3LGAA

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
253
structure length
253
Chain Sequence
MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 70
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3lgaA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lgaA02
4B17A 2DULA 2V74B 4OQEA 5HIMA 1G38A 1R8XA 3R6TA 2I9KA 4OX9Y 4GBED 1G60A 5C9ZA 4RTMA 2AOUB 1VP9A 2P40A 2P3QA 4PYLA 5EC8A 1EJ6A 3BGIA 3B3FA 1XJ5A 3EVDA 3GRVA 1WZNA 3LKDA 3NTVA 4QVGA 2VS1A 1EG2A 1D2HA 3DXXA 3KR2A 2R6ZA 1UIRA 2GAFA 3FZGA 3OU6A 4PYQA 1D2CA 1KXZA 3ER9A 3M6XA 3PTAA 1JG4A 3LBYA 3SSMA 3QV2A 3H2BA 3P71T 5GP1A 3T7RA 3B7PA 5K05A 2IP2A 2QY6A 3M4XA 3NVMB 5EVJA 2G1PA 4YUYA 2G70A 3CGGA 5E8RA 4QTTB 4HC4A 4Y2HA 1AF7A 4R6WA 3DMGA 3SSNA 2HR1A 5DPMA 2IPXA 5BW4A 2FYTA 5IKMA 1KYWA 2FK7A 3LDGA 4PIPA 2IBSA 1JQEA 3E7PA 4QTUB 1ZHFA 2VDWA 3FUXA 5JR3A 2AR0A 3TRKA 1VIDA 3UZUA 3G2OA 5CUQA 4ER7A 4P7JA 4QDJA 3L8DA 4L7VA 1YB2A 2JHAA 2AOUA 3LDUA 2C7OA 2IFTA 3P9IA 1AV6A 1RI5A 4E32A 1TPYA 1U2ZA 3DLIA 3BWYA 2OB1A 1L3IA 2AN5A 4PYIA 5LSAA 3EVAA 3KQWA 5GWXA 3OFJA 1Q0TA 4PGHA 4ER5A 2PX4A 3A25A 1EQAA 3VYWA 2YTZA 1NW8A 3CJTA 3EEOA 5EHGA 3P9NA 3RW9A 4YUVA 3TOSA 2NXJA 5F2NA 5ICFA 3JWGA 4GC9A 2C7QA 4RVFA 2AS0A 1M0EA 2IH5A 1FBNA 1RI1A 3DULA 4EK9A 5E1OA 4AUKA 2OBFA 2Z6AA 1Z3CA 2N47A 3KPVA 5K03A 4XCXA 5EGSA 3ELYA 2Z6QA 5EOVA 2O06A 1HNNA 1ZGAA 4AZWA 2AVDA 2QE6A 3ANXA 2XYQA 3OFKA 4XUEA 3TKAA 3PT9A 5FQNA 2Z6UA 3HVJA 1XDSA 2P35A 2HV9A 3FYCA 3LPMA 3O7WA 4LWOA 2ZLBA 5C0OE 3ER8A 3R9XB 1QANA 2HMYB 5E2AA 5F2KA 4A6DA 5LQRA 5ICGA 3GRYA 5DX8A 1MJFA 4RTNA 5EIFA 4R6XA 5K01A 2ZFUA 2ZBPA 1Y8CA 3CC8A 4EVIA 2BM8A 2H1RA 2NXCA 3DR5A 1NV8A 1VP3A 3IYLW 4KVZA 3UFBA 4FSDA 1XDZA 4LWPA 2CL5A 1BC5A 3A27A 3AWIA 3E05A 2EX4A 3G88A 3OPNA 4OA5A 5T6BA 4E70A 4E30A 4KRGA 1YUBA 4P58A 2FRXA 4EKIA 4JXJA 2G8NA 4RVDA 5DM2A 5FADA 5EIWA 2C7PA 5DXJA 3GCZA 1QZZA 1QYRA 3HVIA 5FUBA 2GLUA 2OKCA 1KR5A 4RSRA 4PNEA 5K0JA 5E9WA 4CKBA 2A14A 3KR0A 5DLYA 5FTWA 1KPHA 4EQZA 4BLUA 3PS9A 5EEGA 5BXYA 10MHA 1WG8A 2YXDA 3PLAE 4KWCA 1SUSA 5FQOA 5E1MA 4RTJA 5JUWA 2FPOA 4IV8A 4Z2YA 1KYZA 3FRIA 5E1BA 4IWNA 4RVGA 2IIPA 5EMKA 4ZTBA 3CKKA 5CVJA 5E1DA 4CTKA 3WSTA 1NW5A 4GC5A 5DM4A 1RI4A 1WXWA 1I1NA 3JWHA 3K0BA 5FHRA 3VSEA 5HOQA 4LG1A 3GDHA 3G5LA 1WXXA 3KR1A 4E2WA 4R05A 5CCXA 4KDCA 5HIJA 1EIZA 4PYNA 2UYCA 3O4FA 1P1CA 2F8LA 4DQ0A 4YUWA 5GINE 4G56A 3FPEA 2JH9A 3TR6A 4C05A 3PFGA 1P1BA 1WY7A 4RTSA 1ZG3A 3HTXA 2YR0A 1N2XA 4P7KA 4C06A 2NYUA 2JG3A 1NW6A 4EKGA 1V39A 1XDUA 1EAMA 2I62A 3DOUA 3FTDA 3FRHA 1NBHA 1O54A 3MGGA 3FPHA 5EMMA 4DM3A 5ICCA 3FPJA 3EMDA 4DKJA 3KR9A 3LBFA 3T7TA 4KIGA 2YQZA 2PWYA 2PXAA 5GIPE 4E33A 4DMGA 3KQSA 2CMGA 2WA1A 4M7RA 2JHPA 5D1HA 3DP7A 3EGEA 3LCVB 2OZVA 3OE5A 3SM3A 4A6EA 2WA2A 5ICEA 3UBTA 1T43A 3UJBA 2BH2A 3ERCA 2P1DA 1ZQ9A 1X1CA 3IEIA 3MAGA 2PBFA 4MTLA 5EEHA 5FCDA 3FUTA 1R00A 3DXYA 3V8VA 4RTKA 3LCCA 2ZBRA 2ZW9A 1I4WA 5G02A 3TPZA 3LDFA 5DTMA 5CVUA 3AXTA 4WVLA 2ZIFA 5CVVA 5DSXA 5KS2A 1DUSA 2XYVA 1R6AA 2IH4A 1QAQA 2PLWA 4OBXA 1BOOA 2OY0A 3O31A 3AY0A 2ZZKA 3GJYA 3P2KA 1NV9A 4PYMA 3G8AA 1NT2A 4MWZA 1XTPA 2EG5A 2BM9A 3FTCA 1FJXA 4XUDA 3LHDA 4AZVA 3A4TA 3HM2A 2WK1A 5KVAA 3LGAA 5DSTA 4RTQA 3NJRA 2NNWB 4CXMA 3GRRA 2IH2A 2UYHA 5DXAA 1KIAA 5CCBA 2P41A 1VQ1A 2I7CA 5KQRA 2ERCA 3V97A 3GO4A 3G5TA 5D1NA 2OXTA 5GIOE 3NDJA 3C6MA 7MHTA 5K0CA 3K6RA 3C3YA 3G8BA 4CKEA 1P39A 2P7HA 3TMAA 2O07A 2O57A 5P8WA 4P7GA 4HTFB 3M6VA 5U4XA 1RJDA 3GGDA 1KP9A 3B3GA 2XYRA 4GOOD 3I64A 2GA9A 1SQFA 2Q41A 2YUIA 5DT2A 4YMHA 5EMJA 2CMHA 3GNLA 3UJCA 2ZSUA 4FR0A 3ELDA 2ZCJA 2E5WA 2AN3A 2B9EA 3ORHA 2ZTHA 4DCGA 3PX3A 1JG2A 4CTJA 1VE3A 1IM8A 1VL5A 2PWPA 1X1AA 4F84A 5K0EA 4QPPA 2AOVA 2AOXA 2IGTA 3BWBA 1L3CA 3HVKA 2Y1WA 4NECA 5T64A 3UJ7A 2QRVB 2C7RA 2ZZMA 3P2EA 1SG9A 1XCJA 4HRAA 2NP6A 3HCBA 4DCMA 4PIMA 3G2QA 3EVEA 1ZGJA 3R0QA 2CWWA 2XVAA 5EHIA 1P91A 2PVCA 3MERA 3BZBA 3F4KA 2ZWAA 5LQNA 4KIFA 4V0RA 4PCAA 3SGLA 3MTEA 3EEYA 3KPUA 3E23A 3KPYA 5K09A 3Q7EA 2PX8A 1RJFA 3KHKA 3BWMA 4PYKA 4E2XA 3MQ2A 5H02A 1SVUA 1N7IA 2AN4A 1L1EA 1N7JA 3B3JA 3BGDA 3P9CA 3RODA 2AOWA 3SR4A 3FTEA 1KHHA 3NDIA 3OU7A 2JJQA 5ERGB 2PXCA 2GS9A 1IXKA 3B89A 4OQDA 4HTFA 5GM1A 1R8YA 4PWYA 5DM0A 5BP7A 3THSA 2NXEA 4DA4A 4BLWA 2PV0A 3HA7A 4YUXA 5LQAA 3MCTA 3CJRA 4C04A 5KQSA 1JTFA 1EJ0A 4AX8A 1INLA 3UJDA 3DMHA 3BUSA 3EVCA 3GRZA 3FUUA 4IV0A 1I9GA 2P8JA 4ATNA 1JG1A 3CVOA 3NWEA 5HFJA 5E9JA 2PGXA 2OPBA 4M36A 1JSXA 3IV6A 3LX6A 4FS8A 5EKXA 4C07A 4H0NA 5GOZA 3UWPA 4C4AA 1MHTA 2EFJA 2QRVA 3DUWA 2PX5A 3HA3A 3BT7A 4YUZA 5DRTA 3KU1A 4GUAA 3A7EA 3JWIA 2YXEA 3MCZA 3FPGA 3OZTA 5MHTA 3EPPA 1JTEA 3BGVA 5CM2Z 5LQKA 2NXNA 3FTFA 1NKVA 2I6GA 3VC1A 1FP2A 4MQ4A 1JQDA 2P3OA 3OCJA 2ZZNA 2LD4A 4BP3A 2UYQA 4M37A 3SX0A 4MIKA 1AQJA 3HCEA 1XXLA 2DPMA 4HSGA 4QQKA 4QPNA 3G2PA 3PFHA 4U7TB 1RJGA 5CVEA 5DWQA 2B3TA 4GOLD 4CWAA 1UWVA 4ER3A 1YZHA 4K6MA 2IDKA 1F38A 3NMUF 3UA3A 5IH3A 4HG2A 5EMLA 4PONA 3AXSA 1H1DA 3LCUA 2OB2A 2VP3A 1X19A 4CKCA 4HGYA 3HNRA 3FYDA 1NW3A 1X1BA 5EQJB 3HCCA 1TW3A 3HCDA 3FPFA 2O05A 4BP1A 2BR3A 1O9HA 4X41A 3TFWA 4EMSA 5FA8A 5HIIA 2ZVJA 1YFJA 2ZWVA 5FA5A 2B25A 3AJDA 1G6Q1 3GXOA 2AOTA 2GH1A 4GEKA 4RWZA 4Y30A 5DTQA 3S68A 1XCLA 3KQMA 5DX0A 2G72A 1YZ3A 3P97A 4M38A 5DRYA 1M6EX 1VPTA 2VDUE 8MHTA 3UJ8A 3U81A 1G8AA 5K0GA 4YMGA 3DH0A 1FPQA 2HNKA 4QVKA 5E8JA 5GM2A 2B78A 3SVZA 5T67A 3OE4A 2AVNA 2PSSA 2ZIEA 1FP1D 3SMQA 3BWCA 4X1OA 1KPIA 3NVKI 3DXZA 2KW5A 1OR8A 5FULA 3LSTA 3DLCA 4RV9A 1SQGA 4LECA 4FT4A 4DF3A 3P9KA 4OA8A 4AZSA 2K4MA 2P3LA 3TLJA 5BW5A 4RX1A 3C3PA 3M33A 4FZVA 4P7FA 3G89A 2PT9A 4OBWA 4C03A 4HGZA 1NBIA 2FK8A 4GF5A 3MTIA 3I53A 4E2YA 4PYJA 5FHQA 4R8RA 3KQOA 3I9FA 3HCFA 3GRUA 3KQPA 3DTNA 4FGZA 3EVFA 3EVBA 4YV1A 1ORIA 4POOA 2B2CA 4GOND 4GOMD 4RYLA 1YF3A 2BR5A 3M70A 4KW7A 4F86A 2HWKA 3UJ9A 2QM3A 3RIEA 3TM4A 4BLVA 1VBFA 3TQSA 4PGGA 4ER6A 2NP7A 3EVGA 5K0FA 3C0KA 2O0LA 2Y1XA 1F3LA 3HVHA 3R3HA 5HILA 5FWAA 3GU3A 2YXLA 3OZRA 4V0QA 5HIKA 2IDJA 3SSOA 3VC2A 5CIYA 3HP7A 4RTPA 3UJ6A 2ZBQA 1B42A 2ZULA 4C08A 2YX1A 2ZIGA 4KDRA 1VLMA 3ELWA 4XUCA 4PCLA 2EJUA 5EPEA 2FCAA 3CBGA 4O29A 2PXXA 3JWJA 3LECA 5DTRA 4X60A 2OYRA 3MHTA 3PB3A 3A7DA 1QAOA 3KPJA 1R18A 3Q87B 5F2OA 3LL7A 3NW9A 5EZQA 4QQNA 2ESRA 5K0BA 2BZGA 1Q0SA 5LQCA 5LQJA 3BKWA 2ONYA 3I5UA 4FT2A 4RVHA 3SXJA 2XBMA 2CKDA 2QYOA 5K8VA 2UZ4A 2YVLA 1ZKDA 1X1DA 3B5IA 3CCFA 4X63A 3KQYA 3UA4A 2AZTA 3DMFA 3NWBA 4ISCA 3TKYA 1R74A 1XVAA 3MB5A 4YV0A 4YV2A 4X61A 2R3SA 1G8SA 4BY9E 1ORHA 5C1IA 3KQTA 2JH8A 3D2LA 2XVMA 3BKXA 3EGVA 3QOXA 3IHTA 5CD1A 4GQBA 4QDKA 5CVDA 3X0DA 3ID6C 5EG5A 3T0IA 1JQ3A 2VDVE 3QOWA 9MHTA 3G2MA 2UYOA 5LR6A 2PKWA 4HH4A 3GIWA 3TM5A 2ORED 3E8SA 3M6UA 5K0LA 3EMBA 3PVCA 2GB4A 2AOTB 3EGIA 2PY6A 1YFLA 4R8SA 5EKUA 2HTEA 5K0NA 4E2ZA 1RI3A 2GPYA 3A26A 1JG3A 4ER0A 3FUWA 3FUVA 4RTOA 3OU2A 1WS6A 3P8ZA 3KQVA 3OZSA 2ONZA 4WXHA 2VZ9A 3P2IA 1SKMA 2V7EA 3KPWA 2H11A 3BXOA 2ADMA 5DM1A 2G71A 5E2BA 2PT6A 1NE2A 4FSXA 1DCTA 2PX2A 1TW2A 3HA5A 1DL5A 1O9GA 5E9QA 3I58A 4RTLA 1UFKA 1L9KA 3LKZA 2EJTA 4IKPA 1D2GA 5DX1A 4AZTA 3THRA 4F85A 5M5BA 2OO3A 4MHTA 2PJDA 4RTRA 3G7UA 1BHJA 3R24A 2JHCA 3GWZA 1HMYA 1RJEA 4PINA 3CJQA 3M6WA 2BR4A 4DZRA 1RI2A 1QAMA 1BKYA 3C6KA 4FP9A 1SUIA 3HCAA 1AQIA 1L3BA 3EVZA 1JSZA 3ME5A 5HEKA 5LQUA 3T7SA 4PYOA 1KPGA 5EZSA 4U7PB 4UOEA 5FWDA 1G55A 3KQQA 3REOA 1IY9A 1M6YA 3ELUA 5B1SA 1PRYA 2IBTA 1PJZA 5HZMA 3KKZA 3UJAA 3PX2A 4E31A 2P7IA 3HEMA 5KYGA 2FHPA 2H00A 1JR4A 1NW7A
chains in the Genus database with same CATH superfamily
4MYTA 5HIMA 1X1QA 2VDNB 2Q99A 3AX6A 3ZNQA 3QKSB 4H16A 5FBHA 4D81A 5CBKA 4JP3A 4L6CA 4RTMA 4L75A 1H3NA 1QZTA 5AVJA 1L5HB 3BEOA 2PDAA 4JX8A 3SQLA 1N6LA 1U1IA 3SOZA 4LFAB 4YONB 1U0JA 3ASZA 3N2GB 4C89A 1EFRA 2GVDC 4DBLC 5KO2A 3DTYA 1G4HA 1I1QB 3IUQA 3DXXA 5HKKD 4LYJA 2R6ZA 1T1EA 3GBPA 3PFWO 1R5NA 2FCRA 1VJCA 4FZJA 2HPAA 1WB4A 2Y1CA 3CLVA 3NX4A 3PTLA 3T7RA 3BZUA 1XBTA 2YOFA 3IVAA 3MRXA 5ALSA 4EI9A 4PSDA 1ZL2A 2EZ4A 4PQYA 5KYUB 3UH1A 3U09A 1ANKA 1VMEA 4Y9TA 5JC1A 4LBWA 1CCWA 3FHJA 4ZGWA 4JLVA 1HR0B 1NULA 3Q3HA 2EV9A 5CA1F 4LS3A 5IXSA 1P81A 2PAFA 4Q05A 5ELMA 1NUQA 5DPMA 1TU3A 1WF6A 3HDQA 3AKCA 3RRYA 3ZS8A 3VAAA 4EUHA 1LLUA 1T25A 3KZ1E 5FP0A 1DAGA 2NZVG 1W0CA 3ZLBA 1ISRA 1KI9A 4URHA 1C4KA 1A95A 4WBNA 4FFNA 4B3CA 5IF9A 2QQRA 2KMLA 3DLHA 3GGOA 3QVWA 4B3RB 4L7VA 1BU8A 1V2HE 4Y6SA 1V8OA 5DHUA 2FKNA 3DVLA 1GTZA 1IN6A 1KQPA 4HXEB 2XT0A 1RQXA 1XXHE 2LP4Y 2OB1A 1KFCB 4RSMA 3KBOA 3OMWA 3M6MD 1B8UA 4S1VA 2KX7A 1VA4A 3TZHA 2G06A 3ESXA 1W1IA 3ROZA 2F1JA 2HLDA 2WZDA 2G1KA 4JOCA 4XIGS 3RVLA 1CIJA 3OTHA 3DFZA 4UTXA 1I3OA 1GRVA 3S7ZA 5IT0A 3OEED 3PUJA 4NOKA 1E77A 1NY5A 3HGTA 2H1SA 3SYTA 1BVUA 1UJ6A 1P3Y1 3CMMA 3P9XA 1KQOA 4KR6A 1UBLS 1GGHA 2X0JA 1CZNA 2J9GA 4JIGA 5B37A 2XMQA 2VH1A 4BN0A 5AIBA 4V1CI 3GJ5A 3R9XB 3QFFA 3W7AA 1U2QA 2C4KA 5E2AA 4A6DA 2OCGA 1KZ6A 4NU6A 1IY0A 4L8WB 2C1EA 4WSOA 4ZDJA 1SQ0A 1F12A 3Q5EA 5JJLA 2G5TA 1ISIA 4AXBA 4RMGA 2AYYA 4Y9DA 2IT1A 3RKRA 3R20A 4ZRNA 2ZR9A 4E5UA 3PJDA 1EPUA 2P2DA 3QVGB 1E2KA 1JT2A 2FWPA 1BKSB 3OPNA 4PLHA 4KQHA 1XU7A 1OH6A 3CZPA 5BVGB 2H51A 1WABA 4IEEA 4CLEA 4DMRA 2E7ZA 3TRIA 3TTYA 4IW3B 4MIOA 3EGDA 4IOJA 2XCLA 4I8IA 4J2HA 3MFQA 3KE8A 1G3RA 4CKBA 5ICSA 1JRLA 3VOAA 2Z30A 2XUIA 1LFDB 3AHCA 2I2DA 5AM0A 3WGLA 4C22A 3DKRA 3LKBA 4CCWA 4FFWA 4KWCA 1SUSA 1WUTA 2C2GA 2BUCA 2QPTA 5C3UA 3W4JA 3WHIA 4EVRA 4CZ2A 5F98A 2ZWMA 3AIOA 1NG1A 3VX4A 4UTNA 5JYEA 1UBHS 1EJBA 3CKKA 3NONA 5J3JA 1GOTA 3AM1A 4CT0A 1YULA 1IZYA 3C5WP 4LAFA 2YICA 4QBIA 4O2LA 1KAHA 5DM4A 2P5TB 4DIOA 4REMA 3R0IA 3TLZA 1MNAA 1G20A 4RS3A 3ANNA 2SECE 4LGVA 4OQMA 1A50B 1P19A 5REQB 4BNFA 4KDCA 4TS9A 5HIJA 1A0OA 2GCGA 3DB1A 2O2GA 1TRKA 3HEAA 2ZGVA 3K4PA 3I5AA 4BNYA 4Z8YA 5CG1A 5IM4F 1WU7A 1TA9A 4BLRA 3EB9A 3TDKA 2WOOA 3ZBQA 1GLVA 1V4BA 3BIOA 4F4IA 1NBAA 5DISB 3S3TA 2YQ5A 3L0OA 5D01A 2B5OA 2XD9A 3RTGA 2P5YA 4XSVA 4MB2A 4PLFA 3IXQA 4ROTA 4C7JA 4RF2A 4UTZA 5E6SA 2HBQA 4PGFA 3SJAA 3LBAA 2MDTA 4FUQA 1H2ZA 1ISMA 3EMDA 4O4LB 4DMFA 3IPXA 3KR9A 4HH0A 1FVXA 1H23A 1Q1AA 3V8RA 4AJIA 1VLHA 1E2DA 4CM4A 1NMQA 4LE2A 5KDDA 3A6EA 4L8YA 3ZWBA 4YR7A 1T4CA 1Z3IX 2JBAB 2FW6A 1KDYA 3B9QA 2WA1A 3K9QO 3U4AA 1NUUA 3ECSA 1XK6A 3NUGA 3CONA 1GTJ1 1F4LA 3HKEA 1V3QE 4HL6A 3L01A 3ZDEA 3RADC 2KWIA 3EIWA 1Y6RA 3OO1A 4Z4GA 1BMDA 1M2OA 2DQKA 1N6PA 3VMMA 1C1DB 4R1QA 2ZANA 2O2XA 3CU5A 3B6EA 2FZCA 3V8QA 1KFEB 2VJKA 3AF0A 4C4RA 1AK2A 5DSXA 2BHTA 3I12A 4MGKR 4IX9A 1DEOA 3E7WA 1USKA 2PLWA 2Y2UA 3KVVA 4OBXA 3KKEA 3UHAA 2VUUA 1D2AA 3FNEA 3H84A 1W96A 1GCAA 1LTQA 3L6DA 4TXMA 2NSJA 1FJXA 4XUDA 1SHKA 1YGYA 2HQOA 3CXRA 3EDYA 4LHWA 1T2FA 2P0YA 4BJ6A 2RGEA 4RTQA 3NO4A 2M9MA 1DTWB 2HHJA 4CXMA 2JDID 2QJWA 3QH4A 1OTHA 4KK4A 4LXQA 4OH1A 5GY7A 3GLQA 4GKBA 4R7GA 4TV9F 5SV2A 2OGZA 1GY8A 1FU8A 2H1FA 2XODA 3SC3A 5TV2A 3QNWA 2J85A 4GNRA 3WOVA 1Z6QA 2R44A 2JIBA 3C6MA 3KL2A 4S1OA 1D4AA 3ONDA 3SYMA 3ZV5A 5BORA 1AE1A 3G8BA 3FDXA 3FPCA 3K9WA 2C20A 1QU3A 4UBOA 4TXJA 1ZM9A 1YRQA 3GGDA 4OO3A 1NP6A 4YJ2F 1FEZA 4UVDA 3ZBPA 1D6NA 3EPRA 2HEIA 4BMDA 5JBQA 2A35A 4NC9A 4ZEMA 2FMXA 2F6RA 4ETWA 2YHIA 3T6KA 2AV6A 1NAIA 2F1IA 4Y2TA 2OFWA 2R6CA 3OC0A 2OENG 4BUCA 3AVTA 1BFKA 3M89A 3MJRA 1KIMA 3NH6A 4WIAA 2NV2B 1JEYA 2JIQA 1NZDA 5F78A 4KR2A 3NPAA 1W49A 2V96A 4MQFA 2WYVA 2BVNA 2BFMA 1P9RA 2ZI3A 1ADGA 1KJZA 4CPDA 1XCJA 4GQIA 4BNDB 4IXMA 1QU2A 3ZUPA 1K7XB 1IATA 1AKWA 5DNEA 5ADVA 4DOMA 2QTFA 2A1TR 3L0BA 1W4BA 5IUJC 4NXMB 3MCWA 4D80A 1CDZA 2EKLA 4OLHA 4PCAA 4R3WA 4V0RA 1S0UA 3EQZA 1JIVA 2GBLA 2PX8A 1JDNA 2DLDA 2R66A 2ZRCA 1L8OA 1NUHA 4RORA 621PA 3B3JA 2PUAA 3ZWVA 3SAJA 1SXJC 1E5TA 2RHWA 3Q2IA 4MLCA 3FWKA 3I4FA 3VZQA 5IFKA 1TZCA 1NQVA 3FDIA 5E6SB 2RI6A 2BIFA 1OBVA 3LNTA 4L4UA 2AUMA 4M1EA 4MVJD 1YNOA 3ILHA 4ONEA 2ODTX 4TL9A 5TXGA 5IKPA 1NMZA 4Z1OA 5AO9A 5KQSA 3OJWA 3TRDA 4R5MA 2EKPA 2QD1A 1E9CA 1VPLA 4U9HS 4CM4B 2BUAA 1Z6AA 2QIOA 1ENZA 3NWEA 5DHSA 2RJ3A 4TTTS 2QMEA 1I3NA 1TQ8A 3EWSA 2DUWA 3DPIA 4FX5A 4KH0A 4S12A 4S24A 4AP5A 1Z5OA 5KNDH 4MP8A 3OCXA 3K8QA 4JVMA 4M21A 4QC2A 4Z4HA 1XIVA 4R51A 5LLDA 2Q1YA 3K0SA 3FXAA 3RUPA 2PH3A 4NH4A 1W48A 1V5FA 1QVRA 1EFPA 2V6MA 5TF0A 3BSWA 3CNLA 3RRMA 4NZYA 3ZEIA 5BSFA 2GTPA 1G16A 2H4WA 3G9XA 3GWGA 3OCJA 1HLFA 2CDBA 4G85A 4PC7A 3ZX5A 4IFEA 4LF8B 1C2TA 1AQJA 3QELB 4TM8A 4ZDKA 4OK5A 3U37A 3X1YA 1WBJB 2FX2A 4QICA 4WZ6A 4U0KA 1I6WA 1RJGA 3RRJA 2ZR0A 1P1KA 1KI6B 2AL7A 2V5AA 3IR5A 4KFTA 4KSBA 5F77A 4YMTA 5LKAA 1L5VA 5JC8A 2WSLA 5F51A 4B76A 2A7QA 2XUPA 2WR8A 3DEJA 1O94A 1ZKMA 1HNXB 3MWEB 1W6UA 1AB5A 3L92A 3T0GA 1H3EA 3FNHA 4OD0A 2UXDB 2WE7A 3B38A 3TNJA 4B85A 2OCXA 1NNSA 3RSGA 4DDUA 2PD4A 1L7XA 3K6SA 3IT0A 1R64A 3I1IA 4ZAZA 1OASA 2W58A 4TRMA 3L0ZA 3UCXA 3BWVA 3RPEA 1RPTA 4L7QA 4P3XA 2ZRQA 5BVHB 3MB8A 1QWOA 3WS7A 7REQB 1OH5A 1TAUA 5FA5A 1MKYA 2HXYA 5KVVA 2P5UA 2FZWA 3P97A 5LQSA 5DYIA 5A62A 4PY2A 2ZRPA 2F64A 1JE0A 2NZWA 2YJZA 3ETGA 3WAGA 2ZAMA 4BNIA 5GM2A 2X0NA 4IJQA 4DNFA 3CZ4A 1C4XA 2VPXA 1G8FA 1OKKA 1V5EA 2PQ0A 3OKPA 4G9GA 4LRXA 4RACA 4ICIA 3E0XA 5AKKA 1LPAB 2WNSA 2XLBA 3BGSA 3SLKA 4BGDA 2YY6A 4FT4A 2PYIA 3NKFA 3VJMA 4B9EA 3JQFC 4YRAA 3KEGA 4G25A 4H1TA 2G17A 3M33A 3WMFA 2HU5A 1EEHA 2AI1A 4PZUA 2HRBA 2O7VA 1XZAA 3WP1B 4HGZA 3BSSA 4U00A 4IDAA 5ALGA 3ZLVA 1DHRA 1XJQA 4YCSA 2XB2A 3FVQA 1U3DA 3FSJX 4JT8A 3V4LA 4KQEA 3V6LA 4IX1A 1QX4A 1XZHA 4KO8A 3EVFA 2ACEA 2CKMA 2QDXA 1RRMA 4FGZA 1IBSA 2XNJA 4LHSA 4OK3A 4YWHA 4CF5A 2ZIUB 1X13A 1I6LA 2YASA 4GOMD 5KMGA 2O2IA 4KW7A 1ZEMA 5EYPA 2ODBA 3K0FB 3TQSA 5B3KA 1NLUA 2QGZA 4MUYA 4N0MA 2WEKA 1PJ2A 3VU9A 1GGNA 3L0YA 4UBIA 4ZEWA 2Z5GA 5AW9A 1CZOA 5A4JA 4LGMA 5M7EA 4AU1A 4CGYA 1AQ6A 4O2BA 2QU8A 5BWNA 4RTPA 3SVTA 1KGDA 2PQ6A 2VG8A 1IXZA 4K6KA 5HJ2A 3W1EA 2DJIA 5JEEA 2WVGA 2V9CA 1MO5A 4OJKA 4X1IB 5C8YB 5HJEA 3H8JA 5LP1A 3K94A 3HRKA 4Y2UA 2OMKA 5AI5A 5CDYA 4BQQA 4NDZA 5HDBB 2NTJA 3U31A 3ZWAA 3KZCA 3PHJA 1FRZA 4MKFA 1E4EB 1WSDA 5KU1A 1XQVA 4UUOA 3UK0A 4KXXA 4BE4A 3U5TA 3A6KA 3TTUA 3J7AC 3KOUA 2OZKA 3WK9A 1FDRA 1II8B 3CCBA 4CMEA 2J5XA 4NJMA 4RHUA 4BB6A 1X0XA 2UZ4A 1QF6A 2Y68A 1E7WA 4B83A 1GZUA 5LZ4A 3HDJA 1QXSA 4X85A 5EJ8A 2ZB4A 4OLFA 2W93A 3TR0A 4WOKA 4PNPA 3PGVA 1A2QA 4PLYA 1E62A 1NDQA 2XVMA 3BKXA 1D1SA 2QLNA 3IHTA 4NEGA 2JLVA 5ITZA 1H85A 3IVGA 4GPAA 1KO1A 4Z0TA 5LLSA 1ENPA 2RH8A 4HAIA 4OHOA 4UHDA 2ZS8A 1THTA 4MKZA 5TQ2A 2OORA 1VBNA 3HJGA 4WZAB 4B2YA 4AKEA 5JJKA 1OAOC 5ENVA 1Z35A 2B83A 1X7ZB 1B76A 3BL8A 3EZGA 2HK6A 3IT2A 1OF1A 3NT2A 3Q15C 1QHXA 1N36B 4K9QA 4M1KA 5K0NA 3BL5A 5DW0A 3ZDQA 3FUVA 2PUVA 2AX3A 1WS6A 3P8ZA 1WHSB 3WO0A 2YINC 4YNBA 4WEOA 3W9YA 1Z62A 2V59A 1IHOA 2W2KA 1IL0A 2VBIA 5K3BA 4ND5A 3ONNA 5PNTA 2ZM5A 1D2RA 5B6PA 1TW2A 1HYEA 1A3CA 1WUJS 2GILA 1EUDB 2BY4A 2W8ZA 1TQ6A 1UFKA 3AB7A 3DVAB 3EDQA 4LJKA 4QHTA 3ROQA 3K70C 1OB2A 1LBIA 1NXSA 4IJ6A 2D13A 4JU8A 1JLLA 2C29D 5DLEA 4S0ZA 2AFHB 3BGWA 4CM9A 2H29A 1Z6GA 2ZVQX 2W8BB 1OHHA 1YJ8A 2E89A 2Q0SA 2ZR8A 4PPQA 1OFGA 4KOAA 3ZU4A 3NBYC 1HYGA 3EVZA 3FYUA 4IPTA 3PTZA 2VI5A 2C5AA 2G8LA 1ZHOA 3K9FC 1HKHA 1BH6A 4AYWA 3W5UA 1M8GA 3KZMA 5CEJA 1OA0A 3L0SA 4IIUA 3I1JA 1MG5A 3IBFA 3WFJA 5DF1A 2G7MC 2DFLA 1ODCA 3VU9B 5E9AA 4DCCA 5AW4A 3PGMA 3IAS1 3WADA 5IAOA 4UARA 5FOTA 1N2ZA 4G2TA 1T91A 1JP7A 4G8JA 1A8HA 4NJEA 2ZCVA 2P40A 1ZMXA 2V8BA 3VO2A 4MI1A 1KTVA 4NBVA 2IHYA 3U4HA 1ENYA 1AKRA 1EBUA 3VO1A 3F71A 3GRVA 2YZ7A 3FMIA 1U31A 1RYBA 2AG5A 4DA8A 1CF2O 2YW9A 1T1RA 4G8CA 4OMFG 2C4MA 2PJUA 1SUAA 4LC0A 3GJQA 3SKXA 4JLWA 4B46A 1T3LA 2I54A 2CNLA 1JPUA 1JYSA 1D2MA 3ADKA 3EXHC 3FPLA 1J56A 4XZ3A 1P2TA 4TTVA 4RF4A 3UG6A 4DVGA 3VGJA 1SAYA 1YDFA 3AJRA 4WK2B 4YRMA 3Q7QA 4TTSA 4EGJA 4ARSA 5J4YA 4KXUA 1QVAA 2CF5A 3RBXA 3TLGB 1MQ8B 4BBJA 3OZCA 4PZLA 4UFNA 2QT0A 4PIPA 4R0MA 3QM1A 3IHKA 3DZIA 1RR6A 3G6KA 3WGIA 1E7SA 4J1QA 1X94A 2PZGA 3WY9A 4YIKA 4ALKA 1JL3A 1VIDA 5DNCA 2BKVA 3CZMA 4TSFD 1P2DA 4JNKA 1PFGA 2AOUA 4GD3Q 3HXTA 1DNPA 5FUVA 1OE0A 1FL9A 3ORRA 3WLPA 1QPZA 4GSYA 4CNBA 1I14A 4EI2A 4CFZA 4P35A 2JI6A 3STYA 3RD5A 1YDHA 2W4IA 3QEKA 5L4LA 1XKXA 1UCFA 5EXDA 4F4JA 4N49A 3DWFA 3R7SA 3WJ2A 5EUCA 4AMVA 4J9VA 3RU9A 2P3SA 1RXEA 4EKYA 1YQEA 1W1WA 1ZD8A 1ZK0A 2DT5A 2P9QA 1YS7A 1RCTE 2V45A 3CH7A 4X3PA 5ICFA 3UXHA 4B09A 4BL5A 4DSNA 4FYWA 1TA4A 3B51X 4AUKA 2QW1A 1GAQA 2W2KB 5IN5A 3SXPA 1VLJA 3Q3EA 4DIBA 4XCXA 3LRXA 1LBSA 4MB0A 4MUHA 4CQLB 1XZMA 2RDMA 2VRNA 4LJ7A 1DQNA 3QPWA 3ANXA 1D03A 2A3NA 1UDBA 2NUTB 2ZBVA 1SZPA 2QRLA 3HM9A 2OPHA 3WWDA 4MKRA 5A1TA 4D0NA 2PNJA 1I5EA 2BYTA 3WV4A 1V9SA 7MDHA 2WUFA 2CEAA 3BPSA 3H4IA 4IKOA 1EVYA 3CUSA 1M3SA 1Q1BA 1NW9B 3AFGA 3AUFA 2H1RA 3DEFA 1C80A 3K1ZA 1ES9A 3I9MA 1G98A 3F7TA 3LP6A 3IQEA 1D6SA 4XA8A 1DG1G 2OV2A 1HUQA 3IAHA 5IG2A 3HWX1 2R62A 5FADA 5J1TB 1GP2A 3BB4A 1M8FA 5TGZA 2RGDA 3W6OA 4AI6A 2M1XA 4EUNA 4MAAA 4NV3A 3HB7A 2OECA 5E38A 3MWDA 4L78A 2I2CA 5BQXA 3EJWA 1WY5A 121PA 1RYNA 2Z4TA 3HR8A 1GEGA 3PLAE 3CPHA 4F3NA 5B64A 5LZ8A 3RBAA 1QO0A 2G4VA 4Q6BA 3HFGA 2Y9MB 5AW0A 3MINB 1KP2A 3GV0A 3INGA 3Q2OA 4NARA 4RVGA 2XYPA 3KQHA 4G5OA 1BS9A 1YKSA 5AJHA 2Q3CA 1GQ2A 3DZCA 4PGAA 3RSLA 4HFJA 1OFTA 2DAPA 1N5JA 1JHRA 4TTJA 1ZESA 3K5WA 2BFCB 1C30B 1MC4A 2I71A 1UXHA 1QFXA 2XTMA 3RNLA 1PZNA 3M82A 4HXGA 4DDMA 4NFLA 2VC2B 5KWJA 3G9ZA 5T3YA 3GG9A 2PT7A 4YUWA 4EHKA 4TGLA 2CFRA 4KP7A 1WX1A 2A0FA 2QAGC 2A8YA 2ODQA 2WHXA 3BMQB 3DBOB 4KIWA 3UMJA 3PIRA 3VR5D 3VVMA 4DCSA 3LU1A 1Z5UA 3UW1A 1G5HA 2RKWA 2FWJA 2HF8A 3OTIA 1YUNA 4AO8A 1MH1A 2NYUA 4IUCS 3QOFA 5K3CA 2JG3A 4DR2B 1BN7A 3ZHUA 3TAHA 1ADCA 1FU4A 1JQKA 3F3YA 3G0BA 1PFYA 3VVCA 3W9SA 4V1CA 1G5QA 2ID4A 4CRWB 3EZXA 3CH6A 5HCIA 3BDVA 1H2FA 3FPJA 4ZHQB 2QLJA 3N5CA 1QIGA 1JAYA 2V7GA 1GGFA 1MD9A 4E51A 1HZJA 5CDSA 4TX1A 1RM3A 3OZWA 7GPBA 3IOYA 3W0LB 4B71A 1I2BA 2N42A 4I19A 5DBEX 4M7RA 1E5LA 2ZUBA 4MGZR 2A9FA 2Y3IA 2CMKA 3KHSA 3O03A 4TXHA 1ML4A 1RAAA 3IEIA 5EZ6B 1I5OA 2R6R1 8AT1A 3PI7A 4D74A 3PL1A 3KWJA 3V8VA 2R8BA 1W30A 4QA9A 4BCCA 1BQEA 2JJ2D 4RPJA 5JZSA 1AO3A 3GA5A 3MZ0A 5EPPA 4B1FA 1J99A 1GKLA 3LA8A 3SC4A 4U2FA 4RANA 2PEYA 1F48A 3CY6A 4PRZA 1QAQA 5MGNA 4BV3A 2OCPA 4PNHA 3GJYA 5HDQA 3SEFA 1IOZA 3KWLA 4R9SA 4H4CA 1OFUX 2BM9A 2II6A 1N8NA 3OCCA 1EGAA 2VRWA 1ST2A 3FJ1A 4Q3EA 3LGAA 4TL7A 5DSTA 3NJRA 4DXDA 1XF9A 4IQ8A 2HSJA 4MW7A 1FJGB 1BXGB 2AYZA 1BMFA 2PM8A 1B00A 1DX9A 4I4LA 5LA6A 4J0GA 2I7VA 2IS1A 1H2XA 1P31A 2HUNA 3QFSA 4IO1A 4KODA 1C7RA 4FQ8A 1PW5A 1U28A 3G2IA 4OP3A 1SQSA 1SVMA 5CR9A 4NCNA 3I32A 4WBNF 1Z0AA 1J8YF 1WW3A 3HA2A 1Q2XA 1C9KA 4JH0A 1KVUA 4GPZA 4O4LF 1FLDA 3FROA 5EWJB 2IYXA 2PSJA 1QFSA 1Y9EA 2Q41A 3OOEA 2QX4A 3LQQA 3HN6A 5EMJA 1RRCA 3NI2A 3I3SR 2VJPA 3FR7A 3H5IA 5B58T 5CFLA 2AEMA 5EN4A 5CYFA 2W71A 5HUHA 3ZDRA 4WZBE 1JG2A 4DCGA 5JQGA 1IM8A 1QCZA 2FSFA 5I01A 3M4NA 1NN1A 1RWVA 1T5BA 3TL3A 3HVKA 1Q2UA 1JW9B 1V8PA 3TGLA 1P5FA 3FSEA 2YVQA 1YMUA 1X80A 4D9KA 5THKA 1VM6A 3M0EA 4IWXA 4J76A 4QEDA 5BOVA 4CT5A 1C0KA 1D0SA 1FDWA 3LQFA 3OZGA 3HQ4O 1XPOA 1Q7EA 3KLBA 3ZPXA 3KYDA 3V4FA 1V47A 2VDOB 3OQIA 3RJMA 5LMZA 1WP9A 2JI4A 3BZBA 3EXEA 3ZZ1A 3WQBA 1G6KA 5EIHA 4ENQA 1RJWA 1SCUA 1Q7RA 1SHUX 4QQFA 1DCKA 5JTTA 2DR2A 1Y4AE 2XHZA 2HB6A 3JYQA 5IC5A 1MORA 3WKDA 3GMDA 2ZSIA 4ZCRA 4EO9A 1E0JA 1K88A 4V1CB 2NU7B 4H7KA 3KJNA 4PWYA 4RM3A 4EX7A 1CUSA 4HAVA 3O8CA 2JFUA 4BECA 2PMKA 2NXEA 5JJCA 5A02A 1FNCA 1YQXA 2W6IA 521PA 1XTIA 2HZBA 4FDUA 4A8JA 4DBLE 1OIVA 3C5CA 3UJDA 4PZYA 2V9ZA 1W75A 3NB0A 4NG4A 2O0JA 5DCUA 2ZJYA 1ESZA 2JKZA 2L2QA 3IV6A 3T95A 3ETNA 2HL6A 4K3UA 4C4AA 4F06A 4ES6A 1ZRNA 2A9PA 3QW2A 3BT7A 2IYFA 5ALZA 2FMHA 3KU1A 4HS4A 1B93A 1PVOA 4DLVA 2FG5A 4G5YA 3PJFA 4RFSA 1J23A 4YBZA 4F3CA 1FBTA 2IEAA 3NS7A 4AF6A 4FYMA 1IY2A 4JJ8A 3BIJA 4OJTA 2VXCA 3GPCA 3FNQA 1IWBB 3ETEA 1V5IA 2A0YA 3GA7A 3EFOA 4YI5A 4FWTA 2X2OA 2WTBA 1UM9A 2O5VA 1Q0PA 2C2OA 3EZ2A 1YASA 4J0CA 1HSZA 4Q4DA 3RV4A 5JQWA 5JS7A 1RXVA 3WHLA 1YQDA 1K08A 2C7VA 3KKQA 5BSTA 2YJNA 2FFHA 2VYVA 3R1IA 4Q3AA 4MS3B 2QNRA 4ALJA 1E3MA 3O4GA 2LBPA 2QU7A 4JLKA 1Y8AA 2WHYA 1BZYA 4LJAA 4CNQA 1FTWA 2R7LA 1KO4A 1GFIA 2W2XA 2V1UA 3VR2A 2CJYA 3CZRA 1Q21A 4EEZA 4N3NA 4AWBA 3IPRA 2PUBA 1XFAA 1VCHA 2G1UA 3NHPA 3AYZB 5KTKA 1G18A 1LEHA 3BK7A 3CM0A 3H2HA 1Z29A 1J2JA 3L79A 3PV0A 2GNPA 3IMCA 4JODA 4UHJA 1ARZA 3VHLB 4GM4A 3GXOA 4BE7B 3P26A 2GH1A 2GZ3A 4RWZA 1ORRA 3ILXA 1EE1A 3ZY3A 3WGYA 3E22A 4ZMSA 3GFFA 3TKLA 4FFPA 4D43A 4JCOA 2CL6X 4EYOA 2XDPA 1U6JA 4W63A 5DWDA 3PNKA 1T2CA 1YRHA 2WAAA 3KYBA 3QEBZ 4WNCA 1RADA 4R9NA 5ALMA 2FHSA 5C4MA 4DDTA 3CX7A 1GQSA 3KB1A 4LHEA 5F3DA 1WVIA 2P0EA 2UXBB 2NUBA 4XR4A 4RU1A 2PS9A 3U9LA 3NAZA 5LP6C 3PFCA 3V5NA 5HZHA 2D7DA 3DXZA 1HETA 5JSZB 2ZUWA 4GX5A 5BUCA 4PFQA 1X80B 2B98A 5PGMA 5EP4A 2HMAA 5CYOA 2K4MA 4CV2A 3HJNA 5CLHA 4CG0A 1KOJA 1ZINA 2G07A 5H59A 4I81A 1W8DA 4AJPA 1RC8A 3G2LA 3A1VA 4M1QA 1R9GA 3TVTA 2ZRGA 4B48A 1O95D 5EKTA 2Q62A 4MITA 4DSOA 2JVIA 3CTMA 4V3CA 2FPGA 3DTNA 4NBKA 4ZICA 1MGPA 2JZNA 4W4TA 4AG5A 3Q7SA 1P3JA 1RVV1 5JDIC 1XVVA 1SQ6A 4KUEA 2K6GA 3ANSA 3WI7A 1NYRA 2E55A 2VZLA 2VT6A 2Y0CA 5GVRA 1K7CA 3LHSA 1T8TA 1DEAA 2VP2A 3L0CA 3TQHA 5KYKA 2XDQB 1DC4A 3KZOA 1E66A 2XPCA 2ZREA 2IYUA 2AW5A 3ICCA 4RHXA 4Y6GB 2JFZA 3F96A 3O4JA 4FLFA 1BOFA 4RK6A 1U3UA 4E03A 1M8KA 1EX7A 2QPAA 3ZDAA 4PBSA 4D9IA 4YLGA 3DZHA 5C3MA 1R0LA 1WCIB 1RQLA 1XQWA 3BXGA 3N2ZB 2JCVA 3VC2A 2VDQB 4REQB 4WN3A 3FE2A 1QNFA 2X8JA 1QIMA 1PDOA 1EWKA 1AQUA 1NYTA 3K1TA 5DN9A 4E5NA 2P90A 1NVBA 2H1HA 2MSNA 5KHOC 2JF0A 3TMYA 1P1IA 4FOOA 4RDIA 1FDSA 5KNBA 3K9HA 3AR9A 3DE1X 4L5YA 1E0DA 5DNYB 2CSXA 4D4MA 4HDNA 1RQ7A 2QSYA 2V6JA 3IMGA 2GVNA 3A7DA 2Q5LA 5DMXA 3EVTA 4IXNA 5LBUA 3DDCA 3E27A 1YA6A 4CCYA 1P1JA 2H0AA 1UKVY 1E7RA 4N0PA 3X1XA 4BFLA 5FPTA 1JSCA 3OC6A 4ITVA 1CUJA 3I5UA 2QXYA 1Z2EA 2PSHA 1G2PA 3U17A 2I3BA 1LDYA 2BEWA 3N2YA 2PANA 3LQKA 6AT1A 3FR8A 2HBZA 3KSUA 3VH2A 1Y33E 4H2DA 4KGXA 3WBFA 4D97A 3VQTA 2YUTA 1HY3A 5C1IA 3KQTA 3NTQA 2XB8A 3BAFA 1P5RA 2GAJA 1E1YA 1JHVA 3QG5A 4ARCA 1VCOA 1J0EA 2BMJA 2YIVX 1Q50A 1GPWB 3QZUA 1FIUA 3CLTD 4PQRA 3L1KA 2V7WA 3VZCA 4TWJA 1M34A 3PL5A 4PZ0A 3MMSA 4GZLA 4RQUA 4TKMA 1D7OA 3X43A 2J5RA 1N2CE 2QZZA 3QPVA 2GD2A 2ZE7A 3KS9A 2PY6A 1Z7EA 4GGMX 4NCIA 3V6MA 4MRNA 4U4AA 3KQKA 2OV1A 1ZEJA 5C1DA 3IP9A 3MNFA 3AO0B 2NTEA 1UMBB 1NVKA 5C8YF 5LXTB 4UHHA 1DTEA 4XIYA 2J0QA 1B73A 2B8EA 1JEOA 3L1IA 3TLXA 5BRJA 2TMDA 3RYIB 1QJCA 5KDOA 3ZGNA 2Z04A 4DLAA 2ZM6B 3LZDA 3GRAA 2CB0A 3OTGA 5EPOA 4B7UA 3F6PA 2LRHA 2EL9A 4YPOA 5BURA 3B12A 1UUFA 4FHEA 4IKPA 4J3FA 3PRJA 2O52A 2X58A 3SPXA 1ZLXA 2B4QA 2C4TA 4HQLA 3LO5A 2X19A 1MRSA 1OQAA 4PINA 4D0GA 2QZSA 2Y77A 2WW8A 5BYJA 4FFOA 2VXOA 4LRSB 1RI2A 2FG6C 3ABSB 4P6VF 1TC1A 3C6KA 3U3ZA 3ZVNA 4PXYA 2HF7A 1BWQA 1Q7GA 2G67A 1UPFA 2I4TA 3BH6A 1QH9A 3DWGA 3MK31 3O3NB 5IANA 2QVZX 2WU4A 2Y1FA 5IT4A 4CQMB 4LWQA 2NQ8A 2X8BA 2YWXA 2AGVA 1K66A 2YWJA 3ME5A 3PFNA 5KTMA 1N34B 3QUQA 4JXXA 3REOA 3NOQA 4LYDA 1VLQA 4H7PA 4OUKX 2IWRA 3LPCA 2HBYA 2VSFA 4IP0A 4Y1FA 5AVRA 2PFKA 2YIJA 3UXEA 4E31A 4YRCA 1OXXK 1FSPA 1XZNA 4Z49A 5ICCA 4D46A 4ZU6X 4KTVE 2AXQA 4A92A 4DV5B 2CFIA 3URMA 5C9ZA 1VLZA 1RLJA 2QQSA 3D4LA 1QV6A 2HPHA 1QORA 1F4VA 5I7UA 4GP7A 4QKQA 5DGTA 2VBCA 1M2WA 3V80A 1VOTA 1B6SA 4QPZA 2FW9A 1DC8A 5BWCA 2H7YA 1GCGA 1VA5A 1L7MA 3LXRA 2GAFA 5JVDB 4LVUA 3FNIA 3P2JA 3ACDA 5KSZA 2F9LA 1CUYA 4OG2A 4DT1B 4GI5A 4A1OA 3B7PA 5KINB 4W8GA 3DPSA 5KNLA 3MUOA 4CCYB 2BLLA 5AW6A 1KYTA 4NF2A 1T1JA 4D3DA 4F56A 2L17A 4RS4A 1NI4B 1JA0A 2CSUA 1MENA 1B2LA 1R0KA 2CLIB 2GOYA 2D8AA 1FTYA 3C45A 4H7FA 4W99A 4YP9A 2JEOA 3SSNA 1A88A 4TMWA 3LLVA 3V1KA 4DR1B 1XEXA 2DPYA 2E3JA 2IPXA 3EGWA 1QGZA 5IKMA 4QJ4A 3X1DA 3I2KA 1A9XB 1QONA 3PA6A 3EIQA 4CVNA 2XZLA 1FFXB 5CFRA 3N8DA 1APBA 1XA0A 1KRHA 4IDHA 1CUWA 1ZJWA 1Z74A 1BMQA 1VYVA 3CRMA 1U94A 3IURA 4KVFA 2AZMA 5DWVA 4QDJA 3ED5A 3IPLA 1YB2A 1COWA 3NHWA 1VKNA 1MDFA 3NIWA 1F60A 3P9IA 4DQDA 1Q1NA 1MP0A 2CL7X 2P62A 2PV7A 3B1FA 1H1LA 3D7MA 4HLNA 2RAFA 4MQ5A 4H6PA 2CGEA 4R7ZA 5CIWA 3KKOA 5GWXA 1JLSA 3AR4A 5IKEA 1Y6FA 2XB4A 4DCUA 3QX7A 1UXOA 3L04A 4UBNA 1JAIA 3SU8A 2CBZA 2VPTA 3I42A 4K03A 3JQBC 5F35A 4OGGA 5EE5B 1QRUA 2E4UA 3MS2A 5F2NA 5IU6A 3C3AA 1RI1A 4TSRA 4CODB 2TMYA 3RAFC 4DHWA 3K6KA 1JKMA 1E6LA 3FCXA 1CSEE 1TGVA 3IOMA 3TPCA 2O06A 3QLUC 4ZZ1A 1VPVA 1HTTA 3B1ZA 3D6VA 3OFKA 4LZNA 4PXSA 1F17A 4XUEA 1NN3A 5CB0A 2AYXA 1FQJA 2KLHA 4IG4A 1GAXA 1FUUA 1Z6TA 1VPWA 1I0ZA 1WM1A 1W581 3CH4B 2DLNA 4RTNA 3Q2KA 3F7NA 4N6OA 2ZBPA 3ICPA 1X14A 3IYLW 4IF4A 1XDZA 4MPRA 3LC0A 4MUXA 2FUNB 3A27A 4GLLA 3STUA 3OT4A 3G0GA 4UXJA 5G0VA 4K9DA 1NPYA 1SNYA 1M1YE 1T3GA 4EKIA 1SXIA 1I7LA 1GPAA 2GBIA 1HTWA 1BU5A 1P60A 1TIBA 5K0JA 1PYGA 4YJHA 4AYTA 3KR0A 4D9BA 1EP2B 3HJFA 4X7RA 3NGLA 1CRWG 1XKTA 2ZT5A 3E48A 4J1SA 1NJ6A 3BMCA 1A8SA 4OYHA 2O3JA 1E2NA 4RXMA 3UPTA 1V7QA 4QIHA 1KMHA 1CX9B 3C6QA 4QXPA 1TUBA 3ORQA 4YCCA 3HBAA 5LLTA 1HFEL 3LV8A 1FTGA 4PO3X 5EJ7A 3D59A 5JNUA 5JFOA 2DFPA 4JMLA 3AJ8A 3AVQA 3LI2A 1GTL1 2AR9A 4U3JA 3TBKA 1SJ9A 2FU5C 4GFDA 2VYQA 1GQOA 1OREA 3ZVMA 1E0SA 1BSVA 2C8LA 1Q20A 1XNGA 4UFPA 5EP2A 5DMHA 3TW8B 1ZG3A 2BCGY 1BX0A 1ZIXA 2GD6A 3IJRA 4GAEA 3H1TA 4BFXA 2QIPA 1OLXA 1XEXB 2ZSHA 1ZUIA 4E5VA 1XDUA 4DIKA 1ZJ5A 4G5FA 5BV8A 1Z4QA 1MW8X 2H92A 1DWOA 3FRHA 4N12A 3O4HA 2CJPA 1PR4A 2IY9A 2BJWA 2FTKE 2R1TB 3DE6X 2UV8A 3N5KA 4DILA 4YRPA 1DHTA 1V26A 1DBSA 5CH3A 1FS6A 2I1QA 4S1NA 1E64A 3VDQA 4EJ2A 3TN7A 4YAGA 3HZRA 1E4YA 1P44A 4OIMA 4E08A 1W52X 1UBOS 2BWJA 1W4AA 4DMGA 4F3TA 3PUKA 4EO4A 1KQGA 2X22A 1VIVA 3EPHA 3AFHA 4LMAA 3Q11A 3WQHA 1K7FB 2VDRB 3SM3A 1RKBA 3D3WB 4IH1A 4CKEB 4DLKA 1ZXLA 3T5TA 3T9DA 4QGHA 3JPYA 1F9AA 1WW8A 4KQ9A 3ZIDA 3LW8A 4XDGA 1L7VC 2EYUA 5ECWA 2RC5A 1H9CA 4BQSA 5G02A 1VSVA 2DF8A 1S5PA 3DYBA 1M1XB 3I9JA 2W7TA 2WFLA 2D1YA 1NURA 2WUDA 3AXTA 3LUGA 3B8HA 4MS1A 4PE5B 4DREA 4HVAA 4DPKA 4AY5A 3P2KA 2R5FA 2V97A 2IU0A 3V4OA 4LY3A 2XKKA 4XPIA 3AQ4A 1CK4A 2AHRA 3AEUA 2RIRA 4L74A 3N2KA 1IM5A 2V9PA 2QRKA 3IP5A 3GEBA 5IZ4A 1O03A 4BKUA 1W36B 3QVUA 3FCSB 4V02A 4PIVA 3PXGA 4LZAA 4C3UA 1F0KA 3NRBA 4GLJA 1A5SB 4HZUB 4MEBA 5EJAA 1W2WB 4OH7A 1R7RA 3SI7A 3PRYA 4RK0A 4N47A 2X1MA 3JTMA 4Y1GA 4A5OA 2VR1A 2ZPUA 4R54A 1S7GA 3IAAA 5I7WA 1G8KA 2WILA 3R40A 4AZ0A 5K0CA 4CF7A 5DK6A 4AS3A 4DXAA 3U3JA 4ZHQF 4K9NA 2EZTA 3AEKA 1HNZB 3EW7A 3JAKA 1L5MA 2BFEB 4HTFB 2YVUA 3ZDXB 4IINA 5AUQA 4PN3A 3B52X 5DT2A 3CEMA 3IUEA 1XLUA 5JECA 1PEAA 1GJRA 5KREA 4KNYA 2F43B 4KYVA 3RVDA 5KOHB 5BNTA 5K0TA 1KMMA 1ZM2A 2OVBA 2XRMA 4LA4A 1WNFA 3ZC3A 3CLSD 2UVPB 4ON9A 1ZDMA 5JY6A 4L1KA 4BVKA 4KQ2A 3PX3A 4NHEA 2FPXA 4AJHA 1FX0A 3OBIA 4PR3A 4U7WA 4A73A 4YAKA 5HYVA 1KMHB 1XTJA 4MPPA 1OLSB 1LQTA 1P0MA 3LWZA 1J2UA 4PRKA 5DCWA 1QIIA 1SG9A 3TZ6A 4AJ4A 1RD4A 1WE2A 1Z0UA 4OBBA 1GUAA 5TE9A 1XKQA 2V3CC 3NTRA 4WZZA 3DBHA 3H8VA 2CDCA 5J2TA 2AN9A 1Z83A 1UBUS 8ATCA 3WIEA 5I7AA 4JVOA 2PMFA 4FBMA 2BGMA 3KLNA 3RTCA 2ZSAA 5A2GA 2ALJA 5AJUA 4N5MA 3HXPA 4WD3A 4E2XA 1JR2A 3P9CA 2AN4A 4QNRA 3DZDA 3N8IA 1YDWA 4XX1A 4N9WA 3NDIA 1P33A 3DEYX 5AQEA 4BNVA 3VR4H 1IXKA 2GPTA 2K2WA 2WTMA 3A3KA 3CQ9A 3AR6A 1K89A 5ADUS 1MOQA 1Y3HA 2XECA 3R4CA 4KLCA 3M1YA 1I94B 2NUPA 4Z0PA 3TOCA 4JC0A 1R4NB 4N3CA 4UM8B 1JWAB 1L7DA 3VHXA 4RKQA 3DFKA 3IDFA 3OJXA 3TIWA 2ZB7A 1CZ5A 3UNXA 1WQ3A 1Q0RA 3VZBA 1A9RA 1MV5A 1SOUA 1T9GR 3A4NA 3OFSA 3RVPA 3IUSA 1FW8A 2QWXA 1MG0A 4IIEA 1IJEA 2WOJA 4FGLA 1E2UA 1GZVA 2GSDA 3CRQA 4FS8A 2CYBA 4MQLA 4C4OA 1Z56C 1UPBA 4OEHA 1ADBA 2BKAA 2DEUA 2CHUA 2WLSA 2WYWA 1JXOA 2PWBA 5M34A 4XYLA 3ENZA 2F90A 3VM6A 3QIAA 1JTEA 5CM2Z 3W1VA 4EUFA 4ZI2A 4ZJZA 1EFRD 1CQJB 5E4YA 1B8PA 2JFNA 4HLUC 1WCXA 4IICA 3LY5A 2FPIA 4UQOA 3V4SA 2WFLB 3GR6A 1T0BA 3X1JA 2CT8A 2PKRA 2RI1A 4NFSA 2QM0A 2JK0A 2YV3A 4K87A 2W0SA 4KU4A 3OQNA 4A8HA 3GJ7A 5IS2A 1X1TA 1QKJA 3MOIA 3DMNA 3ET4A 3A9WA 2R60A 2QN7A 1Y3AA 2V7UA 2PWAA 3ITNA 4J0HA 4QL3A 4XPIB 3TEMA 4U7TB 4UAJA 5DH9A 1ECCA 5THQA 1TYBE 4RD0A 3WJ1A 2X86A 4IS2A 4O02B 1Y7IA 1GPLA 1Q19A 3MBKA 1X74A 4OKNA 5SICE 1ZH2A 3EEIA 3NM4A 4DYDA 3DSRA 5BSMA 1J07A 2OHOA 3AC0A 2W70A 2CB9A 2VP3A 1PGJA 4ZI5A 2D1TA 2HQSA 4L5AA 4RHFA 4JI8B 3G1UA 1SCIA 5LOVA 2B4RO 3A6PC 1YWGO 3OIYA 3KOXA 1G19A 2VFAA 4P82A 1QLWA 4V0KA 3C8HA 1VYTA 1EG7A 2XW6A 4W5QA 1ORWA 3QITA 2P2SA 4IH4A 4RETA 3WWOA 1Z2NX 2XB6A 3CE9A 3VV3A 5FOUA 3NXSA 4ZHSA 1Q77A 1XCLA 3QEMA 3EDCA 3KQMA 1W46A 2OAQ1 3SJ7A 4FI3F 1QYIA 4MIEA 5CBPA 1WD5A 4X90A 1UXGA 2R5WA 4PS1A 3QPDA 5E8JA 3FCEA 2F17A 3G9UA 4RFVA 5T67A 1HDXA 1LC0A 2KSQA 2PA3A 3OE4A 2ZIEA 4IIYA 1F4PA 3WRXC 4ZRDA 5B4TA 4RDXA 2QLFA 2D2IA 3ENNA 3N0WA 4I1RA 4R0VA 5FULA 3G85A 1SQGA 2P2YA 1GPNA 3D8UA 3ICVA 2O8EB 2HU7A 2YFKA 1T4GA 4N8SA 4Q7EA 3L8GA 4JBXA 4I6JA 4PCVA 2PT9A 1VJ1A 2PS0A 5LDHA 1K2VN 2JATA 4CEHB 4R8RA 5DYTA 3Q8KA 1ICIA 2YYZA 3PGA1 3BOSA 1B15A 4AZ3A 3IELA 4KXFB 4F46A 1KWGA 2AZDA 1EDZA 3F2IA 2GCOA 3KKPA 4OM8A 2QEQA 2Y71A 4RYLA 1KSFX 1DJQA 2EFDB 3BILA 3RQIA 3ZDBA 1U99A 3UT0A 1ZI8A 1Z7BA 4G5SA 2ZQZA 3TM4A 4ER6A 2QUAA 1Y0BA 4ZVUA 1PG2A 1X42A 3MWLA 4XVQA 2RHRA 3GGCA 2JAOA 3GJ8A 1YB6A 4DCOA 5A5GA 1SN7A 1J5XA 3AP1A 4V0QA 4Q4HA 5C34B 3ZLUA 2B92A 3NP7A 2HWYA 3PHHA 3P27A 3ZKAA 2CVFA 5KWSA 3PE6A 1CQWA 4ROSA 1L5NA 3ZHTA 2QZJA 2ICAA 1KJYA 2JANA 3GVCA 1N5KA 2ENWA 1T10A 5DP2A 2BEVA 2ORYA 4CTNA 5CA0B 2FCAA 1CY1A 4K1LA 1FA9A 4W1PA 5DM70 1XJ0A 4ACAA 4KFCA 1ZC3A 3D43A 3EDOA 1XVUA 1ZRHA 3SHWA 5FB3A 1S3IA 5D5PA 3GP3A 4RV4A 2BZSA 3HI6A 3D1LA 3H19A 2NYVA 4QQ8A 2BJHA 2AFIB 3AHHA 2Y76A 3NU1A 2PKYX 1NJ8A 2BAGA 2CXUA 4C29A 3AEQB 1HEIA 1B16A 4NH0A 1N25A 2JFHA 2JPDA 4JUBA 2WDZA 3FF1A 1ZKDA 4WBXC 2Z5LA 2J6CA 3NWBA 3SBDA 1XVAA 1XD9A 1A1VA 4YA6A 2OSBA 2W6QA 3A4LA 2IEDA 4XH9B 4INAA 3RSCA 1DRJA 3ITDA 3PNBA 2VNAA 4BY9E 1QQBA 3PEWA 1UP4A 3MBIA 4ANFA 3L6EA 5GVSA 2XX3A 1YJXA 1EFKA 2GK6A 2FA9A 2W90A 3CSUA 3HYSA 3VO9A 5IZCC 2Z4SA 5CH5A 3EE6A 4BC1A 2VOJA 4KB5A 4JJIA 3ZWMA 5IDQA 2WP0A 1PP4A 2ZJ4A 3MC1A 4PCUA 5IVKA 1EB9A 4JQYA 3GLGA 3H4MA 3GIWA 2Z8XA 3EPJA 4FE3A 1NHWA 4HYEA 1LS1A 4RA9A 4A2CA 2M2IA 3D54D 3NKLA 5C5IA 1N92A 2GK3A 3NC1C 5DBIA 1J8QA 3PEUA 3VMFA 2WFMA 4F2PA 5CBPB 3FUWA 2IQIA 5LCXA 3F9IA 3MAAC 2OOSA 3JALA 3SR0A 2ONZA 2B36A 2WM2A 3FMPB 4R8KA 5CX1A 3PVSA 1RPNA 2HEGA 3ONWA 1RS0A 2YYSA 1RWKA 3AVPA 4XQ9A 1O77A 1WDKA 1V6AA 4FFBA 4X1KA 1W6RA 2IXEA 4YRDA 2BW0A 3H5RA 4EB8A 1G5PA 3QWBA 5HCUA 2E85A 1OWOA 3IEUA 5EIEA 3K2IA 1TCVA 3IUJA 1ZU4A 1I2DA 1D2GA 1N2BA 2Q1SA 4CIBA 2OO3A 3INTA 2N1MA 2PWZA 4GX2A 4BJHB 1RPZA 1DJMA 3CWCA 3TFOA 4M0UA 3RVQA 2QYTA 1E92A 1HDEA 3AIIA 5T4EA 5INTA 3D3QA 2IPMA 3IAFA 2OZLB 2YMPA 3QVVA 1YU6A 4R1TA 4IYJA 5TQJA 1IXRC 5K20A 5ALRA 2KI5A 1GA1A 1T6XA 2VAVA 2XTJA 1HEUA 3KJXA 1AY0A 3RVJA 5FWDA 2FMFA 1X70A 3TZKA 2J3JA 4IHJA 1M6YA 4MW2A 1KVQA 4N01A 4QOIA 5TQ0B 3C7DB 3OQ6A 5J58A 4DV1B 2AKEA 1XYGA 3FCYA 3UGQA 4IDQA 4M9CA 3DKPA 1KNXA 1SC4A 3SIRA 1JLKA 1HYHA 1GSIA 2GK7A 2FN3A 4B17A 3R5HA 3F0TA 4MVXA 2Q1AX 1QP8A 1ZJJA 2XADA 2B4YA 4CMIA 1SKBA 2P3QA 1D3AA 3O9ZA 1W88B 1G3QA 1ZBDA 4NATA 1XJ5A 1G7CA 1THGA 3QVXA 4JOBA 3O93A 1R16A 1MO2A 2VS1A 1IXSB 2NPIA 2H5JA 4EF4A 3R5FA 3VSAA 5LXTF 4LN1A 3N74A 4II2A 2JVKA 3RAPR 3SSMA 4UHKA 1OZAA 3T41A 1JPNA 1CF4A 1G4AE 1H65A 3ABRB 4MS4B 1FU7A 4YUYA 3GEGA 3DV0A 2O2EA 2J7KA 1U7DA 2ORVA 2V6BA 3AEZA 5E8RA 4KC0A 2ZJ0A 4PSVA 4HC4A 3Q3VA 1IZ7A 3BE4A 1DKMA 1SCNE 4S1PA 1FP4B 4BIMA 1R4MA 2VWQA 1SKYE 2AF3C 2AD5A 4WN9A 4KMMA 5AXCA 2GLXA 3NHBA 3T9BA 1YIAA 4HNVA 1ZHFA 1VMKA 3TBFA 2G88A 3FUXA 4QDTA 4AC9A 5JR3A 1ZP6A 2AR0A 1JQJC 1VCIA 4IOMA 2JK1A 2D54A 3DKVA 3IIKA 3SZUA 2VT2A 2VPZA 3PC6A 4ER7A 5L7TA 2P4SA 3G17A 5E7QA 2GF2A 2O48X 2V03A 1BNCA 1YO6A 1ISGA 5EY5B 3ZVLA 1E4VA 4GWKA 4EABA 4GKKB 1X15A 1YH3A 3H0EA 4DMHA 4WPGA 5KUTA 2O0KA 3H1EA 4Y0AA 4UOZA 1E1KA 2I4RA 5B6IA 2RD2A 1PKEA 1EQAA 4DJDC 1Q1GA 2IZ7A 2ZWOA 3MF4A 4DIUA 1WUKS 2JGDB 3EEOA 1UINA 3FVTA 3JAWA 5BN5B 2NU8A 5JS1A 1M1YB 3JALB 1KBQA 3MWKA 1U5AA 1B26A 1LU9A 1XJCA 2Q1TA 1A7AA 3FGPA 3JQAB 3AUTA 4LDPA 4G65A 4MWTA 4EKDA 1LPNA 4X1KB 2XOXA 4P22A 4A6XA 5JVDF 4CM8A 3NHUA 4D56A 2FH5B 4MI3A 2YOHA 2YZKA 4MYDA 2ZUFA 3BRQA 3OSUA 2QTHA 3ZHRA 2Z6QA 1NMYA 4RZSA 1S96A 1EK2A 3IERA 3IVXA 3N8HA 4HEA1 4Q1CA 3DOEA 4EATA 1DAHA 1PJTA 1YFKA 1XP5A 4TKUA 1VIYA 2Q4RA 1DJPA 5A3JA 3FIUA 1P80A 4CYMA 4D99A 4GL2A 3IAUA 1DSSG 1U0TA 4IIFA 5F2KA 1ECPA 2G9UA 3GOHA 3NVDA 1WV0A 3AG6A 4V39A 3QY9A 4FCVA 3T35A 4EG5A 5ERXA 4UE2A 4U63A 2IZ6A 3W1WA 1L4GA 1GYRA 4FSDA 5K9ZA 1O94D 721PA 1MR3F 2WHPB 4QXRA 5T6BA 4JI2B 1T8UA 3LT2A 1IBMB 1YUBA 4P58A 4WOJA 1QPGA 3S55A 4DE5A 4X9XA 2G8NA 4B6FA 5DM2A 4E5DA 1H1TA 4F0JA 1WXGA 5JY1A 4M0DA 4KN9S 2ZKLA 5EQDA 4WK0B 4LX8A 4R83A 4J6FA 3SQWA 2F1HA 3AESA 4NMXB 3ZG6A 1PT7A 3WLFA 1J24A 2JA1A 3E8MA 3HSYA 3I2HA 3SQDA 3T4UA 4M0PA 1QYWA 1CJBA 3QFTA 4FTWA 1LDEA 4JLSA 4QRHA 2J0EA 1FYEA 2PO5A 4Z2YA 2GKGA 3OJ0A 4QLOA 3C16C 5HS6A 1ZVVA 1ZGBA 3NAGA 1DI0A 1S9HA 1BS1A 1JF8A 5B12A 3EUEA 1XZIA 1JALA 1L7NA 2Q3FA 4S2UA 1ZVJA 3RUDA 1OKKD 4D9HA 4X0EA 1S2GA 1NWCA 4JROA 2OE2A 4QJIA 5CLQA 3FN4A 4R05A 5CCXA 2R6HA 4LVNA 2O1WA 2ZTMA 3CIOA 1CEEA 3U61B 4DQ0A 3K15A 5KKAA 4HEQA 3DV0B 2FRDC 2Q4BA 3HJCA 3PGJA 4IIHA 1DWPA 2QTNA 4M7PA 4OM7A 4OUDA 4TL6A 5ALXA 4C0QC 3TR6A 2NUAA 1J42A 4RY0A 4DA9A 5IPFA 1SVKA 1T4MA 2OT3B 3NIGB 3WBBA 3ZWOA 1KY3A 3E5NA 1BDJA 2BE7A 3EMKA 3PPYA 1UAGA 3SFZA 1CLEA 1TU4A 4LJ4A 2VOEA 3WLKX 2KBEA 2O7RA 1WXEA 2DHCA 3X2SA 3FSGA 1G3MA 3EOZA 1OAKA 4MYHA 5CNIA 4GWLA 2HOQA 2R7AA 3EK2A 3DLPX 2PZMA 1WD7A 4G4SO 5HMLA 3RUEA 3U26A 3AHJA 4DLTA 2VQFB 3OIGA 2XGJA 1BJRE 3LCVB 4A6EA 4F7WA 3OE5A 4CG3A 2BH2A 2C03A 1CV2A 3H2ZA 3DBLB 4I8XA 5F2EA 1NBMA 3UK7A 4JENA 5AW1A 1I2AA 2WYUA 1NIJA 1U8TA 2ISSD 2NNLD 3BFJA 3DXYA 5GJVC 3JAWB 4LXUA 1E5XA 4HB2A 3RTBA 1TQDA 2E4VA 4FJ2A 4WKPA 1XD8A 5CVUA 3GLIE 3L0IB 4GOJA 2EFEB 5CG2A 2OWDA 1NV9A 2H54A 3JRWA 1PQUA 1Z0ZA 2CBGA 1XTPA 1YS1X 1U0GA 4AKHA 3JQ8B 5I51A 1ZNWA 3HM2A 3P20A 3REFA 1P4GA 3SHTA 3S81A 2NACA 2M1ZA 3KVYA 1V8FA 1ZUHA 2XV1A 3ISJA 2B37A 4G89A 1GAWA 1UK8A 5J23A 1E58A 4YJ3B 4O2AA 4RSGA 4RF3A 5HNKA 4DIDA 5K3EA 3DFUA 4LGYA 4GKJB 1KZ7B 3OVMA 4UASA 3W5HA 1GCOA 2AXEA 1O8BA 1H69A 2QN6A 2VYFA 4WQMA 1Y1QA 1YJQA 1J9ZA 1H0RA 1WQ1R 4Q7QA 3GEHA 4M54A 1V3TA 3G6WA 3KAKA 1V1MA 3WGUA 2C4WA 1PG5A 1VL0A 3AINA 3VAYA 1XMOB 3GAFA 1J5PA 3THWB 2D2XA 2PGOA 4ODIA 2GA9A 4HGRA 1S3SA 1XXHA 1NA5A 5EUBA 5H5JA 5JD5A 3ZYZA 4DMCA 3B8EA 1QZ3A 2C3UA 4N6NA 4EFNA 1XPUA 2OO7A 2F3PA 2P6NA 4AN4A 1DC6A 4URZR 4D92A 1OXVA 5TB5A 2B9EA 2HMWA 2R6JA 1AU9A 1OVMA 2NG1A 1VE3A 3JVDA 4F84A 3TF5A 1C9YA 1EJ2A 4EG0A 3RG8A 2DR3A 4B82A 1JIJA 3L7JA 4AP6A 3CWZA 4BOYA 2VUTA 1J7KA 2NP6A 1QUFA 1TMGE 3HCBA 1SWWA 4QWWA 4PIMA 3DB2A 3B1KA 2CJWA 1GQRA 3WWCA 1CE8A 1QYVA 1I30A 1NVDA 1WAMA 2CWWA 2QTTA 1AS0A 2X2EA 2ZUSA 2GRJA 1DPGA 3ZZTA 1FMLA 1OV4A 2P2CA 2YZ2A 4I5DA 4KO3S 4W1SA 3ZWKA 2HSWA 5CX4A 1NNUA 4K8RB 3ZR4B 4CM9D 5FDFA 1NQOA 3LHKA 1OHHD 3RIHA 3TFQA 4MV1A 2QN8A 5FTKA 4LC1A 3OU7A 1TKRA 3E4DA 3H5VA 2NVOA 4EQ6B 4Q5IA 4HNAB 3MMPA 5JCOC 1R8YA 3G82C 3CZ5A 3AETB 1LSUA 2CLKB 4LK3A 4GX1A 4IOKA 1TC2A 1U8XX 2CFOA 2DWQA 4OGLA 1JUDA 1US8A 3RUCA 1DU4A 4W5JA 5CNMA 3CJRA 4C04A 3ZDCA 1GNTA 4GZ5A 3NDPA 5JI3E 2QTRA 4Y9UA 2GETA 2Z1DA 4HNRA 4KQXA 2QTVB 3HV2A 3TIIA 1L7OA 5L3QB 1RRKA 1JG1A 5AKHA 3OZXA 3OIWA 4TWBA 4ZEOA 1QFYA 2GAOA 2H85A 2IHVA 3FDZA 3L7LA 3DAGA 3DUWA 4KNVA 4Q1EA 1GILA 1PR3A 4M1YA 4LCBA 5IJXA 1J7JA 1PL8A 5C81A 2GTHA 2BGGA 1PYDA 3F49S 4FB4A 1R0ZA 1MAVA 4TROA 2EW8A 1I2CA 1ID1A 2C00A 4BYMA 1U4NA 4QAQA 1TXGA 1ZXXA 2V7PA 3E7XA 3SX0A 1A7KA 4X84A 2FN9A 2EGGA 4HSGA 1R4AA 3MRTA 1AUXA 4QPNA 4EGSA 2D6FA 2OFXA 4ND3A 2BFDA 2UZ0A 3ZY5A 1F2DA 4GOLD 1O95C 4OB8A 3DTVA 2I80A 4BFSA 2FR8A 1F38A 2H63A 5IK2A 3HLTA 4KLNA 3H65A 3N0TA 4RDCA 3TZCA 3W5BA 5BNIA 3WMXA 4N65A 4CKCA 2HADA 2ZUTA 5BMOA 1JDSA 2VK4A 1O6CA 3FBTA 2A4MA 9ABPA 4XOUA 1FS4A 1WDWB 1ZD4A 2Z2IA 3M5DA 4MR8A 3UT5B 2YNMA 2WSSA 5KNCH 4MLZA 1WDMA 2ZWVA 4XYEA 3RFUA 4ERXA 4MYSA 3RFVA 1RWNA 1HRKA 2QNBA 3EYWA 4UZSA 1L8AA 3JZIA 2B9VA 4ALIA 3ZW8A 5A1JA 5F5XA 4GOKA 3U39A 5MDHA 5TT0A 3TQCA 3BTSA 4EL5A 5T8KA 1CG6A 1BYIA 3CR7A 3P0HA 4W9NA 2P4HX 4ZYXA 4RV9A 2W6CX 4LECA 1SEVA 4UAGA 3C3MA 3WDLA 4LV5B 1CETA 1ONOA 2CJWB 2VCHA 4QBHA 3OD5A 4QUAA 5FL3A 1JT9A 2G80A 2NV0A 4MW5A 1FMJA 3R3VA 2J9XB 3ZHYA 4R8LA 3MTIA 3I53A 1D2EA 4OFXA 3TIGA 4ZVMA 3DMYA 5IXYA 1VGRA 2XYGA 3V7FA 1WU8A 1YBMA 1H6AA 1W5EA 5ES4B 5FR1A 3T3OA 4NABA 1Z0FA 2AR7A 1V37A 3OQBA 2ANCA 1GARA 4PGMA 4QGAA 4PLGA 1IVNA 1I9CA 4LE1A 4Y6RA 3FPSA 3B6KA 4BO1A 5ES3A 3CLTC 3HYLA 4JLPA 1IEWA 2HGZA 1HC7A 2F3QA 4LHVA 4FJ0A 3WRYC 3LBHA 1DO8A 3J81k 3QUTA 4UTOA 1B8VA 1C5KA 1G2OA 1W5TA 2X4GA 2IK8A 2B4TO 5DEOA 2FPWA 2LGJA 2YJGA 3T1YB 4HQ0A 3GPLA 3SQMA 4KDRA 1G6OA 5IJAA 4PCLA 3T61A 5AK3A 2IUFA 1HDCA 1QO0D 3QYPA 2QRGA 4B34A 2H4ZA 2YOGA 1BFUA 2FUKA 4GHWA 1KI8A 4EFLA 3D8RA 1W4LA 4FWBA 3DDNA 4NVRA 3OQPA 1MW9X 2ESRA 3UCFA 2H4YA 1Q1QA 1JDPA 4EI8A 1ADJA 1UKYA 1LBEA 3WBKA 1BEZA 1TPZA 1IWPB 4GMGA 4EBBA 4QEKA 1E1CA 3PR1A 4KMRA 2AT1A 4G5RA 4TYPA 2O8CA 3FWNA 3N70A 2RKBA 5FORA 5IJ0B 3RROA 4MRRA 2ID7A 1U80A 4EY4A 4R4JA 3PQ5A 3E3OA 2DFVA 3O7MA 3DWIA 5H9WA 2CHFA 5HHTA 4LJ6A 1D8AA 1XSEA 4XD7A 4ALLA 3C1AA 2VHJA 1PUXA 4PX5A 1UEJA 2GZRA 4UM7A 1ND5A 1IQPA 3WRVA 3GPBA 2DP4E 1H9AA 4JJFA 2XUAA 2JKYA 3ODPA 4C3ZA 1T0HB 3B9BA 4HDRA 4OHFA 4KPUB 4Q9LA 2OXRA 5AXAA 2O8VA 1T8RA 4ENRA 3R7NA 4U7DA 3EEQA 1UXKA 2XKBA 4HEJA 4OXQA 3R3ZA 1E69A 1U0FA 4L76A 1FPMA 4Q7KA 1S3GA 2JRLA 2D0PB 4G09A 5CRIA 3IEVA 1T9CA 2VK8A 2H2GA 1YZUA 4RH1A 1DB3A 3TIFA 1H66A 1VPDA 5CA0F 2G71A 3O73A 5JYCA 1T26A 5D3MA 3DHYA 3D5TA 4W9RA 2QNIA 2GM5A 2XE6A 3KQNA 4G8DA 5DHRA 2X40A 4HH1A 3M9XA 4ZANA 3WX0A 1A69A 3I2YX 5SZJA 1I4DD 4W5OA 2ATXA 4L0CA 4J03A 1CTQA 4GNKA 2BGUA 4OU5A 4IIJB 2AJDA 4FMDB 4ZXFA 3A2LA 3ASYA 4WA8A 5A4AA 5EJEA 3EUWA 2RHLA 4ARZB 4MVJE 1JDBB 4EA7A 2BR4A 2Z9BA 1SUWA 2B99A 2VNJA 3QVMA 4ZO8A 2FLWA 4J90A 5TR9A 4G36A 3RYCB 4MDYA 1JSZA 2D0DA 4ARBA 2PRSA 2VUSA 4KIJA 3UAZA 1BMFD 3P94A 1EWRA 2FZVA 1JDVA 3ICOA 1NVMB 2HT1A 4KPGA 2WVAA 3F5FA 4ZTUB 1W5AA 1I3CA 1K63A 1KSHA 1SBNE 2IL1A 3OPYA 1IUPA 4Q1BA 4XYGA 3L4EA 3TLBA 3K6JA 1Q1EA 4QODA 2BFBA 3KU4A 4JKYA 2VDWB 2HIAA 1R8XA 3L0PA 3W04A 1NVAA 3CVXA 4HNGA 1K75A 4B8YA 1WDLA 4MICA 1E2LA 3DGEC 4AM8A 5HS4A 1YQUA 2FOXA 1XU9A 3DNMA 4MOWA 4XGRA 1M1UA 3EVDA 1DKOA 1A72A 1MAWA 2I8LA 3G8YA 3JVEA 2WWIA 1TVKA 4X6XA 4QUEA 4BFYA 1VL8A 5DTJA 3PSAA 4H27A 5I9SA 4IQ4A 3ODGA 2XITA 4I55B 2DFNA 2GXAA 1BFDA 4D02A 3MJHA 2OBNA 3BTUA 5F52A 4BNUA 3PC8A 1ULHA 1CVLA 5FUQA 4EG1A 3B85A 4BNWA 2GPJA 4HWSA 3PDIB 4RW0A 5C7OO 5HKOA 4M89A 4OP1A 4ZQGA 3K32A 4D3ZA 1Z45A 2FETA 3T15A 1ZK2A 2XB9A 1T3HA 4XYMA 1W5BA 1DOHA 4MLPA 1YQ9A 2W22A 1QCYA 5HK9A 1GXSA 4AWAA 4B9AA 2UXCB 2HR1A 3MTJA 3CEHA 4P4LA 1O6FA 1F51E 1DE0A 4L4RA 3PQFA 4XARA 1QIHA 3LY7A 1UDAA 4RPHA 1L8QA 1E9EA 2IU4A 3DM9B 3S7TA 2Q2QA 3E03A 1PI3A 1V7PC 2Y4NA 2ZDHA 2G4CA 2AE1A 1Z7GA 4PZDA 1F14A 1MLDA 5CT8A 3SR3A 4PHGA 1NW4A 1LH0A 2O3TA 2EBUA 3IT3A 5LBIA 4E1BA 2W6ID 3ACBA 2NMVA 3RHZA 3DLIA 3V34A 3V1MA 4W9MC 4EYGA 5ALUA 3EVAA 1TCAA 1EI9A 2M6KA 4ER5A 1ZH0A 1ZNYA 3VR3A 1CR4A 4PX3A 2AMYA 2AB0A 1GCIA 4RAQA 3VR6A 4LFBB 3ABIA 4AICA 5EHGA 2WWRA 4DMMA 4MI6A 3TOSA 2IH5A 1V41E 2R7NA 3DPUA 4RVFA 3ZWQA 3RR2A 3DULA 4DLBA 4XKJA 4DEXA 2ZQ5A 2R1UA 2QL7A 2ZSEA 5D3MB 3SE7A 1E2QA 2IEBA 5HF6A 1SVIA 3VSCA 2NV6A 5FBKA 5K7SA 1XRPA 3ZK7A 3TKAA 2P1RA 1XDSA 4WOPA 2DH6A 1E6UA 3O94A 4GR5A 3KOWA 1L2TA 2A3RA 5ICGA 2VYVD 3VPHA 3AHFA 3MMNA 2MJLA 4NRDA 1KZYC 2ZFUA 3DLAA 4XQ0A 4EVIA 3UUGA 4F72A 1VB5A 1Z34A 4KHPB 3WO1A 3DZJA 4OX9B 3A28A 3IMEA 3L6UA 4LXGA 1T36A 3M4JA 3VR2D 4QT4A 2GPNA 4ZVTA 2F2TA 3B13B 4HB0A 5EHQA 4AD8A 3VI3B 1TJNA 5D6YA 2Q29A 3B5EA 4BFTA 5JRZA 4EH1A 4NI5A 4LNUA 2AK2A 5TNXA 3V8EA 4I6GA 2FQYA 5FUBA 1IMJA 2IU3A 2WF9A 1J21A 5IDXA 3WB2A 3DAYA 3TX2A 1YZTA 2I76A 1Y8ZA 1Q15A 1A1SA 4FOTA 1RXWA 1YQGA 2R97A 1CIPA 2G63A 1JA1A 1V6CA 3EX7C 3F5DA 1R1DA 4HDKA 4BXOB 1R0CA 4B4DA 2BGIA 5DO9A 1H6DA 3FZNA 1J4AA 5LC1A 5B58C 1H0SA 3KJGA 1XROA 1W25A 3G0HA 3WSTA 1MEOA 2TMGA 2ZJ1A 3DDHA 4GMKA 5AHOA 5FNVB 2PLFA 2ZROA 4FFMA 3SXUB 4MLDA 4G81A 4FUTA 1PSWA 3ZHVA 5HOQA 2R96A 3CB2A 3NBKA 4P3OA 3KAPA 3L8MA 3OKAA 4C5CA 4ZYUA 3LVFO 1GN8A 1P7ZA 3TG8A 1SUEA 1WR8A 4PHCA 3T4PA 3PPIA 1R6VA 3K2EA 1AIPA 2ECOA 3PFGA 4AVYA 4C05A 1IE3A 2C82A 2WG0A 4ZQIA 3B3QA 4ZV7A 1F1JA 3HS3A 1EFVA 2WWGA 3CRVA 3K09C 4JASB 4NCJA 2XCTB 1MABA 3A0UA 3V9PA 1TZMA 2QUKA 3A3PA 4Z51A 3AP3A 2JI8A 2AG8A 4PF1A 1CUXA 2IYRA 5B7PA 5EESA 1I7NA 4MP3A 5J59A 1OI3A 5M3BA 5U4QA 5KCZA 2Z3ZA 2BEJA 2JD0A 2A5JA 4KXNA 4P86A 4HVCA 3LBFA 4ZK6A 5KOJB 1U98A 1OTYA 5JFGA 3QF4A 3DEKA 3MJ4A 4PANA 1NF3A 1PSZA 1P17A 2CMGA 4ETNA 1NM5C 2NO1A 3ZW9A 4FXPA 1XLVA 4CTMA 4GPBA 1CQZA 4E46A 5ICEA 4N3AA 1ZOOA 3L4BA 5TMPA 4DV0B 5A9SA 1PHRA 2P1DA 2W2OA 3C24A 3DMTC 3FLAA 3V7WA 1YACA 2XE7A 1YI8A 4MHSA 4UMVA 4WNAA 3FUTA 4NS4A 2WIDA 3VNUA 4XB1A 3B53X 2CUTA 5KNBD 2XCUA 1NF9A 1PFUA 4KQ1A 2F00A 2OZEA 3LDFA 4L27A 5AUNB 4WWHA 1UQTA 3CEJA 4ZOEA