3LGAA

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
253
structure length
253
Chain Sequence
MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 70
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3lgaA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lgaA02
3BZBA 1FBNA 2BM9A 4AX8A 3OU7A 3HA3A 4O29A 3AXSA 3PVCA 4C03A 5MHTA 1O9HA 5IKMA 3TR6A 2Z6AA 2AN5A 5DM1A 3S68A 3HNRA 4FT4A 4KIFA 2OO3A 2JH9A 3T7TA 3OE4A 4P7JA 4MTLA 5LQAA 3EVCA 3G2QA 5LQKA 3GU3A 2XYRA 3HA5A 3IV6A 1ZGAA 1SG9A 3FTCA 2PV0A 1ORHA 4OBWA 3KQOA 3UFBA 2P3QA 3LBFA 2AOWA 4AZVA 3EVEA 1RJEA 3I58A 5H02A 1TW2A 3UA3A 1RI5A 2O07A 2AN4A 3P9KA 4GOOD 4OQDA 2I6GA 1M0EA 1QAMA 4QVKA 3SM3A 5CCXA 2FPOA 1SQFA 5GM2A 5G02A 5HEKA 2BZGA 1MJFA 2PVCA 3C3YA 1ZKDA 5FWDA 3FYCA 4PONA 1XCJA 4AZSA 4GBED 1M6EX 5LQJA 3TOSA 3R24A 5EKXA 3KHKA 1L3BA 3G2OA 3KPUA 4E2XA 1JQ3A 2EJUA 3B89A 4HTFB 4FGZA 4U7PB 2EJTA 3CJQA 3UWPA 3ERCA 3A25A 2HWKA 3BGVA 5FA8A 3Q87B 5HZMA 2R6ZA 3PX3A 2Y1XA 2YXDA 1P1CA 2PLWA 1WS6A 2UYCA 1KHHA 4PYIA 2IPXA 1HMYA 2VDUE 3DH0A 2YVLA 4GUAA 3A7DA 2DPMA 3HCDA 3FPFA 3QV2A 5CVJA 1XDUA 3DXZA 4BLUA 2P7HA 3SXJA 3I9FA 2PSSA 1YB2A 5KVAA 3I64A 5EMLA 2OZVA 4PYLA 2BR3A 2PX8A 3MQ2A 2VZ9A 3GDHA 1DL5A 4R8RA 1NV9A 2NXEA 3GJYA 1YFLA 3OZSA 3SVZA 3AY0A 5E9WA 1N7IA 2OY0A 3KQPA 2CMHA 1SUSA 5T64A 2AOXA 5LQRA 3OFKA 4E2WA 5ICCA 2WA1A 4E2YA 5LQNA 3NWEA 5EEGA 1O54A 1G55A 5DTRA 1AQJA 2PWYA 5EMJA 4FSDA 5KYGA 3BUSA 1O9GA 3G88A 4BP3A 4PYJA 3SSMA 1D2HA 4CKBA 3M6VA 5K0NA 3BWBA 1VPTA 4YV2A 4RTOA 5M5BA 3C6KA 1KR5A 3LKZA 4IKPA 5EIFA 1NKVA 1KYWA 1L9KA 1NV8A 3NTVA 3OE5A 1FJXA 2AOTA 5ERGB 1X1DA 4C07A 2PGXA 3LDUA 2A14A 4MIKA 2OBFA 3HTXA 2ZTHA 5DWQA 4DA4A 1BKYA 2G71A 5K0LA 1BHJA 1HNNA 5GWXA 3AXTA 3BKXA 3DMGA 2NNWB 1XDSA 4HC4A 4P7FA 5E8JA 3CCFA 4RWZA 3SSNA 3SX0A 2UZ4A 1ZG3A 3FYDA 7MHTA 1KIAA 3T7SA 3KPWA 1R18A 5CVVA 2NYUA 1FP1D 3TFWA 5E9QA 2I9KA 2G72A 2ZBPA 3LBYA 5JR3A 4ER5A 5K03A 2VDVE 1VL5A 3HCAA 4YUWA 3PLAE 1VQ1A 3A7EA 1WXWA 1JG4A 1Q0TA 4R05A 5K01A 3TLJA 1NW3A 5DSTA 1I9GA 3O4FA 3UJBA 4RTLA 3VSEA 3GXOA 2YX1A 4AZWA 4OA5A 2V74B 2KW5A 4XCXA 3LCVB 2IFTA 3KR1A 3G2MA 4EK9A 4RTJA 1F38A 2ZBQA 4KDCA 1G6Q1 2CMGA 1T43A 5C0OE 1U2ZA 3T7RA 3AJDA 3FRHA 2H00A 1SQGA 1TW3A 2JHPA 1RI4A 5GOZA 4CXMA 3EMBA 5CM2Z 4PGHA 1ORIA 1L3CA 5E1BA 5FULA 5BW5A 1SKMA 2ZIEA 5EKUA 1NBHA 1UFKA 3LL7A 5FTWA 3OPNA 2NP6A 1P39A 3PX2A 2IDKA 4QQNA 3HEMA 2ZFUA 3BWCA 3UJAA 4YUZA 3M6UA 4CTJA 3IEIA 2Z6UA 4RYLA 1EAMA 3OZTA 2OYRA 5FHRA 3TKYA 3HA7A 4PIPA 4PYOA 4DQ0A 4YV0A 4Y2HA 2HNKA 3JWHA 1R00A 2GA9A 3GWZA 3UJ9A 1IM8A 4XUEA 1RJDA 4ATNA 4R6WA 2PY6A 3ELYA 5EGSA 8MHTA 5K8VA 2ERCA 3HCCA 5EZSA 3RODA 3RW9A 3MERA 2UYQA 3SR4A 3FTDA 2O05A 2ZVJA 4PGGA 2LD4A 3EVGA 3E8SA 4E33A 5DXAA 2B2CA 3M6WA 3ANXA 4X60A 5DRTA 4YUXA 2AZTA 2EG5A 1R74A 4RVDA 4YMHA 5U4XA 3FUXA 3G8BA 4GOMD 4YV1A 1IY9A 2OPBA 4GC5A 3OZRA 3OU2A 5HIJA 1UWVA 2ZIGA 3LCCA 4DZRA 4E32A 5DM0A 3GRZA 3A27A 3FPJA 3KKZA 4RTMA 1VE3A 3CGGA 4QQKA 5GIPE 2UYHA 3THSA 1JQDA 5CD1A 2FYTA 1EJ0A 2IP2A 3F4KA 3LECA 3LX6A 5FA5A 4QDJA 5DM4A 3I53A 3GRUA 4OQEA 3CBGA 3DR5A 5E1MA 2AOUA 2Y1WA 1N2XA 5HFJA 3SGLA 4QTTB 3FPGA 3EVFA 5FHQA 2NXCA 2AVNA 5DT2A 3P71T 4E70A 4ER7A 4LWOA 4X41A 5EIWA 1NW5A 4X63A 2PX4A 3FRIA 4PCAA 4PNEA 1JSXA 2H11A 2IBTA 4HRAA 1BOOA 2P7IA 4RTPA 5K05A 2BR4A 3DLIA 4GOND 3KQTA 3PB3A 3V8VA 3B3JA 3P2EA 4R6XA 4EQZA 1R8YA 2F8LA 1PJZA 2YUIA 1R8XA 3QOXA 2P40A 3CC8A 3E23A 5DTMA 1L3IA 1WG8A 1WY7A 3BWMA 1KPHA 2ZWVA 3K6RA 3FUUA 3TRKA 4B17A 3EEOA 3HP7A 5DX8A 1I1NA 3EGEA 3G7UA 3P2KA 2JJQA 3CKKA 2P8JA 4H0NA 2DULA 3GO4A 4QTUB 4RX1A 4HGZA 3JWGA 4F85A 2HTEA 2VDWA 3UJ7A 2PJDA 3REOA 5E2AA 2ZZMA 3DP7A 4OBXA 2JHAA 1JSZA 3M4XA 1WXXA 1XVAA 3DULA 3HCEA 3P8ZA 2P3OA 3KU1A 2AR0A 1FPQA 2ZULA 3H2BA 3PFGA 5C1IA 1EQAA 1BC5A 5KQRA 1NW8A 2B25A 5LSAA 2Z6QA 1RJFA 3UJ8A 4KRGA 3NVKI 3JWJA 1N7JA 4PYNA 1DCTA 1JG1A 3DMFA 3DOUA 4FP9A 3MB5A 5EEHA 3LKDA 2HR1A 5HILA 2ONZA 5DTQA 3VC2A 3B3FA 3B7PA 2O57A 1QANA 5EHGA 2HV9A 3LGAA 5GINE 2AOUB 1TPYA 3GNLA 1KXZA 2XVMA 3EPPA 3KQYA 3OFJA 3Q7EA 5ICFA 3RIEA 4E30A 4V0RA 5DX1A 3D2LA 4MQ4A 4PYQA 4RTKA 4R8SA 5FWAA 3G89A 3BT7A 5K0CA 3FZGA 4EVIA 4P58A 4RVFA 1SUIA 1QAOA 4C4AA 1G8AA 3CJTA 1EJ6A 5E1DA 2N47A 4RTRA 2GB4A 1X19A 3THRA 3UZUA 3PFHA 5K0BA 2IBSA 4NECA 3FTFA 5DXJA 3PTAA 1ZQ9A 3ELDA 4BY9E 4C04A 3MCZA 4L7VA 2JG3A 1VIDA 3LHDA 1OR8A 3BKWA 3TM4A 1YF3A 2VP3A 4X1OA 2P35A 2I7CA 4YUYA 1KPIA 2QY6A 3A26A 3SSOA 5DSXA 2PXCA 1G60A 3NDIA 3UJDA 5F2NA 1XDZA 4RTQA 2ONYA 1DUSA 5K0FA 1MHTA 1NW6A 1QYRA 1RJGA 1Z3CA 4M7RA 4QDKA 2ORED 4ER6A 3MHTA 4C05A 2WK1A 2IGTA 3QOWA 1NW7A 2G1PA 2HMYB 2ESRA 2V7EA 3KPYA 2Q41A 3DXXA 4FSXA 5EOVA 2FCAA 3DTNA 4LECA 3TMAA 4POOA 3TM5A 5IH3A 2C7RA 4F84A 3SMQA 4WVLA 5B1SA 1JTEA 2EX4A 3KQMA 4EMSA 4E2ZA 3HVJA 3UJ6A 3ER8A 3G8AA 3MCTA 1RI3A 2ZW9A 3IHTA 3EMDA 3R3HA 2ADMA 4P7GA 5T6BA 10MHA 1KPGA 1R6AA 2AOTB 2FK7A 4HTFA 3U81A 3VC1A 3HM2A 2CL5A 3EGIA 3MAGA 5GP1A 2PXAA 3T0IA 2B78A 5EPEA 5K09A 2IH5A 2XYVA 1INLA 2JH8A 3HVIA 1EIZA 4M37A 1AF7A 1P1BA 3C3PA 3DLCA 3FUVA 1JR4A 4PYKA 2UYOA 3NW9A 5EG5A 5FQNA 1NBIA 3C6MA 1G8SA 2PX2A 3DUWA 3JWIA 4KDRA 3V97A 2C7QA 1FP2A 2P41A 3X0DA 4RVHA 1X1BA 5D1NA 3HCFA 1Q0SA 2CWWA 4ZTBA 2AVDA 3BGDA 3KPVA 4K6MA 4OA8A 5F2OA 3GCZA 3ME5A 2EFJA 3GRYA 1VP9A 4EKIA 5DM2A 2ZLBA 4GF5A 4RSRA 5T67A 2GS9A 3R0QA 4YMGA 1D2CA 2H1RA 3G5TA 5HIIA 4OX9Y 2AOVA 3EEYA 5EQJB 2QM3A 5EVJA 3FTEA 4IWNA 2GPYA 5DX0A 4M36A 4CWAA 3KR2A 4Z2YA 3HVHA 1QAQA 4G56A 1I4WA 2FHPA 2G70A 1SVUA 4CKCA 3C0KA 2XYQA 1X1AA 4RTNA 4ISCA 3UBTA 4KVZA 2IIPA 1VLMA 3A4TA 4HH4A 4QPPA 5EZQA 2FRXA 4A6DA 2B9EA 2YXLA 4GC9A 4U7TB 4X61A 5E8RA 4RV9A 3M6XA 2YQZA 3OCJA 4Y30A 2PT6A 2IH4A 4P7KA 1JG2A 2B3TA 3B5IA 2YTZA 5BW4A 2I62A 5CVEA 3GIWA 4PIMA 2YR0A 1YZ3A 3P97A 4UOEA 3FUTA 3FPHA 4PINA 1KP9A 3ORHA 5K0JA 5KS2A 4FR0A 4E31A 4BLVA 4CTKA 5CVUA 4ER3A 4JXJA 1V39A 2VS1A 1XJ5A 2C7OA 5K0EA 5E9JA 3NWBA 4ER0A 2YXEA 3EGVA 2PKWA 3GGDA 3R6TA 5CUQA 4BLWA 2XVAA 4HGYA 2E5WA 2O06A 2ZZKA 3L8DA 5CCBA 3AWIA 4QVGA 1M6YA 1ZGJA 4GOLD 2NXNA 3WSTA 3PT9A 5E2BA 2IDJA 1YUBA 1NT2A 4IV0A 3ID6C 5DPMA 1JQEA 3LSTA 2PWPA 4RVGA 5EHIA 4DM3A 3NMUF 2C7PA 2OB2A 3I5UA 5CVDA 1JG3A 2GAFA 3MGGA 2BR5A 4PYMA 3MTIA 2ZCJA 4MWZA 1P91A 4XUDA 5LQUA 1AV6A 3LDGA 4C08A 3K0BA 2ZIFA 5E1OA 4DF3A 3KQSA 4HG2A 1B42A 3EVBA 5EMMA 1H1DA 3KQVA 3FPEA 5P8WA 2IH2A 5CIYA 3LCUA 1JTFA 3ELWA 5HIKA 1L1EA 4CKEA 4FT2A 1G38A 2AS0A 3BWYA 2PX5A 5HOQA 1UIRA 4KWCA 3FUWA 3IYLW 2O0LA 2GLUA 3CVOA 2QRVA 4DMGA 3DMHA 4GQBA 4KIGA 4MHTA 2ZWAA 5FCDA 5GM1A 5HIMA 2OXTA 2CKDA 1EG2A 4C06A 3EVAA 2OB1A 5F2KA 4KW7A 1AQIA 1RI2A 3NVMB 1XTPA 4WXHA 4HSGA 3UJCA 5BP7A 3TQSA 3DXYA 3M70A 3LPMA 3P9IA 3KQWA 4V0QA 3BGIA 5DRYA 2ZZNA 2P1DA 3ELUA 3O31A 5ICGA 1QZZA 1VP3A 4AZTA 4LG1A 2G8NA 3KPJA 4AUKA 9MHTA 3MTEA 4IV8A 4FZVA 5FQOA 3EVZA 4YUVA 3M33A 2K4MA 3E7PA 3TKAA 3UA4A 1NE2A 2QYOA 4FS8A 1VBFA 4XUCA 3LDFA 1D2GA 2PXXA 5C9ZA 3VYWA 3KR9A 2BM8A 3P9NA 3ER9A 3P9CA 2JHCA 2NP7A 1X1CA 3HVKA 2QE6A 3B3GA 5JUWA 1IXKA 4RTSA 1XCLA 4QPNA 1KYZA 3TPZA 2P3LA 3P2IA 2XBMA 1ZHFA 3G2PA 4EKGA 3HCBA 4PCLA 1PRYA 2AN3A 2R3SA 2FK8A 2ZSUA 3EVDA 3E05A 4M38A 5LR6A 3PS9A 4A6EA 2PT9A 1YFJA 1WZNA 3KR0A 4DCMA 5FUBA 1XXLA 5EC8A 2PBFA 2WA2A 5BXYA 2OKCA 3NDJA 2BH2A 3G5LA 4DCGA 2GH1A 2NXJA 5K0GA 4DKJA 5GIOE 1Y8CA 3KQQA 3R9XB 3NJRA 1F3LA 4F86A 4BP1A 3GRVA 3O7WA 3CJRA 4PWYA 2ZBRA 3GRRA 5FADA 5KQSA 4GEKA 5LQCA 3BXOA 3OU6A 1RI1A 4LWPA 5D1HA 5DLYA 2QRVB 5EMKA 5ICEA 1YZHA
chains in the Genus database with same CATH superfamily
2OM2A 3CZ5A 3ROMA 4MI1A 5BN4A 2DSTA 3RC9A 3ENWA 4M4SA 1XZHA 1QGOA 2F6RA 2WOJA 4K9MA 5CPBA 3U3KA 3AL3A 5D5PA 4ZD6A 1YFZA 3JQ7B 4RK6A 2W6ID 2H4JA 4RGBA 1EP2B 1IVNA 5BW8A 3R5KA 4BNLA 1QM5A 3O26A 4DY4A 5LP6F 4L95C 2WRZA 3OECA 2ZXFA 5KKNB 1QDNA 4UARA 2FWAA 5JAZA 1AKRA 4D0SA 1PJAA 2VT6A 1D04A 1ECLA 3OC6A 4EMTA 5ABPA 5BV7A 3EDCA 1W85A 2P3QA 2XGJA 3D6AA 3I37X 2ERYA 4UUAA 1AUVA 5JXHA 3FPUA 2JCYA 1OFUA 2D59A 3NH6A 3EVEA 3WL7A 5LYJB 3QXCA 2YZNA 4AWBA 5KTRA 5T3YA 2O07A 2VNAA 4FNMA 1R0XA 4U3JB 3HJFA 1UC9A 1ML4A 2WINI 2FZWA 1KO4A 3E3MA 3BIFA 1A77A 3DGEC 2W5UA 1GUAA 5EUQB 3WLJA 4HNUA 5C8XA 5LMNB 1FIUA 4FSHA 3DE4X 4PLWA 1MCZA 1HXHA 2IA5A 2YWEA 2IPMA 4AZ3B 1A9XB 3T3GA 5CM9C 1DKMA 4D44A 1E94E 2WD7A 2J6BA 3KPUA 5J1TB 4Z7OB 2HRBA 5IM5A 1RPAA 2NU8A 5B7GA 1BH6A 1MH9A 3UWPA 2RGDA 4RW0A 5EYPA 5MFPA 1T24A 2WPNA 1YQWA 2HF7A 2VAWA 1QRSA 3IOMA 1LZKA 1QE3A 4IR7A 5JXJA 2Y1GA 3KJIA 5KINB 2RGNA 2ZSBA 3MNFA 1C41A 3LK7A 3R0XA 4KFSA 3WTCA 4ALNA 5DJ5A 2VDUE 2A9VA 2AW3A 4LRSB 4P86A 4L74A 4JKYA 4EZEA 1OGYA 2WJZB 5ISMA 4I4IA 3K3PA 4NBTA 4EY4A 3AETB 3L2OB 3LO5A 3OCCA 4LAFA 4PV7A 1XTZA 3YASA 2DM6A 3FWZA 1MT0A 3HPQA 5EZYA 3D6VA 4LYEA 5FAKA 1I0LA 2O14A 5LMZA 2VZ9A 2D1SA 2VQEB 2F17A 3DV0B 3CX3A 4YB8A 4G0WA 2R11A 3TMKA 4C9BA 2ZE7A 1Z2DA 4BO0A 3Q72A 5KYWB 3KQPA 2H8KA 4QELA 5LQRA 5K6AC 2YDXA 1N3LA 3IBCA 1AGRA 3FWKA 1NXXA 2XAUA 2JAUA 3CCBA 3EYWA 3N3AC 5EP1A 3E9QA 4EO7A 4YY3B 2MSDB 2NZYA 3OQ1A 4MDYA 1G55A 4TL9A 3CO5A 3QKTA 3E18A 4QBTA 3UJHA 3MMPA 4IHAA 1UC8A 3U4GA 3V48A 4FMDF 3SJCA 4EYSA 4B7XA 1ZD1A 4CTOA 2AEJA 1D2HA 3WOHA 1WUKS 4CKBA 1WX1A 2ZYUX 1LGYA 1ADGA 4YRGA 4HRXA 1IBLB 2H4WA 1DKNA 1QCDA 5K3AA 3ZDDA 2H2IA 3K9NA 3WGHA 4C1BA 5C8YB 5J47A 5EMHA 4F2HA 3O1LA 2HWUA 3OE5A 3D1VA 4K0KB 5CB6A 1QQTA 2WB4A 3HL0A 2PGXA 3PJDA 3TBHA 5LL6P 3FLAA 3OQMA 1MDBA 2BM1A 4HAVA 1WLSA 5AI9A 4KXXA 4UHCA 4WLOA 1HNNA 1COZA 4RWZA 4N01A 2GEFA 3OJWA 1MC1A 4K6FA 2H5LA 4JLNA 2P0EA 5DFAA 3R09A 4W7HA 1W2HA 4IIUA 1NBAA 4PNPA 4I50A 4D4KA 4BFVA 3LY7A 4WXMA 4BO7A 2HF8A 4E46A 5JR3A 4DCVA 1CUSA 1N2CB 1G20B 3DCIA 3IT2A 2VP2A 4FILA 5KSWB 3F9IA 1RWWA 2ZRAA 4G41A 2JEZA 2ROQA 3LV8A 5K0EA 2GQ0A 1KO5A 2JW5A 4I8IA 4M2LA 2P62A 3WO0A 4EI7A 3H4IA 4U9HS 3DDUA 5DSTA 3VXKA 4CF4A 3O8CA 1JWLA 1NRXA 3JQAB 3VPGA 1N77A 1NJSA 1U80A 1YZNA 1DQNA 3D4NA 2VQ3A 3KWJA 2IFTA 4CKEB 3T9AA 4G0PA 5AD1A 3WIVA 2E7ZA 2CMGA 3UAGA 5BQFA 1AS2A 3GLFA 2FDCA 1ESEA 1FLNA 3HWWA 4D0NA 5LWQA 3F3SA 4ZYTA 1G21A 1QRDA 3BCUA 3PDIA 4MINA 4YCAA 2MCFA 3W6ZA 4XD2A 5CM2Z 2QDKA 2ZUUA 1L1QA 3FDZB 3HJHA 4RWEA 5FULA 1K8RA 3GJSA 5I7FA 4BS9A 3BJIC 4XWAA 4DBVO 3HJNA 3AUYA 4WBNB 3ZJTA 1X94A 5DWDA 4MRPA 3ZH9B 1EFAA 3ENKA 2UUBB 1VJ1A 3ITDA 4J3FA 3PC2A 1QV9A 5FHRA 1KO7A 3U3JA 3X1ZA 3WWDA 4FMPA 5A02A 1DEXA 1B73A 1UCFA 1WP4A 2PZMA 5MGNA 4XIIA 3JWHA 5F4ZA 1BX1A 3MLEA 4J94A 1YO6A 2WM3A 2D0DA 5EGSA 3I28A 2NX2A 4EA8A 1XPRA 1JSCA 4LYAA 3QEMB 5EZSA 4M1YA 3TQHA 4NXNB 3SEAA 4ZVMA 4R1TA 2VPZA 2J6HA 4UOQA 4O4IB 1JR3D 2IEZA 3RRNA 3RU3A 3WLIA 1YT5A 2X0RA 3RTGA 2RAUA 2D5LA 4JOBA 4KSYA 1T3TA 4RVSA 4X92A 3V34A 4C7XA 2B36A 2BJWA 4BHTA 2BONA 2JLZA 1JBEA 4R81A 2J32A 1UR5A 4GC5A 3PJEA 2PBLA 1R0WA 4OK5A 2NUTB 3R7LA 3A3NA 1KJ9A 4WCVA 1ISSA 2A33A 3L1VA 1POXA 3EBOA 2ZS8A 3L18A 4BLTA 1PW7A 1NA5A 5L7YA 3BS4A 4JVOA 1TQHA 4F6RB 1Z5OA 4H7JA 1QVAA 2MINB 1GZ5A 2ZIWB 4RCVA 1LX6A 2FDXA 3QF7A 4RY0A 4D9CA 4OQEA 2B69A 1E6MA 4JI5B 3GJZA 4EMBA 1UBUS 1NLYA 2VJAA 4LGYA 2QRJA 4M54A 3EQ9A 2G3YA 2BI7A 1CFJA 4HLUC 4QOHA 4OJKA 5FTMA 1UBMS 2BFFA 5EJFA 4JT9A 3UWDA 1VRCA 2LTAA 4Z6KA 2F4VB 1C7RA 2Q3EA 3O9VA 5TMDA 4XGKA 4N5LA 1EJBA 1Y8RB 3RYFB 4RTPA 3A1TA 1U3TA 2CF6A 3K8QA 5DTEA 3TL3A 4N7BA 5EZ6B 5BXQC 1F1JA 1YSCA 1IZ0A 2ZEJA 2R751 2UXBB 3LNCA 2P40A 1ZGCA 2V7VA 4LFCB 4ZAYA 4BZQA 1WW3A 4YDRA 3GEBA 5TVGA 3K6RA 5HQTA 1X1EA 5DT9A 3EEOA 3JD4A 5DTJA 1IEWA 5CK5A 1VHTA 3HP7A 3O3CA 3OT1B 4EGQA 1EFLA 3AYZB 3DE5X 2P8JA 2Q1TA 3EWNA 4H0NA 1B16A 2REQB 3T5PA 1VG8A 1KNQA 4M22A 1OXUA 5FI1B 1NNEA 4O63O 1C7QA 1JB1A 4IQGA 3NATA 4C7VA 1XTKA 4FNAA 5CB8A 3EN0A 2PFSA 3D6FA 4F38A 3DUFA 2AYXA 2V3VA 2P3OA 4I3GA 3KU1A 2YNMC 1O0BA 1U0SY 1CRQA 2ORVA 2X3UA 2J3LA 1JNXX 4AJHA 3W2FA 2NSJA 2YIJA 3IFSA 3LYAA 3PEFA 3GH3A 9LDBA 1Z0FA 3DCJA 1Q7CA 2YWJA 4FP9A 3TSCA 3WB9A 1CXZA 3TL6A 3T3NA 5HNKA 4JP8A 2QN2A 4A16A 4IP0A 1JKMA 1Q6ZA 2C5BA 2XCUA 3ACBA 3LT1A 5IZCC 2ZJOA 2QEQA 1OFIA 5FWXB 3O82A 3U4HA 4EPRA 4EOGA 2V0GA 1JMKC 4TUYA 3GFQA 3K7EA 3Q3EA 1YVUA 4V0RA 1GZSA 4FD2A 2QQGA 3R9XA 3DEKA 4LOAA 4LXYA 3H5OA 1N2OA 5K0CA 1HYQA 4RVFA 3DOCA 1KAGA 2C2XA 2VPPA 4UZFA 1V45E 1SUIA 3RYIA 2A5DA 3IL2A 4S0ZA 2QTZA 5SZIA 2LXNA 1JR6A 3CQ9A 4HRVA 3OJFA 2MSKA 2BF7A 5AKXA 4URZR 1XUOA 1YE3A 4BEJA 4IIJB 1AHIA 2P9CA 1MO3A 4GWGA 2AJCA 4OGLA 1OZ0A 3EEBA 5DXJA 1V6AA 3MCZA 1G59A 3QENA 1CEYA 3ULKA 4TQAA 4DJEC 1PZNA 1XO1A 2VPTA 2VN8A 3A10A 3HCPA 3I72A 1CU1A 1E79D 1N8NA 2IUYA 3WKBA 4BLSA 4M0UA 3NAMA 3V7NA 3TOVA 3F7OA 1CQXA 2C20A 1Y3DE 3QFRA 2I1VB 2I78A 4M7RA 3F6PA 3SNKA 3MPUA 2AR7A 1E3WB 2DVMA 3E82A 5LXTA 1V11B 2ESRA 1YZVA 2PAFA 2Q41A 2XB9A 3JYOA 2NNLD 3NHSA 5I9TA 3DTNA 3SZGA 1DC6A 1MX5A 1YBFA 3I5AA 3NHFA 3DYVA 1LPMA 1MPTA 2H5IA 5HGJA 1PS8A 3QPWA 3HCWA 3EY4A 3D5EA 1AUOA 4FN4A 3ZV7A 4B2IA 1XE3A 2YZGA 4O6VA 4GKKB 1BCRA 5HDBB 2BL4A 4WY5A 4K05A 3QEOA 3KXDA 4QE3A 3UN1A 4EW3A 1JAHA 4PHFA 3B2QA 3NHRA 5K7SA 4MUHA 1MRZA 1VLZA 5I4CA 4RLFA 3EGIA 5LP6B 1P0MA 4PBTA 4IVQA 3CZAA 2JZOA 1HRDA 3PRJA 2BGRA 4ZQEA 4PYKA 4KGDA 4KR7A 2J3KA 4F9GA 1FX0A 3JWIA 1UBJS 1KEZA 2W37A 3A1VA 1J2TA 1FP2A 1KETA 1S01A 1X1BA 2GUGA 2WSSA 3OSZA 5K3DA 3TQCA 4HZUA 3GJTA 3HXPA 2YN2A 4WNYA 1ZNWA 4EJSC 5JQGF 3AR7A 3NP7A 3GPDG 5KDDA 2A5YB 2WD8A 3DT9A 3TG2A 1Z7WA 1HOXA 1Z38A 1DDIA 1BE8A 3GROA 4S24A 1JJVA 3D4PA 1USKA 4M0KA 4MHSA 2WWRA 3DFFA 1EVJA 2A3NA 3K30A 4WUVA 4IGEA 5DW3A 3TIIA 4HZGA 1ZHHA 5IZCA 3U7FB 4M1QA 4Z2YA 5G1NA 1SOUA 2GBIA 2WTXA 3WAKA 1E1MA 3H75A 3WIDA 3SJBA 5EHNA 3N2KB 4JR0A 2X14A 2XWQA 4XTRA 4MUIA 3FPCA 3OIWA 3DB1A 4LRWA 3GG2A 2XDPA 2A9RA 2TMDA 3BXEA 3NTOA 4FFLA 3RSFA 4CV2A 2BBOA 2JASA 5FTLA 2PT6A 1LSSA 2P9HA 4R98A 1LDBA 1LNQA 2WYUA 1GPJA 3WWOA 4HNGA 2WC1A 1Y34E 3EH2A 2DFNA 5LM3A 2VP0A 3QI2A 4CM8B 5I3CA 3IOYA 3HB9A 3PWSA 2DECA 3CNLA 3R3XA 2FQQA 1XZAA 3OJCA 3HDVA 4NOLA 1AGYA 2XWSA 1U3FA 3CZCA 1AE1A 4YAFA 1P2TA 1FRVA 4GZ5A 4IG4A 3Q85A 5PNTA 3NWBA 4M1OA 2D7DA 3L4JA 2FB9A 4HYYA 4R2LA 3SVLA 4X1YA 3LLCA 2AW5A 2EL7A 1Z68A 2WWVD 4B81A 1JBQA 3T7IA 4Z1OA 2BGTA 2J3MA 1V2GA 3B1VA 3JYPA 4GO1A 2OG1A 1LC3A 1VE1A 4H27A 4LI3X 3SLKA 3VX4A 4XQGA 1MTOA 3IT1A 2MSNA 1YVPA 3HLKA 3LNTA 4BN0A 4YP1A 2WSIA 4KAJA 3NOOA 3AKZA 4QTYA 2MYTA 1YXMA 2XF2A 5B58T 4MAAA 4PZYA 4QG7A 2H31A 1VFPA 4LV6A 2D1TA 3ONFA 4ALJA 3U44B 2IH2A 1I7DA 1U2GC 2YZ2A 4DEYA 3W79A 1EVZA 3ZWVA 5IBPA 1TZKA 1NSTA 4DXAA 4GLLA 2DZDA 1WMEA 2QR2A 2OXFA 2ZRKA 4ZZ3A 5C80A 3DE6X 3FX2A 4AS1A 4DEVA 2VJYA 1TGYA 2FWIA 3LCJA 2H5JA 5CIWA 5D51S 1W4ZA 1U3DA 2ZWAA 4JQZA 4E21A 4EA6A 4EJSA 3ZD6A 4G0MA 4GU5A 3OO1A 3WG9A 2O0HA 4RNDB 2RHWA 3NCTA 4IKEA 2QT0A 4HSGA 5B4VA 1L6IA 2VR1A 2YMLA 5TVKA 4H6VA 4GYKA 1TQ2A 2UUCB 4PYRA 1WNFA 4RADA 4WLEA 1AKQA 1YMUA 2JKVA 3B2EA 2AHOA 1QZZA 2A59A 2HT6A 5B2ZA 2A3RA 4AQ7A 3LKBA 5GVSA 4Y7CA 3MTEA 3FWNA 1UODA 1YASA 3LY8A 5TMBA 4DNFA 4H7DA 5IFKA 1RD4A 3KX2A 5CFRA 4WQMA 2XZLA 5IC4A 1PNOA 2QD5A 3OOYA 1JLLA 1SPXA 2IQIA 3CISA 2SKCA 4MV5A 4F6CA 2YYYA 2NP7A 4L28A 2GGSA 3P52A 1TMOA 1U9IC 2QE6A 4YT5A 1Z9BA 3K8OE 4WLUA 4HJXA 4E5SA 1N1MA 4FHEA 1DT3A 3TPZA 3WKCA 2FWJA 3FCEA 5B6IA 3SC6A 2GLXA 1GP2A 2J9RA 5EGNA 2JA2A 1VYTA 2NPFA 1HOTA 1PRYA 3FJYA 3P0FA 4JVMA 4E51A 4KQIA 2O8EB 1T2VA 1C50A 2GRJA 4RIFA 4ZU1X 3TGLA 3KEQA 4LGCA 1RTTA 1HF3A 5FFFA 3IAEA 4BB9A 5KVCA 1R4MB 4K9PA 3RIYA 5BV2P 4ZT2A 2R4TA 3DSRA 8ABPA 2TMYA 1Y1KE 3KLBA 1JW9B 3NS7A 1DLIA 2IVZA 4PFQA 4EJ2A 3H9CA 4TOIA 4AP9A 5IXJA 5ED4A 1Z63A 1L6RA 2CXOA 1E5LA 4IV5A 2OOSA 4PWYA 5CIQA 5K3BA 1N32B 5EJGA 3BXOA 2CJWB 3ZDZB 3L0PA 2H1OA 1WQ3A 3H5RA 3LKDA 1NVGA 3PQ6A 1OREA 3GLFE 1HR0B 2ZYTX 2WKPA 1G21E 3HZZA 1CUHA 5DLDA 5J23A 4NNJA 5KVQA 3QEAZ 2JAHA 4QL3A 4A8TA 1TZJA 1RZRA 1C7EA 3ZBQA 2AZ4A 4RXUA 1J4AA 1L4KA 3QBDA 1SWVA 3NCHA 4PSUA 3U1TA 3FTNA 1W52X 2X41A 4RD3A 5BWLA 3GU3A 4B3XA 1DLJA 3JD2A 1XDGA 4D25A 1QRRA 1N8KA 3G9ZA 3FTCA 1T9CA 3X1JA 1RU3A 4BNGA 4IGFA 3CX8A 3WLSA 3CA8A 1IJEA 3DA8A 3HYCA 3LBFA 1W47A 4CMAA 4BNJA 4C0BA 3QYFA 1RJEA 5BQ5A 2IIVA 3HWRA 1BA3A 1NNI1 1OU4A 1N5DA 2NUBA 3G8DA 1RXSA 2ZYVX 1SC4A 4A5OA 4Y2QA 4JBNA 2YC4C 1EXWA 1IATA 1W4RA 1ISFA 2JATA 3N39C 5AK4A 3WTBA 3GJ6A 4LIPD 4LV8B 5J58A 4QVKA 1OFHA 2Z57A 1U7OA 5KCMA 4J0GA 2AFIA 4UW9A 3RAJA 1Z0UA 5BR1A 1Y1RA 3IBYA 4EHFA 4J2TA 1EXNA 1Z4PX 3BB3A 4M7PA 3C7TA 3UHFA 3V8BA 1TAUA 1L3BA 2HADA 1S9HA 3G2OA 3ILSA 1MFZA 3B89A 3FZYA 3TOZA 3OC0A 1GKIA 3CJQA 3Q5DA 3A25A 3BGVA 2LKDA 5FA8A 2VA9A 3H9BA 2ZYWX 1U2EA 4IY1A 4RMGA 2ZBVA 4BVLA 1N3BA 4N82A 1R8SA 1WS6A 5JISA 5KQGA 4OOFA 4BLQA 4BUZA 5F52A 3K1ZA 3VPXA 5KYTA 3OPQA 4MYTA 2G1KA 1U9IA 1N6HA 3AOEC 2HSEA 4KQKA 4Y6GB 4EGJA 2V3CC 2C8VA 3QVTA 4O2RA 3VHQA 3QTLA 4PYLA 3W3AD 2D7JA 1XZKA 1P33A 4OLFA 1EXVA 4UCWA 5T4HA 5ALLA 4JI1B 4ZI7F 3EXG2 3RTBA 1LRLA 4ILEA 1C0PA 2Y1CA 5CYOA 5G0WA 2QTNA 1LSJA 4BQOA 1THTA 2OHOA 4ML3A 4NZOA 1YHYA 1BMFA 2FKAA 1F51E 4BMDA 4M1WA 1SPBS 3SLRA 2AUNA 2ZBEA 1OC4A 5A2GA 4B4WA 3LI2A 4XWOA 3X2FA 2BKAA 3BAFA 2FMTA 1QH1A 1S2LA 1ZC1A 2ZR7A 4KFCA 2C2BA 2Q2OA 2UZ1B 1WKBA 5AKLA 3DL2A 2FFBA 4MR9A 1DWUA 1S2NA 1YOVA 2IHYA 3PCRB 1T4MA 1PSZA 5BUCA 3EQ8A 2JBAB 1S8NA 1SOVA 4MWTA 4S35A 5DNUA 4TXMA 2CNBA 3VR4H 1NVEA 3KSUA 4AKIA 4KSCA 4WCFC 2ZVQX 3BFXA 4I14A 1B0AA 5U9CA 4WN3A 3TAUA 5B7QA 2I76A 4W9NA 1YRQA 4Y9TA 4QSMA 4H3VA 4DSTA 7REQA 3H6GA 3OZIA 4KR6A 3NEPX 4DPMA 4DQXA 3SAJA 2WJGA 4OJQA 5JECA 3PUYA 4D57A 3ZZUA 1XDSA 2NT3A 2UZ4A 1QGAA 5M3BA 1LEHA 3RYCB 2FAXA 2XNKA 2ECFA 1JHUA 5HTKA 1D4AA 1K63A 3S0JA 5LNK1 1CE8A 4Y9RA 4I9GA 5E9QA 1Y7TA 3TFWA 2G5TA 4RZHA 1E4OA 2NIPA 3PITA 3AWDA 1IAVA 1RKXA 1HA3A 3GNQA 3ZCVA 4S0XA 1T1EA 4O4LA 1JU9A 2XUAA 2C31A 4XI9A 1IHUA 4LDNA 1L5VA 2OCIA 4MUFA 3KSAC 1KWGA 2BJHA 1PF7E 2MM2A 2N75A 2Z09A 1V1RB 4MR7A 3RV4A 3CH7A 3K0KA 2O7VA 2Z1DA 3O8DA 2CYCA 4J03A 2DFDA 2D5CA 3EFEA 1RRGA 2V98A 2XW6A 2YNMD 2AN9A 4TSFD 4WPGA 4BZWA 3VKHA 5COBA 2J3IA 3QYJA 5AJHA 4D3ZA 3EDYA 3GDOA 2FFJA 4ZZ2A 4E1BA 2EW1A 5IULC 3OFVA 2W58A 4BECA 1ACMA 1X7ZB 4R84A 2PE5A 2F8TA 4KH1A 3EG9A 2NP6A 1T3SA 1XVTA 3PLNA 3CTPA 3RIGA 2VCHA 5IFLA 3JRWA 4TXLA 4QLOA 1M67A 3K2QA 4PN3A 2Z6UA 2FLKA 3CNHA 3LIIA 3MJSA 4N0PA 3TPCA 2UKDA 3VZDA 5JQGB 1Q2XA 4L5IA 4I1RA 4RQTA 3C5VA 4PO8A 3UYLA 1O57A 1VKZA 1N9GB 2G36A 3CR7A 5K1ZA 4XUEA 1G8FA 3CWCA 1CQJB 1PUXA 2XGOA 3QA9A 4R6WA 3ZV3A 5K6TA 1JEYB 1NQ5A 3RODA 3RW9A 4TZTA 1Z8HA 5AK5A 2GLTA 3IV7A 4Z49A 2P2LA 4XLTA 3L6CA 3T61A 1OC2A 3W04A 1UMBB 3FR7A 2JEOA 5FBWB 4RMNA 1WA5A 3DL7A 3LXMA 4EUNA 4GSKA 2R6CA 4ZQCB 3ONEA 3SY8A 1H66A 4X7RA 5EWJB 4C88A 3WLFA 3OZRA 4CT0A 2PQ2A 1FFDA 5HIJA 3SYTA 1UWVA 4CIXA 4EM6A 2C2YA 4FDTA 3EGXB 2QTRA 3V2GA 4QUHA 7ABPA 3KV1A 1G64A 3U9TA 2ZIAA 2YHIB 2G9VA 3ROQA 1PJQA 2B3DA 1X14A 2IP2A 3F4KA 1NQUA 2J6CA 3GR6A 3MWDA 1O8CA 3ZDXB 3GRUA 2Z2YA 4UDXX 3X44A 4LCBA 2Y3IA 1M2FA 2Q5OA 3Q2OA 3ZE0B 5MF6A 1M0TA 4RY8A 1PCXA 3KOYA 2FU5C 4BMCA 3AM3A 2GZ3A 3I0NA 4P4SB 2QG9A 3AFOA 3DTVA 3BMNB 1QYIA 4C0AC 1XSEA 2A1UB 3CZQA 1FP7A 3KVYA 4E70A 2F7SA 3LUBA 5BWNA 2IUFA 4JYZA 2V7WA 4ALLA 1BVYF 4PQEA 2JLCA 1NN0A 1DOHA 4TTSA 4NEHB 4Y9DA 3IHKA 1VFNA 2IS4A 3G7NA 2VF7A 2QP3A 3ACCA 3ZWPA 4LY3A 4EABA 1L8LA 3THYB 2ODEA 3HBFA 4ARIA 1N6LA 4G25A 4F4DA 5FNZA 1JKJA 2YJGA 2PEZA 5DMHA 1LX7A 2Z8ZA 3IQFA 3VI4B 1WDKA 3A9WA 4GI1A 5IC5A 3RU7A 3HNPA 5EPUA 4YJ3A 5IS2A 1N6IA 2EATA 4CYMA 1SXGA 3N8KA 4ROTA 1QE5A 3UG6A 4YQFA 1UFOA 5CA1F 5D86A 1X7DA 4O02B 5CD9A 3DKPA 1UJ5A 3T12A 3CIFA 5GGXA 1N4DA 1ZXLA 2X58A 1XMJA 1B8OA 4B7ZA 1HH4A 2WP8J 3ZHBA 1WWKA 2GA8A 2ZRQA 3REQB 3H5LA 4IDEA 3NKLA 2AR0A 2ZULA 1GAEO 2IWHA 3FVVA 4DR5B 1DEAA 5JWHA 2O19A 3GGOA 3BF7A 5LSAA 4LQLA 2Q1SA 4NMMA 1WMDA 4MARA 4MXDA 5JAQA 4D82A 1M0SA 5CAEA 1A9YA 1TJPB 2AMLA 3A6GA 2PS1A 3H11B 3LT2A 4LRQA 2D54A 4P4TA 1NXWA 4WK6A 1QVRA 2ZBUA 1FZTA 2A0XA 2QD4A 1TKRA 1XD2B 1I4LD 1NMSA 1PK8A 4LZPA 4W99A 2QAGC 4M49A 1Z16A 3CLVA 2NO4A 1OXBB 3LK6A 3N2GA 4R2HA 3A28A 1ZOLA 4KAFA 3VNQA 3OFJA 2XVMA 2YVQA 4ZQGA 5BUZA 6AT1A 4D9MA 2F1KA 4WERA 1T0UA 2XT0A 3RAPR 3KYIB 1PX2A 1T35A 2BEVA 2Q2NA 2X22A 3DAYA 4RVUA 3UGQA 4JIMA 1KARA 1ZK0A 3JQ9C 3LUGA 1ISGA 5JCJD 2OP1A 1UKVY 3V2UA 3TW8A 1QAOA 2B35A 4M0EA 2O2YA 4IIYA 3RFFA 1Y1PA 3HSKA 5IJ0A 1X19A 3TRFA 2O5EA 1VRWA 1RYBA 2J3DA 1DC8A 4G0NA 4XAQA 4ZT4A 3V55A 1FJ2A 3GCWA 1H93A 2PZKA 2J9GA 1OUMA 3VNUA 1T1RA 3HYLA 1HT1E 3KOWA 3FYUA 4FCCA 5CXUA 3WIBA 3ZX5A 5LQAA 2QY9A 1GADO 2BW0A 4LEIA 3PIIA 4KXFB 1A9RA 3F3KA 4RSMA 3RFVA 1DIHA 2FPPB 2PVSA 4URHA 4ER6A 2B4YA 2J4CA 3JALA 3I05A 5GONF 5EOVA 2ZPTX 4FQ8A 1K66A 1U9JA 5GLFA 3T5TA 1Y7LA 2D4HA 2QG4A 1C0KA 3DVSX 3I9V6 1R0RE 4YP7A 4KYVA 4QXOA 5IAOA 2YWGA 2QVCA 1JE1A 3ER8A 1KIFA 5T6BA 4ZT5A 4FDUA 2NVBA 1SHKA 1R0SA 4ZYVA 2E89A 2VF4X 3OZAA 2FK7A 3MWEA 3QQ7A 2XGSA 4EG0A 3ABOB 2WDPA 4LC1A 5GP1A 4RD4A 4CF3A 2GBLC 3PEEA 4JGBA 4LRXA 3EPRA 5JOQA 6REQB 3HVIA 3HUTA 2VUTA 4TRNA 3VR3A 4BFZA 3JQDA 3NTQA 3GLTA 4X3CA 2XXBA 5YASA 3IILA 5DF1A 2DUUA 5HWSA 1J8FA 5INTA 3EDRA 3DXFA 3TVTA 2PUGA 2NN3C 2IYQA 1BN7A 1B00A 3R7SA 3W8DA 5C4MA 3ZGYA 2X5NA 1AH2A 4FU0A 1UPBA 3DMYA 2MIIA 3WJ2A 3ZBPA 1GTSA 1DG9A 3KXLA 4XARA 5DTIA 3EPLA 2WIKA 1SWWA 3ZS8A 4AY4A 2EIXA 3WISA 1MVLA 5TS3A 5AW0A 2WLSA 2BEWB 3AF2A 1RBZA 1VE6A 2G08A 2XYQA 1EI9A 4OFZA 2IYNA 1VLMA 3A4TA 4Q1AA 4GBJA 3V6LA 3TRJA 3GJQA 1QHHB 2J1LA 3P94A 5AQEA 3A6KA 4EG7A 2QRUA 2R65A 5IX8A 4WOPA 1FNDA 4GHWA 3ZQKA 2HIMA 4PIMA 4FJ1A 1L4NA 4KNVA 2JGLA 2OD2A 4CM5A 2PZJA 3IIKA 4X1KA 5DULA 5ES3A 4BOYA 2HQBA 1PWXA 1XV5A 3Q1LA 4U63A 4DGSA 4NVRA 3KL4A 2HBYA 3EXIB 1FTSA 4PR3A 4MVJH 2X4LA 5CVUA 3DLBA 1GLVA 1KOJA 2I2BA 1Y0BA 1ESZA 4NH4A 2YXEA 4FHFA 3EGVA 2F3TA 3BRCA 2AJTA 4OQXA 5KTSA 1NR1A 1W0CA 2O2JA 2XMZA 5FI3A 5TSDA 1KE2A 3ROGA 1VA4A 3TUJC 1Z5NA 1O3YA 1PWZA 1H8ED 2FPXA 5ARCA 1KI8A 3SZOA 4IV0A 1GAWA 3BE5A 1LF5A 4HP8A 4XGNA 5IBRA 2CC2A 4ZDIA 4OHCA 2R44A 4BVGA 3ZLVA 3LPDA 4KPUB 2MR5A 5IARA 4BO3A 1TYCA 2NZUG 3MJCA 1V9SA 3QVGB 4M0LA 2QP9X 4PZZA 4PG6A 4C08A 5DNVA 1QCZA 5A6SB 2EQBA 3HVRA 2PYDA 5HP4A 4XPIA 3KQVA 4I4LA 4EG3A 4JI8B 1QS0A 3C4JA 1TZMA 3TZLA 4FGKA 4A9AA 1DZIA 2IEGA 4YCDA 4URXR 4FKMA 5IAJA 2QYSA 3I09A 1ZJWA 2NVUB 1N5RA 2BFCB 2XBLA 3DAHA 5CLLA 3MILA 4BVJA 1FVHA 2J0SA 4IIVA 3LY5A 4K88A 1LA2A 1TCAA 2AYZA 1YRBA 2EXXA 2VPXA 4WNAB 2AK3A 1CY1A 3TXAA 2XUIA 2XGMA 1F6BA 3O7MA 3NANA 1Y48E 1CUFA 1KFJB 1Y4AE 3M4JA 4X6UA 4C06A 1Q5PA 1ZH8A 1CWUA 1ZRHA 5BNFA 3A2NA 5HM6A 4D4IA 1XTQA 2QE7D 2WVJA 2VDQB 2QI9C 4NZPA 1DP4A 4RSHA 1H2BA 1WSBA 3BMOA 1TK9A 5ICGA 1I94B 4Q7MB 3L7IA 1PL6A 2WHEA 4X94A 4MQ5A 3TSOA 1TMGE 4B6FA 1OE0A 3AV3A 2P4SA 3FR8A 1A9OA 4UNRA 2O7RA 5F3RA 3ONVA 3ONWA 2EBUA 4TKZA 1GG8A 5M04A 3WMRA 4BFWA 2DY0A 1X1CA 2OBMA 5KPDA 1ZOIA 4N18A 3B3AA 4KYIB 2P3LA 1PG5A 3CR3C 4D3FA 2QPOA 5DH9A 4LFBB 3HCBA 5LKRA 4IH4A 3R6LA 3KSRA 2XE8A 1S1CA 4M38A 4MIEA 2HA0A 4F1WA 1U9CA 2EX1A 3DZGA 5BWMA 2ZJ8A 1QPZA 3FNHA 2JFBA 3EH1A 2NW6A 1KMHA 1UBRS 2GHTA 1W93A 4ND8B 3TS1A 3WFIA 3PUXA 1Z33A 2DKFA 1N0WA 4L4RA 1A8UA 2BHNA 121PA 1IU9A 1F3LA 3A1FA 4HBZA 1BRMA 3KZOA 3I2FA 4JBLA 4REOA 5C32A 1YCDA 3AF3A 4DMUB 1P5ZB 4X93A 4NEGA 1PK7A 5DYNA 1FBNA 4D26A 4FYJA 3OU7A 1MAWA 1XQXA 1YRWA 3LBAA 1PV2A 4DLLA 3TSZA 1T1SA 1E1YA 1RAEA 3WXBA 5JCOC 3IUBA 1VGQA 2RJNA 4BU1A 1IOZA 2QN7A 3KOXA 1YS7A 2DTXA 4S1OA 3VZCA 2WYVA 3KWLA 5AJUA 1T2UA 3SBDA 3LG2A 2C58A 3A36A 4Y8VA 4OI2A 4B75A 4D8UA 5L4SA 1SVIA 3H2GA 3WGTA 5KYNA 1SY7A 1DQYA 3K1TA 3RC7A 1OGIA 3WQQA 4RJKA 3AZQA 1R64A 3UHJA 3WICA 1FTYA 4QGGA 1TPZA 4R7TA 4W5TA 2EKDA 4PHGA 1C8KA 1R9GA 4D81A 4EGSA 3BMQA 2QRMA 3D6JA 3RLFA 5I9LA 1EXDA 4JEMA 3LP6A 3GDGA 3MBIA 2VHJA 4HB2A 1F7VA 4ZAZA 1WNTA 5IEBA 2RHBA 1KJZA 4HR7A 5AI4A 3F5FA 3EY9A 1GWNA 3TZKA 5HF6A 1WOYA 2OHGA 3ET4A 4UMFA 1FU4A 1W76A 2OBYA 4AJ9A 1M2VA 3JD1A 3KU4A 3NM4A 2YWRA 1VECA 4MUEA 1ULTA 5L3SB 3EQZA 3L0IB 4FHZA 4JLVA 5GVRA 2JFNA 3INNA 4GMXA 4TMTA 1W88B 2KM1A 3JSAA 2D74A 2R6DA 4RIGA 3SHQA 1UF9A 2PLWA 3HXQA 4B2LA 3H18A 2F62A 5EY5B 3PXGA 4CEIA 1ZP6A 2HWXA 2UZIR 1CERA 2OCAA 1HMYA 2VP4A 1T8WA 1KSHA 2V3WA 3DE2X 1N57A 3BSWA 3DH0A 3HA2A 3EPJA 4X8MA 4TTVA 3U7QB 3FRJA 5I7RA 2CMFA 1VG9B 4AICA 1Q12A 4V0NA 2VYND 1TO2E 3HWX1 3A6JA 3MSXA 4ZKEA 3R8CA 4CMBA 1DV2A 2Q5HA 3B6EA 1KDTA 2NZ2A 1MLDA 3T1NA 2UXCB 3UXYA 1ULUA 2GILA 1ZGHA 2HA4A 1PUJA 3OZSA 3UUGA 4PLYA 4UOZA 3L0YA 1K68A 2M9MA 1Y89A 2OY0A 5A7HA 4KDFA 5C31A 2IQ5A 4H35A 5ALTA 1AQ6A 3GFVA 2EV9A 1B6SA 3MC1A 4L8LA 1PQ4A 2J6IA 2JA1A 2OE2A 3A9UA 3MTQA 4JELA 4LJLA 4P34A 4P82A 3OCZA 4TWZA 5CG2A 4KFTA 5DTRA 1NUAA 2I2WA 1MVOA 3RJ5A 2R6HA 4AZ0B 5KYGA 2HZ7A 2P0AA 1L5GB 1MAHA 4OHVA 4R7GA 1KK2A 2X40A 5SICE 1OWNA 1MRNA 3Q6NA 4L8FA 3SSMA 3USES 4F21A 5K0NA 4LRYA 2C4NA 4MLCA 4RHUA 4CEHA 4KE8A 1WXDA 5C8DA 4K1XA 4LCJA 3UMVA 5EIFA 2R79A 3LKZA 4IKPA 4QYWA 3NTVA 2C0CA 4TS9A 2PX3A 2ZJ2A 3LPAA 3NC4A 2A7QA 3PL5A 4QG3A 4BDSA 4Q93A 2CL6X 3LDUA 5D5QA 4CM4B 3GI1A 3NJ4A 2DBYA 4DB4A 3FMFA 3SFTA 3KV3O 2AXPA 3CLKA 1BHJA 2VYVA 1UC4B 3DDNA 3L8YA 4MGYR 5GWXA 3WHKA 3JXEA 4RZQA 1UEIA 2P3SA 4MITA 3ZJUA 2FOXA 1EX7A 1K0FA 1HLGA 2DLNA 2JIDA 2WHXA 4IHJF 4PRZA 3SHTA 3KQKA 4LF7B 2DTDA 3QPCA 3NBZC 1E2PA 1OT5A 1X2EA 1LWNA 1NIPA 4E3ZA 1BVUA 2VUUA 2YXNA 2I67A 2HQSA 3EZYA 1LUAA 3GLHA 5ALSA 4EPTA 3KJQA 4IUBS 2GYUA 4F56A 4FQ5A 4DCPA 3QKRB 1M2GA 1PUIA 4N6NA 4CLOA 1NWCA 4DZZA 4XGRA 4YFYA 4KIWA 4QOSA 4CTNA 3BIOA 4NFHA 2O1XA 1I9GA 1JPNA 1VGVA 2HEIA 4DIUA 4C4RA 4HD8A 2BE9A 1E1KA 5BN5B 3GXOA 3UB3A 3ESZA 1JDNA 1UP4A 3G2MA 4IEEA 3BDVA 1KQGA 1JYSA 1Q0QA 5ARBA 4XFDA 1M2JA 4ND2A 1Q1AA 4O4HF 1SQGA 5H59A 1WDWB 1ZUD1 4Q1FA 3K53A 3RSLA 4C20A 4KQHA 1U2PA 1QIKA 4Y6OA 2VP6A 1DJNA 4AUEA 2ZFUA 4I4CA 5FOXA 2DWUA 2CD9A 4IQ0A 1LQ2A 1XRSB 2REBA 3BMCA 3QHAA 4F8YA 3GZNB 1O95C 3K4PA 3NAQA 1GCIA 3MVEA 4OLHA 3HGQA 2GHIA 4ZZIA 4FWIB 5GV8A 4D43A 3EMVA 4IJMA 4YI3A 2BEJA 2UZ0A 1RE1A 1P4SA 2UYQA 1U98A 3SI7A 4U9IS 1MHPA 3EQ7A 1YNOA 3HBMA 2IYEA 2VUIB 1XAGA 1KH2A 2QAIA 3LUHA 3WBJA 3C1UA 4LHZA 2BBSA 5LJLA 3F1LA 4DA7A 2BBTA 1DINA 2E1PA 4QX6A 5H83A 2FUCA 4B7UA 1SFRA 3K0AA 2QLBA 2DFTA 3CRQA 5I6DA 2AJ8A 3GRZA 3PHLA 1TTPB 4G0YA 4CN9A 3D81A 3CGGA 3F3YA 1MX1A 1XC7A 4AYXA 2C7VA 3K2BA 1CNEA 1E6CA 1NF9A 1S2OA 2QP4A 3EW7A 3QKWA 4G1MB 5FA5A 4ZCTA 1GNVA 3EUAA 1WPGA 2X9VA 3PUZA 1J06A 4WSOA 2W2LD 3MS7A 1IBRA 1WD5A 1QP0A 4BO4A 4ZEWA 1AUQA 2Y1WA 3U3RA 2GCEA 4JQSA 2D8MA 3S8MA 3HHEA 1I6KA 2JI6A 4HDNB 5EIWA 4AD8A 4X63A 1T6XA 5HQ3B 5L95A 4PO9A 2PX4A 1B8NA 2XQJA 1Z22A 3DPSA 3LVRE 4MS3B 1WZ2A 2IOHA 2VIIA 3ADKA 3Q5GA 3U1BA 4HRAA 1BOOA 3FOBA 2OCKA 3F47A 1D2AA 1F14A 1PG0A 4BWGA 3FD8A 1QHSA 4YS6A 4EEKA 5HKKD 1CB7A 4DLKA 2WEKA 1M34E 2YUIA 4HX5A 1MQ8B 3AHCA 3BPSA 5CP8A 5TR9A 2R8BA 1KPHA 1SCUA 2X19A 1ZD2P 4R9UC 3H8JA 3QG5A 4DGQA 4PAGA 4EWLA 3R3WA 3UW3A 4R1UA 3CUSA 3Q2IA 4ZK6A 2WIJA 2Z9CA 4K9RA 4S1NA 4X6XA 3LFHA 3Q3VA 4B3RB 1OYWA 4XW2A 1ICEA 5FTNA 1L7AA 3QLJA 4K26A 2IZOA 4S1WA 4N41A 1HPLA 4G65A 1WW8A 2EBHX 3PPXA 4TL6A 2HYIC 1JKFA 1WF3A 2FSVC 2DE0X 3I12A 1FPQA 2FFRA 3PNOA 4HNAB 1FSZA 4KACA 3ZTYA 3KT6A 2GF0A 2OL4A 3THOA 1E9RA 3TECE 5DHFA 4DVJA 3DMFA 1MRSA 3BQBA 3ZCQA 2HDNB 1P72A 3FN4A 3SQDA 4UVEA 2HYDA 2WVGA 3VC2A 1OWLA 2O57A 2XF8A 4P08A 3OX3A 1NZFA 5DYYA 1I4EB 3G2HA 1NM5C 3LLVA 4AUMA 2YQ4A 4H9GA 3ENVA 2OVFA 1CSEE 1KI4A 2IXEA 1VKJA 1LTHR 2A84A 2IEDA 1NVWQ 4ITUA 3RWMB 2C78A 2CCKA 2ZB3A 1V1MA 4LVOA 1VCOA 1XLTA 3SC4A 3U26A 1XMXA 3HP1A 4DUPA 4YJ2A 4IDHA 4MROA 1G8AA 5LVAA 2GO1A 2QT1A 4D7AA 3HCOA 2ASEA 5F1KA 3T5BA 3UZUA 2HSZA 3ZV6A 2PKRA 3M6LA 3ED5A 3MWGA 1M2KA 1UBOS 5JSZA 3FTFA 1SVNA 4M87A 1QYCA 4JP1A 3ZG6A 4DLYA 1QU2A 4CMIA 4JUDX 5KWSA 1LNZA 1RWKA 4K6GA 5AFSA 5HZHA 1AS3A 4D0LB 1KSGA 1YF3A 3ZHSA 4JLDA 3WK6A 1CQIA 1KPIA 5A04A 1G60A 4ZCSA 4HK4A 2GXAA 3KHUA 2ZG6A 1YC2A 1HZZA 1F9AA 1RVDA 1CJBA 1E99A 2FR1A 2GTIA 3DYIA 3LQ1A 4O08A 1O6GA 2HMYB 4ZVOA 3U4AA 1OHHD 3A9CA 4KQEA 5J4LA 2EEPA 3F73A 5F9HA 2MTBA 3NWOA 3PZBA 4F84A 2PMDA 3QPBA 3TIWA 3T3OA 2FZGA 3E9YA 1XWWA 4E2ZA 3KNZA 2QTVB 1CY8A 2DCMA 4FEYA 4P7GA 4BNNA 2ADMA 1EFVB 2C04A 2BGNA 4CZ2A 3MCWA 1XCGB 2PL1A 3MTDA 4YR9A 2B8TA 2ZSAA 3A4LA 5JJ5A 3AFMA 1YL7A 3L49A 2HJVA 4C7MA 4HN9A 5I45A 1R9JA 3TTSA 5EPEA 1JXQA 4WZAA 3BE6A 3R1IA 4PZ0A 3K9BA 3VTFA 3C3XA 3T54A 3S55A 1EM8B 5AYVA 2RGXA 2LIPA 1YVDA 3D0RA 3ICPA 4GWLA 3CW8X 4MRSA 5JNRA 2IBTA 1QP4A 2I2AA 3GUUA 4J6FA 4WLFA 4DDVA 1A4RA 1S2IA 1B3RA 2BCGY 2YWHA 4Y6QA 3UAYA 3KM0A 1JEOA 1CDDA 3VC3A 3IOEA 4XR4A 1MIOB 2GAIA 4OA8A 1JLSA 1PNTA 5DO9A 4G5QA 2ZSHA 3W9SA 3WNVA 1RABA 1GKYA 4RLSA 3DOHA 2E55A 1MIHA 3GFFA 4EDHA 4L1KA 2OV8A 4LDPA 4CDNA 1SHUX 2GWRA 4UPVA 4BMXA 2AOVA 5BPHA 1ULAA 3JQBC 4JLSA 3HVHA 4IVPA 3MCUA 1QAQA 2HO4A 2C4MA 4G09A 3RWOA 3QELA 4CKCA 1AO3A 1DI0A 1WHTA 2I8LA 2FSSA 1BX0A 3QVLA 4Y2GA 3VI3B 4F5DA 1V2HE 4FLMA 3HXTA 1V8ZA 2QVBA 4U7TB 2ZJFA 3FHTA 4B0PA 5JMWA 2K2QB 2JKYA 3D59A 2DMRA 2EFEB 4MEBA 3TVDA 3RUIA 4P7KA 4BJ3A 3Q11A 2B3TA 1K8YB 3GLRA 4FKZA 1MAVA 3GIWA 5E6RB 4L0DA 4PZPA 2I54A 3O8OA 4BBPA 4CGYA 1J7JA 3JR7A 5CPFA 6CHYA 1EPUA 1J90A 3RVQA 1CR2A 3DCNA 2G9RA 3P9RA 1QC5B 2OESA 2RFLA 3GDFA 2GK6A 3C14C 1D6NA 3W2TA 2GFQA 3N6VA 2G5PA 4DARA 4U8GA 5EPPA 3E7FA 2O8CA 3E6AA 2PKXA 2JZNA 2O06A 3DG9A 3FGPA 2P79A 4WN9B 1XMOB 1M8PA 4MI9A 4QVGA 3OTOB 4ZANA 1M6YA 1V8PA 2DYKA 4HH1A 3RKSA 2F55A 1U3WA 4ZVRA 3G0HA 1XFDA 1QJ4A 1L5SA 2QRHA 5DPMA 1AA9A 1AQUA 4RVGA 2Q1UA 2Q45A 5FBQB 4INJA 3BJZA 5EVCA 3R5FA 2JB9A 3QHQA 4P3KA 3T5DA 4B4KA 3BGWA 1X8KA 3KTAB 3OLZA 4BGEA 4FFWA 1GUYA 1O1YA 1ODFA 3FOFC 3G0BA 2GJAA 5DYIA 2C84A 3VVCA 4NBWA 1LW6E 2M32A 5C5DA 4HG2A 3OZWA 2XVYA 1R0ZA 5A6VA 3K94A 4OFWA 4A0FA 4ACAA 2HAEA 5F2EA 1XZNA 1JTFA 1SU4A 4MKZA 4XRGA 2XUHA 3M9XA 1IOWA 3AP2A 5AI6A 1L1EA 1TF7A 2DKOA 1PZHA 4ZOBA 2HSGA 1XDWA 4DIFA 4LA4A 1U63A 3MIIA 1FX1A 3K32A 3UC9A 3MINB 4EB8A 2ZJ7A 1EK0A 4IHJB 2OXTA 5DK4A 2JLWA 4MIOA 3ZQJA 1ZK2A 5T4FA 1G8HA 1QCCA 2RC6A 1ZJ4A 3E70C 2AG1A 4WXPA 4AW9A 2IYAA 2L69A 2PUDA 5BY2A 4YO8A 1XEXB 3KQWA 1FUEA 2WU3A 3NNNA 4GMGA 1JEAA 3N0RA 3LHSA 3KSZO 1S2MA 3RSGA 3HUUA 3IODA 1TCBA 3E2PA 1E1QA 3T9FA 2L2QA 4KQ9A 5JS6A 2O3TA 5ENZA 4LJ5A 5EJ7A 4JUAA 1V47A 1ZM9A 3V8NA 3RS5A 4NG5A 1XTVA 6Q21A 3JASA 3AVQA 1ESMA 1K5DA 1BSVA 1K6MA 5TQ2B 1QH0A 4QBIA 2YYAA 1H6CA 1UIMA 3D4IA 3NXKA 1GGNA 2B7CA 1ZH0A 4O4HB 4P6VF 3Q8KA 1SBCA 2B9VA 4ALMA 1JE0A 1FE8A 2GT1A 1R8JA 4IEFB 2P2CA 4M6WA 4NBLA 3F8WA 1JBKA 2C92A 2WU4A 3H4VA 5FBHA 1EDZA 3W8FA 3IS3A 3EW9A 2BOVA 2BIFA 1YTLA 2R3SA 3A6ZA 3BN3A 4JROA 5JE8A 2A2ZA 4UM9D 2JNWA 3VO8A 4DM7A 1QIJA 5ITZB 1KGSA 2ECQA 2JEYA 1VXOA 2FPWA 4G1UC 3WGQA 1XI2A 5DGDA 3HS3A 3NQ41 5AW4A 5BT9A 5LOVA 2VSQA 2YW2A 3RAGA 5KI6A 1G4AE 1B0UA 2Q6KA 5DBEX 3OJXA 3UEOA 4F9EA 2C54A 4KX3A 4YRZA 3W3ZB 3NHUA 4ZOCA 2YOFA 3H1FA 4O29A 2X0DA 1WZEA 1T13A 2Z6AA 1M1XB 1Z62A 1GPUA 3AUXA 5JYDA 3T5MA 4OY3A 4KO1S 3CCCA 3HNRA 4TQ9A 3VKWA 4UMVA 4LX8A 1PV4A 1QVZA 1V71A 2Z1NA 3CGWA 1N34B 2LCQA 5IYZA 3EGWA 4XVHA 2RGWA 2XTAA 1NKTA 4Q15A 5F76A 3MAJA 2Y4OA 2B30A 2EKBA 1EVLA 4L8YA 2R8YA 4H3SA 5AXDA 5MN5A 1CQZA 1JQJC 1DTWA 1SA0B 4BFCA 2O6LA 1CDOA 1W2GA 2BFPA 2JGIA 4HBGA 3WLKX 3R9WA 1LZLA 3FPBA 3KYCA 2OAEA 2R7NA 5LYYA 1I33A 2IYWA 1HDZA 5K8TA 2ZDGA 5KNLA 4AT1A 2EFHB 4RHXA 1U7TA 1R8QA 4ITRC 3ABZA 1M6WA 4G6ZA 1C4KA 1MORA 2O2ZA 1BXRB 1SQFA 2FPOA 1USUA 2IXGA 2V45A 1E32A 2PVCA 4L4SA 4GL2A 2OCDA 1IZ7A 3IR7A 3AL0C 1OXMA 2C9YA 1ENYA 3RFCA 4QAJA 3KHKA 4WFKA 2B0JA 4Q4JB 3P0JA 3HY6A 4RS3A 4CQMA 4EEZA 1I3OA 5D6YA 2V59A 3JW8A 1Y82A 2PGAA 3L05A 2XOEA 2XUFA 1VYHA 1QIEA 3TGPA 3H99A 2WY2D 4L3OA 4LSMA 4Y0AA 4FQ7A 3LOQA 3M2TA 1H2YA 4R31A 2IELA 2XIQA 2W6QA 3NWPA 4PYIA 2AUMA 1DRKA 1G42A 2DJIA 1QVVA 3QV2A 3HPRA 3F2IA 4YQYA 1FQOA 2J4FA 2MWMA 3VNBA 1O95D 1VJDA 4IRXA 2CK3A 4D96A 2IDMA 5TARA 1KDVA 2I99A 1LDMA 1RW4A 1W0KA 4Q02A 4QBKA 4ZDJA 1WPRA 1ZCZA 4PX2A 1MQAA 3L04A 3WGUA 2NTEA 3GJ0A 1TLLA 1X74A 3UK1A 1KQPA 2XXAA 2Q4RA 1BS1A 1NV9A 2WJ3A 4PG4A 2RH4A 5CB4A 3IMFA 1D6JA 5HCNA 5D7BA 1EGAA 3COPA 4C4PA 1YQGA 4DUZB 1I4OA 1T10A 2E85A 1CDZA 3ILXA 3UCEA 5AO9A 4Q24A 2YZMA 2QGZA 2PK3A 3OZEA 1BDMA 3WGJA 2C3YA 5F64A 2XQIA 4CHGA 4I81A 4MS4A 3PNPA 4QM6A 2GN0A 2MJLA 4FJ2A 4BRZA 4EI9A 3NDBB 4O0LA 2HBQA 3ZC3A 1H8HD 1SEVA 2H2GA 2P6UA 1XEWY 3PU6A 3SU8A 2HDOA 3W4JA 1J09A 1DCMA 2ZITA 4KN6A 5GAJA 3OAAA 1O6ZA 4KMRA 5AOAA 4B85A 1KJWA 1L9KA 1ATZA 2AC4A 2I3DA 2I6TA 3M6MD 3TQFA 5HCIA 5EJ5A 3PK0A 1FJXA 3PC7A 4X1IB 2P2YA 1LDNA 1QGUA 3OG9A 1YI1A 1IJBA 1YC5A 1PW5A 4XWTA 1ETHA 1KYTA 2OO7A 5CT6A 3W9BA 4EI8A 1TEVA 1QIGA 3O2NA 4WNIA 1U1CA 3X2EA 4NBNA 4GECA 1NDUA 2QRNA 3CY6A 3GT7A 2IUUA 5JHGB 4KDEA 1GRNA 1OLSB 2ISQA 3NC1C 4JLMA 3JD0A 5LQDA 3R44A 3DO6A 1R18A 2QI9F 3AJEA 5CVVA 4MJXA 1V7ZA 2I9KA 1M74A 3HXMA 1ID8A 3D6MA 3I76A 1LTKA 2ZSDA 1TQDA 4Z9FA 1MB2A 2Y99A 3K0FA 3HCAA 4YAUA 5HKBA 1PQUA 5GJBA 2J5KA 3FMPB 4DYDA 4OLJA 4TLCA 2VRBA 4EJ6A 2QTLA 4R8VA 3KQLA 1P29A 4FK8A 2GBFA 1T8SA 3ICOA 3TL2A 1Q17A 3UJBA 5THKA 4PQFA 4F1KA 3I6MA 1JWAB 4ENRA 1RC8A 4OA5A 3EODA 5SY9A 3LRXA 3U3XA 2QUJA 3HZHA 3DVLA 3IIJA 4KXVA 3IAS6 4HGPA 4OUDA 2Z2JA 2QBYB 1A9TA 1J99A 2QQSA 5JO0A 1TYDE 3QJYA 3AY7A 3PR2B 4EW6A 2GZHA 4Q00A 2VAMA 3CLHA 5ED0A 3X1YA 2I3BA 1K2VN 4HEHA 5FTWA 2IYLD 3WGGA 1T36A 2O7QA 5DP1A 1I14A 1K97A 3PFKA 2GN8A 4O4JA 1ZIDA 2WIBA 2F8MA 2V97A 3PGKA 5IXSA 4RYLA 2E6KA 1IHYA 2CUNA 3M1IA 4INPA 4ZDWA 5J2UA 4LFAB 1FYEA 3PTLA 2RHRA 2OM6A 1P7PA 4JH0A 2YYSA 4Y2HA 4DYHA 1JF8A 1W34A 2I2FA 4GG1A 4A2QA 3PQ4A 1KC3A 3DOJA 1QYXA 1NVFA 3GVPA 1UKEA 1YS6A 1RWXA 5I7UA 1FVOA 2H2HA 3EIXA 4UBKA 3K1YA 3R3VA 3F78A 2X23A 1SKYE 4G24A 4MWOA 3KJEA 5REQA 4YAWA 2ZVJA 3U4MA 4FOLA 1NHGA 1ONOA 2AZXA 4U2KA 3OJOA 4WZAE 1AK2A 3TJRA 5FV7A 4B3BA 4RVDA 4L16A 1DXQA 4R40A 5I7SA 3G8BA 4O2AF 1CJMA 2FR8C 4PLFA 5THQA 1ZMRA 3H83A 3RFTA 2GM4A 4QUKA 2A94A 1NF3A 1ZK4A 1J8VA 1Z25A 1RKUA 5K4HA 4RTMA 2DR0A 4XYMA 2FZVA 1HFKA 2X6RA 3GLGE 1SKBA 2VTVA 1VCNA 3O93A 1RFGE 3M83A 5FYQA 1MV5A 3SN6A 4N5NA 1GU7A 1XNHA 3RAFC 1UXKA 1WDLA 3CIOA 5EUMA 1E7MA 3ITNA 3NEYA 4HDSB 2B4QA 3FWYA 3HBNA 3MGAA 4Y2TA 3CLSC 2D13A 2NAFA 2IHTA 2LPMA 4LOLA 2D2IA 4TTJA 2Z5VA 3EDMA 3RUDA 5IANA 5CBKA 4ON9A 2QXTA 4P83A 4MQUA 1GY8A 4YV7A 1YB5A 4LDAA 4X6YA 5HF9A 4D9HA 3ZZTA 1GUDA 1P7ZA 1CZRA 2BR4A 2VWQA 3H5WA 1NYTA 4CFYA 2WNSA 2H1HA 5ES4B 1RCTE 4R01A 1TYBE 4JYCA 4YVFA 2D3TA 2JC3A 3ED1A 2F8LA 2PKQP 3QKSB 3GP8A 4YIHA 3SXUB 2W4IA 3WB0A 5HF5A 3ZYZA 2FP4A 2WFLB 4OPMA 4B2YA 5BNTA 3LZ6A 4LZNA 3R9KA 1TM4E 4IIGA 3AIMA 4BXOA 4HF7A 5FWYB 1W0JA 4G1EB 1G291 5CTAA 4BNIA 2FPSA 2OZPA 5DU2A 4D3SA 5JMTA 5CLIA 1GA4A 1MU0A 2DULA 2RCYA 4JJ4A 4M60A 4CETA 2OPHA 3K70C 2BMAA 3GVCA 2VDWA 1EHYA 4UNNA 4RIHA 5TQ0B 5E2AA 4X7MA 3UV3A 3FOCA 3W77A 5DVZA 1H2WA 4D99A 2ARKA 3BE8A 1NMXA 1TQ6A 4Y7DA 5F23A 3L46A 4YRSA 4IG9A 3A6EA 2P2ZA 1X9GA 2QLJA 1MC5A 1E3IA 2P77A 3OA2A 4XA8A 1DRUA 2WTMA 1GQ2A 1OGJA 3UCFA 1TMYA 4EB0A 2Z43A 5LQMA 5FOVA 1HC7A 3C70A 4F11A 3CH4B 3CN7A 3OTWA 4D8TA 4MV6A 3DBHB 1LVUA 3TCXB 3CB4A 4X45A 2VKTA 1IXZA 1ODKA 1W96A 2KB0A 1DJLA 3O83A 1GPDG 4L85A 4OQMA 4UULA 4YRTA 5JFGA 5DIFA 4QA9A 3N6RA 4QUIA 5DX1A 5IU6A 2XH8A 3UNXA 4RTKA 2H51A 3VR2D 1F0NA 4FKBA 4F9TA 2NU6A 4YRIA 2QW8A 1C1XA 4I8DA 3KUDA 3TDMA 1K88A 1TVKA 3FPTA 1LXCA 3M1YA 3PEWA 3QFFA 5KX5F 5G4KB 2ZJ4A 3BHJA 4MA4A 3W1EA 3SHFA 3ECCA 4HAYA 3B3QA 2BTEA 3WSVA 2A9PA 2PMKA 2IXDA 4OGKA 4BTLA 2DEUA 3ADCA 3LHDA 2O1EA 3ND9A 4B9EA 2ZRLA 2YJ3A 4CODB 2QY6A 4OQFA 3A26A 3SSOA 2HFJA 1ZUHA 3R4VA 4ZALA 3AEKA 4AJ4A 1HFJA 4FMCF 4DIKA 4WE3A 1WEKA 5KOHA 1E5TA 2IGTA 2M6LA 1JL3A 2PT5A 2JLRA 5BMVA 4BEVA 1CT9A 1EVEA 3ADPA 1W46A 4HNSA 3ZBTA 1BOFA 1UBSB 1SULA 4ODIA 4EKYA 2C29D 2HCJB 3H87A 2H1VA 3QWFA 5EHZA 2VHCA 3GLIB 3HWSA 4IZHA 5BSRA 5M34A 4JJIA 4IMPA 1P45A 1EVQA 1E2NA 5HMLA 1KDOA 4WKBA 2FFAA 1OWMA 3CRZA 3U81A 4HN2A 1KSFX 1Y3FE 1Z4MA 2XKAA 3MJHA 3VC1A 3O4GA 1Q0RA 2JARA 4B3FX 4I5EA 3J80A 2XYVA 1INLA 5AXAA 2OCBA 3SEQA 1HLDA 2H7XA 1EIZA 4KFRA 1FRZA 4QBHA 3WMFA 3ZD7A 2I1WA 3SMVA 1XD9A 1MA0A 1NBIA 2GD2A 1G8SA 1P9RA 2IUEA 2OUKA 3AVPA 3L92A 4PS1A 3O8RA 1L7EA 1P1FA 2XWJI 2I2DA 5AIAA 3W8RA 4ND1A 1HTBA 1Z6YA 1NOKA 3U31A 4EBBA 1CIJA 3IP5A 3CRRA 5CLQA 1HNWB 1UXOA 4DV3B 3BXXA 4F8JA 3GRYA 2AI2A 4RPJA 3DAOA 4KO4S 5H5JA 3WGZA 2QTHA 1NJ2A 4F91B 3COSA 3FF4A 1XZQA 3FCOA 4RSRA 4K6KA 2R48A 1AK9A 2VJOA 4FFOA 5EIBC 4OX9Y 1U5AA 2DPLA 3M49A 5ALYA 3TSWA 3AUJB 1LSOA 2R00A 3SG0A 2VT2A 4FC7A 3HU1A 4GPTA 5AJYA 1G3UA 2GPYA 2Y2VA 5BUSA 3O8QA 1HX7A 3ICEA 4B4OA 4PN7A 2WUFA 4RKWA 5DP2A 3UWSA 1T2FA 3ZOKA 5JNTA 4FFBA 3TW4A 1MX9A 3LWZA 3QEJA 4RPLA 2DRIA 4RKYA 4OK6A 4WIAA 3Q5EA 5EPOA 1M1YA 3H5AA 4Y2XA 3EASA 4K03A 4L5BA 4D9GA 5KB3A 4QGAA 4Y30A 5LUBA 2GAAA 2ZUDA 3K16A 3KOOA 1TCUA 4XWWA 2UZ3A 1J2YA 3IEVA 4KAAA 2WF7A 2QX4A 5BRAA 5ECWA 2JFOA 2G7ZA 1XKXA 4ND7A 3EOZA 2WZDA 4OIMA 5IVIA 1SXJC 3JZAA 4RLHA 4QARA 5DLPA 3WQRA 5LMCA 4PINA 2WTBA 3IVCA 3ROKA 3IQHX 2CL7X 4HNVA 3C3AA 3UAZA 3QQPA 4ENVA 2VS1A 1PGOA 2WJHA 3OBIA 2QN6A 4F5WA 3UWOA 4UTVA 4JBXA 2QPLA 2Y2UA 3IRVA 3TLYA 5BR8B 3D43A 2CL0X 3WLQA 1HQYE 3VHLB 1GVNB 2P2GA 2FX2A 1ANKA 4ONEA 4PE5B 1T15A 5MN4A 1BFDA 1RBQA 4JGGA 1J2RA 1KZ9A 4OU5A 1E4EA 3KYJB 4PFKA 3WSTA 4A82A 2DR2A 2EFCB 1BQ4A 5HJ2A 3TRDA 3V7UA 4MYCA 2G5CA 4TV8A 1LDEA 3K6SA 7YASA 4ARSA 1L5FA 1PBTA 4CLDA 1AF4A 3C3EA 4BKQA 2ZCJA 1VSBA 3BL5A 5BWCA 1GFIA 2OECA 1K9SA 5FLXA 2QOEA 4LTMA 1KNXA 4R7ZA 1ZVQA 4Y98A 4URYR 3U60B 1VSVA 3UMFA 2WTAA 2X8LA 3B1JA 1ODTC 2IU6A 2CBGA 1XCMA 2AJDA 3AJRA 4LZWA 2XNDA 1J22A 1RIIA 2ONCA 1UXIA 3VHRA 2Q1XA 1GYPA 5UKDA 2COEA 3ELWA 4KH0A 4BE7B 4QUAA 2C2HA 5IW8A 1ZH2A 1CUBA 4BO2A 2FKNA 5I4BA 4EB6A 4FYMA 4O2BA 2GBGA 1E5XA 1KI3A 3N86A 3IYLW 3L4BC 2HSWA 1P0PA 2JIMA 4H7HA 4RGYA 3RH0A 3DZIA 4AROA 3VNVA 3X1MA 1GZ6A 1RM3A 3MPOA 5EJMA 1DQZA 1MP0A 4MMYB 4YLYA 1C9DB 1GTMA 1NQAO 1TA0A 3G3EA 1P6UA 3KVNA 3WGNA 2X2EA 1RLMA 2Z2XA 2P2DA 2P91A 2O3SA 2VHWA 4WJLA 3CW9A 4DXDA 2Y27A 2X9QA 3P9IA 3G5AA 1JG6A 1KEEB 2YS7A 3E22B 1B41A 4DT1A 4RXTA 2GEBA 1RM5A 4UFPA 1I7PA 2V7QD 3D3WA 1DEHA 3MTGA 1A4XA 4XDZA 1UK9A 4FYPA 1MJNA 4KQXA 4JA2A 1E1RA 3TKAA 3CNQS 3WK4A 3K09A 4MW5A 1V3QE 1X7WB 4EHJA 1MTZA 4XUCA 4TTRA 2HA6A 5FH9A 4GOJA 2BSAA 2FG6C 1MBZA 3OICA 4ZYLA 5C5CA 5EZYF 1USVA 1WUIS 1ZN8A 4JFAA 3I1JA 4IZOA 2ZANA 2Q18X 3B3GA 1AMOA 1Z5PA 2HPAA 2XBMA 2CNDA 3ORQA 2FR0A 4HWSA 4PPGA 1YCFA 4NDZA 1TJYA 1Z6GA 1N3YA 4QXMA 4TLAA 3FTQA 2PT9A 4DCTA 1XMIA 4GM4A 4KIUA 3W8NA 1F8XA 2BP7A 3IMKA 4JP3A 1GQOA 2YVKA 4B09A 1NPTO 4EYGA 5GIOE 1FFXB 1FVXA 5BR7A 3WFZA 3KZXA 1QVWA 1WE2A 4CCWA 2E18A 1ULSA 2Z1MA 4LF6B 1OWPA 2P1RA 3DNPA 3NO4A 4LMPA 2CV0A 4G81A 2QRVB 1Z8DA 3V4SA 4Z8YA 1HG1A 2J3EA 4CLRA 1JFVA 4KWEA 1VL1A 4GOKA 3GJ3A 4HQRA 4LBVA 3EUEA 2H18A 3ZDQA 1ZM2A 4W5OA 1HM5A 2ECKA 2GPJA 2PZ8A 2BSXA 3VOTA 5EIHA 1FDOA 2CN1A 3BD7A 5FV4A 1IB0A 4ZEXA 3T7TA 1SZPA 3A1UA 5CLGA 4XOIA 1VLLA 3F8TA 3PF8A 1LQUA 1AGNA 1OTHA 3KJHA 4NHOA 2VLIA 4REQA 4LXUA 2BGMA 3PWTA 5LA6A 3MYRA 4CBVA 2ZETA 1DAPA 3OHSX 4NYMQ 5IF3A 1ML3A 3SOPA 4DCJA 2OCPA 1OT3A 1C7FA 2DT8A 2Q1YA 4QC2A 4W5JA 1SD5A 3CF2A 1Y3IA 4KO2S 2CDNA 2GESA 1QKJA 2X0IA 2YMMA 5EE0A 1D5WA 5ADVA 3ORRA 1RI5A 3R20A 2AN4A 4KC0A 1H9AA 1IOLA 3V7FA 4NY1A 3ZCRA 3VR4D 5TY0A 1C4XA 5KQSA 1UXJA 5G02A 4PLZA 5JQWA 3AF6A 3IHLA 3GJ8A 3VR6H 3I04A 4Q4LA 5EKXA 3WS7A 1UINA 2NM0A 4BQIA 1ONBA 1IL0A 3C87A 4HTFB 5BYBA 1SUAA 2GKSA 3I8OA 3MD0A 3ERCA 3NTRA 2H2DA 1H9BA 2HWKA 3IAM6 3IP6A 2ENUA 2VH5R 3PXUA 3VU8A 1WV1A 4DTIA 2BEUB 3ZHCA 1Y7IA 3A1EA 1Z2PX 1I8TA 3SD7A 2ECPA 5K9ZA 2VQ6A 5A71A 4PU0A 4DMHA 4MEJA 4RF5A 3VJLA 3EZFA 4C4TA 1PVVA 3A7DA 4J0DA 5CEFA 1YAJA 1IH8A 4IDNA 2YV2A 3I9FA 3L7JA 4M9XA 4OYHA 2JBHA 2ZT7A 1EK2A 4BV2A 1Z8NA 4MWEA 3FCSB 1VKNA 3KHSA 3UY4A 2VAXA 4RY9A 1F2TB 4NBRA 4ANFA 2JAPA 2QTBA 1WAMA 2RSLA 5FD8A 1KOGA 1K6IA 1YCHA 4DPLA 3VZPA 4E5YA 3C15C 1GTRA 2NADA 5HFNA 4PG7A 1N7IA 2P4HX 2VF8A 1QDLB 4UM9B 1SUSA 3FVQA 1BZYA 3RJZA 4LTNA 2OSVA 3I8XA 5GOTA 3UB2A 2XJ9A 4DSZA 3PKIA 4IHKA 3QVSA 4TM8A 2XCTB 1M2OA 1J70A 4HDAA 3VX3A 5L45A 1WB5A 4JMPA 4US1R 1QP8A 1UJ6A 1K06A 1UJ2A 3GOHA 1L8XA 3EMKA 1Z17A 3O9ZA 4MPTA 4OKIA 4WESB 4BTVA 3FMIA 4Z4HA 1N36B 1NBMA 2W2PA 3VPBA 4BLPA 3BDIA 3VOBA 4UFNA 3K5WA 2JCSA 2QJWA 1MMFB 1TOAA 5BO5A 2OCGA 2R7KA 4M9CA 4D92A 3L7BA 2VH2A 1ZMBA 1KR5A 3GV0A 4OREX 5KX5B 4D9NA 2C3PA 3CLSD 1MC8A 1TECE 2EFGA 3DZ8A 1GGKA 1LPSA 2V8BA 2X5XA 8OHMA 1WMSA 4LY6A 1XTTA 1XU4A 5CXSA 1VPEA 1XF1A 2XUDA 2VDNB 5B37A 3KZCA 3TD2A 1OZGA 3UG7A 4M46A 5JI2E 3VSAA 2XOKA 2XUOA 3SX0A 1NVAA 3BTUA 2VC2B 3OF2A 1IUNA 1QV6A 4W5WA 4XYBA 1J6UA 2PGOA 4RBNA 3T41A 2VDJA 3L01A 3D9QX 1HE3A 5IPFA 4A8PA 2EFDB 2R7MA 3VDRA 3ESQA 3K9QO 4RDHA 4EY5A 5E6UA 4NICA 1QNFA 1QTNA 2GBPA 4HDKB 2RHGB 4A73A 4UHJA 2IYXA 4D4LA 4TMKA 2E4UA 4M99A 3V2HA 2I2CA 4X3OA 2XRFA 5A9SA 2PJUA 2RGUA 4IIHA 3TLJA 1ECCA 3V1NA 3AIKA 1VHQA 2WV9A 2BHLA 3I2GA 4JHLA 3W78A 2LBPA 3NBUA 3I5XA 5TXGA 4CUKA 5C2JB 8GPBA 4GKJB 2E0IA 3Q6IA 4DNXA 4IJ5A 1DUVG 4OHFA 1Z5WA 3NBQA 3PTZA 4MNTA 4RTJA 2SKEA 3LC0A 2R86A 4Q0MA 1FBTA 2XLBA 4JLOA 3W5VA 4ZHQF 4ZO7A 1JVSA 3CX4A 4JB0A 4K7JA 1UM9A 3OPYI 1VCHA 1P4HA 2WU0A 4CXMA 4Q5IA 1Z7BA