA 2QIIA 2C71A 2QJIA 3F5LA 3ES7A 4QE4A 4LV4A 2VTFA 3EMCA 2QMJA 1UZDA 2AKMA 4AC7C 3P14A 1BXBA 1VBGA 1LDCA 3ZMRA 3AIEA 3QN3A 3TJIA 3P81A 3AOFA 2C79A 4JNYA 5HA7A 1V0LA 4F2BA 4HSNA 3NJ3A 4HHMA 3VDBA 2A21A 2CBIA 3ERPA 2WAGA 3WD4A 3GG7A 3L23A 3RF9A 3T08A 3LDVA 3ELFA 1E1CA 3G77A 4LUIA 2QCGA 1LM1A 2XIJA 2ZBTA 4O4WA 2X40A 1XL9A 2PDWA 4JDBA 3E38A 1L2QA 4N0RA 5FSEC 4XZNX 1S2UA 1WUEA 1EL3A 3GH4A 1Q4WA 2VC7A 2XVKA 4NI3A 4AEFA 4N4QA 4C6OA 3W7RA 2NX9A 3OZMA 4AXKA 2DV0A 3RXZA 4RZ4A 2Q02A 2BHUA 3IJ7A 3QQWA 3QY8A 1LLOA 3EZ4A 1XIIA 4ERGA 3UVAA 2GUYA 5I24A 4E2VA 1UWRA 4J7RA 5AC4A 2QXWA 2ZWYA 4ORIA 3GNOA 1HF6A 4XAPA 1ICSA 3JZEA 2GSEA 4A2SA 3QMRA 4J2MA 1UYQA 2GQ3A 4IX2A 2DSZA 3KVKA 1Z8AA 3IGHX 3B0VC 4MF4A 3H70A 3GFZA 1QAPA 1RD6A 1VAHA 4B5XA 4DWSA 2ICSA 2ZUUA 3MVIA 4JTCA 3NGFA 2R14A 3W86A 4HTYA 1AD1A 3G8RA 3OVQA 4AHQA 2QT3A 2F61A 1FRBA 1N8FA 5DT5A 4AZHA 1JDCA 4GY1A 2VUYA 5AHFA 2CERA 4DEFA 5AC6A 5HMFA 1FHUA 3W1LA 3W7IA 1FWGC 3EOSA 1VCVA 3S3GA 2HVOA 1XX1A 1HVQA 1LRTA 4J27A 4CCZA 3C56A 3AHTA 2OG9A 3E5PA 1K70A 2PD9A 3GHSA 2YFNA 3W26A 4F2TA 2FLIA 3GNXA 2GGEA 4LUTA 4KS0A 1W9PA 2J27A 3GFYA 4PR4A 1E4IA 3QZAA 3NXFA 2NV1A 2CBVA 4A3UA 4QQUA 1V3LA 2VFFA 3R79A 2PWVA 1JL8A 4B5UA 4HMNA 4DM2A 1I2PA 3G3DA 5MHBA 4AVFA 4W85A 1RR2A 4Y9PA 1XQLA 2HWGA 2RGMA 3SRHA 5IXEA 1MQQA 4RV3A 3QTGA 4DXXA 4H04A 4O53A 1W5PA 3G1RA 3TR2A 3G0SA 2YCLB 1RQEA 3O06A 3I7SA 3MP5A 3V0TA 3VNYA 4UTFA 4R53A 2PLCA 4TVUA 3UR2A 3IRDA 3UQNA 2YL5A 5IFPA 1EP3A 1HTIA 4UCGA 3H4GA 4KCWA 3KBWA 4LUSB 5J8LA 4OBRA 1BPLB 1KLYA 4BF7A 3G1YA 4A4AA 1OK6A 1ADOA 3F2BA 1MXSA 4S3BA 1A5AA 1EZ2A 2FJUB 3RHGA 3B40A 4GY7A 3WH7A 1PSCA 3RLUA 2YZRA 1G4EA 1R47A 1PS9A 1YPIA 1GYNA 3NDYA 4V15A 5AYXA 4D6IA 3VZYA 1Q65A 1FP9A 2X0YA 3HO8A 1GPWA 3H8AA 3KDNA 4JIRA 3UVIA 4W87A 2HBVA 3DKLA 1YEYA 1ADDA 2EJ1A 1EQPA 4JX4A 1WYIA 3TW7A 2GLKA 4Q4QA 4X3ZA 2V68A 1UKSA 1TZZA 5LZLA 2TYSA 1EUNA 3WEMA 4B5NA 3O0KA 3HJZA 2INFA 1P0DA 1R7AA 3I65A 4ADTA 2ACQA 3M1ZA 4POCA 3CWOX 1FWAC 1SSGA 1O95A 1MUMA 1Q6CA 3GBDA 4YTSA 4I5RA 3DG3A 4PUWA 4K36A 5CPSA 2HVMA 4XVEA 3QR0A 4RX0A 2J6VA 4C1NA 4A6GA 4ZTYA 4TVDA 4LYPA 3ITXA 2Y1HA 2ZUTA 1TPVA 3C2OA 3ZLHA 4Y8FA 3VFLA 1UROA 4DNHA 4YPJA 4WKHA 4JQ2A 1W5MA 1WKYA 1ZLPA 2R6OA 3G3MA 3SUUA 3CZLA 5EKYA 4L4MA 3GYCA 1AW1A 1JCXA 3AIQA 3N17A 4H2CA 2PP0A 4CNTA 2ZRVA 5DO8A 1F5ZA 2RJHA 2XGBA 3R43A 3QPYA 2DZWA 1NOFA 2BVDA 1AMYA 3HQPA 3S46A 3URNA 2EPMX 3N9SA 3PG8A 1HN1A 3W2UA 3U48A 3W1NA 4N9CA 1W1ZA 3FJ4A 3OA3A 4QNWA 1PAMA 2FHBA 2OPJA 5CGTA 2Z1WA 1RP9A 1WZMA 5I5RA 4KWOA 2ZVRA 5LXEA 2G41A 1M65A 3CHVA 4LOCA 4JN7A 2X0HA 4JQ4A 3R0UA 2VR4A 2XFRA 1Q2SA 1OD0A 4L6OA 4YVVA 2QR6A 1TRIA 5A6BA 5C6MA 1K8CA 2CWNA 5A6MA 5REQA 1RP8A 4Q6XA 5A8OA 1YIXA 1RUSA 7REQB 1YQ2A 4UTLA 2Q01A 4FMVA 2C1HA 5KINA 5TAOA 1KO0A 3NFUA 1W9UA 1E1FA 2GOUA 4HZ8A 4IQJA 1W6TA 1SM9A 3VO0A 3RR4A 1A5UA 1FDYA 1PJ9A 4AZBA 3PN8A 3S5OA 3AZSA 1QNOA 5LHFA 4ADUA 3C3UA 1RCXB 4FLQA 5I02A 3DU0A 5CCZA 1NFPA 1JDFA 3WUBA 1MZHA 4HNLA 1W54A 1JCLA 3GUGA 4PGLA 4ZZ9A 3C3NA 4KT2A 4ZB2A 4PUEA 3KZPA 3SW6A 2ZZ6A 3NA8A 1VLIA 2Z2UA 3L0KA 4LFYA 4H9ZA 3CEUA 1RA5A 2J7HA 1KM1A 2ZXBA 2VZOA 3R7MA 4ENLA 1IYXA 4Z1YA 3EXSA 1V5XA 1IT7A 2ISWA 5BMWA 4GACA 4AY8A 2G4JA 4OTKA 3WBYA 1H0GA 4DUXA 1HKIA 2VEPA 3GIPA 4FX6M 3UESA 1W3JA 1EO5A 4GQGA 4JL2A 4Q8VA 2W27A 1VPQA 4BQ3A 3PHAA 2E7FA 1KCLA 4CQAA 3MWCA 3AS1A 3WBAA 5AVHA 4X9SA 1UKQA 3LCLA 4QTGA 1E3ZA 3CMFA 3BZJA 2FHCA 3V4BA 4DXVA 4CNPA 4D6CA 3AMKA 1XLAA 4JFSA 1XYFA 3N6HA 2YKKA 3GDBA 1NDWA 4A8RA 1V4YA 1S5TA 3DYPA 3CIXA 4IGSA 3VOHA 3HURA 2Z6IA 1U5VA 1UWUA 2VWTA 3M6YA 4PMVA 2ZOXA 2GDVA 1FA2A 3LLDA 4Q8OA 3PY2A 2JKEA 4FXRA 3URQA 1DJIA 1TA3B 2I17A 4HJFA 3OG2A 2Y8VA 2JIEA 1MNSA 1VQTA 2VRQA 4DYEA 4DX3A 4NNAA 3S5YA 3BV7A 4KGJA 1YE6A 3QVQA 3WLLA 4MNKA 4E3TA 3KTXA 3UG8A 3UW6A 4DJFA 5HPOA 3N25A 4DM1A 1V03A 3R8HA 1IXOA 1EA9C 4L4PA 3VXGA 1R86A 3GAYA 3BG9A 1P1XA 4WJEA 2PP1A 1XSJA 2OSYA 3FVMA 4WZHA 2GQ9A 5CZTA 1VH7A 1WZLA 3GHTA 1OFEA 1EB3A 2VT0A 3IJLA 4H9TA 5EL1A 1LCOA 3L65A 1US0A 1AL7A 1XBVA 4NF7A 3DKJA 1U83A 3ITOA 1IR2A 3WLIA 4ZENA 2WANA 1J4EA 2NQHA 3CZEA 4LUYA 1J01A 2QW5A 3LGGA 3AIVA 3LQLA 3PTQA 4NSBA 4M1BA 3S2NA 3O16A 3B8WA 3V16A 5T9CE 1TE1A 2ZX6A 3RPMA 1I2RA 1HKWA 1G69A 3EKGA 1S2AA 4H6RA 1X97A 3OPSA 4AD0A 4AD2A 3SN1A 1JRCA 2HEJA 1KTCA 3NTYA 1QRQA 2Y62A 3FAXA 1XC6A 5DN1A 1GCYA 1R6WA 3D3AA 3N12A 5G1YA 3F1QA 4KWUA 2A7RA 2PF0A 2WHLA 1JDEA 2YX0A 3CUFA 3CEPA 4LNYA 1ISYA 4U3AA 1V0KA 1W32A 1RK5A 2F84A 3AHXA 1GOKA 1TWIA 1QVBA 4HNVA 1H51A 1BWLA 4AW7A 1LF1A 4KEZA 5LYRA 1CLVA 3E2QA 1KGWA 2J66A 1TR1A 1TZ9A 4B4HA 4D2JA 1Z9AA 3EWCA 3LPGA 1NFBA 4YCPA 2EAWA 4DF0A 1E72M 3KW3A 2G3NA 3UG4A 3WN6A 5C9XA 3RRXA 2GGGA 3IIVA 3TQ0A 3NZPA 1AJZA 3HGRA 4NX0A 2UZ9A 2Z24A 3PBVA 3E6EA 5CAHA 2PFHA 2OQLA 2OODA 4J3WA 2XGIA 3REQB 5XIMA 4WXZA 3KCLA 4AFYA 2CESA 3S5SA 4EPEC 5M03A 5A6JA 1ECQA 1UR2A 3T2OA 4XG1A 5BOFA 1H63A 4QG9A 2QPSA 3AYRA 5DY3A 2J8GA 4FNUA 1WNOA 2YOCA 3W88A 5HOSA 2BHZA 3W7MA 3ZWTA 5D38A 3VKDA 4K1GA 3U2CA 1FCVA 3PPHA 1REQB 1JDAA 3RMEA 4LALA 1VPYA 2C18A 1YPFA 4KH2A 4Q8UA 3DHPA 2YJQA 2HVNA 3ITYA 3WQOA 3MO7A 1H50A 5HINA 1K7FA 3OG3A 1WUFA 3QZEA 1DWFM 3W1QA 4AF0B 4KPLA 1W5OA 2BXYA 4GG9A 2BY1A 4PODA 4DELA 4WSHA 3GC2A 1VKFA 1RPXA 4MAVA 5G1MA 1F6YA 4CD7A 3UG5A 4OGZA 1E56A 2FZ8A 4XD5A 2VC9A 4W8BA 4CCDA 3RILA 1I9CB 5AHLA 2OSWA 2PLJA 2Z1KA 3GVVA 1YTKA 3B4YA 3L68A 1GZJA 1FH9A 1TPC1 1B54A 4ECLA 1V93A 3S83A 1FP8A 1H60A 1OBAA 4QCEA 2E9BA 1OJXA 4FZIA 3IPWA 5A6AA 4S3JA 2AMGA 5KEZA 2UWFA 3OYZA 3QR3A 1LBLA 3MUY1 2D1ZA 2ZWZA 2BVWA 5I3IA 1TPDA 4M6VA 4HA0A 3O6YX 3GYEA 2G8ZA 4Q4MA 3HG3A 3MY9A 4L1GA 1W3TA 3ISIX 3ALFA 3KLKA 5HJXA 4TR9A 2YGYA 2F6XA 3NO5A 5G2WA 3HIJA 3OB8A 5A5WA 1U33A 1F3EA 1ISZA 1FQ0A 4FLSA 3P80A 1EOKA 4RZBA 3A4WA 3KRBA 2TSYA 4AIEA 2CHNA 3EDDA 4WOZA 4A21A 3T55A 3GK0A 3FCPA 3UZWA 3CC1A 4FF5A 4PEEA 2UY4A 3CMGA 4WSKA 2QCNA 4JS3A 2R1PA 1SO3A 1PV8A 3SGZA 4P8XA 3U7BA 3NL6A 4UZSA 1WCGA 2I5IA 1A4LA 4QIUA 1LOLA 4WKAA 1Q3NA 3VIIA 3TUUA 1XGDA 4HVXA 3KVMA 8CGTA 3W83A 3RFAA 3EMZA 4CN1A 1JXKA 2V8ZA 3CO4A 5AC7A 2XZ9A 2PDLA 5CZKA 5FSDC 1WXZA 4M24A 3WMLA 2WJFA 1LG2A 5KMYA 4AH7A 3TC3A 5B7ZA 1KB3A 1OF8A 2DEPA 6ENLA 2Y4SA 3EX4A 3FYYA 1L6SA 4QS6A 4W93A 3UEQA 2VQUA 4O15A 4JHZA 1EKOA 3LY0A 1OEPA 1WA3A 5GJPA 4GUHA 3W2LA 3GXMA 1MSSA 3KS5A 2VEIA 5TNVA 4AWEA 4GYKA 1VIZA 3A5FA 5D32A 2WLYA 4H3DA 3TV8A 4GI8A 2J7EA 4EK7A 3B0UX 1J5TA 1Q6LA 4FEZA 1FWCC 1JJKA 2YDSA 1RLDA 4RLIA 4J28A 1PO9A 4IJCA 2WO5A 3PTDA 2WHKA 2OEKA 4PC8A 4QJ1A 4EIVA 3FVDA 3LRLA 1QI3A 1JULA 3ZZ1A 3ATZA 4Y96A 2REQB 4IF2A 1WKFA 1RVGA 4LU0A 3B9EA 1QW7A 2GOKA 4L9XA 4P5UA 5ABFA 3LHWA 2Y24A 4AXNA 1ZUAX 9CGTA 2NXHA 3GS6A 4GMEA 1V02A 4DAIA 4FIRA 3ANVA 2ZC8A 4C6LA 1DIOA 1K4GA 1R3TA 1KGUA 4GIRA 4GH3A 3FW6A 2P5NA 4CD5A 2V3DA 2OFJA 3SJNA 5E0KA 1IIGA 2PS2A 4O50A 5E9AA 1ZSXA 3HG2A 2VDHA 3WQ8A 3CPUA 4FR1A 3LA4A 1MW0A 3EWYA 1LQ0A 1JGIA 1WDWA 5HNNA 3MYPA 1ZU8A 3VM7A 3AYTA 3TYCA 3TFCA 2TAAA 3CL6A 1I1XA 4PH6A 1Q6DA 3U57A 5G4HC 4MUZA 4S39A 2BOEX 5CZJA 3P67A 1ODZA 1JQVA 4FNSA 3GU9A 4Z0JA 2ZX5A 1IT8A 4C6QA 1WDSA 4M3PA 2GJRA 2IPFA 2CHRA 1V79A 5BYWA 3SCWA 4R27A 3NYDA 3O8AA 3CB8A 2DT1A 5EU9A 3R11A 4BZYA 3VGBA 4ZSTA 1WO2A 5DF0A 3PP7A 1PEZA 3CUJA 2J9XA 5HPCA 1ENUA 2CLPA 2D2GA 4Y6GA 1EGMA 4GUGA 1HJVA 3M43A 1KRMA 4HP5A 4IFKA 2ZX8A 1JZ2A 4HZMA 4UOQA 4DHGA 1TVPA 4W5UA 2F6KA 4DBUA 3VYLA 1MRAA 4KFNA 5CPQA 3WBWA 3VD5A 4HGXA 3RM4A 1LLWA 4C6MA 3LTYA 1Y5XA 4H7ZA 1F3XA 4EE9A 1SPQA 1J5SA 3UJFA 3ZVHB 4UFLA 3N18A 2ZTJA 2ACSA 1AZ2A 2G3JA 3WFLA 3OIHA 4IP7A 5I3KA 1QJWA 1MDRA 2DT2A 3GM8A 1J93A 1DWAM 1ZJIA 2OJPA 2EO7A 1EC8A 1A0EA 2DY3A 4P8UA 3AISA 4CN6A 3OZYA 4I6KA 1Q8JA 4BWLC 3VKJA 5JU6A 4DBWA 3B8UA 1UIOA 2EQDA 2ZZ7A 3M0LA 4CQDA 3CM4A 3DZ1A 1J9YA 1ZAIA 4FF7A 3MO4A 3GB6A 4KBXA 1W3NA 2G97A 4K6AA 4DYJA 1DL3A 4QR6A 4ADSA 5CGQA 2A3EA 1W1B1 2B4GA 3PAJA 3STPA 3U8GA 3W7CA 3H4XA 4S3KA 4R88A 1S5MA 1VPXA 3QSRA 1PWLA 1FWBC 1KCZA 1T5AA 3IANA 1EX5A 5KZDA 5FIPA 2VJXA 3N6JA 1CYGA 1QI5A 3H2CA 3ZYZA 3NXLA 2CBUA 4A3YA 1X6NA 2FTPA 3G1AA 2VEKA 2X2YA 3SBFA 1F3WA 5EMUA 2HE5A 1XKJA 2ESCA 1SMAA 3TEVA 1J0ZA 3T1GA 4MFEA 4UTTC 1XBXA 1G7VA 1WPCA 4MY9A 1L6FA 5H8PA 4XAYA 5LA1A 4JYFA 5DLCA 3MB9A 2PDJA 1C8QA 4IWWA 1O68A 1LT8A 4RNIA 5HQLA 1VYRA 3QTPA 3F2DA 1KR0A 5U4NA 3BAWA 1E6XM 5GNXA 3SB0A 1UPMB 1KFLA 2VCCA 4EXBA 3ABRA 4LEFA 4IGHA 1OHLA 1LQ2A 3PULA 3ZJ6A 4N42A 2QUMA 3N2MA 2B7NA 2PGWA 3B06A 2HZGA 1NVMA 4DI8A 3LUTA 2I9EA 4ATLA 1CXKA 2ZCGA 4AZCA 2A3CA 4A2RA 3WQVA 3M7WA 4EPDC 1N8IA 2AL1A 2J9ZA 1XKYA 2G5WA 3DXIA 3PANA 2Z29A 3KXQA 4RK8A 4DB7A 1CIUA 5BNKA 4UFJA 4QEHA 1N7KA 3I3BA 3IK2A 3DEQA 2V82A 3KUMA 1J10A 1T0OA 3ZR6A 1XYMA 2B7PA 2QCHA 3VDAA 3W3OA 2PLMA 3SUWA 1UWIA 3ZT6A 1US3A 2H6RA 1JYWA 3TTYA 2VKZG 1EWDA 1F4AA 1NP2A 3GW3A 2Q71A 4PUJA 5AN7A 4HKPA 1SO4A 3W74A 3WQ6A 3L5MA 3Q4DA 4Q6JA 4NZFA 1CDGA 3R8RA 4NJKA 1TUXA 3KOZA 1VRXA 4REQB 3MSDA 3B8SA 3BQ6A 3PNZA 3Q58A 1W1YA 2IXUA 1LUCA 3H55A 4S3DA 3VOGA 4S3CA 1B3YA 1TPUA 2XHYA 3HZ3A 4MOZA 5IHRA 3MUZ1 1BLIA 3KHDA 3Q37A 3KCOA 3PB2A 3JUGA 1Q6EA 3EWUA 2DQXA 5I3FA 4CU8A 2VENA 1YDYA 4R9OA 5A6LA 2Q8LA 4P7OA 2HRWA 1CPUA 5KITA 4WR3A 4EACA 4UTHA 4R7WA 2PGFA 2BASA 1ME9A 4JY8A 3UGVA 4K37A 1J18A 4ZFMA 4CD6A 1E1CB 3VNMA 2XFWA 3L0GA 3NQMA 2B7QA 2PMQA 1PYFA 4HHLA 5DBTA 3WQDA 3JZUA 1A3WA 4E38A 4IGMA 4IIBA 4IICA 2VEFA 1G4SA 4JTHA 4GFSA 5F4XA 2QV5A 2YCKX 1S2VA 4AWUA 5GQBA 1XLHA 1GQLA 2WBGA 1HZYA 1LBMA 1W5NA 1FDZA 3W7PA 2CETA 2ISVA 3C2RA 4ZR8A 1H5YA 3D6NA 1PB0A 5C54A 2RDUA 2IKIA 2X2GA 5AZ1A 3W29A 4HNOA 3TTOA 3MJMA 1A53A 5FJRA 1M7XA 3V1HA 2IQDA 1AH3A 3F7JA 4ZO7A 3DFHA 5CSSA 1ZRQA 3P62A 4MB1A 4RE3A 5MF5A 1B5TA 4EAYA 2C13A 3USBA 3CLWA 4X9YA 2ZYFA 3WQWA 4ZVJA 1CECA 1U5JA 2XH4A 3TU9A 2H90A 1JFXA 4NZ4A 5CJNA 1KBLA 3WF1A 3PJUA 3E1F1 5TIMA 1ISVA 1L8NA 3UT0A 3KP0A 1K8XA 3U3HA 2FFIA 1RCOB 1KFKA 2FGBA 3BLPX 3WQEA 3UZ5A 4MZ1A 3BG3A 1XLKA 3U6WA 2WLZA 4GJJA 4RDWA 4HSHA 4IMGA 3ZSTA 3NOEA 1RY0A 4DWSB 1W91A 5DY2A 3H26A 1S2WA 2J7DA 3CO8A 4XV0A 4ZXOA 1A3HA 4GH1A 4O52A 4GYJA 1KBBA 3DDMA 2ATMA 4JR5A 4RDZA 4J4KA 3ZR4A 1RJPA 3SIMA 2NQLA 3HG5A 5HNRA 2RUSA 3CYJA 3GFXA 3ZO9A 3TJXA 1XIFA 4DPPA 3MKKA 3VAVA 2PTZA 1TG7A 3CUIA 3WFZA 3WD0A 4GCXA 1RBLA 4JTEA 4GX9A 3M0MA 3Q2DA 4MAZA 3SCTA 3EWWA 1FUYA 1E9ZB 3HQ1A 5IRPA 1OM0A 1TJPA 3L9CA 5U7SA 2E3ZA 5BXRA 2YW4A 3OU8A 1J0YA 1B9BA 1XRTA 1CGVA 5KZEA 1FWNA 1KFWA 4JBRA 1PIGA 3FS2A 2PSNA 3BE7A 4UTMA 3LMZA 3ME3A 2BBFA 3IEBA 1NWUA 1BVZA 3L21A 3UWEA 4ZB0A 1PDZA 4N4PA 3MYOA 5LKYA 3UG3A 3DHFA 4XK2A 2P3EA 5A1AA 3THCA 1MRQA 1SFLA 1VBHA 2GVGA 5CC3A 4NYYA 4UQCA 4O12A 5XIAA 4A8IA 4PL1A 4B5SA 1CXEA 1DJHA 1SFTA 3TWBA 1HQTA 4LAOA 3FK4A 1GORA 2JGQA 1CI1A 3FFSA 1K4HA 3MBFA 3N2TA 4I5XA 4AY1A 3FHAA 1TO3A 3L4YA 3RITA 2J13A 2WMHA 2ZA2A 1OABA 1GKQA 1IEWA 1SVDA 2FGZA 1XGZA 3IIPA 3B8DA 3UWQA 1FWJC 1ZNNA 4Q22A 2YBUA 4JOMA 2DH3A 1IIHA 2QCLA 1U2YA 2DSKA 4OECA 7PTDA 3QQ1A 4AG0A 2HK1A 2CKRA 2BVYA 3UWWA 4K8HA 3RU6A 2ZE3A 3H2OA 3EA3A 5DCEA 1R8LA 1KFEA 3SUVA 3HGOA 1KRAC 1AL8A 4E8CA 3QW4B 4W89A 5D2YA 4JX5A 4IHCA 1G4TA 1V6WA 5JBFA 4AX7A 1A5NC 1PKNA 4H9VA 4A3HA 1QHOA 2XINA 3MP3A 1TWZA 4JIIX 4GC3A 2YA0A 1Y5WA 3LCFA 1EEXA 5KZ6A 3WF2A 3W2MA 3CGTA 3VKAA 2IKHA 1B30A 1OT2A 3PJTA 2BXZA 1BAGA 3SCNA 1RAKA 4C1NB 1A5OC 3W2KA 1QOXA 2VGGA 4NAEA 5AYYA 1FCQA 3BUVA 1BF2A 3ARUA 5C5YA 3R4IA 3N4AA 4HPHA 3RPDA 3TYZA 4HBKA 3S2MA 3AHVA 3PZNA 1PZ1A 1VYSX 4IH3A 4Z2JA 3DERA 4PRRA 2BG5A 2XVLA 1YDVA 1Q7ZA 4GLEA 5A2BA 2J8FA 2QCEA 3GDTA 3NQ6A 3QV6A 1AMKA 2PP3A 4BWLA 1RSCA 4IGNA 4XTDA 4PRWA 2W91A 4GGHA 1RXOB 3URBA 1GGOA 1L0PA 3K1GA 4LS0A 4B5TA 5LXXA 1BYBA 4OJYA 3FA5A 2CLLA 2OO6A 3H12A 1NWTA 3GO2A 3M47A 3LX9A 1W3KA 1V0MA 4P61A 2PEVA 1O5XA 2O56A 5AY7A 3WJZA 1ZBCA 2P8CA 2WSYA 4UQEA 3W22A 2OELA 3W2JA 5CC6A 1JYXA 5EMYA 3CL7A 1FBAA 4BI6A 3QY6A 4BF9A 3UCCA 2PZ0A 4DJDD 1QHPA 3LZ5A 2DZBA 3W81A 2Y70A 3M0HA 4D8ZA 1IE7C 3LN3A 3M0XA 2QJHA 3FA4A 4B3LA 3VPLA 4UTTA 1EC7A 4HD5A 4E4UA 3HA1A 3MS8A 2XYLA 4Y9OA 8RUCA 1ME7A 1VF8A 1PKYA 5CJMA 3T07A 2YLAA 1H62A 1B2YA 3DG7A 2X1TA 3G6MA 4I9AA 4GUIA 4ZO6A 1XIJA 3ARXA 3DOPA 1N2VA 3TA9A 3S8HA 4LV9A 4GWEA 1P0NA 1LLZA 5T8GA 5I03A 3BMXA 3FSUA 4EOUA 3WK2A 4B15A 3LENA 1PZ0A 3T6CA 2VURA 3CUXA 3HOJA 2KX9A 1W9DM 4IL0A 3QXBA 3ZXWA 3VNIA 3AIWA 2OQHA 1XI3A 4IG2B 1P0BA 3U4AA 3YPIA 5FJIA 3CTLA 3S9IA 2C0AA 3GTNA 3AFBA 3WNNA 2TMDA 4PUDA 1QK0A 4H9MA 1S5VA 1VRDA 2BB0A 1JPMA 3A9IA 1C8XA 1JR1A 1BQGA 4WX2A 3LGDA 1I2OA 5CZSA 1TVNA 1UD2A 2Y2WA 3WH6A 2C14A 2JGYA 2X8RA 2INZA 3M0ZA 5A6TC 2IQ0A 3TW9A 2EEXA 1GTEA 5FI8A 5I00A 3G1DA 4F3HA 3PM6A 5D05A 1X1NA 1FFRA 5M17A 9XIMA 2X30A 3WSUA 2A0NA 6XIAA 5G4EA 1XLIA 2V5LA 3MHFA 3FIGA 3EDJA 2F2KA 2OLAA 4YWIA 4O1FA 4K39A 4MVAA 2BS9A 3SSZA 3ZSSA 4M6UA 4O1EA 2BGSA 2ABAA 2VQTA 4GQRA 1JZ3A 2I9UA 3EPMA 5FF2A 4RXGA 2DJLA 2R1NA 4Q7NA 3S1VA 4N6FA 4MNMA 1F8IA 2YSWA 1R3VA 1S5WA 5JBEA 3UFYA 3KM8A 5IBXC 1IQ8A 2CIPA 3MU7A 2CBJA 3TXZA 4YL2A 4H83A 1G5AA 3T4WA 4ICMA 5JH2A 3W9ZA 4KEUA 2CZ5A 2PCEA 3BV4A 4PMOA 4JNMA 4LAZA 1O4UA 2Y63A 3S2CA 1P6CA 4OZOA 3UCQA 2X05A 5I0DA 1TWSA 1PXGA 4M80A 1XCWA 2BV9A 2YYTA 5FD0A 4ZCWA 4Q7IA 3T4CA 2WVUA 3B04A 3BK0A 4MSSA 1G6CA 4WRHA 1NQKA 1Z3NA 3KBMA 3BJSA 3UGRA 4FNTA 3OYXA 1JRBA 4E2DA 1WBHA 3C86A 2QKFA 3SY5A 4D72A 1ZGDA 3L67A 4DYKA 1X7FA 4DPQA 2QNEA 3L4TA 3IS4A 1ONWA 4AZGA 1M04A 4ZQCA 4G7EA 1JPDX 1R87A 1Q13A 3BLOA 3GDRA 4XO6A 2HXTA 2P53A 1WP6A 1XRFA 2QUUA 2WSRA 4ZO8A 1DWJM 1HGWA 4G1KA 1QATA 1A50A 2D24A 2E5BA 2D3NA 3UJ2A 3T0AA 2QJGA 4PMNA 1R9YA 4K8EA 1HFBA 4B92A 3WENA 2E0PA 3GVGA 4YVPA 1TSIA 1XCFA 1UCWA 1XBZA 3NQBA 5DRIA 2WJDA 1HKJA 3VIJA 1XYZA 1PPIA 1KA9F 1M9HA 3QHMA 2FVKA 1GVIA 4GI6A 1V3HA 4MB4A 4GHRA 2C1GA 5CAKA 4I9JA 4DO7A 7TIMA 1XSIA 4Q4PA 3ATYA 3QLLA 2VCAA 5D9PA 1NDZA 4RDVA 3UZZA 3F5JA 4H41A 3W87A 1SZNA 4P8WA 3OP2A 1BQCA 2YL6A 3PWIA 3CU2A 2PU0A 4GUFA 5GNYA 5H8MA 3PPGA 1DQUA 4J3SA 4NY2A 3EDFA 7ODCA 1GVFA 1OYBA 3A4AA 2CLKA 3PC0A 4Q8MA 2QPXA 1VLWA 4WGXA 4CCCA 4NASA 3WJXA 3CIVA 1ZTVA 2GDQA 2V63A 2RDWA 2PA6A 3LB0A 1O7AA 2ONEA 2I5QA 4K3ZA 3RO8A 3V75A 2X41A 4JEJA 3UU0A 2ZC1A 3GR7A 3OODA 3QHOA 1OX5A 1H5VA 5C9ZA 7CGTA 2WW5A 5M2FX 2HQAA 3PF3A 1FWSA 3C0SA 3G1HA 2OU4A 4UOJA 3N29A 4UNKA 1JZ5A 2GK1A 3U2ZA 3T0DA 4HU3A 4I5UA 3CUGA 3OTRA 4UQDA 1RPKA 2EPLX 3W1MA 1W37A 3W1AA 2Z1VA 1KQYA 1WKDA 4JTIA 4PCPA 3XISA 1M41A 2VO5A 4IUOA 3HPFA 1L6YA 3KRSA 4LBUA 3W02A 1OX4A 2ZQ0A 2CCRA 4FALA 3NQGA 4P7RA 2VNCA 4GQ0A 1ZPTA 1W1VA 2POTA 2YYUA 1Q6GA 2Z27A 1I6NA 2XUCA 4HJWA 3AALA 1QUMA 2NT1A 4YTQA 1O5KA 2IPGA 5J5DA 3CB3A 4IFOA 3GXFA 3IUDA 1BHGA 5D9NA 1ADSA 2NQ5A 4OBSA 1QHZA 1WB0A 4FI4A 5I3GA 2BTMA 1J2BA 1GVYA 4JDYA 3H21A 5LNWA 2F7FA 1P0EA 1VBRA 2PWEA 2FHFA 2DP3A 2A2IA 3LXBA 1EGVA 3R8GA 4PMQA 4ZQOA 3N73A 2XIQA 3VZZA 4V2XA 4UBPC 1MNZA 2VEMA 5BU9A 4KMQA 1M68A 1B4KA 2O4QA 1DTUA 5BOEA 1A5KC 4NAFA 2Y61A 3S9YA 4HU4A 3W1UA 3BXWA 3GKFA 2PI6A 1W2PA 3WX7A 4URIA 2DIJA 3U9IA 4R33A 3OVGA 2YFOA 1F76A 5GJMA 4LRSA 4ZOBA 1E40A 4H9UA 2ISFA 4DO6A 2PURA 3MT1A 1BD0A 3MDWA 2PDKA 3CMJA 3CPRA 4KIRA 2IS7A 1NOWA 4CU6A 3QV7A 2CWXA 3WLPA 1VHCA 2Z00A 3TMLA 2CNCA 3IGSA 2XJ7A 4ES4A 2UY5A 2CLIA 3JR2A 1DWGM 2JEQA 3LHUA 2FH8A 1HIZA 5D9OA 3DN5A 5LA0A 4JTFA 2WM1A 3ABSA 3I7RA 3MUCA 2BHYA 1C7SA 2Z2AA 3WNPA 2WMIB 3OLGA 4S3FA 4A3QA 3UBPC 1JNDA 2A6NA 3IV8A 4QP0A 1G01A 4KWSA 4ZOEA 2PC4A 3P61A 4QLJA 4YYCA 2VZUA 1Q66A 3EB4A 4EWJA 3LSBA 2CLFA 4AZ7A 4WIWA 1FKWA 3ICJA 2CKSA 3GWQA 4K68A 1LL7A 3WLKX 3H7RA 4NUWA 1ZBWA 1OD8A 3NEHA 3VKKA 2W5FA 4AVOA 1G4PA 2C3ZA 3ARQA 3BQ5A 5DFAA 3WMSA 2F2HA 5ENLA 3PG9A 3H2MA 1EH9A 3LHVA 3TYDA 4JPGA 4V1YA 2AL2A 5HUOA 2HCVA 1SO5A 3HB9A 1R46A 2PWGA 1V6XA 3VIPA 3BW3A 1XIHA 1TREA 1LT7A 3SQSA 5DQPA 5AYZA 2OCZA 3R1ZA 3UYIA 3KBNA 2ZTKA 1PZ2A 5G2IA 2Q8ZA 4ML9A 5CKSA 1GQKA 4AD4A 5D4YA 4JEQA 4R34A 4G9PA 4F0MA 4RXFA 4US5A 4JIPA 2DH2A 1XFBA 2ALRA 4YNGA 3WD1A 3TX9A 3W25A 3AS2A 3VD7A 1NEYA 3WUEA 1BF6A 4IMFA 4TQTA 4RCXA 4MYXA 5GPRA 4QFUA 3BW2A 2EKCA 2QGHA 1YPXA 4M29A 6CGTA 4O8RA 4GXMA 3AMCA 2OEMA 1MW2A 4RUBA 2C7FA 2OT0A 2DJXA 1YXYA 1YW1A 4OVXA 1C29A 2BY2A 2QDDA 1LOQA 1OC7A 3SN0A 4C7GA 6XIMA 2NUWA 3DHDA 4PEKA 4GBDA 3NYZA 4JAWA 4DWSD 1XUUA 3CAQA 3U2OA 3VIHA 1QNRA 5E5CA 1K7XA 3LS9A 4JL1A 4GC4A 2Y8KA 1QTWA 4H1ZA 1J8VA 1CGTA 3WDRA 4LVGA 4XVDA 3S6OA 1DOSA 3E0IA 3AUJA 4HYVA 2NVAA 3SO7A 1P48A 4Z1DA 3IGUA 3AXKA 2ZFAA 1CTNA 2JQXA 4MM1A 3OBEA 3P93A 4UR7A 1QOQA 3HU7A 2DORA 3O07A 1DQXA 3A4XA 3TCEA 5AOUA 4GFIA 1EQCA 1XLBA 2DT0A 4BQ4A 5I06A 2ZVIA 5IBXA 5I6SA 4H01A 1FXPA 4O14A 1RH9A 3BCJA 1UD4A 1UJQA 3CNYA 1TCDA 1UZ4A 3NSNA 3OBKA 4HIBA 2X1IA 1BG4A 3OVPA 1X38A 5C8BB 3A4JA 2BSLA 4IFKB 4MYAA 1TV8A 3VOIA 3WD3A 3GSMA 4A35A 1J0HA 4FXFA 5I23A 4JQ1A 3VKBA 3E0WA 2VD8A 4E6MA 2QEZA 4XTIA 2C16A 1A5SA 3WJYA 4HCHA 1XLDA 2JFEX 3AXHA 5F2IA 3SAZA 4CNSA 2D2HA 4UXDA 1VJIA 2J8TA 3OBAA 2X1UA 1AK5A 5D2VA 3QHNA 5AC5A 4WY0F 2ZRZA 1HO1A 1V6YA 4TTGA 3EGJA 3SECA 4IPPA 2DUXA 2QCFA 3IIZA 2CZEA 3BANA 4LY8A 1YDNA 4F66A 1TJ1A 3NSMA 3VE9A 2Z25A 1LL4A 4NHVA 2DUZA 4B4FA 2X16A 1SZRA 3I4EA 1XC4A 2EHHA 3P5ZA 4M7TA 4BJHA 3WDQA 4K8GA 1A80A 1NWSA 3LXAA 1B9ZA 1MUCA 4X63A 1CZ1A 5RUBA 4OBTA 3L4UA 3EB2A 1MYRA 1OC6A 1RQBA 6PTDA 1XD0A 2HE8A 1W5QA 4IQDA 1TJRA 4LVBA 1J0KA 1CX9A 1XH2A 2CC0A 3NR0A 5D03A 2ZUVA 4I7WA 4H8VA 3CWHA 3DHUA 3EX3A 4MG4A 4UCFA 1H7RA 4KW2A 4ZO9A 3WNLA 3GVRA 4I6VA 2O9PA 5H2ZA 1DJGA 2QJMA 4BEQA 1BTMA 3C61A 4LUSA 4IJRA 3KRUA 4PTVA 3TKFA 3VX1A 2AMXA 4BS0A 1EP1A 2V2DA 3DFOA 2OGYA 3AS0A 4F9DA 3DFSA 3O05A 4NNCA 2AQVA 3QM3A 1Z42A 5F2MA 4AQLA 1Z41A 3C52A 5IM51 1MFVA 3ALGA 3XINA 4N9BA 4JD4A 1RBOB 3W38A 4WK9A 5A2CA 4I7VA 1QWGA 3BVJA 3AC0A 1OF6A 2WMFA 2VCBA 2NVCA 1PVNA 2WKGA 3TW6A 1EP2A 3NQFA 2Z1BA 3OW1A 3PVFA 3K8MA 1F7BA 3MV01 3WH5A 3H2EA 1KRBC 4XBJA 1GQJA 5IDIA 4IL2A 1UR9A 2KAUC 5CXPA 4GUJA 4C5YA 5HNTA 2FVMA 2Y7DA 4ZL1A 2B81A 3TQPA 4TMCA 4FOKA 4KERA 5E9XA 1OT1A 2PF8A 1NDYA 1LQAA 4PFHA 4AZCB 3DIPA 1K02A 1OYCA 4LANA 1KXHA 1QPQA 4LRTA 3TC6A 2H9AA 2BDQA 5A6BD 3PSVA 1R5YA 2DQWA 2WPBA 1JUEA 3UJRA 3VFCA 2WMKA 5JXQA 3MSYA 1AQ0A 1MDLA 2CLMA 4PTDA 2BY0A 3W7LA 3U5YA 3GR8A 4MPQA 2V5KA 4DJDC 2D22A 3A3XA 4KF1A 1GQNA 5HWNA 1PCKA 1UBSA 4KRUA 1RZMA 1DIEA 2DPEA 2ZKMX 1JUBA 3L2MA 3RGTA 1XICA 3JU2A 4F9JA 3EPOA 4GQBA 3E2SA 4DJFC 1SZGA 3CLMA 1H7PA 2ZUWA 2V5BA 2A85A 1W9XA 1UZ1A 1UKPA 2F8QA 2V5JA 3SCSA 2PWDA 1Q7MA 4JTTA 4MWAC 3PZTA 4US6A 4FOUA 2HS6A 4C6EA 4ML4A 2VFDA 4RR4A 2GSJA 1WOAA 2ZDSA 4YN5A 2DW6A 4EF8A 1GOIA 4K1WA 3W6YA 2HNHA 3VE7A 3WDJA 3MV11 5IHSA 3LPPA 2FZMA 1GEHA 3ZT5A 4G5DA 1DWIM 5C71A 5CBIA 1DJNA 4JY9A 4CEXC 4B9ZA 1LUCB 4DVOA 3GH5A 2BZNA 3V1PA 3VOFA 2WV8A 1GPFA 2BGQA 3RDKA 1U1UA 4Z17A 5A8GA 2PB1A 1UWTA 4P7NA 4PTXA 1XIMA 3GE7A 3LV6A 3VIFA 1L8PA 1XLEA 5SWUA 4NL1A 4HCDA 4GVHA 3VGDA 3IACA 5FA5A 5L9FA 3W01A 2R1MA 4E2BA 4LNCA 3QH2A 3FKKA 2FZBA 1UP0A 4XKMA 1JZ6A 4UFMA 3E0LA 2DU2A 3AI0A 3R6IA 3B9DA 4UWMA 1BWVA 4GX8A 4JHOA 3G0UA 1LROA 3WDIA 3CZJA 2VFEA 2C0HA 4OOZA 2EPOA 3HV9A 1POKA 2H8ZA 4L4LA 4W84A 1X6LA 3RG6A 4MLRA 3LBOA 1FWFC 1UUQA 3BGGA 1PTGA 5TQLA 1PYMA 1UUMA 3NCOA 1M7OA 3NVDA 4MJ2A 1CW2A 3G1FA 1SMDA 3GZ3A 3QSTA 1NSJA 2ZUNA 3GXIA 1V02E 1SZEA 4F0RA 3OGRA 4PE8A 1KR1A 4FOJA 4DLFA 1XWYA 1M1BA 2D2OA 1MFUA 4PTWA 4M1RA 3AAMA 3HQOA 1XH0A 3LMYA 1A5MC 2YIHA 2QVNA 4A8LA 2VC6A 3ID7A 3HG4A 2FVLA 1V0NA 1TTJA 3W24A 3FEQA 1SW7A 1HXJA 4C1KA 1I0BA 3TWAA 3VINA 4H9YA 1P43A 9XIAA 2YDRA 1W31A 1XFCA 4FA3A 2OXNA 4Q32A 5MKGA 4UFHA 1MXDA 4GBUA 3ORWA 4L80A 3O2LA 3OGVA 3CZGA 2C6QA 1B90A 5FAGA 2WVVA 4L7ZA 2QHAA 1SFJA 4IMCA 1YX1A 3LCHA 3I10A 2YCEA 3HQNA 4ZOAA 1F2JA 4DUWA 3ZT7A 4WHBA 2AQOA 4LBRA 5FCZA 5K7JA 1H61A 2V69A 5AZ0A 1QPNA 4F48A 4MNLA 3FJLA 1PHQA 1OFPA 3RM9A 8TIMA 4ALDA 2J74A 3O1NA 1JZ4A 1NDVA 3E0FA 1XH1A 2AAAA 4LXFA 4NILA 3WQPA 4HK6A 4C91A 1PCWA 3RCYA 1QCWA 4Z1BA 2FZDA 4MTVA 3K4WA 1GG1A 3EPNA 3NOYA 1NFGA 2QLYA 4TX8A 1L6GA 4LB4A 5I77A 2HDJA 3BLLA 3WDPP 2FH6A 4PMRA 3WLOA 1DXIA 5D9MA 4GGBA 3JVAA 2OOGA 3FSTA 5D8ZA 3S42A 4IZGA 3FX4A 4JYDA 1GQIA 4R5EA 1H1YA 1A49A 1AQMA 2PGEA 1GVEA 4X22A 5KTLA 5FF4A 4WVXA 4HNCA 1TYGA 3PFMA 3NGJA 3SFKA 4FNQA 4Q8TA 4YTRA 5ABEA 2EG6A 4RZ5A 1OQFA 1UOKA 1CGXA 4FXJA 1E4MM 3VIKA 1EJ7L 3AJXA 4HK7A 3WYZA 3BURA 2XIOA 3QZ6A 1RBAA 3MUXA 2YBTA 5TD4A 3W85A 1OZQA 1XIEA 4XUGA 5ABGA 2J62A 2VHLA 4XZBA 1F3TA 4MIMA 4BEUA 5F2LA 2WNNA 2ACRA 2EJAA 5EMMA 2ZA3A 1GK8A 4WEVX 3AROA 4C6PA 3HJEA 2OYKA 3KOFA 3VI2A 4NJHA 1BRLA 3EKLA 4H8UA 4BI5A 1UQYA 3DAQA 2D23A 3GLCA 4RE0A 3R0DA 1UR0A 1KTNA 1BKHA 1UB3A 1S38A 1IGSA 3O6AA 5EBUA 1WDDA 4S38A 3TSDA 4EP8C 1HJWA 3EWZA 1QFEA 4ZXLA 3QF0A 2OWWA 1E0VA 1R3WA 1XQKA 3ES8A 3QV8A 2CLOA 4JZ5A 3IK4A 1ZJHA 2XWDA 4CCEA 4NAEB 2P0IA 3PTMA 1X6UA 4LAUA 1GEQA 3QOKA 3BL3A 5C9UA 3SN4A 3A21A 1OX6A 1J2WA 2D0FA 3K2GA 4R9XA 3R94A 1SU5A 2CZFA 1OYAA 3W1RA 3B8TA