3LGAA

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
253
structure length
253
Chain Sequence
MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 70
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3lgaA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lgaA02
1R6AA 3LKZA 5FCDA 3GWZA 3BUSA 3C0KA 5E1DA 2XVMA 5T64A 3QOWA 3UJ8A 4A6EA 5IKMA 4M38A 5GINE 2EG5A 2WK1A 4PYJA 2BM8A 2PX5A 2XYQA 3HA7A 3TMAA 2IDJA 3EVAA 5HOQA 4FS8A 3FRIA 3JWHA 3SMQA 1U2ZA 5HIJA 2QRVA 3BGDA 3CJRA 3GU3A 3JWGA 3KQMA 4DZRA 3FYDA 5K09A 3E23A 3TM4A 4PCLA 3B3GA 5EVJA 2A14A 5F2KA 2ZBPA 4CKEA 2IPXA 4F84A 3PX2A 2XBMA 2FK8A 2P3OA 3HCCA 5DPMA 5DWQA 3LCUA 5JUWA 5EHIA 1AQIA 5G02A 1RI3A 2PXAA 3DOUA 3FPFA 1L3CA 4E2XA 2AN5A 3R3HA 5K8VA 2PY6A 3MQ2A 4RVFA 4AUKA 4XUCA 2CMHA 3SSOA 3EVZA 2ONZA 4ZTBA 3HEMA 4KIFA 5E1MA 2CWWA 4KVZA 2G72A 1UFKA 1RJFA 2PSSA 3DXYA 4PONA 2PBFA 1F3LA 1XCLA 2FK7A 3HM2A 4ATNA 4ER3A 3L8DA 3JWIA 2C7PA 3KR0A 2CMGA 2FCAA 2YXDA 3CCFA 4IV8A 3SSNA 3G2MA 4EK9A 2FRXA 3K0BA 3LSTA 4M37A 3UFBA 1JG1A 3OZSA 5E8JA 2IH5A 3HTXA 3P2IA 3LPMA 3OU2A 5BW4A 4ISCA 3KQQA 3LCVB 3NMUF 2AN3A 3G2PA 4YUXA 2ZBRA 1FP2A 2IP2A 1DCTA 1P91A 3FPHA 1VP9A 3VC1A 2OBFA 4BY9E 1R8XA 4QQKA 2VS1A 5DX1A 2ORED 2YX1A 1ZHFA 3I58A 3ERCA 3FUWA 2IH2A 4RVGA 3RW9A 4BP1A 5FUBA 2XYVA 3P9IA 4E2YA 1D2GA 1QAMA 5K0GA 5IH3A 3DTNA 4GOND 1P1CA 2VDVE 2VDUE 4CKBA 2PGXA 1SQGA 4RTSA 2HV9A 3MTIA 4BLWA 3PTAA 3OFJA 5DLYA 3D2LA 4GBED 2CKDA 4RTRA 2ERCA 2IIPA 2ZIGA 1R18A 2ZIFA 3HVIA 3M70A 3FRHA 1WXXA 1QAQA 2F8LA 3FUXA 1ZGJA 1KP9A 2K4MA 1SVUA 3NWBA 3P9CA 2ZZMA 2YVLA 2UYCA 2PXCA 5CVVA 1Z3CA 3MGGA 3C3YA 4P7GA 2IDKA 2AOTB 1HMYA 2XYRA 3OFKA 4DCMA 5DXJA 1WG8A 2OO3A 1NE2A 2AOWA 3M6VA 4RSRA 4FGZA 5CVJA 4BLVA 3OU7A 3HNRA 5U4XA 1VBFA 5EKUA 4QVKA 3LECA 1H1DA 4PYOA 2ADMA 2R3SA 5K03A 1TPYA 3LBYA 10MHA 2BH2A 4HGZA 1JQ3A 2NP6A 3TLJA 2HWKA 5ERGB 4KDRA 1QZZA 1JSZA 2VDWA 3B3JA 3A4TA 3I9FA 3VC2A 2NNWB 3BZBA 1N7JA 1EJ6A 3K6RA 3PFGA 4PWYA 1XTPA 3AXSA 4YMHA 3KPUA 2YR0A 3DMHA 1O54A 2JHCA 3KQSA 3S68A 8MHTA 3CC8A 5FWAA 3HCFA 2EX4A 2G8NA 1L3BA 5ICCA 4QDJA 2JJQA 1YFJA 2PX2A 4EQZA 4PIPA 3KU1A 4IKPA 1ORHA 5EQJB 2P3QA 4R8RA 4FR0A 1AQJA 3SM3A 2B9EA 4QPNA 2FHPA 3DR5A 1WZNA 2OZVA 3TM5A 2P7HA 3T7TA 1AF7A 3DXXA 3DLCA 1BOOA 2P1DA 1VL5A 3PB3A 2ONYA 2NXJA 3GRVA 5DSXA 2AZTA 5D1NA 9MHTA 2YUIA 3V8VA 1FBNA 3GDHA 3GRUA 1ZKDA 3LKDA 2G71A 4HC4A 3MCTA 4E31A 2FPOA 2AVDA 4YMGA 2IH4A 4Y2HA 5DM4A 7MHTA 2PWPA 3FZGA 4PYNA 2WA1A 4EVIA 3LHDA 5DM2A 5E8RA 3SXJA 3G89A 3FTEA 3M6WA 2ZWVA 5LR6A 4BP3A 4E2ZA 3EVFA 3P8ZA 1AV6A 4HTFB 4GQBA 2DULA 3KHKA 5FA8A 2ZCJA 4C06A 3G5LA 1JG3A 4PYIA 5FQNA 5E9JA 4E33A 3ID6C 3O7WA 3P2EA 4FSDA 2YQZA 3THSA 3I5UA 4QTTB 3MCZA 1TW2A 3PLAE 2PWYA 3GCZA 5DM0A 2HMYB 4RVHA 2VP3A 3G88A 4ER6A 5E9QA 5HIMA 5CIYA 2PX4A 1RI5A 4MIKA 1OR8A 3GIWA 4IWNA 4PYMA 5D1HA 3ER8A 5HIIA 3EVEA 5EG5A 2P41A 3UA3A 3MHTA 1NV8A 4EKGA 4X1OA 4CTJA 5GOZA 5CVEA 2I9KA 1XDSA 5ICFA 5C0OE 5DTMA 5MHTA 2HR1A 1I4WA 3R6TA 2BR3A 3GO4A 3VSEA 2AN4A 3Q7EA 4C07A 4XUEA 5P8WA 1XXLA 4KDCA 4GOOD 4LECA 4MQ4A 3LX6A 3EVDA 5H02A 2Y1WA 2AOUA 2B25A 1T43A 3EGVA 1X1AA 2CL5A 3HCBA 5EMMA 2HNKA 5FA5A 4X60A 5KYGA 1KIAA 2V7EA 1KXZA 5K0LA 2QRVB 2C7RA 1X1DA 2O57A 3LL7A 2O05A 2QYOA 1M6YA 3AWIA 2GA9A 1KYZA 5E2BA 5KQSA 1FJXA 3BGIA 1G55A 2PX8A 2AS0A 2ZLBA 3GJYA 3CBGA 3OE5A 2AVNA 4WXHA 1KYWA 3THRA 4C03A 5F2NA 3FTFA 3B5IA 3EGEA 3ELWA 4XCXA 5DXAA 5DT2A 5HEKA 4PYLA 3JWJA 4PGHA 3LGAA 1NW5A 2VZ9A 3DLIA 4UOEA 3FPEA 3NDIA 4YUYA 3UJBA 1I9GA 1MHTA 1JTEA 1KPIA 3R9XB 2OKCA 2P35A 4RTJA 1SKMA 2PLWA 2ZBQA 3KQOA 3KR2A 4A6DA 4OBWA 5CCXA 5FWDA 4BLUA 2GLUA 4YUWA 3MTEA 2PJDA 3AJDA 3KQTA 1EG2A 3GXOA 5ICEA 1RJGA 5DX8A 5HZMA 2WA2A 3OCJA 3NWEA 4KWCA 1M0EA 1D2CA 4EMSA 1Q0SA 3GRZA 5EHGA 1G38A 3FPGA 3SGLA 2B3TA 3GRYA 1L9KA 4DA4A 1KHHA 4CTKA 3KQWA 3T0IA 3PX3A 5KQRA 2QE6A 1IXKA 1X1CA 2IFTA 2PXXA 2C7QA 2GB4A 3DXZA 4KIGA 5K0BA 2ZVJA 1UIRA 2NXNA 3KPWA 1BC5A 1F38A 5K0FA 3KQYA 3NVKI 4RTNA 1HNNA 2C7OA 3KQPA 4GOMD 3UJ7A 5K05A 4U7TB 2JHAA 4GC5A 5K0JA 2EJTA 4GC9A 3KR9A 5FHRA 1N2XA 1ZQ9A 2BR4A 4R8SA 1G60A 3B3FA 5LQCA 3BWBA 4AZSA 1EJ0A 2NXEA 3LCCA 1SUSA 5E9WA 4HGYA 4ER5A 2ZSUA 1YZHA 2PKWA 5KS2A 3A7EA 4G56A 3NVMB 3KR1A 5DTRA 2H1RA 3UA4A 3M4XA 3O31A 4GF5A 4RTKA 2JHPA 1R74A 4M36A 4X41A 3KPYA 1JQEA 3ELUA 4OBXA 3ORHA 3A7DA 2Q41A 2YXEA 1X1BA 2UZ4A 1NV9A 4X61A 4PYKA 1NW6A 4DF3A 1NW7A 5E1OA 2N47A 1PJZA 3BKWA 3FPJA 4RYLA 5T6BA 2P8JA 4C04A 4GUAA 5E2AA 2OB1A 3TR6A 3P9KA 3SR4A 2Y1XA 3HP7A 3IHTA 3UBTA 3X0DA 3FTCA 5LSAA 2ZW9A 4E32A 4FSXA 4XUDA 2G70A 1YFLA 3G5TA 3PS9A 3O4FA 3B89A 1XVAA 1M6EX 2H11A 1NKVA 1G8SA 2B2CA 4FZVA 4PINA 3HA3A 4V0RA 3HCAA 4AZWA 4ER7A 4PNEA 4CXMA 2OY0A 3TQSA 2XVAA 3H2BA 1ORIA 4LG1A 5ICGA 4DQ0A 3NJRA 4E30A 3LDGA 3BWCA 5EIFA 5FADA 2PVCA 3LBFA 5GP1A 4E2WA 2GS9A 3AXTA 3KKZA 1IY9A 3EVBA 2PV0A 3HCDA 1EQAA 1DUSA 3I64A 1QANA 5LQRA 1EIZA 4C08A 1VP3A 4RVDA 4GOLD 4MHTA 1QAOA 3RIEA 1IM8A 4QTUB 5F2OA 2ZWAA 3HVJA 3TPZA 3GGDA 1VLMA 3FUUA 5FULA 1ZG3A 3VYWA 2GH1A 3CJQA 3DP7A 3NDJA 3T7SA 5C9ZA 3OU6A 4NECA 2I62A 2ZTHA 1WY7A 5BXYA 3PVCA 4AZVA 3RODA 3OE4A 2ZZKA 3IEIA 2JG3A 5GIPE 4C05A 4R05A 2ZIEA 2P40A 4HH4A 1DL5A 1N7IA 3EGIA 1WS6A 1YB2A 1XDUA 4R6WA 3EPPA 3P71T 4RV9A 3DULA 2R6ZA 1JG2A 2PT6A 1JTFA 4RTQA 3Q87B 5EGSA 3T7RA 1YUBA 2JH8A 5HILA 4PYQA 3TRKA 1RI4A 5CCBA 3UJ9A 5EEHA 4QQNA 5CVDA 1V39A 3UJDA 3WSTA 5HIKA 1SQFA 1Q0TA 1BKYA 2UYQA 2I6GA 5B1SA 2GAFA 2YXLA 1JQDA 4LWPA 5LQAA 3ELYA 5GIOE 3TOSA 3P97A 4Y30A 1R8YA 1D2HA 5EZQA 1O9HA 1NBHA 2JH9A 3M6UA 4HRAA 3EEYA 2B78A 4JXJA 3AY0A 3TKYA 4X63A 3UJCA 2O07A 4YV1A 2KW5A 3E7PA 4WVLA 5EZSA 1QYRA 4PCAA 4V0QA 3REOA 4P58A 2OXTA 5CM2Z 1O9GA 3C3PA 3DMGA 4KRGA 3SSMA 3UJAA 2ZULA 5EPEA 2V74B 3ER9A 4YV2A 2AOTA 3C6MA 2OYRA 2P3LA 2NP7A 2IBSA 3UWPA 4F86A 4OA8A 5K0EA 1KR5A 2DPMA 3UJ6A 3I53A 2Z6QA 3PFHA 4QDKA 2O0LA 5K0NA 4RTLA 1RJEA 4AZTA 1SUIA 3OZRA 1RI1A 4L7VA 3B7PA 4HSGA 1R00A 5K0CA 1SG9A 1TW3A 3DMFA 3G2QA 4FT2A 4RX1A 1XDZA 5CUQA 2NXCA 3TKAA 1G8AA 3MERA 1I1NA 5EIWA 4DKJA 3HVHA 3P2KA 1P1BA 1EAMA 2BM9A 3E05A 1XCJA 4DM3A 5K01A 4RTMA 4FP9A 5BP7A 1VPTA 4MWZA 3LDFA 4P7JA 1YF3A 2ESRA 1KPHA 1L1EA 3P9NA 2ZZNA 1NW3A 1BHJA 3EMDA 2P7IA 4DMGA 2GPYA 4RTPA 2QM3A 3NTVA 3CKKA 3R0QA 5E1BA 3CJTA 5GWXA 4C4AA 5DSTA 5HFJA 1PRYA 3KQVA 3DUWA 2AOUB 3A27A 4R6XA 5DRYA 2Z6AA 2OB2A 1Y8CA 4KW7A 5CVUA 2IBTA 4OQDA 4P7FA 4Z2YA 5LQKA 3F4KA 4RWZA 4P7KA 1VQ1A 3G7UA 4LWOA 3SVZA 3ME5A 2FYTA 1VE3A 3DH0A 1MJFA 2PT9A 2ZFUA 5DTQA 2EJUA 1KPGA 1FPQA 5LQJA 1YZ3A 2I7CA 5FQOA 4O29A 4EKIA 5LQUA 5EEGA 3U81A 3HCEA 3UZUA 3A26A 3QOXA 1JR4A 4PIMA 2AOVA 2LD4A 3MB5A 3KPJA 4B17A 1X19A 3FUTA 1ZGAA 3HA5A 2Z6UA 4YUZA 4M7RA 4OX9Y 1RJDA 3BT7A 2NYUA 4YV0A 5GM2A 3FYCA 5DRTA 3A25A 4QPPA 2EFJA 5EOVA 3G8AA 5EMLA 2BR5A 2AOXA 4E70A 5C1IA 1L3IA 4HG2A 4F85A 2H00A 5EMKA 5EMJA 5GM1A 3IYLW 1VIDA 4ER0A 3BXOA 3TFWA 3E8SA 1FP1D 3G2OA 3M33A 1NT2A 3R24A 4YUVA 3BWYA 1B42A 1RI2A 3C6KA 5EC8A 3BWMA 3EVGA 4FT4A 4HTFA 3ANXA 3GNLA 1XJ5A 3HVKA 2UYHA 1NBIA 2E5WA 5CD1A 2QY6A 2YTZA 1JG4A 3CVOA 2BZGA 3QV2A 4H0NA 4AX8A 5LQNA 3EEOA 5JR3A 2G1PA 5KVAA 3EVCA 3LDUA 5DM1A 2O06A 4U7PB 3EMBA 4CWAA 3FTDA 3M6XA 3BKXA 4GEKA 2UYOA 1INLA 3ELDA 3OZTA 3SX0A 4POOA 1P39A 2IGTA 3G8BA 2HTEA 2OPBA 4CKCA 3OPNA 4OQEA 1WXWA 5T67A 3BGVA 4DCGA 4MTLA 5DX0A 1G6Q1 3CGGA 3NW9A 4OA5A 5M5BA 1JSXA 1UWVA 4PGGA 5BW5A 3PT9A 5EKXA 3KPVA 1NW8A 2AR0A 4K6MA 3GRRA 3V97A 5FHQA 4RTOA 5FTWA 3MAGA 4IV0A 3FUVA 3IV6A 4QVGA
chains in the Genus database with same CATH superfamily
2J9YB 4OXIA 4RM2A 5FCDA 4B7XA 3BSSA 5K8UA 4YX9A 1SNYA 1XEWX 3LT2A 5FA6A 4M38A 4NHEA 3T7JA 4C76A 1SVMA 1XZDA 3LOQA 5CP8A 2AE1A 3WNCA 1B93A 3ZCQA 2GEUA 2H8GA 1UKZA 4KU4A 5T4BA 3IELA 1DQZA 1J0BA 2CXQA 3FCXA 2P5TB 4TYNA 1DAHA 4ZAZA 1DDIA 3DHVA 1CU1A 1G3RA 1USWA 2P9JA 1G41A 3GVXA 4CF5A 1M75A 1DU4A 3IKVA 3HXMA 5TC4A 3NV9A 3B3GA 4CHTA 4R2LA 4M83A 4HT3B 4RZ3A 3PENA 4HX2A 4EY5A 4NBUA 3A6HA 1BHQ1 1DG3A 1F2VA 1UDAA 2KX7A 5K3EA 4PLPA 3E5MA 3KVOA 4HUQA 1THTA 2J41A 4L57A 1E9VA 2RKOA 1E5XA 2WWVD 1UT8A 3QFHA 3TZ6A 5TT0A 4KIFA 4RY0A 4F8EA 1K3UB 3PGKA 4LGCA 3DE2X 4BC0A 1VKNA 1DHTA 4NZOA 4D92A 5EIXA 2XF8A 4FXPA 4MR8B 3L8DA 1J49A 1W35A 4FFOA 3VR5D 1A7JA 4JENA 3KR0A 4NS4A 3L1KA 2BV3A 4J0QA 3CZ9A 4OB8A 3CCFA 1U63A 1VHWA 4EVRA 2XMGA 4M8SA 1XCMA 1T1GA 4RE5A 3LSTA 4H4CA 3HC7A 1PZGA 1QFJA 5ALIA 4CKXA 4I46A 1GPUA 1BXRA 1EUQA 1XCGB 1TCAA 1XTTA 3C6QA 4B74A 1U28C 4ESEA 5HSGA 3FPHA 3QW2A 1GSAA 3QU2A 4PZYA 1VL1A 4YRPA 1WHSB 2Q18X 1DAOA 1YR7A 3D64A 2DOKA 4KGDA 3TJMA 2ZJ8A 2JGEA 5C1PA 2D2VA 3NYRA 2R2GA 4KE6A 5CFOA 4ZQCB 3U7RA 1VA5A 4F04A 1JT2A 1UC8A 2VJDA 5JO9A 2ZS7A 3AK4A 2HX1A 1PGPA 2YV3A 3I3OA 3MCAA 4P4SA 4RKQA 4KBFA 2CFOA 1O97C 2QMUA 3HA2A 2NVOA 3PRJA 3QELA 2XQJA 3BFXA 2HRQA 2RHRA 3Q10A 4YRBA 2Q6IA 1J56A 2JATA 4MK4A 2GN6A 5CDYA 3OQMA 1GNTA 4BFWA 3QUCA 1RTTA 3QVJA 3Q12A 3DAGA 3KSBC 3IMEA 1Z9BA 3D1JA 3VHLB 1SVUA 3HY6A 5AW5A 4KPEC 5BYJA 1HDZA 1HRKA 1YK1A 3FI0A 3S40A 4DEYA 2QW1A 1J1IA 1NG1A 3N0XA 2C4MA 1GZ6A 5FWYA 5CIWA 2JLAA 1QFZA 3TQTA 3V34A 3VO8A 5KZMB 2WU4A 1E1CB 2O2IA 4D74A 4KH0A 4UAGA 2PBLA 4EPRA 4FQ5A 1FVXA 5K3BA 3IP6A 4AO6A 2AZXA 4HADA 1ENYA 4G1EB 1WHTB 1H1DA 1E79D 4OGLA 1ISFA 4KOEC 3GBVA 5HJEA 2V7PA 3EQ6A 5EZYB 4HGZA 2OOSA 4CKWA 4N0DA 3VO1A 1SHLA 1IOVA 1GPWB 2FU5C 2IA5A 3NBQA 1RYEA 2OCXA 4N5IX 2P2YA 4KRYA 4ZDJA 5JD4A 2JIDA 2N42A 4YRDA 3TFOA 4G0VA 1M6VB 2RGBA 3OTGA 5EINA 4BNWA 4ADSG 3BE5A 2FX5A 4C6TB 1I9CA 4DC9A 4EA6A 1SKYE 2WAAA 3TVTA 4EQ6B 1CJCA 3AJEA 2AI2A 2C4TA 1ESNA 4MVJD 5AK4A 1NNLA 5TS3A 3VNUA 1JE1A 4KXVA 4FINA 4Q4HB 4IKPA 4QULA 1YDHA 2C0CA 4O4LA 1AURA 1QWOA 1AQJA 1U0JA 3SM3A 1A7KA 3C98A 5FTNA 4RV5A 2QE7D 5KNCH 1EDBA 1QGZA 3NTOA 3TM5A 3UKOA 2P7HA 4J1TC 3ADDA 3A6PC 3QX7A 4CMGA 4EGFA 4TKZA 5LQMA 1J22A 4X8HA 2FZGA 5ALZA 4HVTA 1GFZA 4J7XA 4Q1BA 2YZGA 1FTSA 4KBYA 3SEFA 3UENA 4A15A 1FDTA 4IPTA 4AROA 5CH8A 2QTVB 2IPMA 3G9TA 1U1IA 3FDXA 5DM4A 5CG2A 3VQTA 8GPBA 2XYPA 3L0SA 1T9ZA 4F9EA 4KVAA 2Q27A 1G5TA 1WU8A 2I54A 3PC6A 2X6RA 2ZE6A 1WDMA 3LQRA 5LR6A 2LP4Y 5CYOA 2C94A 2H7YA 5FR1A 3U3ZA 4M6WA 5LYJA 1PR3A 1KY5A 3U9SA 4ONEA 4DUZB 3URMA 1DKUA 1QRAA 2IX3A 4QUIA 3W4JA 4P3PA 2V5UA 1UJCA 2E18A 4KAJA 4Q9LA 1AQLA 3P2EA 1QF9A 2ZT8A 1RAFA 3IH5A 5J2UB 3A11A 3D9QX 3NOQA 5DM60 4LJRA 3PLAE 4EAQA 1LVGA 3KJXA 4GGPA 2DKOA 2Z2KA 421PA 5K5EA 3ENKA 1FFYA 3HDTA 1ATZA 1K88A 5LNK1 5AD1A 1Z8DA 1FA9A 2GPTA 1PS8A 1OR8A 1BS1A 4TGLA 2GM5A 4D56A 2QGNA 1H8HD 2P41A 2YHIB 3Q2KA 4J49A 4JT9A 5EFZA 1J33A 3QQ8A 1IXYA 3RI3A 1LSJA 1SJ9A 1WUIS 4JGBA 4Z1MA 1CS0B 3K8YA 3CLTD 2GX6A 3I32A 5DTMA 5F5XA 2H4JA 1O95C 4KPUA 2XKKA 3GPLA 3N8DA 3R44A 1FDOA 4B35A 1T8WA 4WK4B 4Z0HO 5REQA 2SBTA 1VPVA 2Y1WA 3BMOB 5KVCA 1VDZA 2RGDA 3GQVA 4FYJA 4MPTA 3TQRA 4UM9B 1CG6A 3U6KA 1USKA 4HQRA 1HA3A 5J1TB 1B26A 3N2KB 1JHZA 1E3EA 1DC7A 1K27A 1H1LA 1AKRA 1T8UA 1T8SA 3P26A 4GYWA 5A5GA 5HVNA 2X6TA 4MRNA 1YR6A 5E2BA 1QHXA 4E03A 5CX4A 1FJXA 3W05A 4F3TA 4K28A 1JHXA 3THRA 1OTXA 2A5JA 5HEKA 1A1SA 2WSBA 4PYLA 4OMDA 4KWHA 4HDQB 1JIIA 3DLIA 2B30A 4L9RA 1BFUA 4JN6B 3E27A 3U4QA 3GG2A 1LPBB 2A78A 4XQGA 2E6KA 4QD3A 3HB4X 1N77A 4V38A 1T1JA 3DW1X 4KPYA 4QHTA 3B52X 5GLFA 3FKSD 3ZCTA 4YQFA 2AN9A 3G49A 3QKUA 1GRRA 3IT0A 1QK4A 4RQAA 3UHJA 1YS4A 2KPOA 1UBNA 4KWCA 2CLEB 4D2IA 1K8ZB 1DBVO 4BMNA 2OK8A 3DVAA 2O8CB 3QPWA 3IQEA 3T6KA 4GKBA 3P0HA 3VAZA 4AS3A 3J81k 2CNKA 5CT8A 1YZNA 5JECA 3REQA 3L40A 4DLSA 4QOGA 2Y0PA 3GOHA 2PRKA 4GP6A 1EK0A 1FF9A 3AR4A 1T13A 4DWVA 4YCJA 1X1SA 2PBRA 4RXUA 1KP3A 1REQB 4JYCA 3WLNA 1CJMA 3O75A 1I3CA 3PNPA 3O03A 1A98A 3TX6A 2D13A 1GQRA 1A9YA 3Q85A 3KSZO 3DEIA 2VI5A 3BWBA 2H9YA 4JBNA 1R8QA 4NY1A 1UAAA 2FZ4A 4OLHA 2WYHA 3OJLA 4I4NA 4L4UA 5GMOA 3TH5A 4DS3A 4HNUA 1J2EA 1DEKA 3HFSA 3BORA 3CRQA 2V4UA 2R6AA 3OPYA 1XVLA 3Q3IA 5ENVA 3SYLA 1XA4A 1JQEA 4LIPD 5JDCA 4HS4A 4XOIA 4YASA 4OBXA 3ORHA 3P9ZA 1C3LA 2VCEA 2VRCA 5ALHA 3T94A 4BMYA 1EZZA 4DQLA 1ZPDA 5C5DA 2JGAA 1EFRA 2XVYA 4Y7CA 5PGMA 1RZ3A 4I5FA 4Y9UA 3EF3A 4IQFA 2MM0A 4GLLA 2J67A 1ONNA 3BKWA 4RYLA 2AHRA 9ABPA 4WNYA 2WB2A 3I9JA 2HBQA 4S12A 1D1QA 3X0DA 3IOEA 2LDBA 5FEMA 1KFJB 2WVAA 3SY8A 2GDZA 1VB5A 4AQ7A 3NOOA 2JBAB 1QRSA 4XQEA 2D1YA 3EW7A 3KVVA 3KOWA 4ER7A 3U3OA 3D8BA 3SLRA 5CA1A 2X4DA 3PFFA 4FSHA 1UMDB 3RS4A 4C5AA 1G0OA 3KXPA 2P0AA 2HIMA 3OIUA 2QN7A 4B48A 4QXQA 2BH9A 4PFJA 3KYCB 4N8DA 2ZUUA 2PV0A 3EVBA 5E6RA 4UE2A 5G1PA 2C92A 3ZWVA 5AR1A 5K8JB 2JRLA 3JVEA 2RBGA 4JJGA 1AQYA 1RFGE 3NBXX 4P7BA 1XOIA 4GFDA 5DLQC 4D4KA 5AIBA 5I4CA 1TZKA 2J9RA 4E7PA 4TXMA 1Q1NA 4S1OA 1LX6A 3TIXB 4ITUA 3T7SA 3VR4H 3M1IA 3CRRA 3GJQA 4WNAB 4KN5A 3UUGA 4O3MA 2DFVA 2YWRA 4ND5A 2J0EA 1II8A 1QCDA 4OHXA 3TW0A 5BPFA 2RD2A 2A9FA 4BNMA 3WGTA 4Y6RA 1N8KA 4I3FA 4C1BA 4IOKA 1WMDA 3HU3A 4MQFA 1R50A 4TTSA 5KQPA 3R0IA 5ITSA 3DEAA 4UXIA 4GM4A 4ED9A 2I2AA 1OH8A 1OQAA 2ODBA 4PYQA 2QVZX 4DLBA 2VF4X 4RHYA 1QZ3A 1Y81A 2P2ZA 4C0JA 1EBBA 4HQOA 5D3ZA 5DLDA 1B14A 2PUEA 3UATA 4P22A 2UYQA 1XJQA 3NEJA 1V2GA 2RH5A 1A69A 5HCIA 4BNZA 3U4IA 5DASA 3ELYA 3K6JA 4QFCA 2EKQA 3GRCA 1Y33E 3OY7A 4TKVB 1HH4A 1BXKA 2F3RA 3FPAA 4HVAA 5EYPB 1GZDA 2ZYAA 3IB6A 1DQRA 1S1CA 3OOYA 1DTEA 1D7OA 4NICA 1IHOA 1GRVA 4KO3S 5EZSA 1IUOA 4GI3A 3STTA 2ZRAA 1CY1A 5HUHA 2YDXA 1L7NA 3Q3GE 3D1LA 3UANA 4Q3EA 3K9CA 4HEHA 1JFLA 4DSNA 1T1EA 2BF4A 3F2IA 3JPWA 1SOAA 2H31A 4RE6A 3Q0EA 4L73A 5HF9A 4YV2A 3HUTA 1YRAA 5FBRB 4D4LA 4AJPA 5K0EA 3AR9A 3DQZA 4KVGA 5FI1B 3AL0C 4G0QA 3VPBA 3U44B 2I6UA 3IT2A 1RJEA 1R6BX 2A3RA 2G06A 3JR3A 3NM5A 3OT1B 3QUBA 3D6UA 4IHJF 1RI1A 4D8YA 5ADVA 1U1CA 2J5XA 2C7QA 2DLNA 1UAGA 3DMFA 4D9BA 2BDEA 4ASUA 4HLUC 4Z3OA 4Y2QA 3FPBA 5A1TA 4DIMA 1JBKA 4DLXA 1TAGA 3VMFA 2EG9A 4D6XA 3H87A 1V25A 1Y5RA 2FN4A 3BA1A 4FOSA 4ZOLF 4P7JA 1IHXA 1KEEA 3TW8A 2N1BA 1J4AA 3U4DA 4D8VA 3BHMA 1KSJA 1CXZA 2B7CA 1P6QA 3N8NA 1QP7A 2JGKA 1PRYA 1WV0A 3M34A 3DUWA 4BVGA 5ITWA 1IZ8A 4R6XA 5DZSA 5KPJA 1RWXA 3F6RA 2NVWA 2OQIA 1KJ8A 2W6MA 2PS0A 2ZRIA 3H5WA 1R0BA 5EIBC 4ZVQA 4GR9A 2E1RA 3QKSA 2P1ZA 1YZVA 4HEA1 1NE7A 1JQKA 1NVDA 2QMEA 4KKVA 4G1VA 4DDHA 2Y6VA 3O26A 3GGJA 2ZAYA 5LP6F 1U99A 3L6EA 5FAXA 5MN6A 1KKLA 2FSUA 5LQUA 2XGMA 2OO7A 2C7GA 1MC5A 1CUYA 4RCYA 4TL8A 2PKCA 1ORVA 3FPRA 3PXAA 2HYIC 1MZVA 4DG5A 2QY9A 4LNUB 2XUQA 3I2YX 2I29A 3JZIA 4KSYA 1CR5A 1XEXA 5C5EA 3L8GA 1NUUA 1UZAA 4J4BA 1HE3A 2XKAA 2C2YA 3GLIA 3VUEA 2EW8A 1QGOA 5EMLA 3CVWA 4G9BA 3RRXA 1GZUA 1JPNA 2YV2A 2VC2B 4F85A 1RAHA 4ZMRA 4YMLA 1K8YB 3D3WA 3ESXA 1WZEA 1E8MA 3G2OA 2Z4SA 5EWMA 3B2QA 1ZINA 4GKJB 3VNSA 1QFXA 1XAHA 4FFBB 3TB6A 4L8VA 2IT1A 3B2EA 5JVDB 3ZGNA 4FT4A 3BBLA 1WEKA 4WMLA 5C5IA 1QV6A 2D1SA 2C59A 1VPWA 1NBIA 3MK31 5FYQA 3ZLVA 1NAHA 2O06A 4NZMA 4MO2A 1QX4A 4W9MC 4Z86A 2P9FA 5JSQA 2WU8A 4DHEA 4CV0A 5JAHA 3K16A 4BFTA 1CY4A 5KNDA 1RIFA 3VO9A 4R9VA 4HMOA 3OPNA 4BE7B 4OHCA 3OLXA 1GNLA 2BFEB 4G5XA 2WJGA 5FF9A 4NKRA 4TXNA 1MFPA 5IHPA 3THXA 2HRBA 2F1HA 4HRVA 1UK8A 3PXCX 1ZD9A 3A28A 2I80A 2ZUSA 2FEMA 4UUAA 4DLNA 2BKUA 3NBUA 3M1LA 3DCIA 2IYRA 1VXRA 3MHPA 4QVGA 1SZDA 3L4KA 2LVBA 4HXEB 4KUGA 4ALMA 4G1BA 4XGRA 3IQGX 3SR3A 4ID3A 4GBMA 2HRDA 2VDNB 3OQBA 3FPKA 1ZNXA 5AM0A 4J07A 1MJHA 3ZH9B 3D1VA 3V8PA 1PT6A 4EF6A 2FGKA 2GAAA 1IFXA 2FLVA 3EUWA 1ZXLA 4XSHA 4FNOA 3MGAA 2ZSHA 4YBRA 3TQCA 5J4KA 1DTWA 1ODJA 1UQTA 2QJRA 2YH2A 4NJOA 3OCVA 3KYBA 4XVCA 1C8LA 1ZGCA 2PAAA 3AF0A 4TVSA 3SWWA 1L7EA 1QHFA 3OEYA 3DJFA 1IAVA 3ETNA 3K0AB 3RSSA 1Y98A 1BEZA 1TKAA 5DPMA 5BSEA 5EXTA 1DRKA 2Z2XA 4HDRA 3IVAA 4KI0A 4B6RA 4QGSA 3DOUA 3MWDB 5HW0A 3L77A 2NUAA 1E32A 3A6EA 3BQ9A 4GH5A 3MQ2A 4CMCA 4EYOA 4KSBA 4KO8A 3AV0B 4B46A 1RRKA 3SFVA 2RHDA 1YDWA 3SSOA 1J00A 2HADA 1TLFA 5BMVF 1YSCA 4RULA 1VIVA 3KLOA 4UVHA 4UZEA 4XARA 4KVZA 1DFIA 1MOSA 5FPQA 2M6KA 1XU7A 1J99A 3AFGA 3MZ0A 3HJCA 3HB1A 5JEDA 2FK7A 3N8GA 3QLUA 1TGYA 1E1QD 1ATIA 2C00A 2NM0A 2Z1MA 4Y9SA 1COWD 5LWQA 4LJYA 5H9VA 4PHFA 2HJWA 5K6AC 5IC6A 3WGVA 4PANA 4RELA 1XZKA 1ABFA 1P8AA 4F91B 2HQOA 3A14A 3IP5A 1CF4A 4FOLA 3OEHD 3QUTA 2ADOA 2JFVA 3OZBA 1PZNA 3QBVA 4PTZA 4XFKA 2DTDA 4P86A 2YWDA 5FO1A 5BT9A 3ZHYA 5K7SA 3QY0A 1ULZA 5T4HA 4REQB 3UT5B 1FP2A 5DGCA 3GCWA 3VDXA 1RLIA 3B6EA 3A4MA 3ZU6A 3ZVKA 5FAKA 2J3JA 3UVEA 4CLRB 2QZZA 3S8YA 2UUCB 3G0DA 2M1ZA 4CKEB 3FIJA 4QL3A 3S7ZA 3BGWA 1E1YA 1L4KA 4RVGA 3WIOA 4AP6A 1QIDA 5FBZA 4ZYUA 3P9IA 4H1HA 2RK4A 1SQ5A 2VT6A 2W2LD 1D7AA 4RY8A 2Z3VA 1V1JA 3AGQA 3N39C 4OI1A 3VZRA 3EPHA 4RANA 2JIQA 2GR9A 1JFFB 4NPCA 3ED1A 4UOZA 3A4IA 4CKBA 3ZJYA 4ZOEA 3SXPA 1TVEA 3O9VA 1LGYA 1Q7BA 1R0XA 3LAWA 5BSGA 4DCNA 1Y6JA 4CIYA 3IL2A 1Q12A 2CYBA 3VI4B 1GQSA 4JROA 3FLEA 5EJ7A 1S2LA 3I6MA 2IYTA 5F77A 2XXAB 4IOMA 3FUXA 4DCJA 1ZGJA 2FW9A 3LP8A 2PUHA 4OYLA 1UUFA 4X66B 2UKDA 3OZCA 1LW6E 1GL6A 2E6UX 4RPCA 2QD4A 1CRZA 2BBWA 3MGGA 5AP9A 3VNAA 1NAIA 4W5NA 1CUJA 5CW2A 1NIJA 2ZROA 4PAGA 2WWRA 4C6HA 3NRCA 3PFCA 2NU8A 1E64A 1VDMA 3RK1A 4HUJA 5JSZB 2PEYA 1XNGA 1BRMA 3QBJA 5A7HA 2ZQ5A 3MMZA 1AKWA 3ETEA 4FGZA 1RHRA 2YVAA 3D81A 3MJDA 3S0JA 5IFKA 2YKGA 1PO7A 4YIHA 1D2MA 3O8LA 1CQIA 2BM1A 5EKUA 2AL7A 1NI5A 2NSDA 1B43A 1L4NA 1LBIA 1Q21A 2OBLA 1AXEA 5FR2A 4E15A 4A36A 3HU1A 1LPOA 4JQOA 3ZI4A 1IJEA 3K1JA 3LI2A 1JQ3A 2ZSAA 2W6PA 3WK8A 5I7WA 1JSZA 4TTJA 3QKRA 5JYDA 1B8NA 4G85A 1NZFA 3KT0A 4OYHA 4U02A 5B2EA 3CEPB 2CLFB 3M2PA 3E15A 3G23A 2VPQA 3DMHA 3JPYA 3R2JA 2XUDA 1OXSC 3RVOA 4AQYB 1YNSA 5CT6A 2E49A 4GPTA 5BSKA 4LF8B 1N0IA 3IIKA 2XQFA 4YXFA 3OX3A 3BILA 3M6IA 4KDFA 2IF2A 1PGOA 4EQZA 1SXGA 1ZSNA 2PLAA 3UK1A 2HHJA 3UK7A 2HBRA 4WBXC 1AKEA 4MHOA 5EZ6B 1E4OA 4ECEA 5A4JA 2DP4E 4TV9A 2MU1A 5JHGB 4FN4A 1SN7A 3EIHA 3DR5A 3GUCA 5HZGA 2YC2C 1R7RA 3G9QA 4LXHA 4Y1FA 5TNXA 1FU4A 1C81A 2VSYA 2XMBA 4DJJA 5B6IA 2BPOA 1CUGA 1EFDN 1U1GA 2D54A 4J0FA 5D5PA 3UXYA 2PU5A 5DT9A 2DRIA 4WN9A 1AO3A 4FYPA 4HXGA 1UKYA 1NHGA 3V8VA 1DRVA 1C0KA 1RP7A 1NL3A 3C97A 4LTMA 1CDOA 5EKTA 1PHPA 1YB4A 2GM9A 1P18A 4FTWA 4G01B 1FL9A 5IDWA 1UCFA 3R8FA 2JVIA 4GSLA 1KH3A 4J1TA 4REMA 1C1DB 1TQHA 4M86A 4PYNA 6PFKA 4HFNA 3FTEA 2QYTA 4OJNA 1IVSA 1LBTA 4BP3A 1KAGA 2DH6A 1GPYA 1RWPA 1XVIA 1R12A 4WGFA 1QORA 4CEIA 3NC0C 1JG3A 1XZAA 4CLXA 5CNIA 3O47A 3SZRA 4XUGB 2XUAA 1RLJA 2FPIB 3H04A 1TW2A 1UQRA 4X8OA 4RIHA 4ZYYA 2DQSA 3GCZA 5FRDA 3G88A 1SOUA 2GWRA 1J6UA 4LF6B 2CD7A 2TYSB 4ZEOA 1RI5A 4PZUA 4MSUA 1PFWA 1JU9A 1LRKA 4PYMA 4CTOA 1ZJ5A 4Q12A 1FUEA 3L79A 4RV4A 1FYVA 1NV8A 3WVNA 2CD9A 3NBYC 3BA6A 2AH5A 5ICFA 1MPXA 4QXOA 1JXOA 1ST2A 2EL7A 4KQHA 4ZV9A 3VYSB 2BMDA 3Q7EA 3P0FA 3G0GA 1OWLA 4NSNA 3AERB 1LLQA 4WY8A 1B76A 2O8VA 1BA3A 3GFGA 2VHUA 4AKEA 4ZK6A 2QMOA 2RB5A 3EPJA 3V7YA 3E03A 4XVRA 2XA2A 5KTTA 5LDHA 2VA9A 3RVLA 5EESA 2LDXA 2ZYSA 3EMVA 3PUIA 3VR6H 5IJ0B 1UKCA 1AS0A 3O1LA 1KIAA 1JH8A 3DDCA 1AX9A 2QQ0A 3IEKA 4HFRA 2O05A 3FOWA 4IWYA 4GOXA 4YJ3A 3MXTA 2GWHA 2H5JA 4G0PA 5IVDA 1KYZA 5JD6A 2PM8A 3QWIA 2IE8A 4CODB 4HH1A 1J70A 1DSSG 2CLHB 2W93A 2V6JA 3FZEA 4PGHA 3OQPA 1P2FA 4EHDA 1JVSA 3I9V1 2B35A 1CUXA 1MR3F 1V16B 3AEQB 1TCCA 2QV7A 4A6DA 1M2KA 4OBWA 1V6SA 1W1UA 1EJBA 3PPIA 3W0LB 4AX4A 2HEGA 3JQ8A 5JCXA 5AHOA 4R2WA 3IJ5A 1XHFA 3L6BA 4WLOA 2HNAA 3E48A 3TMYA 5JTUA 2X8JB 2O8BA 2VCYA 3HL4A 2DB3A 4BLQA 1TD1A 2RHCA 1SCNE 1VJGA 3D4PA 3JR7A 3CH6A 4Q1FA 4I4LA 5D6WA 2VUUA 1E1KA 1U3CA 1JQAA 1SD5A 2H4YA 1Z7GA 3U6BA 3SXUB 5K0BA 4QT0A 4R41A 4URWR 4AIIA 2O7NA 4RPJA 3I8XA 4R1MA 2PN1A 4HOYA 3JD0A 2FR0A 5G3ZA 1FRNA 3W7BA 3KQPA 2C7OA 5E7QA 5TEVA 3PUJA 4D5EA 2C5HA 2BLNA 1II0A 4BNDA 1HY3A 4F96A 3F6PA 1RPNA 3L8CA 2BMVA 1O87A 2XUFA 3VNVA 4TWAA 4AZSA 1G20A 1I1HA 1U0FA 1HT0A 1PHRA 2CVOA 4IIJA 3M89A 2WZCA 4U00A 3A7EA 2NZWA 3DQPA 1W19A 3HADA 2H06A 3SHVA 4YJ2A 1E6KA 4K6OA 4H7IA 2ZI3A 4LWQA 2XUPA 4RTKA 1PI3A 1MC8A 3ABZA 3TF5A 3T7DA 3VH1A 4YHHB 3IALA 1P33A 1F4VA 4NE2A 4NBLA 1F0NA 3Q3EA 4JBWA 3WNDA 4AU1A 1K7CA 5ENZA 4DF3A 4YFYA 1AMUA 3ZWXA 5IAAA 2FP4A 1HDXA 2I6SA 4PG4A 4MPPA 1ONPA 1PWEA 2RGCA 3OPYI 4LTNA 5T8KC 1JLLB 1F12A 1E2BA 3TN7A 1QLJA 1YUMA 1IK4A 4E88A 5KDDA 4TLMB 5B7PA 3DZKA 3K0EA 4GWLA 3PXUA 4LKOA 2ID8A 2FE1A 4Y6GB 1MO3A 3G5TA 3QF4B 1XDBA 3G2JA 4Y6OA 4BLPA 1FVHA 3SJBA 3QEJA 1LPAB 4I1VA 1XVTA 3E4CA 4MROA 2G9UA 3UXMA 2PKEA 2WV9A 4DV6B 2EZ9A 3HS3A 4M3NA 3HJNA 4OKIA 2WHXA 3OI7A 1KYTA 5TR9A 3UYKA 1WM1A 5IWCA 1EFHA 2Q3HA 3HY3A 2A0XA 2WJZB 1YVRA 3NJRA 1OX5A 4XR9A 2VDWB 3TJRA 3KOOA 1QF6A 1WL8A 4GZ3A 4RMIA 1N2EA 5IAGA 5JRZA 4ZTUB 2CNNA 3EY9A 2H5EA 3NU1A 3C5HA 4EFNA 1GIAA 3INYA 5H70A 4MHTA 1XD9A 4EG1A 2J6IA 3VR3D 5KJEA 1YB5A 4Q1CA 3TPZA 3ZQ4A 1PL6A 1PFKA 2IYWA 3BIJA 5EZ5A 5EWJA 3FCCA 4QA9A 3KCNA 3RODA 2BELA 1YDGA 2GVZC 4EW1A 2VKQA 3OFND 4YAIA 3HYSA 1BN6A 3ETLA 5ARDA 3HKBB 3R75A 4BRZA 4E08A 4IFTA 2JG3A 1C4XA 1N7IA 5K1ZA 5I9TA 1YQ9A 1XDUA 2POQX 4OKNA 3OIYA 2VP9A 1SXJB 1KE1A 3Q87B 3T7RA 3QVMA 3L6RA 4UMEA 1JAIA 1KR2A 1UBEA 2QRPA 2WWTA 2Y0BA 4K88A 5IK2D 3OICA 1EINA 5ELMA 3DE6X 2E4WA 2XE4A 3C1AA 4MJ7A 4WKGA 4YP9A 4A23A 3H11A 4BMDA 4EA7A 3D4OA 4FZRA 4JP2A 3LGSA 3VR5A 4ZEVA 5B4TA 4X85A 1Q2UA 1UK7A 2YYYA 4H6XA 3HNPA 3VJMA 4D9KA 1KFCB 1W88A 3CG0A 4YJGB 5JS7A 3WB9A 1JKFA 1ZJYA 3RG2A 1YZFA 2YOHA 2QMQA 3OG9A 1UMCA 2IQ5A 3H2ZA 1Q0ZA 4RSMA 3HG7A 3N70A 4LZZA 3BHNA 1ORDA 4S1VA 2Q1DX 2VDQB 2HSEA 5F4ZA 1M2FA 3CVYA 3EBPA 3BERA 1L4FA 4NFLA 1ZOSA 2PUWA 2GCEA 3EQZA 2ATIA 4RA9A 3HABA 4AL4A 2WE7A 3FYUC 3P9RA 3S2FA 4QDOA 3M9LA 1X74A 1RU3A 5CG1A 1T24A 3TLZA 1HORA 2H18A 1GG8A 5HCNA 3NYIA 5AUPB 1XD8A 2OBYA 4ZU1X 1MO2A 4D3DA 3MWEA 3NM4A 3IQIX 3AF2A 4O6VA 1LF0A 3I05A 3M5WA 3HEBA 4FT2A 4MYSA 4RX1A 2AIRA 3RFUA 1CD5A 3UB4A 5AVJA 2JAWA 4WACA 3OLWA 1T9BA 2JFWA 2R60A 4GMXA 1SXIA 1F14A 4FP9A 4L07A 1UJ6A 3I4FA 1LLDA 5BP7A 4CF7A 2GCOB 2BM0A 1L1EA 3Q88A 3IUYA 3TLBA 5JV5A 4JI4B 4P8RA 3VJKA 5I7VA 1D09A 2IHJA 3CWCA 3S2GA 4ZT4A 3R0QA 2BSXA 4PRZA 3TI9A 1OSNA 5HUJA 2WF5A 1CLUA 2C4KA 2V7TA 3BJZA 4M8IA 2Q1TA 1I5OA 1FMTA 2PQ6A 2PX6A 5CVUA 3C5EA 2IBTA 4P5DA 4FBLA 8OHMA 3VZPA 4LCEA 5CB8A 2VHXA 2WILA 1E79A 1J25A 4LE1A 5C8YA 2WVJA 3DOCA 3I23A 4RH1A 4I55B 1MQAA 1E20A 3H7IA 1FPQA 5ALWA 5AUQA 1N7HA 2IYSA 2P2CA 5K20A 4LNAA 4MICA 4EPTA 4JJIA 4IUDS 4F3RA 3RYFA 2GSDA 5HE8A 3CR3C 4EA8A 4R40A 4CM4B 1R4NB 3TS1A 2VAWA 3O8OB 4A03A 5D3MB 3GJ0A 3FYCA 3I73A 3WLEA 4I0WB 5BN5B 1YRQA 3CLHA 4K9SA 4BVEA 2P6PA 4Q3CA 3D4LA 1CFZA 1NUAA 4GRDA 1NSTA 3L41A 4MVJA 2EF1A 4C4YA 1U9CA 5CTJA 4F3KA 4J1SA 1QCSA 2C99A 2FW8A 1AB6A 1E69A 2JVJA 3R40A 3S28A 3PIRA 3L0OA 4DIKA 5AKYA 1JEOA 4YPFA 4N65A 1RI2A 1FFBA 4JX8A 4Q6BA 2QE7A 4ZO7A 3N2GA 3NTXA 4ZFNA 4J2HA 3HMQA 1OYVA 4MJ3A 3NOVA 3C39A 4R4JA 3TDMA 1YS6A 3H9UA 4FEAA 4LQLA 3ZIAD 4TT8A 4DDUA 1PJ2A 4YS6A 2J9FA 5LQNA 3OO1A 1VE7A 1UEJA 3GPIA 2BHRA 3M5PA 4NU8X 3F6BX 1VCIA 3EMBA 4AY3A 4I3GA 1GCOA 3WOVA 1XEFA 2RGNA 3WKDA 1GTJ1 5DEOA 4D6PA 1U2DC 1L6RA 2WVGA 3CLSD 1Z5WA 1ZITA 1OHHD 1H6DA 2QHXA 2WM9B 3DAHA 1U3GA 3GHHA 2J4DA 3H5VA 4YVFA 5IMBA 3SP1A 3TSCA 4BO3A 3KZKA 1AD2A 4J7CA 1HNZB 1O3YA 1OY1A 2Q1YA 3QU5A 1XTZA 4UD2A 1FU8A 1X3SA 3ICQB 2CJWA 3UKDA 2DBZA 1Q3KA 1KEWA 3GWZA 4HLQB 4J3JA 2JKVA 1UZMA 4HAIA 5E6UB 4TOIA 3P2OA 5JCOC 1WDTA 1A27A 1U2QA 2F1RA 5LC1A 1U8EA 4PYJA 4GXTA 4O4HB 2XYQA 5JSHA 1GCUA 1PEYA 5C32A 1XHEA 4UQLA 1AHHA 3P0RA 5LDGA 5LZ4A 2BGJA 4KNYA 3V1LA 4JJ7A 5HIJA 3ADBA 3KOZA 3J7AC 1AKTA 1G0NA 1H8HA 4W5RA 3ZHRA 2JLWA 2Q6OA 3OQOA 2DT8A 5DWQA 3V7UA 4D4HA 2HXGA 2R1VA 1SC1A 3WFJA 1QRUA 4C4PA 2GF7A 1Y3HA 3F71A 4CRWB 2FWPA 3R3HA 4CYMA 4P38A 3KSRA 3UHPA 3MMSA 1LH0A 1WXFA 3AB8A 4RVFA 3QEMB 3A1SA 1H0KA 1I2CA 3WNBA 1K6XA 1N6PA 3LLVA 5GJVC 3DXYA 3UIEA 2VDPB 2HPVA 4PONA 3JD2A 1E3IA 1JDBC 2V45A 3FHOA 4QU0A 4KQXA 4ATNA 3NR2A 4ER3A 5D87A 3L9WA 4JVLA 1YVUA 2QL6A 1E4EA 1VMKA 2H1VA 5M04A 2IY9A 2CZGA 3MYYA 3NG1A 4TV8A 1Z7YA 3REGA 2YQ5A 4EW6A 1I7DA 1PFUA 1CNMA 2MIIA 2HJGA 1XSEA 3A9WA 3H9EO 1T6XA 3HTXA 2H5LA 1OOEA 3TAHA 3NNDA 3AY6A 4GG1A 2XA9A 4YXWD 4I8XA 2RI1A 2Q5CA 4TM7A 2JGJA 1A9XA 2KBEA 1TQ8A 3AW8A 3ESDA 3VC1A 3ZHSA 4YAKA 2B8TA 1RXUA 5DX1A 1Q92A 3FKSA 1NJ6A 5I7AA 5A05A 4QU8A 3DM9B 1EWRA 1FP6A 1FMCA 3HJFA 1A8UA 1GSIA 4EUKA 3RRNA 1KMHA 2XYVA 4IXTA 4QRHA 3RNLA 4JOSA 4BN5A 3A37A 1Z12A 5IH3A 4AZ0A 4CBVA 5LQDA 4R5MA 3AT1A 3E7FA 4O2BA 3NB0A 4X3PA 4HK4A 3B2NA 2P2GA 3D0KA 3IP3A 4M7WA 1OXVA 1QC5B 3NH9A 4G5SA 1XFAA 2HYDA 2PX3A 5GJCA 5TVGA 4BATA 4DE5A 1EP1B 5DTEA 5CITA 4DPMA 3EZ7A 1PGQA 2R6CA 3FMIA 3VHXB 1VMAA 1L5WA 2UDPA 4KLRA 2FWMX 1U6KA 1J07A 1P2GA 5MGNA 4ZO8A 3HH8A 2IXDA 2V9PA 4MCIA 2GYWA 1E9SA 1MC4A 4INPA 1EWVA 1KOLA 2RE8A 2QVGA 3G68A 4P7GA 2X9VA 1RHQA 2Z3WA 3K09C 1DQYA 2AXPA 3K31A 2J07A 3LUAA 1U3FA 4MQBA 1CJUC 3H97A 4C89A 1SKUA 5J5CA 4F7DA 1V8PA 2AMFA 1UH5A 2AOWA 1EX1A 2CF6A 2OO3A 2XE6A 3RIYA 3D3QA 2B0CA 1O08A 3O9MA 4IIEA 2FF5A 2BFBB 2CJYA 2G63A 2BD0A 3HJAA 1G3MA 1Z6YA 1FUUA 2V1XA 3N75A 4PYOA 4JQCA 1Q83A 1V5EA 2EHJA 3I2FA 1TPYA 3NOXA 2O5EA 2YWEA 3QWFA 4DQVA 1BH2A 1E1LA 4Q3NA 3BHJA 9LDTA 3C3DA 4G2TA 5I7OA 1GAJA 4RK0A 1GA4A 4ZO4A 4TS4A 1E5TA 2PMBA 1GP2A 3QOYA 5I7SA 3DC2A 2GPWA 3I4CA 4J76A 5TPZD 3SJZA 1NBMA 1XRMA 3F3YA 4UMVA 2GN8A 3KPUA 3KQHA 1Z08A 4FOTA 3UGJA 1Z7BA 3JVUA 1KQ3A 1I4TD 2BC9A 2O2EA 4XIIA 1D2EA 3S68A 4DSUA 5BR4A 1BJKA 3AC0A 4MUYA 2GZHA 4JIMA 5FKJA 1D6SA 4P84A 1JHDA 3W2EA 3DE1X 2QRQA 1D2NA 3RIMA 2XRZA 5ITZB 4JUDX 4PQYA 1M2OA 1ZK0A 1JLSA 1L4UA 1BXGB 4QJ3A 4B84A 3ZCXA 3I9KA 1FPMA 1ACMA 4OUKX 3VGPA 4X7RA 4DDWA 1UPXA 4ND3A 2B94A 2PUTA 5BYAA 3COJA 2HSJA 1FDWA 1GRNA 3DLCA 2P1DA 1TECE 3ZY5A 1L4HA 3GAZA 1SY7A 3G9UA 1Z4JA 2B99A 3MW8A 3CNNA 3QWHA 4YFVA 1Z5VA 2AFHE 3FCUB 4QG7A 1P62B 3UJHA 3IO3A 2YUIA 4BNIA 3RANA 4CIXA 1EK6A 3HKDB 3B1JA 4XEHA 3I9OA 1CK4A 2I4RA 4E31A 1GR0A 4GLBA 1MA0A 5DLPA 4Y2HA 2JFPA 2M6RA 2AR9A 3GRPA 4M0KA 2H65A 4LGYA 2PMEA 3V4FA 5JYBA 4JLOA 3LHDA 2JGFA 4B6JA 4YMUA 3NC4A 4G5OA 3GUZA 1M2GA 3L7BA 1N5IA 2FW6A 2R68A 1DJMA 4BRSA 5CX1B 1DV2A 3SZMA 3ZXSA 3L04A 1KOGA 3BXEA 3K70B 3K53A 2V8BA 5CJ2A 2CY0A 2DHEA 2P0EA 1QCYA 1R6TA 1DIGA 1HTWA 2CHEA 2F8SA 3QVUA 3ETHA 2HJHA 4Z9XA 1EP9A 1W36C 1NNEA 3QE3A 4ZO6A 1YMUA 2OM2A 1QPZA 4EO4A 3F9RA 5AYVA 3KTAA 1GPLA 4W1PA 2VP3A 3FFBA 3I5MA 3OF3A 1JDSA 1E58A 1EXWA 4HN9A 5DBOA 2OCIA 2XTZA 3WRYC 2BSQA 6Q21A 1T3HA 3A9CA 3TTWA 3K8OE 1G42A 4I1RA 4TTQA 3DKRA 3HP4A 4MAMA 3SLKA 4L72A 4YDHB 4EJSC 2B4YA 4OU5A 2A1TS 5ALGA 4Y0AA 3VPSA 3KAKA 1XXLA 2ZE5A 4R3NA 1I7LA 3AUJB 5I9IA 2A33A 2ZJYA 1FNSA 3IESA 5K3SA 1KQNA 3EVDA 3SQLA 1J2TA 1HDYA 3TLKA 4E1VA 1G5IA 1DFGA 1XN1A 1CUSA 5EP1A 1TVMA 3QM1A 3RSOA 1TM4E 2DJ5A 4X1IA 4ZZ2A 4IF6A 4BDSA 1KXZA 5BNTA 3DM5A 2COUA 3DONA 4R2JA 3TNDA 4DCPA 1ZW1A 3E4DA 3OSUA 3D6VA 1Q7TA 1C30A 3WO1A 1ILEA 3N0WA 1T8TA 3MGCA 2WJHA 3CNBA 3DKVA 4HAVA 3CINA 2O2HA 3CBGA 2HBYA 1EA5A 1KGSA 1EE9A 1PR2A 1QYCA 3OOHA 2G88A 4K3VA 2GFQA 4XCXA 5IJZA 4Q7QA 1TQ4A 1EDEA 4TT3D 4MB6A 4HUQB 2ID9A 5J2TF 4AZ3A 3FPEA 4N7BA 4QO7A 3UJBA 5BUQA 1I9GA 2HUNA 1MHTA 3GZ4A 3OX1A 1SKMA 1AT1A 3RDPA 3I61A 3TCNA 1M5RA 3W2TA 1XPRA 4EVQA 1JU3A 2G9RA 4HL6A 1BCSA 1SUWA 2PR2A 3CRMA 4MV9A 1GOTA 1YJ8A 3FPCA 3VKUA 4IJQA 2XCOA 4P33A 3N7AA 4YRSA 3H1PA 2BGKA 5LBIA 2FUG6 2C3MA 2HA5A 2HHAA 2Y76A 1DS6A 2FEPA 1DE0A 2J3QA 3AW9A 3L1HA 2P6UA 1IXKA 2XCUA 1Q6ZA 3ZZNA 4ZAWA 2A94A 1BXRB 3VAYA 2I67A 1OBCA 2V3VA 4J6FA 4MWTA 1ZSVA 4QBTA 4K9OA 3OKPA 5NLLA 2PUDA 4CIDA 1QONA 1FMFA 2PT5A 1JJ7A 2ROQA 2REBA 4BO7A 3A36A 1Z4QA 4KV9A 3LQ4A 1LW7A 1OREA 2GHTA 4BNYA 3USCS 3QU4A 4R83A 1YD7A 2GVDC 2XTNA 2NXEA 3CPSA 1HSOA 1UM9A 3LCCA 4B34A 2Z8YA 1XKXA 1BKSB 4P4SB 3BG5A 3QELB 1OH5A 3CLSC 1VYUA 1M2WA 1PTKA 1D3AA 2H1RA 2I7XA 3BH0A 1E6LA 3DZ8A 3MD0A 3B8HA 3QX3A 1JSLA 5C8ZA 2ZDQA 2QP9X 1W4RA 4ND6A 3GDOA 3PC3A 4I8DA 4JP1A 1ZXBA 1U2TA 2HU5A 2Q41A 2EFCB 4B82A 3TTTA 1AXRA 3H0CA 1KSHA 1SU8A 4JLKA 5E4YA 4P0PB 5LB2A 2FZEA 1XTJA 1PJTA 2YZNA 1EDZA 3BWEA 5IXSA 3EDCA 2R11A 3Q7TA 1W9MA 2I7DA 3IODA 3HP7A 5F3RA 3HFJA 2NT4A 4MP6A 4U2GA 4WY2A 2VK2A 2EFEB 3C3KA 1U8XX 4XUDA 5K3FA 4W5WA 2FI1A 2YY6A 4BE4A 2ZIWB 1NR5A 2YW2A 4JNKA 5GOTA 4URYR 5DNVA 4A91A 4FJ0A 3R9WA 3R3ZA 2HT1A 4ZT3A 4IQ4A 1G19A 3PYLA 4P3KA 4M0MA 2G5GX 3J7TA 4WW0A 3UT6A 4HB4A 4CKWB 1T9KA 1Y9EA 4GPBA 1X7HA 5K0ZA 2KMLA 1Z28A 2OO5C 2IW1A 1GTVA 4W4TA 1LUAA 2O2JA 2LV8A 2ZJ2A 3I64A 1UXHA 4QBHA 5CFQA 3M9XA 1EUDA 1T2UA 4QIHA 1TF2A 3N7TA 2IIVA 3AYZB 4GOLD 4EMBA 3F8SA 1Z15A 5I9LA 1OPRA 2IZ1A 1I80A 4UVIA 2QRGA 4XPIA 1QGDA 1VLMA 4UTPA 4L0DA 1H0RA 7MDHA 1LBEA 2C61A 1E4YA 2DC1A 1YZLA 4Z7JA 3ZXYA 4D9NA 5IZCA 3AVXA 1SUCA 1T8RA 1FC0A 2IVFA 4O4LB 1EUZA 3FAZA 5JC8A 1ZN7A 4EJ6A 5FBVB 3BL5A 1QH8A 2BP7B 3E70C 5F7XA 4DA7A 3UC5A 5HZHA 3DULA 1E5DA 1JG2A 3FROA 4TWIA 1KRXA 4KXWA 1TT7A 1IBMB 3OPMA 4QYMA 3HV0A 5E0OA 2CVHA 2F1KA 1Z4MA 2Z2IA 4H1TA 4OMCA 3A1NA 4JGGA 4ROTA 4OQLA 2P9QA 2RI6A 4E13A 5JBQA 1ISIA 1E1QA 3C7AA 3LQ1A 4KXUA 4MW1A 4TUYB 3WNQA 1COWA 1JA0A 3T9FA 1BKYA 2AZ4A 4DBVO 2YHSA 3N2ZB 1R6XA 5AM4A 4OXYA 1FTQA 4IGEA 4CL3A 2XT6A 4AAYA 2PX0A 5GIOE 2FN9A 3U7GA 4MQ6A 5KNBH 1PL7A 2QLTA 2Q4OA 4LOLA 4QECA 2J0SA 4PLWA 5LXTF 2O8DA 4HRAA 3CEMA 4EZBA 2Q28A 3NRJA 4ZXPA 3NUQA 3ITKA 4PHGA 5F7ZA 5BV7A 2IV2X 1XQ6A 4LZAA 4M6WB 4WK2B 5LYJB 4XRRA 4UW9A 1L6IA 3REOA 1F4PA 2WU1A 1GFWA 5CGZA 5B6CA 2Q2VA 3CLRD 5JIBA 1EVYA 1E94E 5HTOA 3ER9A 2NG1A 2YXBA 3KZNA 2AG8A 4LF7B 2YUJA 2AEFA 5HF8A 4KO4S 2DPMA 3UJ6A 3WLIA 4A1OA 2W2LA 1WBDA 3PGMA 4M9QA 1W25A 1UP4A 2CDAA 3KP1A 4ZO9A 5HGXA 3OX4A 3VISA 3WNZA 1XVVA 2R5WA 4HSGA 4V1CA 3RVQA 2YRXA 2I4OA 5A4IS 3HJHA 1DXHA 4ZVTA 4IJUA 4G4GA 5SICE 4HXFB 2ZI7A 5EIWA 1NW4A 3PHGA 4UU1A 3GVCA 1DEOA 3CZCA 2O52A 2OM6A 3E05A 1XCJA 2DECA 4K7JA 2B20A 4U3JA 1M54A 1NY6A 4DUGD 2PXHA 4R2KA 4KPUB 5F1PA 3T9CA 3UHFA 4U2FA 1E3LA 3ISVA 3H8WA 2YASA 3CJTA 3FY4A 5REQB 2P6RA 4DV5B 2G1AA 2C4VA 1N2CA 5EAIA 2A4KA 2PIDA 4EG8A 1FSZA 1VCOA 4EHIA 1VG0B 1NX6A 3LQKA 2I6TA 3DMTA 3E9EA 4KW7A 1M2JA 3EW9A 1M6HA 4OHOA 4RDHA 1TU0A 4B40A 5JROA 1F8UA 1H1LB 4L0MA 1DRUA 1RLUA 1HG0A 1A9QA 3PE4A 3GRFA 2YN0A 2ZFUA 4UCQA 2IHNA 1E6WA 2F3UA 4XGQA 4CDRA 3B38A 3IUPA 3L0PA 4F6CA 3WGZA 4OLBA 1YB7A 1AK1A 2H4WA 3WLRA 4BYMA 3ITNA 4OJMX 1PN3A 4ARCA 1NM5A 1DI0A 3MB5A 3ASVA 1NQAO 1OJ7A 1AE1A 1V5FA 1XZCA 3O0TA 1ECFA 2IZOA 3LGXA 2GO7A 4K6GA 1P2SA 3VKWA 4CMBA 4YUZA 1CC1S 1M8JA 5E2IA 1CR4A 1Q19A 1XRLA 3GLQA 4XDYA 5DRTA 4EY3A 2QTLA 1SOMA 3FDZA 4IS3A 5K6AA 2X19A 3D6HA 16PKA 4B83A 1LTHR 1CDDA 4FX2A 3AM5A 4H1WA 1NI4A 2BGNA 2ID7A 3IHWA 2P11A 5KEIA 4DRZA 3DVAB 4CGYA 5BNZA 2NZYA 1CQPA 2WB4A 1L4BA 3Q0TA 4GI7A 3P96A 2V59A 3EVGA 4B7UA 2X2FA 1RBQA 1T36A 2MINA 1NVBA 4AM8A 8ADHA 2UYHA 2YJTD 4MVJI 3REQB 1W1IA 3X3HA 5JWRA 5KVAA 5JOQA 5DNWA 2OHGA 5KC8A 3VJRA 3L92A 3BKXA 4N5DA 5IWAB 3WAGA 3CVJA 4XCVA 3RS9A 1GR1A 2X3UA 4H0FA 4X5OA 4M0DA 2O1XA 4LY3A 3OAAD 4EEXA 5DVZA 3K2QA 2CLOB 1JSXA 1QBGA 1YVEI 2VOEA 2PMDA 3G2NA 3PPWA 3BMQB 3FCSB 1ESCA 1U0OC 2Z1NA 3VRHA 5EJ5A 1ZK4A 1NXXA 3HL0A 3LA8A 1N5RA 4DZZA 2H5IA 2I6FA 1Q2XA 1NVFA 1VRWA 2VBGA 4RGQA 3UQYS 4QJ5A 1C0EA 3C0KA 4GXRA 3ZE0B 3ENWA 3DAYA 3TI7A 3Q5EA 1QO7A 3U7IA 2NO7A 2IHYA 3DSRA 3C8ZA 2ZYWX 4NAHA 3W8DA 2YW9A 4R9RA 1Q11A 3H2KA 1N33B 1PT8A 4Q3OA 5CBKA 1Y3IA 4GT1A 3SMQA 1YTLA 3TCKA 3QBTA 1MT0A 3E2MA 3ZCPA 1B6GA 3FBWA 5K09A 5GADl 3COSA 1CJTC 3OM1A 1ZEMA 2F1OA 1ZJ6A 2COKA 2WJ6A 4W5TA 2IODA 3U48A 3R41A 4BCBA 4ZT2A 1SBHA 3G2KA 5TS2A 3M4YA 2HY7A 5J4VA 1LRJA 2CV2A 3E22A 3K9GA 3FPFA 4FDAA 5CA1B 1RJ9A 2JGMA 2FSPA 2I99A 3AHEA 3GF4A 1YHNA 4L8YA 4P5PA 5BW8A 3N8IA 1S9DA 4JZYA 4II7A 1K8XB 2QDKA 1PZMA 2X5XA 5EIHA 1YQUA 1I2MA 3SICE 4EGSA 4WJLA 6AT1A 2BONA 3O73A 4WKPA 5E6RB 1ODKA 4G9EA 2C3YA 4JD5A 1ADCA 4OSEA 3OUZA 5FNVA 1CETA 1Z06A 3HM2A 4A27A 1FLAA 2C7PA 5JXJA 1GNSA 1IEVA 2AD5A 1K89A 1TO2E 3EXIA 2CLDX 2VYFA 4LJ8A 4QUGA 3FR8A 4CNQA 2FX2A 1WSBA 1HT2E 1PJQA 1RBZA 3PUHA 4MP8A 2YS6A 4QFMA 3L7AA 5AW0A 1II8B 3P2IA 2IH5A 1BD4A 1NN0A 1YQGA 1G64A 3AI7A 3TQIA 3MINA 4FDUA 2QF7A 3HVRA 3ENNA 3FHLA 4MQFB 4RH3A 5KTOA 4Q1DA 1DCTA 1X7WA 4YROA 1W85A 4ZYVA 3V4RA 4QOEA 1Q77A 3N0RA 1X14A 1VE9A 2FAXA 2Q1WA 1QXSA 1DFHA 1PX0A 3F73A 2BHNA 4NJEA 2XMSA 2XQGA 1ZMXA 2FSVA 3WTBA 1K9VF 1PL8A 5K0GA 1WDLA 4YI5A 1GUZA 2OCLA 4OUDA 4LGMA 1X6VA 2OFFA 2OZPA 5F73A 4BASA 1LX7A 1Q7EA 3E7XA 1U7WA 4J0DA 4C1NA 2WZQA 1HE1C 4KMRA 2F59A 4W1RA 2NV6A 2XH8A 2QIPA 3HO8A 3M70A 3QMVA 4L3VA 3ZQKA 4DCSA 4DV7B 2Y99A 3LQYA 2AA3A 2R86A 4PLGA 3ROGA 3TTYA 2YVLA 1LZKA 5KQLA 4KKXB 4XJVA 3KELA 2HRZA 4Y0NA 1M66A 4BOYA 1D1SA 4I50F 1AS3A 1N4DA 1UBGA 3I5XA 3IDSA 3ZU4A 4J7AA 5EJEA 3PA8A 3GFPA 3ZS8A 2PYDA 4YT8A 2QJWA 3U4AA 1SPBS 4RJ2A 1XB2A 4L4SA 2XQKA 4G8JA 4XPZA 2RGAA 4LZOA 2O3QA 5U4XA 5AW7A 4ZQFA 3D6TB 3RJ9A 1Z8FA 4X9XA 5MF6A 1TM2A 1HDOA 3TQFA 1UK9A 5IM4F 4I9NA 1ZESA 3DYIA 2WWIA 3HFRA 1BWQA 1EGMB 1KEEB 4HNHA 5KPDA 1KK3A 2I1LA 4W8OA 4XD7A 3TW8B 4HVLA 2RGEA 1N7JA 4WZBA 2QPOA 1ZN9A 1PEKE 1XTPA 2I33A 3BB1A 3DDWA 1XZMA 3FETA 4FEEA 3ZCRA 2RGUA 3KZXA 2XMPA 2CT8A 4D26A 2C0QA 1UIMA 2GEKA 1Z2EA 1Y8QA 1H2EA 2Q0SA 3EA5A 1VZ3A 4FXOA 4GP9A 4PFKA 1EVLA 3IR6A 4JT8A 2XZPA 1C3OA 1KJYA 5BURA 5LB4A 2A58A 5BUSA 1CUUA 1DWOA 2Q1XA 3QKSB 1XR3A 2L2QA 4Q00A 2HHLA 1SCKA 4UBKA 4MVJP 1JBEA 3LKBA 5EPUA 3T9BA 1HYGA 4RK1A 3QF7A 4B4WA 2C1XA 5AQEA 1JKMA 2J32A 1U3UA 5TRTA 4AJHA 2QSZA 4YC7A 1AF7A 1KBQA 2WKWA 2Y1KA 2WNSA 4MVCA 4C5BA 1BYUA 4GXNA 2FWBA 2QZ4A 2CEAA 1S2DA 4V0OA 4KC0A 4I36A 5D1NA 1PYDA 4U9IS 1XEXB 3HUUA 4Z4QA 1A8HA 3GLIB 1VFNA 2N75A 1AB5A 1DRWA 1I2ZA 1FYDA 1VGQA 3VR3A 2CCJA 2W5UA 3ET5A 4BP8A 1E7SA 2OQ2A 4A10A 4V3CA 3WIEA 3ZZ1A 3D3WB 5JJLA 5BN3A 3QBDA 2AJ8A 5EWMB 3OCWA 4CEHA 4LI3X 4LX8A 5C2JB 2ZI9A 1SQ6A 3RGWS 4BX3A 3GY0A 1OWNA 1P4GA 2QZJA 4L1KA 3R4CA 1Z45A 2ZCJA 3C5VA 3E9RA 3G5LA 5IK2A 1GA6A 1MG0A 2JI6A 2IRWA 3KXLA 4KB5A 2BEJA 2HGSA 3PDHA 3PFBA 3V2HA 3ZHOA 5IF3A 4GGMX 3W9BA 4RADA 4LOJA 2DQKA 2OENG 1A04A 1L7QA 2HTFA 3EJ6A 3TTXA 3R7DA 1PYOA 1H2YA 1ENOA 4EKDA 5GGXA 2CFIA 3HYCA 3TZEA 3CLRC 4ZJUA 2V7VA 1RWNA 2XY4A 5BRNA 3THXB 1AKQA 3EBLA 3C3EA 3X1XA 3QUSA 5J3JA 2CCGA 3JQBC 3SC2A 5EI5A 2GBGA 1AGPA 1B0ZA 4XZ3A 2JD2A 1CFJA 4LJ6A 5I7EA 3E3NA 4L7QA 4RK4A 1ZRNA 1VCMA 2YS7A 3OUTA 2GZAA 2IYNA 3M1AA 1K2WA 3AOEC 4G86A 1ZMTA 2QRNA 2ZEJA 2FF7A 3EZGA 4K9PA 4DCUA 5K0TA 3CRNA 5HZKA 3HXPA 4PTLA 3TR5A 2Z83A 4RY9A 1OXTA 1UBLS 3A06A 4OMUA 4EZEA 3R76A 3H5TA 1DEHA 3KRTA 1P9NA 4FHDA 2CUKA 4FZ5A 5DW0A 4BO8A 2C54A 1OAAA 2HNKA 4KDLA 2NSJA 1DTWB 1WIWA 5BSRA 4CM8A 1KQOA 2C7RA 2GK3A 1E2GA 2JEZA 5K0LA 4R1TA 4B6PA 4C87A 6NULA 1FW6A 5JS1A 4TZ0A 1L1QA 2YXPX 1C9DB 2GA9A 2AMYA 3W1VA 4PEVA 1WX1A 5ALQA 1NRWA 2ZLBA 2QRLA 5JCJD 3N76A 4RZUA 4HDRB 1T2NA 1BZYA 1W4AA 2F00A 2O7VA 3JD4A 3MQ4A 4RSGA 4XGKA 5JH7F 3IJEB 5JFOA 3E9MA 4EABA 1QQBA 4D9EA 2VQ6A 2NUAB 2BRUC 3FM9A 2G1KA 3I92A 4D5GA 2E5FA 2VDRB 2XAUA 3HB9A 3UF0A 3U60B 3IPCA 5A0TA 1H05A 4EG5A 2WWHA 3ZHQA 4P4NA 5CCXA 2JANA 3T5TA 4CU5A 1WKVA 5F3DA 1Z47A 3L46A 1POWA 5TB5A 4C21A 2XTAA 4MWSA 4CL8A 1RJGA 3I2HA 2IF0A 1XDDA 4HAZA 2IXFA 2CHGA 5ED0A 4ZALA 4AECA 3IVGA 5EHGA 4FFSA 4GICA 4B3CA 7AT1A 3LC1O 3BN3A 2CCKA 4TTPA 4G1CA 5LMUB 1E7MA 4NV3A 3SQNA 1KS9A 1LWOA 4OL9A 4Z0TA 4ITVA 4BJ6A 4UNSA 4QARA 3EFOA 1U6JA 2ZBGA 3KFXA 2Z6VA 3EBOA 4HDKA 2HPHA 4FILA 3R7AA 3NTUA 3GCGA 3W1EA 4PYRA 4DDKA 3EB9A 1U3DA 2QAJA 1G4HA 1NKSA 4BO6A 1WUJS 2IOHA 2ZUEA 5EA2A 1NPYA 2JJ2D 5E6SA 4ARUA 3WGUA 2ET6A 3QXCA 1SUSA 3MWFA 3WE7A 5JAMA 1ADJA 1KTIA 1DHRA 1S2GA 3BXXA 3AVUA 4CKBB 2PUBA 1JFRA 3KKPA 4EECA 4UREA 3ZW9A 1T0UA 5B58C 3ZIAA 3LXMA 3QX8A 4OAOA 3K1ZA 3RU9A 5IPFA 3H8JA 3Q9NA 4JODA 5FUXA 2C2OA 3CF4A 4U2DA 1SVKA 1N8SA 2Q5FA 1A71A 2V6BA 3DHNA 1QK5A 3BTUA 1RPTA 4L85A 4ZVNA 4XJTA 5JZVA 2AHOA 3LBHA 3O95A 3HYLA 2O48X 4OXXA 4LRQA 3PD0A 4QXRA 3LC7O 3IPXA 3ZXIA 4EO7A 4LHYA 1OHHA 1EHCA 1TZCA 5AJYA 2NU8B 3PHBE 3A8TA 4WLVA 4C7XA 3OTOB 3MGBA 1CJBA 3UBTA 2IYOA 5CDTA 4HN2A 4WWHA 5HDQA 1BVUA 1W8IA 4ZK2A 4HQKA 3KAQA 3IO5A 3GCDA 1R9NA 3B89A 3MUEA 1VCNA 1CQIB 3QVKA 2QN2A 2RHMA 4PBTA 1Z6GA 2UUPA 1VI6A 1QDEA 5DP1A 2EX1A 4YCBA 4F8YA 3PCTA 1NIPA 1RC0A 2C8KA 2F62A 4LG1A 1FYEA 4YY3B 3DF7A 1MGPA 4LK2A 1E0DA 1U0SY 2ANCA 2CUNA 3NDRA 1TZJA 3ND9A 4YQEA 4A1FA 3QKRB 3MJTA 4HNTA 1D04A 4V0SA 2QLBA 1HEUA 1KKUA 4LOKA 4M1QA 5AJUA 3ZDRA 3WMEA 5AESA 2QW0X 1VP3A 5DHUA 4UARA 1ZUNA 5ALUA 2HDWA 3ZCUA 4RH0A 3GGPA 5LZ5A 2WJAA 1NXQA 2ZKIA 2DBRA 4UJ5A 3QUQA 1JNXX 2DHCA 2VAMA 4H1VA 3SI7A 4DKXA 3LXRA 4I5EA 1JW9B 4FHCA 1EK2A 2V6IA 3MTQA 2B6HA 4IJMA 4JFAA 4B0PA 1L8QA 2NT3A 2C5AA 3AL2A 4TV9B 2AKEA 1DC4A 1KFKB 3PNBA 2WTAA 2VLIA 3Q6IA 4CR8A 3ETGA 5HK9A 2XIJA 3CIOA 2O2SA 4F06A 3GLVA 4WN9B 3D8SA 1Z3IX 4K9DA 4IIYA 2PGJA 3T7CA 4TYMA 2Q3CA 4R1QA 4NCAA 1NOIA 2YXLA 2PKXA 2XBUA 3UK2A 2C5SA 1CB7A 1JI3A 1CUCA 2OAQ1 4X7PA 3TO5A 1O9HA 2RGWA 3UMVA 2GN9A 1IN5A 3JQCA 3P4YA 5B4VA 3MAAC 1VSTA 1XAIA 1RYMA 2Q9CA 3E7PA 3JYQA 4Q9AA 4DQKA 4CIAA 2QSYA 2QUBA 3FOCA 1VG9B 4PCAA 2GBFA 4CEIB 1JZTA 3F4LA 1YS7A 1I7PA 4R1UA 4YNBA 1N2ZA 2RONA 3SSMA 1PSZA 3WYDA 5C8DA 5JCPA 2C20A 4L5YA 4C0WA 3U37A 2HCFA 1C3JA 1VLLA 2Z6QA 3HBAA 4FBMA 4YRQA 3ZNOA 2LZ0A 4CFYA 1JPJA 1N5JA 2RMKA 1WAMA 2C98A 3PICA 4FCVA 3HBNA 2TRSB 4GX0A 3H1EA 1WVMA 2GEDA 1CS4C 4WDQA 4C4TA 4HP8A 4TL6A 1K6IA 4E3WA 1FUYB 1NUTA 1NF9A 3H99A 4N39A 3SHOA 1ZR2A 2A88A 4U7JA 5BRJA 4RTMA 1HF3A 2GMWA 4K05A 4D4JA 4JB3A 4UUBA 4WOBA 1MB2A 4YRIA 2B69A 3MFQA 2BEVA 3V4PB 1D9ZA 1K4KA 2WJ3A 3WWEA 1X0XA 4AY2A 2B5WA 2QGZA 3IKJA 3UGTA 4A73A 4CV2A 3S1SA 1IXZA 1NNI1 2XGJA 5JI2E 1I33A 1QDUA 1MENA 1KMCA 1U8YA 1MX1A 4G0MA 1MJ5A 1FNNA 1K8RA 1PG0A 1T1SA 1YZTA 2JBHA 3OZIA 4QEZA 3TEMA 4Z2YA 4CCWA 4ZCIA 1GTL1 3KAPA 3PLRA 4KLCA 1VQ1A 1Z0ZA 3MG9A 4MS4A 1SULA 4YJ3B 4RV0A 3ME5A 4TZKA 4ZQGA 3ZVLA 4HR7A 1MJFA 1QQAA 4IWXA 5DTQA 3FIUA 2FR8A 4JJFA 3VKVA 3SYKA 1IONA 5EEGA 2EIXA 4MLZA 3A26A 5TPZA 1IH8A 1NZJA 2BBOA 3HGMA 1X19A 2Q5HA 3OQIA 1KY4A 4LK3A 4K9MA 2HRCA 4Q66C 2GETA 1TA9A 5A3RA 4B6FA 4WEQA 1H3FA 4JA0A 1PDOA 4LJKA 2XDPA 3JQ8B 2VAPA 3NANA 1FUKA 3BDVA 5JNLA 3H13A 1PJBA 3DLTA 2X86A 2I8LA 4CT4B 4D0SA 2O8BB 4XD2A 3R24A 4NHOA 3DTYA 1RYHA 4IH9A 1Z82A 4H77A 5CK5A 4BPBA 1YI0A 1BEUB 3ESZA 2V6FA 5DBIA 1Q84A 1D03A 4Q4LA 3W34A 3AJ9A 4HTFA 2E4XA 4MV1A 3FH0A 4AKSA 3WX0A 5CA0A 1N75A 1TEXA 2JV2A 2G4VA 4C4XA 4H0NA 4WOJA 5E7MA 4PHTA 2NSYA 5M29A 3H05A 1ZGGA 5DOZA 1V3QE 4JB2A 3LZDA 3ZGXA 3R74A 3T3EA 3ELDA 5E7JA 4B2YA 2IGTA 2QD3A 2OPBA 3BTSA 5ALKA 1N2HA 3EXG2 4BNDB 5ALEA 1PJLA 1TTPB 1WDKA 3HBJA 4JSTA 3TTUA 1J5PA 3VR5H 4D9MA 2JNWA 2K2WA 1G20B 3WLOA 1NW8A 1DG9A 2HDHA 2XKBA 1MCZA 1J2YA 1P45A 2ZRKA 4IIJB 3GLUA 4YT4A 4EEZA 1YCHA 4ODIA 3TCXB 1FVOA 3TNLA 3E35A 4B2LA 4YJ2B 4B4KA 1TUIA 3W6ZA 1BMDA 3CWZA 1DAMA 1UOQA 1RKQA 4RA6A 5IKMA 4FIBA 1LXCA 2TSYB 1CEQA 1XIVA 4G0WA 1C0IA 1FX0A 3PNVA 1RKUA 4JC5A 2XLBA 2IDJA 3GOQA 2XX3A 4PX2A 2FP4B 4RLFA 5HOQA 1OAOC 1A9PA 4OOFA 4UUPA 3CUUA 2DHDA 3WIBA 4DM7A 3JWGA 5FYDA 2OCDA 1PV4A 3FYDA 2ZI4A 5E38A 4LY9A 1IXSB 3ZWCA 2ETVA 2WKSA 1U0EA 1FZTA 2NGRA 3GUYA 3NAQA 4GM0A 1SG0A 2CVFA 5EZYF 2BAGA 3SJ7A 4NBNA 1EKXA 1NJGA 1YKGA 2X0NA 2SCUA 2PQMA 3ICWA 2Y4NA 2OV3A 2PY6A 5B3AA 3TR0A 3DF9A 1P0IA 1FOEB 1BE0A 3STXA 4BQRA 5M2QA 4I66A 1GUFA 3RYCA 5IEBA 4ZTBA 3HEMA 2EW2A 5AOVA 4BLTA 1LC0A 2HA0A 4DJEC 4G0YA 1UFKA 2C4WA 1XALA 1YS1X 3IQHX 4XFDA 3UAZA 5IKPA 1RT9A 4B4DA 5ISMA 1IEQA 4KAAA 3A3NA 3AMVA 2JAHA 3ZJUA 2QM7A 4O1IA 1SVNA 4RIGA 2ZXUA 1MZPA 5JSKA 4HPJB 1Y1TA 2PDAA 4YAUA 2DSTA 2YN4A 4MIOA 5CM8B 1XLTA 3CNQS 2VUSA 4GS5A 3A04A 5EWJB 1G3QA 4PLCA 4I4CA 2VH2A 1ACJA 3LPMA 2JIPA 2PH1A 3W5HA 4X8LA 4AJOA 2PZGA 3QLTA 5EP4A 2J7KA 1XL0A 2UZ1B 4TLDA 3RAFC 3SZ3A 2EJVA 1DXYA 1DKPA 2C9OA 2NUPA 4IDOA 2DQYA 1GRQA 2O3RA 1ADBA 1WCXA 1K68A 1G21A 3HUEA 2HO5A 3MOIA 4NFHA 4CDMA 5K9ZA 2FG7C 3A6FA 1CULC 3QQ5A 1GUYA 3WYNA 3H11B 4FCTA 3RAEC 3RS3A 1CDZA 5D6OA 5HWSA 1FFDA 4L4ZA 1CSEE 3RS0A 1XYVA 2NQTA 2OECA 3D3KA 4BBZA 1W88B 5IT0A 4H4EA 4L8GA 2FZWA 1T9HA 2MSKA 4Q3DA 4Y2PA 1HDRA 5IARA 4F4CA 1LB1B 1UMCB 2Y8EA 3CG4A 1K8QA 2GUWA 3LW7A 3NH6A 1BW9B 1H2XA 1W5FA 3KJQA 1SOWA 2GZ1A 3IAS6 2ZIGA 4ND4A 3EPLA 4M1ZA 1SKAA 1ZXXA 3HCPA 2G0AA 1Z73A 3GVPA 4JJAA 4RCVA 1XP8A 2SHKA 4J0IA 4M0CA 4RA9B 1GAWA 2W4QA 1KEUA 4H6PA 4XSVA 3P9SA 4AD8A 1JKIA 2PWZA 2VK4A 5JNWA 5KWJA 1HMYA 4LTDA 2FLWA 1VKRA 3WGIA 3F3MA 1P1IA 3HGTA 1DKOA 4LYGA 2D1FA 2IUYA 4E3ZA 1UANA 3MWEB 4UZFA 4YCSA 5BOSA 1H93A 5JZOA 1VMIA 1X1EA 5FT9A 2OORC 4H08A 3KXIA 2JI7A 1ANKA 4LMBA 1QRTA 4YLGA 1R3UA 1IHYA 3LBYA 4BTVA 2DFTA 2BH2A 2QAGC 4PW0A 4MQMA 1W0JD 3B60A 1PP4A 3V4OA 3X1MA 4QUKA 3LY9A 3C8HA 1RKBA 2HZBA 3VC2A 2PGAA 1BQ4A 3A10A 1G5QA 3BZBA 4PX9A 4RS3A 5FBLB 2DF8A 3IBFA 1DNPA 3KSUA 2R97A 3NVAA 2YR0A 4L27A 3OZXA 2ZANA 4WESA 4BZZA 1HE2A 2GJ9A 8MHTA 2VUIB 2OE2A 2GYYA 1EVIA 3CC8A 1OBHA 4XM2A 3TSOA 4Y0VA 3V7WA 4C20A 1L3BA 3GFVA 3K94A 4ZVVA 1SR8A 3I5AA 1WOMA 1RZVA 4K8RB 3RNOA 3FSGD 5L4LA 5DGTA 1ZRSA 4NP6A 3ESAA 2FUKA 2PMCA 5C8YB 3WTCA 2I2BA 1LK0A 4PX3A 2RHOA 3PA6A 5I47A 4UU7A 4TRJA 1XYYA 2ORWA 2JDIA 2OMKA 1QH9A 1WZNA 1KWGA 3UAYA 4RUKA 1UJNA 4QNNA 2GDJA 3TUIC 3RYFB 5JJBA 3HZHA 3F6YA 4UBNA 3QYAA 4OVKA 3VI3B 2WSYB 1KC3A 4PV7A 4V39A 1YQXA 5GONF 1FXWF 1AQ6A 5A6VA 1SEVA 1J5XA