3LGHA

Crystal structure of nikr from helicobacter pylori with variable ni site coordination
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
131
Chain Sequence
IIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Holo-Ni(II)HpNikR Is an Asymmetric Tetramer Containing Two Different Nickel-Binding Sites.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
molecule keywords nickel-responsive regulator
total genus 42
structure length 131
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3lghA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3lghA02
2PC6A 1QTGA 2K5JA 1P94A 2CA9A 2JXGA 3QOQA 2BNWA 2GPEA 2BJ7A 2AY0A 2WVEA 1BDTA 3QSIA 2BNZA 2H1OE 2K29A 3FMTA 1ARQA 3VEBA 2CPGA 1MYLA 3OD2A 3VEAA 2KELA 2CAXA 3BKUA 1MYKA 4FXEA 2FGCA 2Y3YA 2CADA 2F1FA 2WVFA 2HZAA 1PARA 3LGHA 4HV0A 2BJ3A 3FT7A 1EA4A 2K9IA 1BAZA 2RBFA 3BKTA 1IRQA 2WVBA 1B01A 2BJ1A 3PHTA 1MNTA 2WVDA 4ME7E 2BJ8A 1BDVA 3BKFA 1Q5VA 2HZVA 1X93A 4D8JA 2BSQE 2NZCA 2BA3A 2JXHA 3GXQA 2JXIA 2WVCA 1ARRA 1NLAA 2CAJA 1B28A 1Q5YA 2K6LA 2K1OA 3H87C 3VW4A 2BJ9A 1U9PA
chains in the Genus database with same CATH superfamily
4TXSA 4IFYB 1YLXA 4BHQA 4HHJA 3UQSA 2GW8A 4UTGA 4PAAA 2IVFB 2IJFA 5B0EA 2ZWOA 1X5SA 2JL9A 1R89A 4USMA 1OPZA 3IAM9 3QSYB 3T3FA 1SJ3P 4DL0C 3DLLQ 3VEAA 2YKOA 4U8YA 5DGAA 2IMWP 3MR3A 2UXDJ 2R2RA 3W5XA 2F1FA 5DLFA 2VICA 1ITPA 4HV0A 3BO3A 3KHHA 2I1RA 1K0VA 1UVNA 3MR5A 1PC5A 2DGSA 4KGZB 3R7NB 3GJTB 4X4RA 2XM3A 2VOOA 3JQMA 2C2EA 1RT7B 2RT3A 1U6FA 3JTPA 3GIJA 2D7SA 4O23A 1LXJA 3EMTA 1MROB 2B4UA 1S59A 3DLEB 1RAGB 1B28A 1XR7A 3QQCD 4DX6A 2RB7A 1LV5A 3OXFA 2AJ2A 1VQSA 2LU2A 4P7TA 5HQLA 2YH1A 3JAMY 1RZMA 4NZ0A 3LJPA 3P6YC 4ECYA 4OV1A 1NK9A 3FQLA 3CJKA 3W8PA 2J6SA 3U02A 1UKUA 2H1YA 3NBPB 4A8XA 2KXNB 3T9ZA 3RJMB 2HLUA 1D8YA 2KB2A 3VV2B 4DR7F 4MKAA 2COLA 2IAJB 3L9ZA 3WC0A 2HK3A 4PQAA 2C3YA 2N7CA 4UZBA 2HFOA 3R97A 1EP4B 2MQOA 1RE1B 3D0HE 3I4HX 3IP0A 3HHEA 1CS4B 2CG4A 2G1DA 4O3PA 4JI7J 3C6TB 1W25A 4ZITA 1RT6A 1S0NA 2BA3A 3U7JA 5HBMB 1CC7A 2OH2A 3G2XA 1NBEB 2HS0A 4G1PA 2Y0BB 4DOZA 1ZM3A 2RRNA 5KFFA 1T05B 2QGFB 4ILMA 1J2VA 2CVIA 4ELTA 3G87A 4HL9A 1WHVA 1LWFB 2QYGA 2V4JA 3QIPB 4RUBA 2XCPA 2CPIA 4RW4A 5E3QA 4BS2A 2AV5A 2WHOA 5JUMA 1XR5A 3GLJA 3K58A 1SC1B 4O3QA 1RQ0A 2E9RX 4F4ZA 1HBNB 1AT1B 5C5JA 2DGVA 2YBVA 4WK1A 5ETQA 4DUYF 1M5SA 3RAMA 3AA8A 2N3LA 3FKBA 1HR0F 3CGIA 2BACA 2BE2A 2I5JB 3FZBA 3HVAA 4HHUA 3CJSA 3GU0A 2IM1A 1VQMS 2RKIB 4NXMJ 3QJLA 2OP5A 2HZCA 2A6OA 1FKOB 3IBWA 2ILZA 1WHYA 3JSMB 3NG8A 4PXEA 1LFWA 1AYEA 1X4BA 2CPXA 4LF4F 2HQCA 4KQZA 4KY3A 4ZLNA 3EYZA 2K2PA 5KFLA 3TJ8A 1JJ2R 4I7FB 1FVSA 2HWIA 4DUYJ 3MOJB 4X4PA 3MDFA 4GKJJ 3DOMB 5K8PA 3N5BA 2FVSA 4OI4A 2Q6CA 1U1LA 3SFGA 1HQUB 1PAUB 1S1WA 1YBUA 4WBFA 4C0BA 4QR1A 3AD8C 2F8EX 4XIUA 1NO8A 1UAWA 2XSFA 3KG4A 2C22A 3N0VA 4M5KA 1H3DA 2P9EA 1W7WA 4CLZA 1X60A 4NLRA 3ZC4A 4ES3A 4ZLPA 2X1AA 3EWGA 2JFKA 4CQ1A 1KC8T 2QG9B 1RTDB 3NNHA 2E5LJ 1T9WA 4NA2A 4NLYA 1HD1A 4B9MA 1Y7PA 1ZM4A 3IGVA 5I42B 2NR0A 4RWWA 1VC5A 2YXLA 3CCWA 5HATA 2M0GB 5EWEA 5LMNJ 1BC6A 2YTCA 2AJ4A 3MM8B 7FD1A 5DZ7A 2SXLA 2WAQD 3CCUS 2MZ1A 2U2FA 1XNRJ 1RHUB 1RISA 1TELA 5AE2A 2H5EA 2WK4A 3I4PA 2HURA 4Y34A 2BJ7A 4FYVB 2ZJQQ 2M2BA 4O3NA 3T1HJ 1PC4A 3FMWA 4K2XA 1VYAA 1XJWB 4B9VA 2JLEA 1BQMB 2C28A 2Z30B 1S72S 2QA2A 4EZ6A 1WF0A 4A8SA 4KRWA 2B9XA 4HTJA 4C7QA 5KG2A 1QAJA 5D0GA 2DKOB 1FEHA 4J91A 1ICEB 4OYWA 4MIAA 1BAZA 4RW7B 2QC3A 1QM9A 2GJIA 5FD1A 4LIWA 1OYDA 4OYZA 4IFVB 2DXFA 4ZVEA 4RUHA 2ACYA 4MIBA 2RU9A 2J6TA 1RGVA 3ZZUA 4TYBA 3ZTQA 4YP3A 1UW9A 3LH2S 5CYQB 4FP9A 1AXQA 4QOTA 2RJZA 3B54A 4DFKA 4OZ5A 3Q2SC 5KFAA 2CPDA 2NQPA 3DLKB 5F9NA 4ECSA 2BQRA 4ZPTR 1S9GA 4JYAJ 3NS7B 3R5BA 4AL7A 1DZ5A 2PEBA 4LF9J 1RTHB 4LF5F 3NGRA 1JNZB 1H2TZ 3UVJA 1URNA 8AT1B 2GQQA 1Z1ZA 1UFKA 2B9YA 2NUHA 2OO4A 3ETMA 4LVOP 4OZ2A 4QJVA 4Q2LA 4UOCA 5LT5A 5DLGA 1HD0A 4DUTA 4Y0FA 5GAGI 2UUBF 1S1XB 2DPIA 2DPJA 4YN3B 2VFRA 4F0HA 2CWXA 2VFUA 3N79A 4KPCA 3DHXA 4IDKB 1WC3A 5H9EJ 2V94A 3PJ9A 3DN9A 1EIYB 1YG0A 2CXEA 3KG0A 1VBYA 1JMTA 1TUWA 1APSA 1TV6A 4NLUA 2MQQA 1BQXA 1T0TV 2UZAA 3BPSP 3KK1B 3FCWA 2UUCJ 3C15B 5GVQA 5T7LA 4X4QA 1U1KA 4B3OA 2AP6A 4C8LA 2DNQA 2FJWA 3DYAA 3CC2S 3RW7A 2G4BA 1Y4ZB 4WFZA 4DR6J 4F4XA 3OR1B 2BM0A 3NGUA 1FRIA 1TMJA 3NP5A 2ADLA 4RW8B 4RW8A 3I0RA 4TKTA 2FJAB 3G6ES 3T5JA 3VEBA 2NSCA 3MM6B 5F0WA 3BEGB 1QVGR 3BO2A 1UEUA 3PTWA 1N5TA 1JQGA 4X65F 4X4OA 1FKPA 1IWAA 1OY6A 2LA6A 3TRGA 2F9JA 4K5SA 5KT3A 1B0PA 2XLKA 4DQRA 1G1XA 4ED1A 3HHLA 1MU2A 1UZDA 4RKUC 4CTAB 2H3AA 3MPDA 1N4LA 1IR1A 4U7UD 1CQMA 2BOPA 1HLWA 4DV1J 3MZIA 2OD4A 2Z2ZA 1ZPWX 3H5SA 4KB7A 3ZZTA 5KG5A 1R8AA 1RHRB 3D3CJ 3GJSB 2K6LA 3HZEA 1SBRA 4KBIA 1TP7A 2F5GA 1OO0B 2A6MA 2ZE2A 2V4JB 5D15A 1RWMB 1S57A 3PJXA 3W1YC 5KFHA 4FF3A 3LW5C 4S0MA 4YEAA 3RZAA 4FS1A 3BS9A 4IH7A 1WTFA 1SV5A 5F9LA 3KLEA 2RH3A 2YKNA 4Q8EA 3MPWA 4DJBA 3BR9A 5A8WA 1PIEA 5A8KB 4XDDA 4DCOB 4YS2A 1R7IA 2BMBA 3OL7A 2Y1IA 3CIMA 1JXLA 3LWMA 1SXLA 3FBBA 4MT1A 5T14A 4EBEA 1RAEB 3KLHB 4UUXA 4RW6A 3RR7A 2LXUA 2IJRA 1VR6A 1JJ4A 4N56A 5ETOA 1H6KX 2K1RB 3QWPA 2FUG9 4I56A 2HEKA 5A76A 5IT0A 4R5PA 5GAGU 3KLGB 1C4AA 1ROFA 4JI7F 1D3WA 1K44A 1TQLA 4Y2CA 5GMKa 3TQ1A 1XC9A 1I94J 1F3VA 1YJRA 2AEMA 3DCAA 4DV4J 1VIXA 1VGYA 4DV7F 2ZBCA 1X5TA 5GAHU 1IBCB 1V3SA 3JTNA 2KI2A 4AXIA 3W3SA 1WEZA 3CUNA 4NZ6A 1VK3A 2Y3YA 1AZSA 5KFKA 3NGKA 2QLJB 1QD1A 2CQ2A 1PKUA 2G2ZA 3N4WA 2B8QA 1ZETA 2C3MA 1ULRA 1KHVA 4ECUA 3RB6A 3IR6B 3G96A 2AGOA 1FJGJ 3QO9B 3HFVA 3PCOB 4WWSA 2RF2B 4NCGB 1BGXT 1RTJA 2MXYA 2LECA 2ATLA 1SKUB 2DGTA 1RDRA 2F63A 2CPYA 3H42A 2CJXB 2P8IA 4OHWA 5HVFA 3QT6A 5AE1A 3SQOP 4PCQA 4ZN1A 2X3DA 2DO4A 3EE3A 1GEHA 4GVBB 3PKYA 3BZQA 4Y2KA 3PX4A 4FYWB 4BC9A 2XY7A 2JXGA 4H4KA 4EBDA 2UV8G 4F4WA 5KFDA 2DH7A 3L7UA 4A8MP 3M6VA 1MLAA 3ZZPA 1D9FA 2ZKUA 1LOUA 1HMVA 2ZVSA 3QGPA 4R8UA 3CEDA 3HXMA 2GZOA 2VUGA 2XMAA 3CC7S 2BR0A 4CLFA 1UMJA 3OSPA 2DNOA 4DL3A 4KV8B 4CIOA 1LW0B 1C1BA 3I87A 1S1VA 2DXDA 1CJKA 2QX0A 3D66A 3GV5B 5IS2A 2O66A 2DNRA 2VPXB 4ZVRB 3TNVA 2YNIB 2MZTA 3HHLC 1YJVA 5FLXY 3TAPA 2P6SA 4YQWA 2XS5A 4RZRA 1ZA2B 2V8GA 1TKXA 2M8HA 4ID8A 2DCLA 1DTTA 3BN4A 2XB2D 4H54A 4DCJB 5E3CA 2KVIA 5D4PA 1EHWA 3ENAA 1IBKJ 3EXCX 2ZJPQ 3EM1A 1S1UB 2H54B 4C0HA 3VHQA 4O0NA 3J80Y 3SV3A 2AF6A 2C2KB 2YWHA 4IG3A 1N48A 2ZM6J 2V8PA 1LNQA 2MKCA 3RBXA 2DY1A 1BMQB 4OHXA 3VGVA 1TL7A 2AYGA 2KFZA 2LVWA 2F4VJ 2R4FA 2UVWA 4OHYA 1H72C 2KFNA 3F41A 1CBKA 2NPIA 2C42A 3SDEB 2BABA 1UVMA 2L3MA 3GYGA 4KHMA 3HD1A 2KG1A 3N9UC 4LSLA 1WC0A 1HQ2A 2DR6A 9ATCB 4F3QA 3F44A 5KOXA 5C25B 1F9HA 2BRKA 4L3NA 1U09A 3TA0A 1DY3A 3ZTPA 3ZTRA 3PRVA 4U6PA 4FPIA 2VJUA 3CJ8A 3M7VA 1KNZA 1B0VA 3CW2C 4WXWA 1QAIA 1V6HA 2UU9F 3B4DA 1F5CA 1SJRA 1YBTA 3TVKA 4LF8F 3OL8A 3MMCB 5J2NA 2XMWA 3I5CA 4DL6A 5HSPA 3Q0AA 1T03A 2DRBA 2F7VA 4ELVA 3NO7A 2CPHA 4PG8A 1T94A 3MUMP 3ZZ0A 4ANDA 4CH1A 3NGDA 1QSYA 2HZAA 1T03B 3CJ3A 1NPRA 2IHR1 2ZOMA 5LMUF 2AEFA 2A18A 5E7OB 3I0RB 1H7XA 4CLYA 2IM2A 1UVKA 3V6DA 2K3IA 2MTLA 3AY0A 2Q79A 3MM9B 2WONB 1V3RA 2DXEA 2WSCC 2HQDA 3ENVA 3EGVA 4IOBA 4OI2A 2GX8A 7FDRA 4GO5X 3RRKA 3RG6A 1LWXA 2IVYA 2VPWB 5B09A 1HNWJ 3AOAA 2VB6A 1G7CB 4H4KC 2EKNA 1KP6A 2D69A 2OFGX 2E29A 2ABYA 1JXEA 2QL7B 2O5DA 3FEXB 3TZXA 1S10A 1JKHB 2V6AA 4JI0F 2W7AA 3CO9A 2R9LA 1EARA 3DMJB 4DMZA 1HPZA 3PW7A 1ELOA 2LLZA 1FX4A 1WI8A 3IBCB 4QU6A 1U1NA 3V6HA 1Y5LB 4ZCMA 1P9QC 2BV3A 2RHQB 2FVRA 4IOAQ 1EKSA 1OSCA 5KFYA 2ASLA 1K1SA 3CCZA 2B6AB 3OTDA 2MKKA 4LRDA 3BV8A 2XNQA 3MPYA 1RWNB 3VWSA 2OSRA 4N77A 1SPBP 1RA6A 1TKZA 5C7PA 1SH3A 2ZH9A 4ER8A 1FD8A 1SL1A 2DR5A 2DNKA 3O5TB 3EDQB 3PIPQ 2BNWA 3T5HA 3MAAB 1G2EA 2MKHA 2N4DA 2YQ1A 2V69A 4RLEA 1HI8A 1PBAA 1R0CB 1UPPA 1XMQJ 1JJHA 1UP1A 3IO1A 5KFQA 1VQOS 5FJ4A 3BDPA 2L08A 4KH1B 3JS9A 3LQVA 1OHNA 5D0RA 1X4CA 1JLCA 5KG1A 1C2PA 3QAUA 1OYEA 4HH0A 4HDGA 1HI1A 2AT1B 1O51A 2E1AA 2J0XA 3H2LA 3HI9A 1C0UA 3T9NA 2FVQA 3IFEA 3KNGA 2R8JA 3ONQA 2HFZA 1JXVA 2HFNA 5EX0A 1IKWA 4ZPWR 2VQFJ 1BDVA 2B5JA 1DTTB 2BVZA 4I2QB 4PR6A 4CRJA 2MQ8A 2PEHA 2QSFA 4ITSA 4LBIA 1NDPA 4JI2J 1CVJA 2AQ4A 2BX6A 4WF9Q 4OYBA 3LOUA 1PYSB 4CI0B 3UO0A 4OX7A 3RAXA 4TNOA 4B3RJ 5B08A 1QTGA 1C1BB 3A8IA 2EC0A 1BLUA 5AXKA 2VFSA 2YNHA 5I42A 4OJ1A 2W2NP 4QWAA 2ZC3A 2K8GA 2XGPA 4K8RA 3QT5A 2HVZA 3A4TA 2J0QD 3T6BA 4XAKA 1TL3A 2PI5A 4KO0A 1JLAA 2Q66A 3M6XA 5KFGA 3UDCA 2JVRA 2PA3A 5AXMA 4Q5VA 4YDDB 2CIMA 1FK9B 3TP2A 3MR6A 2FQQB 1LWCB 4M5MA 4ME7E 1PBUA 3MAHA 1B3TA 2HZVA 2GVDA 1R8HA 1YX2A 2P5VA 2A1BA 2A0FB 2POKA 3NY0A 4KC5A 4V1Ak 4YB7A 4ETZA 2ASYA 2QLBB 4NCGA 4DV2J 3TAMA 2L9NA 2D3O1 2FC9A 1TL1B 2XHWA 3I9ZA 1U6BA 3CSKA 1FERA 5KFTA 3ZTSA 1REVB 3E51A 3W64A 1KRPA 2E5IA 4GKKJ 3EZUA 4P9SA 3KLIA 5B0BA 4B3MF 3F0NA 2W4DA 1Q8KA 3ENWA 4ETXA 3L95X 4JI0J 5CXTA 1TL3B 5D6GA 2RSQA 3LGMA 3QRPA 3KLIB 1DHMA 1SH0A 1TAUA 3TUIC 2UUAF 2DNPA 4P73A 1FE0A 3L7PA 1RBLA 2L48A 4IDKA 1MWQA 1ZTWA 2MSSA 2HHUA 3KYLA 1TL5A 3EX7B 4NLTA 3H25A 3OXLA 5HANA 3MFHA 1R3NA 3PJWA 3GXQA 1LWEA 3QLHB 4HEA9 4NLSA 4A4JA 2R7SA 5B0GA 5ETTA 3OLAA 1CULB 2LQ9A 4PRFA 1NJWA 1IJFB 2CQ4A 2ZKTA 3N01A 2U1AA 2EVZA 2VDHA 1RT1A 5B0AA 1B7YB 2NPFA 5IM0A 3OJSA 2PDAA 3B8HA 4HT5A 4NASA 3CMES 4QYRA 5ETMA 2IBOA 2QMUB 3W2WB 2MJNA 4DR3J 1SJ4P 5IM0B 5IT9U 3CVKA 2LXIA 4HI2A 2AU0A 2KELA 3Q8RB 2JNJA 3D6HB 4CLTA 2XLJA 2QFIA 3LP1B 2PD1A 4WIQA 1S9FA 1RT7A 4NL5A 5BR8J 3J7YI 3G86A 1GMWD 1NHVA 4ZA1A 5CYMB 2XGQA 2DY9A 1SIWB 2G0CA 1LEOA 1OSDA 5K14B 3VAGA 3FFIA 4CNYA 2K7JA 4IOCQ 4NXNJ 2UXDF 4B3OB 3I0SA 1Q78A 4B3RF 4QW9A 2P9CA 1OQ6A 4ZP9A 4JP8A 3HT0A 2HHPA 2CAJA 3DXBA 3GMGA 1TK5A 1J5OA 3AT1B 4U95A 4TYAA 3VW4A 2DNGA 3JXOA 2ZH6A 3NNCA 3DOKB 3S01A 3C8YA 4OX9F 1A6LA 4P75A 1QVFR 4RU2A 2MQPA 1NKCA 1RAHB 2IAJA 5L9NA 3G8SA 1KLMA 1KONA 4YMEA 5C42A 1KLMB 5C42B 4E8UA 2NREA 2JSXA 1XWLA 2DIVA 1TK0A 1HPZB 2CQDA 3H2UB 3AOCA 4CM2A 4X64J 3HD2A 2C2ZB 1KBRA 1UW4A 3K5PA 2AMCB 2B7BB 2QSWA 3BGRB 4X62J 1N54B 1JKHA 1MG7A 2X1GA 2HNDB 3Q8YA 2R2TA 1FNXH 2EXUA 2DNHA 3BDEA 3THVA 4K50A 4E0DA 2NXEA 4M5LA 1J5EF 1LW2B 2ZD1A 4LF7J 1VLYA 1RTZA 3WZ0A 2GVZA 4YR3A 5ETNA 2HNZB 2UUBJ 4B9NA 2OPQB 3NGTA 1HBMA 4M94A 4D3GA 2RDDA 5DG9A 1S4FA 1TUVA 1WEXA 2BJEA 2NXUA 1S6UA 1U6ZA 3D3BJ 3NEKA 4RNFA 5L1IA 1HBMB 3FCVA 2DGQA 3VCDA 2HYIB 2HHVA 4Y2MA 5DGBA 2GC8A 1X9SA 1NZAA 5EN1A 2DK2A 3H4BA 2GMJA 1J5EJ 1H98A 3LWLA 1QY7A 2BYCA 3D6TB 3D7SB 3TO8A 1EA4A 4EYHB 3QJJA 3JSMA 2HFSA 2DGOA 4O44B 3FUYA 4KYZA 3PR5B 3ET6B 1HW9A 3NGSA 1LQ9A 5J1PA 2AJ1A 4ZP8A 2KU7A 1HR0J 2J7KA 4DR4J 1HHQA 2QE5A 4K4ZA 3M2RA 4X2BA 1P1TA 3SQGB 1VQ5S 3NLCA 2J8AA 5L39A 4K4SA 2GQCA 3CJRA 5EDWA 2V4RA 1PYOB 1RCOB 2DEIA 2LU1A 4B3SJ 3KDNA 2JC1A 2KT2A 1GMWA 3D28A 4NXMF 1XMBA 2HMIA 3CULA 3IG1B 2GMLA 3NCRA 1VQ6S 1NSPA 3CDBA 1IBKF 4NYOA 2FHJA 3KJFB 1D0EA 2O3DA 4FYXB 3MD1A 3GFHA 1FXDA 3HJVA 1PYTA 4UY8T 1QE1B 3BF4A 1H2VZ 3K89A 1Y3JA 2BJ3A 4P7VA 5C2CA 1S7IA 2YPYA 3F56A 5F8JA 1V5IB 2R7OA 3FVYA 4WE1A 1A0OB 2Y1JA 1OJ4A 1D9DA 4ES1A 3C6UB 3PACA 1FHTA 1GT8A 3TAMB 4MYUA 1HW8A 4DV6F 4USHA 2VBXA 3K57A 3NNEA 1T8EA 5CZVA 4JI4F 1RYSA 4L6V3 5D4NA 1RT4B 1TFYA 1VQPS 3OFGA 3GQCA 1DTQB 5A2QY 1MWZA 1FFWB 5CH7B 3MXHP 1NZ8A 3HHLD 4F4AA 4IH6A 2NUUG 3FDSA 4DPUA 1RT1B 4Y00A 3W7BA 2RE1A 2RKIA 1EX8A 3QT7A 3BQ1A 2DGUA 3CJ2A 1HWUA 3Q86A 3ILOA 4ES2A 1M5KC 3HSGA 2I2YA 3UCUP 1XNRF 1B7FA 2LQ8A 3K7RA 5D77A 2XYGB 4OYMA 3OHBA 2WONA 3OLBA 3RRGA 4Y2AA 2BKNA 3CCES 5L1JA 2HVHA 3D54A 4N8NA 2GO9A 1U0SA 4M5DA 3E8OA 2KRBA 3U1MA 4ED2A 1ZYQA 3H7HB 2JXHA 4WP9A 2CZ9A 3VZHA 1N5SA 3KG1A 4C8KA 2DHHA 2QO3A 4LF2A 1X4FA 2GVDB 2CPZA 4C48A 4DLGA 2VD3A 1S0OA 1M5OC 4DSJA 3HO1A 3K0JA 1TVRB 4ZHRB 4N5SA 1FT8A 4ED3A 4DQQA 3SZ2A 3MMCA 4YDXA 1RAFB 5J2NB 4DWIA 1WG4A 1FKOA 2HFVA 3I31A 4GMKA 4KV8A 4DSKA 2D74B 5DDRC 1ARQA 4LRAA 2HBYB 3CCSS 1CULA 1XN9A 2VG5A 1AROP 3DDKA 3NAHA 2AZ1A 5IFMA 3KHRA 3GCXP 2CJ9A 2VC1A 4FDFA 4USIA 4YHHJ 2VIHA 5LXRA 4OV6A 3P5TL 4GC7A 1U1MA 1HNVA 2HNYA 3PNIA 2AHOB 3H8YA 3FRZA 1KDNA 1OG7A 2KOEA 4UUWA 1F9FA 1U8WA 3R7SB 4QWEA 2G13A 3QIPA 1JJCB 5KFZA 4BLGA 4J9MA 2MLZA 5HI7A 1NDLA 2RDJA 1N52B 1UWBB 3D1QA 3LP0B 2W2MP 4HACB 4NLOA 4NA1A 3IS9B 4OLOA 2KM8B 1Q1KA 3DLEA 4WK3A 1GTEA 1ARRA 2V0NA 2GHPA 3Q83A 5DM7Q 4A8QA 2QN6B 3DRPA 2ALZA 4B9TA 2XEXA 3C6TA 5E5NA 3WC2A 1CC8A 1FDNA 2HGMA 3FEZA 4I2PA 2OMOA 3I5AA 4WFYA 1UTAA 5K5MA 5K8OA 2R2SA 3PVXA 1F5AA 1C0TA 3KWMA 3NS5A 1VBKA 2YNHB 3CB4A 3AHPA 4OX6A 3V2UC 5BYSA 5HROB 5HROA 1X0PA 4A8WA 2D1CA 4HLBA 2MHEA 2W2QP 3BO4A 3IBFB 2CNLB 4DS4A 2GIFA 5F3ZA 4OIXA 2LQJA 3WX8A 4K4WA 1QUVA 3FJ2A 3CD6S 1HBOA 3MM5B 1YQHA 2YKMB 4DFJA 1ZH5A 3LA0A 4AUKA 1Q82T 1WKLA 1NPKA 1RBOB 2KYZA 1NJIT 1S5ZA 4LFCJ 1ZAWA 4HDHA 2F40A 4O4GB 2OMLA 4PG6A 1N0UA 4BBYA 4DDFA 4WZQA 3EZOA 1S76D 3MUTP 1U1QA 4FXDA 1RUSA 3MMBB 4BCAA 4DPOA 2IVMA 4OZJA 4QQBA 1DLOA 2R7UA 4UW2A 4P2MA 4DR2F 3LPEA 2EFGA 2FLOA 1BWVA 2XZDB 3AJDA 4CT8A 4WYWA 1RADB 3AH6A 1Z2ZA 2J9CA 1LW2A 2ZD1B 4OHZA 4Y6IA 4LFCF 3O44A 4WTOB 2Z57B 1NUEA 2HRUA 2LEBA 3HSDA 2B5JB 4I2QA 3TA2A 1S0VA 3ZZRA 4AYBD 3RYLA 3J81j 7AT1B 3POTB 2DR7A 2Z0GA 1NKBA 1XNQF 4DFMA 3M05A 4PPDA 1F60B 4DR2J 3E2EA 1RT3B 2GIRA 1X4AA 1YVFA 3DRYA 5GAEU 3KKFA 4LF8J 2DO0A 1XTZA 1M5VC 4ECWA 1QSLA 4DR5F 1L3TA 3TWZA 1HNIB 4LSLB 5L46A 2YWEA 5J2PB 4Q0BA 4C11A 2V2QA 3SSSA 2IDEA 1N56A 4UOFA 4B3MJ 2GPEA 2AIRB 2UUWA 2VV5A 3BN7A 1QTMA 1CQNA 3CXCR 3CCQS 2ADCA 1NH8A 2CYYA 2QMXA 1ZAVA 2LDIA 3IR7B 1SB6A 4OMFG 3M6UA 3W5YA 2XWYA 2DGWA 3ADAC 4J9SA 1RLDA 1QAYA 5C24A 2ZJRQ 1RT5A 5IV4A 1UVLA 1H2UX 1FRMA 3GSIA 4CLSA 5A6PA 4DFPA 3PZPA 2DVIA 3L7OA 1YJUA 5HMYA 2RDIA 1RU2A 4DR6F 1HNXJ 3RBDA 5CHCB 1N5VA 2KJVA 4DX5A 2ZOGA 2XC9A 4LQ3A 5DDOC 5IQQA 3OTBA 4F0MA 2RQCA 4C3KA 4X66J 2MLYA 3DRSA 3C15A 5KFBA 2AGQA 2BE7D 3DRSB 5E3RA 1NKEA 1O8BA 1RHJB 3W2WA 3G6YA 1GXUA 3BR8A 3PFOA 1WKKA 1WSRA 3O8WA 4KGKA 4NA3A 4I68A 1K47A 3TVYA 4DV0F 5DQHA 4USWA 3UD3P 1GNKA 3TI0A 1YTYA 2MLXA 4DPYA 3HT3A 5AE3A 4EBCA 3M8ZA 1B70B 1S1XA 3TQEA 1PO6A 2DHAA 2VG7B 3C14B 2EK1A 1F2GA 4DLEA 1X4HA 3O2IA 4DN0A 4DV1F 2WVFA 1IXKA 1M5HA 4FYYB 4IG3B 2E7WA 4PG7A 5KG4A 3UVJB 1RT3A 2MPUA 4USUA 1RWPB 4MFBB 2X1BA 4WIIA 1N88A 3OFHA 4ED7A 1NJZA 3R2CJ 1MMNA 2JJ4D 2IYIA 3SXLA 2ZH3A 2J0WA 3M2UA 3OR2B 3BJYA 2IM3A 4K4UA 1S1TA 4F04B 4LQ9A 1VRUA 1V3ZA 3QGHA 2K1OA 3P4UB 5M2UA 3BSAA 5CZXA 3PW4A 3M8WA 5K8MA 2HSEB 3AD9C 4DF4A 3G82B 3QBCA 4P71A 5GAEI 1CJTA 3HZGA 4PG4A 5KFUA 1VQNS 3PXGa 1MNEA 2MQMA 5AXLA 4JI2F 2E44A 3J81Y 3QGIA 1TR0A 3I96A 1SL0A 4OX9J 3D4JA 2IBKA 4TY8A 2FLNA 1X5PA 3H98A 1SKRA 4DG1A 2XMMA 2BUNA 3T1HF 2BJ1A 2IRXA 3PW2A 4F4KA 1WDTA 4YB1P 5F8GA 1VRTA 2B4VA 4AD6A 3C19A 4ICLA 2DNNA 2BOAA 2C2RA 2HHQA 3H0PA 2YWKA 2OGUA 3EJMA 1Q5YA 1U1PA 2VG5B 2APOA 2IC3B 5K9FA 1WWHA 2E1PA 2BM1A 4OYPA 4BC7A 4O4GA 3KHGA 2YQ0A 2J7UA 2HAFA 3B78A 1SUQB 4B08A 3CC4S 2VL1A 3JSYA 3X1LB 2R8IA 1NRKA 1KSPA 2MKYA 5IZHA 1GAOA 1L3KA 1IBLJ 3R1HA 2N82B 3BH7B 2HS3A 2HAIA 4TN2A 1P9YA 3IS9A 4NLPA 4NYZA 1HNZJ 1D9AA 3NCQA 1UCNA 2MGZA 4EGLA 1FTCA 1KFDA 1OIAA 2H65B 2V2KA 3BKTA 3FFIB 4K5RA 3TZZA 4QWCA 4AFFA 4RUCA 2QFJA 3SV4A 3OFEA 4WU3A 1TZ0A 3EGWB 1TKTB 5MLCV 1LWFA 1D8ZA 2OKQA 3MMBA 1R31A 2DNMA 3A1YG 4C98A 4ZLLA 5J2MB 4UOGA 4ECZA 3J80U 2KZZA 1KHWA 2WBRA 1NHKL 4CLPA 2XTJP 4QCLA 2KO1A 2O67A 4QW8A 1WD6A 3NL0A 5K8NA 3VAMA 1S6PB 1KR4A 2RAQA 3D9BA 2AWZA 3HHLB 4IG0B 5G0RA 4CP5A 4CTAA 3R7BB 4YUDA 1GFWB 5LOQA 5DDPC 3KLFB 2R7RA 3ETOA 3MAAA 3PRDA 3UW1A 1OS5A 1AFJA 1SJ1A 3BSOA 1F2HA 5U47A 3WIVA 5IC4B 2BKPA 2IA6A 1WSVA 1E6VB 3GSDA 3I5BA 4WTYA 1Q95G 3GP9A 3OUYA 3LP2B 4CYUB 2YKAA 5HLFA 3EGNA 3QO9A 1JK9B 1FVQA 5BYRA 1KN6A 3E01A 3HKZD 3BYPA 4XO0A 4ZCKA 4GRSA 4DV6J 4DR1J 2CJKA 2OHDA 2VF3A 1RT5B 3BKFA 2AEJA 1WTBA 2KHCA 5E33A 3IM9A 4FBUA 1FO1A 3A8KA 2P9GA 4F36A 4J9RA 2ZBQA 3W62A 4NLDA 3GV8B 5D3GA 4U67Q 1HWKA 5CABA 3MCNA 5LJ5Y 4MJKA 3IG1A 4AAIA 3Q24A 1N32F 2G2OA 4M8LA 2R3VA 4P74A 1NEEA 2LDYA 2MEWA 2H1OE 3ZZOA 3K5NA 4PEOA 1V9OA 1S9EA 3SCIE 2WTFA 2EFVA 1S99A 2K1RA 3KLGA 1IUJA 3IWLA 2BDPA 3QT8A 2VKRA 1FRJA 4KHRA 2M8DB 2D9PA 1Z4UA 1NDKA 1XMQF 1O6XA 3OR1A 3DU6A 1L3UA 3CD0A 3OTOJ 3G5OA 2WBMA 3BBFA 2ZUAA 1FWPA 3S6EA 1K9MT 3FBFA 1MNTA 3KJQB 3RGIA 3R5GA 3CE8A 2Y0SD 2ZH7A 1M1HA 1KVIA 4AL6A 1QE1A 1RT4A 1FKPB 5B0CA 3OTEA 2E5HA 3C16A 2UP1A 3PYDA 3RR8A 3AOBA 2OD6A 5A0YA 4OYOA 4DV4F 1VI7A 1ZPVA 5LMNF 5F8MA 3MTJA 3M8SA 1DQ9A 2CZ4A 2CUYA 2M5YA 3H90A 4ZP6A 3RBEA 1P6TA 1BD6A 3I6PA 3SSRA 3U27A 4N8OA 2W1BA 3KK2B 4KAIA 3C46A 2E9ZA 5MAOA 1NU4A 1RTIA 1KEKA 1I1GA 3P3DA 4F3MA 1U02A 2V34A 4K59A 4DPTA 3TUZC 1SVDA 2XLIA 3KK1A 4ECRA 2BA9A 1WEYA 4OZLA 1W26A 2PI4A 1OY9A 4LREA 3AB2B 4MTPA 3VAIA 3FBCA 3IRXA 2BQ3A 1R43A 4IO1A 4ZVGA 2D3OR 2IIHA 1RLCL 1JLBA 2C3OA 4ECXA 3GFXA 3I55S 2WVDA 3TARA 4B9SA 1NDCA 1UJ6A 4EI2A 2F4VF 2XSJA 5E3AA 3U1NA 1Y5IB 3M1VA 3A13A 3M4XA 1Q7LB 1FXLA 3TUPA 1SQFA 3ISZA 4CLLA 4U9RA 4Z7YA 2ZBPA 1N36J 1Y00A 3W66A 2M70A 3KXDA 3GB0A 4DCPB 4PWWA 1IKXA 1BDTA 2PGCA 4U7UK 4F25A 5H1SV 4IQXA 1NB7A 1VQ7S 4I2PB 1M1GA 3I9V9 3DYAB 4DU8A 2XQCA 2JRSA 2VOPA 1KTVA 3CDWA 1TKXB 3MMAB 5M2RA 3THPA 1NK5A 2HHHJ 4LSNA 3PIOQ 1FEEA 4QR0A 2R7QA 2AJQA 4C3LA 2HRYA 5ADZA 1FKAF 3HKWA 3PFEA 3S7RA 2DRAA 4YFUA 1CSJA 4MKVA 2CNOB 2IRYA 2ROEA 4F3OA 1HQUA 1S1WB 1R8CA 2OPPA 3VALA 4JI1J 4PUOB 4B3SF 2GV1A 1HQEB 1RACB 2RQKA 2B6AA 4XDCA 3EGZA 1BQNB 3TEHB 5ETLA 3K5MA 4C2MA 1BHNA 3FSIA 4J9LA 3A8EA 2FLLA 4PPZA 1B0TA 2I0XA 4FZVA 2NXCA 3M2RB 4X84A 3UD5A 4HYKA 1GX6A 3DMJA 3OVBA 1NAQA 3VAHA 1NK4A 1E6YB 8ATCB 2DCUB 1FDBA 2V8VA 4DV5J 4TLQA 2BNZA 1TVRA 2HVEA 2PE8A 3MM7B 4GVLA 5KG0A 3CCJS 5A2QU 2V9KA 3CO0P 2KFYA 3MM8A 4LRFA 1OPIA 1CJVB 2HBRB 2OTLS 4FF4A 3U1LA 2IRUA 1IVZA 1QDUB 4O4RA 1DJ0A 3M2VA 3QPIA 3RUBL 3OVAA 3HVWA 3MOZA 4ZVUB 4DSEA 3Q22A 2H4YB 1A9NB 4NLWA 4RUAA 2VZ9A 5DZ6A 4DS5A 4I67A 4F0KA 3N6LA 1Q5VA 4Y3CA 2IY5B 2HNZA 5HMXA 4Y2IA 2CQIA 3GFYA 4I7FA 4PXBA 4TY9A 3V81A 1Q81T 4E98A 1VS3A 3JQJA 3PO5A 1RT6B 2V9WA 1BWEA 1FRKA 2YKMA 2V5HG 4A8YA 2E1CA 3BGRA 4KSEB 4LR9A 2AY0A 3CJQA 5CAAA 2XULA 3MCOA 3OPKA 1MSWD 5DRKA 3TVZA 2Z58B 4MYTA 3JB9k 1X7VA 4PYAA 2WOMB 4WP8A 3BKUA 5ETRA 4P2SA 2KXFA 8RUCA 1NK6A 1YI2S 1JX4A 2PO4A 2HKEA 3TZYA 1O5JA 1HBNA 1Y5NB 1T02A 2RQ4A 1S9EB 1X5OA 2F9DA 3EVWA 3MFIA 3T1YJ 4LF9F 1IRQA 1FA0A 3CIZA 3BGFA 3JQKA 1VC0A 2E5GA 3PHTA 4OQJA 1QLNA 2XNRA 5G0RB 4OYAA 1KVKA 4WFXA 2EBGA 2C2MB 5HP1B 5D3GB 4LBHA 1QAXA 4RW9B 1I94F 1VQ4S 4AL5A 1RU1A 3MD3A 2M3DA 3E3XA 1HNXF 1FFGB 3ZZYA 4IRDA 5IT9Y 2HMIB 3WHIA 4ZPDA 4YHHF 2A2BA 3MURP 4NWBA 6FDRA 2D41A 3QATA 2GJFA 2XY5A 1WHXA 3M2VB 4NEZA 3FC9A 2LQ5A 1N33J 2EG2A 4QIFA 2WOMA 1YDLA 2EW9A 5HVGA 1WI6A 4C8NA 2QV6A 4JBCA 4RW9A 5CD4A 3CJKB 3G6XA 3SYZA 1TK8A 1WORA 1IR0A 2VBZA 2HHHF 1FRXA 1X4DA 4OI3A 3HMJG 2Z56B 3HK2A 2B43A 4IFYA 1ZZNA 2BJ8A 2AX0A 2VH7A 3FMBA 1F9EB 3Q8VA 1PJ7A 4IH5A 4DQSA 2XYHB 4DN9A 3OHAA 1KQFB 4EK2A 3SCJE 4QIWD 5F8LA 3M9NB 2OIHA 2OPRA 3P96A 4DXLA 4DQPA 3HHDA 2YX4A 1U9PA 3NOGA 1ZOTA 3TJAA 4RL1A 4ZPBA 1EQMA 4A8FA 3TYTA 3IWNC 4FXWA 1VBXA 4EO8A 2ACMA 4KE5A 3NMRA 2VG6B 2Q2KA 4K7QA 1NLKL 2AJ0A 2EFQA 2I9SA 3O1LA 3DOLB 3QAEA 3FSYA 5IV3A 3TA1A 2QYCA 1T9UA 2VU5A 3Q23A 4X4NA 4OZNA 1FJ7A 2Q3PA 2NCKL 3IWXA 3JSRA 4JV0A 4AT1B 1U49A 1CJTB 3KNAA 1CS4A 4OX8A 2V63A 2K9IA 3NWGA 3M32B 3OQ2A 4QIEA 3VGSA 3VVUA 5HJYA 4RBUA 4EYIB 4QYZJ 4LSZB 1HL6A 4LRBA 4JI5J 1IWGA 1DBDA 3K8VA 3W9HA 3MMJA 5F0UA 4PQUB 1ZM2A 3R5AA 2FB0A 1O0PA 4OLPA 4OI0A 3BGOP 3G9CA 1UEVA 2B9WA 3FSXA 2BANA 2QA4G 2VODA 5D8HB 2X7IA 2ERRA 4JI3F 4NMXA 5KFIA 2F3JA 1JLBB 2X3GA 3KK3B 1LWCA 5KOWA 1I3OB 1HKAA 4RBTA 3NNAA 2W9CB 1JWWA 3GONA 5A8RB 2QL9B 4TY8B 1YIJS 1HA1A 4DPXA 3DLBA 4LSNB 1IR2A 2XO6A 3T1YF 1D09B 3I0SB 1HWIA 1RAOA 5KT5A 1B99A 1FWKA 3UE2A 2VFTA 4FKYA 2ZWPA 1M0SA 4YY3J 2VG7A 3C14A 3AODA 4LUBA 4DR5J 1X31C 1P8GA 2ZZNA 1I51B 1WACA 4W4MA 1VJWA 1GXLA 1HQEA 1AUSL 2DT9A 3MF5A 4FVMA 2B56A 4J9UE 3MPUB 5L1LA 2W4CA 4C9DA 2BEFA 3NCPA 4USVA 4X4VA 3LALA 4LF7F 2VONA 1DURA 4KGXB 2XSJB 3VTIA 4DSFA 3OJUA 1SV5B 1PJ6A 1HHSA 4MMOA 2HQFA 3PR4A 3OW2R 3MM7A 2GGPB 2ZNZA 2ZH2A 1U1RA 4CM0A 4IRKA 4G3IA 1T9YA 2OUGA 3KK3A 1WOPA 3DLHA 1FJCA 1R8BA 1YJTA 2XHCA 1ZA1B 2GNKA 1UWAA 2ZOFA 2KRRA 3ELHA 3GJQB 3T41A 4ZCIA 2IC3A 1FJEB 4FXEA 4B9LA 4QIGA 1F0XA 2DGXA 4LF5J 4JI8F 1T3OA 2JWNA 3LGHA 4NPOA 4URGA 1RCXB 3MM9A 2FJDB 4LVNP 2UVUA 2ZH4A 2CWKA 4URQU 3OSNA 2R8HA 1H38A 4WYLA 2OPQA 4DV0J 5K20B 5DG7A 1PSDA 2HRTA 2X51A 2GVZB 3LF0A 3BGLA 4O3OA 3RU0A 4D8JA 4Q45A 2Z8QA 1KTQA 5I3QA 1R6YA 1U2CA 3DRRA 2XMTA 1FCAA 4IRCA 1KS2A 2AKWB 2J7WA 2KKEA 2HNDA 3IR5B 2BW2A 5LSLA 2BJ9A 2B51A 2E1RA 3V4IA 2CQ3A 1RAAB 3QOQA 2JH3A 4AQYJ 3FZ2A 3SBMA 4IR1A 1YWXA 1UL3A 3DHWC 3DOMA 4I1TA 4RNHA 1FRLA 1JLQB 2HQGA 2RU3A 2KVQE 2VJVA 3MWBA 3QJPA 3LP2A 4Z7CA 1CG2A 2DD8S 4DR4F 2FY8A 2DJWA 3KFWX 2R42A 2MQNA 2B4PA 2JC0A 3R5JB 2YNGA 1LFPA 1OY8A 1U26A 5T41A 4HTIA 3DOKA 3AJ1A 3KLFA 4K0KJ 3QIDA 4LIRA 1S1VB 1B01A 3HM9A 3H5UA 2H5IB 3MECA 3ISNC 4L73A 4XTTA 5H9FJ 4N47A 4ED8A 1EAYC 2HQIA 5CQGA 1X9WA 2X1FA 1X93A 1NNDA 2FVPA 3WIUA 2BW7A 4JI3J 2VA2A 1HMVB 3MEDA 3W5ZA 2FDNA 4K4XA 2V4QA 3ULHA 1FDAA 1TKTA 4MKBA 2YWGA 3IRWP 2GCFA 3CPWR 3LAMA 4DR1F 3W63A 4CLUA 1R8PA 1S1UA 4J9KA 3SSQA 3GZ7A 1FE4A 5HAOA 3SCKE 1VOMA 1NK8A 5L1KA 3T5KA 3TX8A 2RD5C 2V68A 4MAKA 2UXCF 3PEJA 5HP1A 1R6VA 2E66A 5KG6A 2CQGA 4RX6A 2QRRA 4MK8A 5FDLB 4EO6A 5GMEA 1L3SA 2Z2YB 2UVRA 4CLWA 3R1LA 5ITHA 4LRCA 2DYAA 3GCWP 4IFVA 3LAKA 1QUPA 2G1HA 4CO1A 1JIHA 1H73A 2JHEA 3E01B 3CMQA 5E2QA 3OTCA 4WKYA 2PMHA 3A3PB 2EFNA 5KFOA 2MJUA 1HYSB 2Q43A 3MEEA 1LWEB 3MEKA 5C24B 2AGPA 2V8HA 4MJWA 1JLEA 4G1QA 1RA7A 1L3VA 2J76E 3AFGA 4ICLB 4F67A 2UXBF 3GJRB 3H20A 4A47A 2MB0B 4I4BA 1WG5A 2PC6A 4P10A 4C3MA 4KIAA 2ZBIA 1Q8LA 3VGUA 2IYGA 4ZP7A 1FESA 2JVOA 5IXUA 3KUHA 3RW6A 3OUYB 2DRDA 3GIIA 3AB4B 3UCZP 4JOUA 2ZC4A 5DJBA 3V4MA 3KMSA 2ZDOA 1S0MA 4ED4A 1HARA 4NLXA 5FIIA 3FRYA 1PARA 3MEEB 2ZEJA 3AQOA 3M9MB 2M9KA 4YB5A 5F3TA 3TR5A 2KG0A 1QSSA 2QTWA 2XMVA 3EXYA 4M95A 2FJEB 4CH0S 3KLVA 3CCRS 2FYXA 2XMJA 3CJTA 2DB1A 2WSFC 5HQMA 5BYQA 1KQSR 2JLFA 3M32A 5A8KA 1HBUA 4NLVA 1YBAA 1R27B 3H59A 1Q16B 2AYMA 4ZHRA 2W9BA 4JI1F 2R2UA 1S4EA 3UDEA 1CLFA 2VPYB 1VQKS 3B4MA 2JEJA 4O3SA 4K4YA 3KTQA 3PHEA 4JV5F 3CJ5A 1RKIA 1OWXA 2AN7A 2WB1D 6AT1B 2ZE2B 2N3OA 5J1EB 1VMBA 1UA0A 4DU7A 1G4CA 2YQ3A 4IYQA 4ZPAA 3ZNUA 1U48A 2AYBA 2YX1A 3HSJA 4R0JA 1SCJB 2E5JA 1PAEX 2UV8A 2EWHA 3VQTA 1YJ9S 1VQLS 4C8ZA 2FGCA 5HQ8A 5J2MA 5ETVA 5LSOA 2RHSB 1BQNA 4ZMMA 5I3UA 5IQ6A 1VRTB 2J5AA 4ZCLA 5FLXU 3OL6A 1K1QA 1YJ7A 2C2OB 2QZ8A 4W90B 1VCTA 3HPOA 3RB0A 4JV5J 1UA1A 2GHVC 2ZNYA 2DR8A 2ZZMA 1JLFA 2QMWA 3EUNA 1IKYA 1VRUB 4URSA 5DG8A 4QWDA 2B4OA 4K0KF 2XYPB 4OJGA 1VK8A 4I6AA 2PFDA 4DHVA 4Z37A 1XR6A 5KT7A 3DGVA 3NRBA 3TJ9A 4ERDA 2D3UA 3M8PB 1RTJB 3R6LB 4CCHA 1KQKA 5D0HA 1SUQA 5E41A 2ZHAA 3CWJA 3NKYA 5I4MA 3ILLA 1KD1T 4K4VA 3MEGB 2VQEF 2WB4A 4NOHA 2HW3A 3BQ2A 1RAIB 1JLCB 2GO8A 5A8WB 4RBVA 3ZFVA 4KHPF 1AZSB 3BREA 2CADA 4NRTA 2AYEA 4OZ1A 5JJBA 2UVVA 2O01C 4V19X 1MMLA 3FT7A 3ILIA 4C4WA 4IR9A 3QYYA 1CEZA 2CQCA 3DGPB 3P45B 4J90A 3DGPA 5J2QA 1IKVB 3UN3A 4NI2A 3HHKA 1UVJA 2ZH5A 2RUSA 5H9FK 1Y11A 4FPRA 4HR2A 2QL5B 3WX4A 1YRTA 2VQEJ 4ED0A 3EVMA 4UY85 4ZKAA 2ZHOA 1U8SA 4RW6B 4K2JA 3SQGA 4DX8H 4DX7A 3EPGA 2DR9A 3J7YU 2HFUA 1WKJA 2ALYB 3DXSX 4YY3F 4DSLA 3C6UA 2HVIA 3THTA 1EB0A 4LRVA 3GR1A 2HGLA 5A0YB 3BB5A 2KJWA 2FHMA 4I64A 3PX0A 2FIUA 3TW0A 1TTHB 2CVEA 2OEMA 4X4UA 3DI6A 2IA0A 3DI6B 1FRHA 3IR7A 2DHGA 4JV2A 4OI6A 4X66F 3HFZB 5DETA 4CO4A 1CJKB 1S77D 4JUZA 3M30A 1SIZA 3PYEA 4RO0A 5IOLA 4LBPA 5GAHI 1UEKA 4GKKF 3TAQA 4F02A 3D6FB 2Z2MA 1TAQA 1M5PC 5E0OA 1RK8A 4RW7A 4BDPA 4NLQA 2VPZB 4R25A 3EPIA 1ZZFA 4ZK7M 4WFBQ 3CD7A 2XY6A 2OTJS 2OEKA 2ROPA 3RB4A 4IO9Q 4ILLA 3UI3A 4C8OA 5EX3A 1KVJA 1IN0A 5L8RC 2UUCF 4HT7A 3CDEA 2VASA 1V5VA 2DISA 3QSIA 4GVBA 3ENQA 3HDSA 2RQMA 4ZOSA 2KKHA 2FZKB 2OI2A 3GG1A 1CJUB 3H5YA 3I56S 1Q8IA 3GTYX 5ETSA 3CD5A 3UFCX 1FFSB 2HHTA 5EUHA 5HO4A 3PV8A 4GKJF 1J27A 2WVBA 1RTHA 2R8GA 2PT0A 2M52A 3M6WA 4P52A 3NS6A 1N34F 1JNRB 2EPIA 5GMDA 4ATNA 1XEZA 1YGYA 2EK6A 3CCVS 3DLKA 1REGX 5T7LB 1DFDA 2HIQA 2Y1RI 2V67A 1RWXB 3O3LA 3R2DJ 1TV6B 1WC1A 1WC4A 2FTRA 2VG6A 2G0IA 3D5MA 2K5JA 2L41A 4USTA 3GG0A 3VAJA 4RNMA 3SEOA 4FKXA 1NJYA 1TFWA 2G9OA 4DI6A 3AXKA 2OELA 4PYDA 1ZS6A 3K8WA 2UXBJ 5CA5A 1ZAXA 3LP1A 5KT2A 4ID5B 5EHHA 1IQTA 3DNCA 5HN0A 3C2PA 2GFFA 4ANCA 5F8HA 2EKYA 1FTRA 4PWDA 5C2GA 1EQ0A 2HS4A 2C3PA 3VAFA 3W2VB 3DRPB 2W9AA 4C97A 1SJFA 3NMAA 3L3CA 4RU9A 5AXNA 2J9DA 4EWTA 1Y0HA 1T9TA 5CCLA 1UWBA 3LP0A 4X64F 2VQFF 1JLFB 1HWLA 3ICLA 5KFNA 4UT4A 3QLHA 3MUVP 3OTOF 2AD9A 2UXCJ 4M5NA 4MKYA 2C2NA 5K14A 2AW0A 4PQUA 1R0AA 4GO7X 2WVEA 2NS1B 1C0TB 4M5IA 1IM4A 1S49A 2VBYA 3IAS9 4FXVA 4LF6J 3QFHA 3ZZZA 2CPGA 2CNNB 2OLWA 4DR3F 3B82A 3PEHA 1YK9A 1FNOA 4WJBA 3R8YA 1HHTP 2KT3A 1WUUA 2E7VA 4ZVHA 2VC0A 2YWWA 2MKIA 3AD7C 3DOLA 1RHKB 5D0EA 1MU2B 1KLNA 2QJ3A 5J1EA 2B0GA 4ECVA 5HMZA 4M1KA 4NX9A 1HBOB 1XQIA 3MM5A 4OZ3A 3VAKA 1W2BR 4N76A 5KTQA 4OFZA 4W98A 4UOHA 1S79A 3CJ0A 4CNZA 5CYJA 4J9VA 2Y8WA 2HBZB 1T95A 5I3PA 1RXOB 5BR8F 4J5OA 1LK5A 2IFXA 1HBUB 3Q89A 3KLHA 2QA4S 2G2YA 3BBCA 2XZTB 3IN5A 2KDOA 2RRBA 4ZLJA 5HL7Q 1UETA 2ZHBA 2GAGC 1MW7A 2Y9HA 5L38A 4DV2F 1GXTA 3DC2A 2JX2A 2MY8A 1SQEA 5IT4A 2HHSA 2PA8D 1HIYA 2LFVA 3JTOA 3FNNA 2LA4A 3HF5A 3KLEB 1EETA 3HFKA 1EETB 3MGJA 1FF2A 4EZ9A 3BGUA 4FN5A 1YZ7A 1WC5A 4HVZA 3UNYA 3GR0A 3GIMA 3BSCA 1D1UA 4CDIA 3H40A 1ZBTA 3NOCA 4TU9A 4I6WA 3MTKA 1NXIA 4C6AA 1SKWA 1UFWA 2ZFHA 2MZQA 3BSNA 3D0GE 3H2VE 3OT9A 2QT7A 2W7OA 1NCLA 4F50A 5KFSA 2DNZA 2L9WA 5KG3A 3M9OB 1G3OA 2R8KA 5AT1B 5F8NA 1N5YB 4USJC 1OMSA 3W65A 2FD2A 4ED6A 1XIQA 3UDVA 2IDLA 4NMLA 2H9ZA 3V5RA 2YX7A 3IC1A 1BXNA 1MWYA 1CPZA 5BJRA 3W8GA 3GPAA 4DZDA 2J9EA 4YR0A 3DM2B 2JBVA 2P2CB 4QR2A 1VC6A 2MKJA 1KFSA 3R5DA 1TKDA 1NM2A 2W8KA 2QLFB 3Q8SB 1VFJA 1Y3KA 3WBZA 2HHWA 4RNNA 3D1OA 3D1HA 4HH1A 2EG1A 4KT0C 2W2PP 3D2WA 2N4CA 3MEDB 4XK8C 5KT6A 1NK7A 1LK7A 4JYAF 2IPOB 2FHJD 3D68A 4IQMA 4CH7A 2Y1LB 3I82A 4P2XA 4L72B 2YH0A 4FF2A 3FGVA 1MROA 4ELUA 1NHUA 4EEYA 3CF5Q 1TU0B 4PG5A 1X9MA 2DHSA 1UJ4A 2UUTA 2VA3A 3G8QA 5HVHA 1REVA 2BBEA 6FD1A 3N28A 3FMTA 4U96A 3OVSA 4DR7J 3H5XA 2CZVC 4ZVOB 3R9LA 5AJ3J 4H4MA 2JFDA 2PMWA 2HK2A 2KXHA 1VRQC 3BM7A 4QIVA 4CO3A 4P6QA 4Q8FA 3UDLA 2NLWA 1SC4B 4H4MB 1AW0A 3UN2A 4KTQA 4KKOA 2RBFA 1PJ5A 1Y10A 2MDAA 1FK9A 2WW8A 2BSQE 4C11B 2WZ1A 4TQRA 2FJVA 4LJMA 4LFBF 4X62F 3GV7B 1RTIB 4TU8A 1VISA 1EJ7L 5KFMA 5IWAF 3KK2A 4QYZK 3RBZA 2LEAA 3M8QB 4ZPCA 2BKOA 2N7YA 3P5BP 2YKPA 1ZM9A 1GX5A 1RAJA 1U7LA 1MN7A 2MMYA 3FEYB 3HSZA 3LO3A 3G8TA 3DM2A 1SKSA 2PN6A 1L5UA 2OPRB 5DDQC 5JVGQ 3DLJA 1NSAA 3R27A 2RS2A 3QGGA 1BQMA 2MZJA 4LFBJ 3GILA 3MAQA 3M2UB 4DL5A 2MQLA 2GGPA 2HWTA 1S7HA 3OL9A 1IKXB 4O3RA 4PWDB 4LMZA 4Z2XA 1J5OB 1WOOA 2DIUA 3BBBA 4EMDA 3HVRA 1U45A 2HPUA 1N32J 2BRLA 2WVCA 4ZDNA 2FZGB 2YVSA 3LGNA 3PYFA 3C3LA 3MCMA 4F8RA 3M1VB 3TZWA 2FHKA 2XG8A 4ENOA 5J1NA 4RW4B 3MCSA 4KGMA 4DL4A 3S8SA 2BZ2A 3KHLA 2OPPB 1RT2A 4GC6A 5KFEA 4PUOA 1Q53A 1IQZA 1NMEB 2CJBA 4PABA 2ZVIA 4V19J 1WF2A 2KN4A 1WDDA 3CT9A 5L9XA 1BUXA 4J9OA 4A8OA 2L9DA 4OYXA 5LJ3Y 4FYDA 5DM6Q 5D78A 1TKZB 1IJEB 2B3TB 1EP4A 3SIPB 3DDIA 2H3EB 3FBEA 4F26A 3QZ7A 1HI0P 1RWKB 5CYMA 2J6UA 3PW0A 2KTQA 4E2FB 1XBWA 3ITHA 1UVIA 2BANB 3RAQA 3PYGA 3X3UA 1VQ9S 4OYIA 1KWMA 4WPAA 1RWWB 1VQYA 2W2OP 1SH2A 1AFIA 2H48B 4AXJA 1FWLA 2VKZG 3GWCA 3C66A 4NZ7A 1FD2A 3UN5A 5AJ3F 2OJ3A 2ZBRA 4Q43A 2XWXA 1WOSA 4ALZA 2A2CA 1S6PA 2CPJA 3J7ZT 3ZXWA 1WF1A 1FI4A 5KFXA 4OL8A 5I3UB 2I5JA 3ILJA 4DBQA 1R0AB 2RS8A 4NXNF 4DV3J 1WJ9A 4L75A 3UR0A 2Q1LA 3SI8A 2ADBA 2PIIA 4U7CA 1EZZB 4WP3A 5EWGA 3QRQA 2A3JA 3SMZA 3VQSA 2CPFA 3N5FA 2YPZA 4F2SA 2Z2LA 4CLKA 4M5GA 3KMQA 2M7SA 2MKSA 1S6QA 3QZ8A 4TU7A 3ISND 5DQIA 3QNWB 3TUJC 2ILYA 5HK4A 1GQEA 5IC6B 4G6VB 1AA1B 3B6BA 1IKWB 1E6YA 4WFNQ 5CCMA 2NXJA 4IUFA 3HULA 5EWFA 3V6KA 1JLAB 3QMQA 2NYIA 1XK8A 5D4LA 4LT6A 3US5A 1Q0NA 2VHGA 5HLFB 5C25A 4XPCA 2FLPA 1U25A 2ASDA 4M63A 3R6GB 5JVHQ 4WE1B 3JYTB 4YOEA 3SDEA 1HNZF 1FJGF 2JZ5A 2HGNA 3GFZA 2CKWA 1X4EA 4MH8A 1U24A 1JB0C 2MSTA 4KO0B 3VR1A 3V81B 4DQIA 4N7TA 5KFRA 1JLEB 4RJVA 1T9VA 4DF8A 1N34J 1Q16A 5HMWA 5KFVA 2JEFA 1RYRA 1PCAA 2NZ4A 4FNIA 2LXFA 5M2PA 4MIWA 1F6TA 4DL2A 2RIJA 3M8RA 4IKAA 2H5JB 3SFUA 2AX1A 4TQSA 1QJHA 1RB0A 2ZH8A 4K4TA 2XI2A 4PZVA 1X0FA 1DRZA 2J0SD 3R3TA 5ETPA 1RSCA 3HVTB 4KR0B 2I6WA 5E3PA 3IXQA 4D3HA 1DARA 1FX2A 4P72A 2NSBA 3W2VA 1T9XA 4DV5F 3CTRA 4H4OB 5RUBA 2WW4A 3IRXB 1VQ8S 1Q8BA 2K3KA 4CZCA 4CT9A 1VHIA 3WDOA 2GHWA 2ZUGA 5JXSA 2C2DA 3MHYA 1IBMF 4QU7A 2ATCB 3A12A 4WZMA 4KJIA 1G6BA 4Q44A 2UU9J 2GAHC 4R8UB 1VHFA 4G1QB 3SCLE 3UNGC 2EEYA 4NCAA 3V6JA 2WRMA 4B9UA 1F5BA 4DPWA 1KOHA 2GMHA 2E5LF 3UCGA 1P94A 3M8QA 2K7KA 3N6MA 1VDHA 3PO4A 2XBPA 3KJVB 4FS2A 4R0EA 3W9JA 2GJ2A 2NXNA 4ECTA 2CDRB 3K2YA 5H9EK 3W60A 1AB8A 5FDLA 2O1PA 1IBMJ 9RUBA 2DH8A 1MYKA 2G0JA 3BYRA 2XS7A 3DU5A 1GTHA 1I5OB 1ACMB 2DBBA 2GQ2A 4RPFA 5KT4A 2MHNA 3MR2A 4M5DB 4OHVA 5LXYA 2CJYB 3FQKA 3K59A 2ZM6F 4C8YA 3LPYA 2KZMA 1F1BB 2CJAA 2A2DA 2JDJA 3DDNA 3DLGB 4ID5A 1UPMB 2XMUA 4NE9C 5DQGA 2GS8A 3DRXA 3OFFA 1XNQJ 3RB3A 4JI5F 2ZH1A 1Q4RA 4DSIA 2E7XA 1MN9A 1NB2A 2EBEA 4W92B 1FNMA 1RWOB 1YKWA 1JLGA 2YWFA 4L76A 3T1AA 3K5LA 4A48A 2OAUA 3PDNA 4QBUA 1VLOA 4N41A 2WCXA 2LCWA 2ROGA 1JLGB 1PILA 4MK7A 3OBIA 2MY7A 2RRAA 3NWRA 5DO2A 3K17A 5BXIA 2E1MC 1H0HB 4ZJLA 3W61A 2OPSA 1K73T 2R7WA 4ILRA 1QTNB 4ZN3A 2OFHX 3MEGA 2XCAA 2GA7A 2KT5A 3CDAA 3QWUA 3L4BC 4KGVB 1YHQS 3JSBA 1U0HB 2CQBA 2EFOA 3ITHB 2CG8A 2M4MA 3AJ2A 1S48A 3R5CA 3AAWB 4DEZA 4LF6F 5THWA 2ZDPA 1RWUA 3KUEA 4QZVB 2D9OA 2F65A 3M30B 1GH8A 3KOAA 3M8PA 2NYHA 4JV1A 2WSEC 3BH6B 1E6VA 3MR7A 1VBZA 2JXIA 3ZTOA 1NLAA 4ANEA 3I32A 4AE5A 4DV7J 1XERA 1XMOJ 1IKYB 3OR2A 2RUGA 4C0OC 4YR2A 1T3NA 4IG0A 5DS7A 3CCMS 1AUDA 3MPVA 2IM0A 2B9EA 2V2ZA 2Z4PA 2KHDA 1N5YA 1N5QA 3K5OA 1S6OA 3CNQP 1K8AT 1N36F 4KFBB 3F73A 1MMDA 2I8EA 2CPEA 3A8JA 1KOOA 4KH0B 3PX6A 4ED5A 4J9NA 3AQPA 1HNWF 2BQUA 2LQBA 5KFJA 2EI5A 4TLRA 2KH9A 2JEGA 3Q8PB 1X4GA 5HJXA 3J7A1 5GADI 4J7CA 3POTA 4ZVPB 2W8LA 1IKVA 3ET6A 2HQ3A 2MGZB 2BXJA 1N6QA 4PWUA 1YZ6A 2OSQA 4UQTA 1NPPA 2DH9A 3UR3C 4CO5A 2R7VA 2R7XA 2RNEA 2W24A 3NAIA 1NSQA 1N0VC 1U2FA 2BE9B 2J9DE 3Q8UA 1HNIA 4F7VA 5KG7A 4ZPVR 4HI1A 1URRA 2OEJA 2RF2A 2YY3A 2W01A 2DEJA 3A3NB 3IM8A 5CYQA 4JB8B 4NEYA 2XO7A 4J9PA 4HHHA 4WFAQ 1GK8A 4NYPA 3UD4P 2CQ1A 2RVJA 3TX0A 3VZIA 1YSJA 2Y8YA 3VVTA 2K06A 4FF1A 4OZ0A 3A3OB 2FGOA 3PM9A 2V2VA 1S12A 4BWMA 3EDRB 4ZJQA 2P6TA 2LKZA 4ZIVA 4B3TJ 3OV7A 3KJNB 3G6VA 1RHMB 2YNIA 1SJQA 1UZHA 2HVDA 2GIQA 3GE9A 3W9IA 4WCEQ 1X8DA 3J81U 4CO2A 2KM8C 2HWHA 2W7PA 5J2QB 2FC8A 1LW0A 1WG1A 1U1OA 4F2RA 3Q2TC 4KHPJ 4KKOB 1UJ5A 1WELA 4R5PB 3P49B 2B8PA 4ECQA 3D0IE 3PW5A 4Q0BB 3JAMU 2HHXA 3KDOA 3VGTA 2AZ3A 3GYXB 3IMQJ 1UFLA 1HYSA 4B3TF 5LL6d 4B02A 3G82A 4CWBA 4DUZF 4Y28C 4BWJA 4DV3F 2VDIA 2A10A 2JOQA 1C4CA 2LEPA 5KFWA 2RMLA 5LMUJ 3RRHA 2QEXS 1YITS 2QLXA 2FVCA 4CYUA 1S9GB 5IWAJ 4A46A 4QPXA 2HG4A 4OJ3A 1NJXA 1B4SA 1YRXA 4FVCA 1S97A 5A6WA 4NCBA 2FPHX 1N6QB 4NLGA 1FXRA 1KQGB 1Z2LA 1IBLF 3Q8QB 4LFAF 3PG9A 4MFBA 2DNLA 3L09A 3KJVA 4QPTA 1SC6A 5KAKA 1VJQA 1C0UB 1SIWA 2H4WB 4FNHA 3O6QA 5SZTA 2R7TA 1HNVB 2HNYB 2W4PA 1GMUA 4OI1A 2FZCB 3ZO7A 5KFCA 4WXOA 4UQGA 4KPYA 5SUHA 5KFPA 1YJWS 1SQGA 1PGZA 3WQPA 2E9TA 2FJXA 5GADU 2C3UA 5A8RA 3HX9A 4EU0A 4LF4J 2FJBB 3VF0B 2PFFB 2CNKB 1XMOF 2W9CA 2H51B 1DTQA 3G4SS 1PG5B 4XPEA 2YKNB 2V8DA 3N6NA 4P2FA 1M90T 3HHNB 1T11A 3QFWA 1YRUA 1RHQB 2HIYA 3MI7X 2W9BB 1LXNA 3MM6A 1EKRA 3HVTA 5B0DA 3NBPA 4X4SA 3AA9A 3PRBA 1TMMA 5LM7E 4DL7A 1N33F 4M5HA 4WU2A 3EVOA 4DZ6A 1U47A 4I6YA 1H7WA 2EC2A 3ZNJ1 1DAXA 3DFEA 1N8RT 4LR8A 3PY8A 2ZITA 4NRUA 3AXMA 3M8YA 3TANA 5D4OA 2FY1A 4JI6J 2OPSB 5JMNA 2DITA 1S1TB 3BPDA 3LANA 4OJHA 2D3ZA 1T05A 5HBMA 2VBWA 1FDDA 4HACA 3GYNA 4ZVFA 2XZWA 4ZS6A 4ZVSB 3H4DA 1GMVA 3EZ5A 4ZVTB 2CQPA 3DKDA 1ZTTA 1RI7A 4DG1B 4PKDB 4B17A 2KL8A 3HP6A 4X65J 3GIRA 1TL1A 1NSKL 1SC3B 3EICA 1MYLA 3OD2A 3HJFA 2IJNA 4PXDA 2HLTA 4RWXA 1TL4A 4Y65A 4ZVQB 1U4BA 4USKA 4KFBA 3V6DB 3J7AN 2C1EB 3FCHA 3TOQA 2DNYA 4UF4A 4J9QA 2IMOA 3D67A 3MECB 2MYFA 3J7Z5 4O44A 2XS2A 2QLWA 3NXZA 4C8MA 3D6MB 2NZCA 2MZSA 4EFAC 3RTVA 2YNGB 1W2IA 2FHOB 3T6JA 1RKJA 1T7PA 4UZCA 4J37A 4ZIWA 4PXCA 1KKHA 1RBAA 2J8SA 2BE2B 4ZJOA 4O0IA 3T19A 3BQ0A 1S6QB 2DTJA 2BJDA 2YKQA 3CDUA 1RT2B 5F41A 1Q7YT 1SL2A 4WKRA 4EUVA 5F8IA 3LTOA 4G65A 3UWTA 1U0HA 2HBQB 2ASJA 1F3FA 2LYVA 2K29A 2B7CB 4DUZJ 1K0TA 4YB6A 1Q86T 5CD4H 3GIKA 2V50A 4QWBA 2PMZD 4LFAJ 5G4DA 1BE4A 2F8MA 2W25A 1CJVA 1VIOA 4F4YA 3DRRB 3PKMA 1P27B 2JEIA 1R0BG 1WC6A 4NI2B 4M5JA 3MMAA 3CMAS 3HCXA 4Q2MA 2Q6BA 1DQ8A 1RP5A 4H4OA 2VFVA 2CFXA 2XMKA 2MZRA 3UPFA 3QRRA 1HWJA 3CJ4A 4FBTA 1WNEA 3LUYA 2CRLA 5J2PA 2M88A 1TL7B 1NK0A 3HLUA 1RABB 3G71S 2EFPA 2YNFA 1LKZA 2PSZA 2F8HA 2XI3A 2YNFB 3IGNA 3CCTA 3H87C 1JLQA 5ETKA 5EGYA 1RJJA 2CA9A 4HKQA 2UUAJ 1RTDA 2CJQA 1BY9A 4I0WA 3V4IB 1H74A 2CQ0A 1IM6A 2DHXA 4X4TA 2CAXA 3FK4A 4U8VA 1C1CA 1OQ3A 1U2RA 1A7GE 1C1CB 2QIFA 4LR7A 4MK9A 2RILA 3OXGA 5B7WA 1DQAA 4G1IA 3T5LA 4A8KA 1M1KT 1RWVB 4TVAB 1Y9OA 5LSRA 4JI6F 1SI9A 3KUGA 3JYTA 2JLGA 2KYXA 4Q7AA 2F4FA 1NH7A 1Q79A 5B0FA 4LF1A 1DLOB 2I38A 2ZZTA 1HFEL 4L3KA 4RNOA 1I6JA 4JI4J 4JI8J 1WHWA 1P1LA 2CQHA 2QA1A 3TEGA 1B64A 1TUGB 2LMIA 3DLGA 4CO0A 3CCLS 2LP4A 3C16B 2AJFE 3IA0A 4I69A 4L74A 4AQYF 3S1TA 1CJUA 4RR5A 1YJNS 2CDQA 3P8BB
chains in the Genus database with same CATH topology
2PC6A 1QTGA 2K5JA 1P94A 2CA9A 2JXGA 3QOQA 2BNWA 2GPEA 2BJ7A 2AY0A 2WVEA 1BDTA 3QSIA 2BNZA 2H1OE 2K29A 3FMTA 1ARQA 3VEBA 2CPGA 1MYLA 3OD2A 3VEAA 2KELA 2CAXA 3BKUA 1MYKA 4FXEA 2FGCA 2Y3YA 2CADA 2F1FA 2WVFA 2HZAA 1PARA 3LGHA 4HV0A 2BJ3A 3FT7A 1EA4A 2K9IA 1BAZA 2RBFA 3BKTA 1IRQA 2WVBA 1B01A 2BJ1A 3PHTA 1MNTA 2WVDA 4ME7E 2BJ8A 1BDVA 3BKFA 1Q5VA 2HZVA 1X93A 4D8JA 2BSQE 2NZCA 2BA3A 2JXHA 3GXQA 2JXIA 2WVCA 1ARRA 1NLAA 2CAJA 1B28A 1Q5YA 2K6LA 2K1OA 3H87C 3VW4A 2BJ9A 1U9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PC6 A;  1QTG A;  2K5J A;  1P94 A;  2CA9 A;  2JXG A;  3QOQ A;  2BNW A;  2GPE A;  2BJ7 A;  2AY0 A;  2WVE A;  1BDT A;  3QSI A;  2BNZ A;  2H1O E;  2K29 A;  3FMT A;  1ARQ A;  3VEB A;  2CPG A;  1MYL A;  3OD2 A;  3VEA A;  2KEL A;  2CAX A;  3BKU A;  1MYK A;  4FXE A;  2FGC A;  2Y3Y A;  2CAD A;  2F1F A;  2WVF A;  2HZA A;  1PAR A;  3LGH A;  4HV0 A;  2BJ3 A;  3FT7 A;  1EA4 A;  2K9I A;  1BAZ A;  2RBF A;  3BKT A;  1IRQ A;  2WVB A;  1B01 A;  2BJ1 A;  3PHT A;  1MNT A;  2WVD A;  4ME7 E;  2BJ8 A;  1BDV A;  3BKF A;  1Q5V A;  2HZV A;  1X93 A;  4D8J A;  2BSQ E;  2NZC A;  2BA3 A;  2JXH A;  3GXQ A;  2JXI A;  2WVC A;  1ARR A;  1NLA A;  2CAJ A;  1B28 A;  1Q5Y A;  2K6L A;  2K1O A;  3H87 C;  3VW4 A;  2BJ9 A;  1U9P A; 
#chains in the Genus database with same CATH topology
 4TXS A;  4IFY B;  1YLX A;  4BHQ A;  4HHJ A;  3UQS A;  2GW8 A;  4UTG A;  4PAA A;  2IVF B;  2IJF A;  5B0E A;  2ZWO A;  1X5S A;  2JL9 A;  1R89 A;  4USM A;  1OPZ A;  3IAM 9;  3QSY B;  3T3F A;  1SJ3 P;  4DL0 C;  3DLL Q;  3VEA A;  2YKO A;  4U8Y A;  5DGA A;  2IMW P;  3MR3 A;  2UXD J;  2R2R A;  3W5X A;  2F1F A;  5DLF A;  2VIC A;  1ITP A;  4HV0 A;  3BO3 A;  3KHH A;  2I1R A;  1K0V A;  1UVN A;  3MR5 A;  1PC5 A;  2DGS A;  4KGZ B;  3R7N B;  3GJT B;  4X4R A;  2XM3 A;  2VOO A;  3JQM A;  2C2E A;  1RT7 B;  2RT3 A;  1U6F A;  3JTP A;  3GIJ A;  2D7S A;  4O23 A;  1LXJ A;  3EMT A;  1MRO B;  2B4U A;  1S59 A;  3DLE B;  1RAG B;  1B28 A;  1XR7 A;  3QQC D;  4DX6 A;  2RB7 A;  1LV5 A;  3OXF A;  2AJ2 A;  1VQS A;  2LU2 A;  4P7T A;  5HQL A;  2YH1 A;  3JAM Y;  1RZM A;  4NZ0 A;  3LJP A;  3P6Y C;  4ECY A;  4OV1 A;  1NK9 A;  3FQL A;  3CJK A;  3W8P A;  2J6S A;  3U02 A;  1UKU A;  2H1Y A;  3NBP B;  4A8X A;  2KXN B;  3T9Z A;  3RJM B;  2HLU A;  1D8Y A;  2KB2 A;  3VV2 B;  4DR7 F;  4MKA A;  2COL A;  2IAJ B;  3L9Z A;  3WC0 A;  2HK3 A;  4PQA A;  2C3Y A;  2N7C A;  4UZB A;  2HFO A;  3R97 A;  1EP4 B;  2MQO A;  1RE1 B;  3D0H E;  3I4H X;  3IP0 A;  3HHE A;  1CS4 B;  2CG4 A;  2G1D A;  4O3P A;  4JI7 J;  3C6T B;  1W25 A;  4ZIT A;  1RT6 A;  1S0N A;  2BA3 A;  3U7J A;  5HBM B;  1CC7 A;  2OH2 A;  3G2X A;  1NBE B;  2HS0 A;  4G1P A;  2Y0B B;  4DOZ A;  1ZM3 A;  2RRN A;  5KFF A;  1T05 B;  2QGF B;  4ILM A;  1J2V A;  2CVI A;  4ELT A;  3G87 A;  4HL9 A;  1WHV A;  1LWF B;  2QYG A;  2V4J A;  3QIP B;  4RUB A;  2XCP A;  2CPI A;  4RW4 A;  5E3Q A;  4BS2 A;  2AV5 A;  2WHO A;  5JUM A;  1XR5 A;  3GLJ A;  3K58 A;  1SC1 B;  4O3Q A;  1RQ0 A;  2E9R X;  4F4Z A;  1HBN B;  1AT1 B;  5C5J A;  2DGV A;  2YBV A;  4WK1 A;  5ETQ A;  4DUY F;  1M5S A;  3RAM A;  3AA8 A;  2N3L A;  3FKB A;  1HR0 F;  3CGI A;  2BAC A;  2BE2 A;  2I5J B;  3FZB A;  3HVA A;  4HHU A;  3CJS A;  3GU0 A;  2IM1 A;  1VQM S;  2RKI B;  4NXM J;  3QJL A;  2OP5 A;  2HZC A;  2A6O A;  1FKO B;  3IBW A;  2ILZ A;  1WHY A;  3JSM B;  3NG8 A;  4PXE A;  1LFW A;  1AYE A;  1X4B A;  2CPX A;  4LF4 F;  2HQC A;  4KQZ A;  4KY3 A;  4ZLN A;  3EYZ A;  2K2P A;  5KFL A;  3TJ8 A;  1JJ2 R;  4I7F B;  1FVS A;  2HWI A;  4DUY J;  3MOJ B;  4X4P A;  3MDF A;  4GKJ J;  3DOM B;  5K8P A;  3N5B A;  2FVS A;  4OI4 A;  2Q6C A;  1U1L A;  3SFG A;  1HQU B;  1PAU B;  1S1W A;  1YBU A;  4WBF A;  4C0B A;  4QR1 A;  3AD8 C;  2F8E X;  4XIU A;  1NO8 A;  1UAW A;  2XSF A;  3KG4 A;  2C22 A;  3N0V A;  4M5K A;  1H3D A;  2P9E A;  1W7W A;  4CLZ A;  1X60 A;  4NLR A;  3ZC4 A;  4ES3 A;  4ZLP A;  2X1A A;  3EWG A;  2JFK A;  4CQ1 A;  1KC8 T;  2QG9 B;  1RTD B;  3NNH A;  2E5L J;  1T9W A;  4NA2 A;  4NLY A;  1HD1 A;  4B9M A;  1Y7P A;  1ZM4 A;  3IGV A;  5I42 B;  2NR0 A;  4RWW A;  1VC5 A;  2YXL A;  3CCW A;  5HAT A;  2M0G B;  5EWE A;  5LMN J;  1BC6 A;  2YTC A;  2AJ4 A;  3MM8 B;  7FD1 A;  5DZ7 A;  2SXL A;  2WAQ D;  3CCU S;  2MZ1 A;  2U2F A;  1XNR J;  1RHU B;  1RIS A;  1TEL A;  5AE2 A;  2H5E A;  2WK4 A;  3I4P A;  2HUR A;  4Y34 A;  2BJ7 A;  4FYV B;  2ZJQ Q;  2M2B A;  4O3N A;  3T1H J;  1PC4 A;  3FMW A;  4K2X A;  1VYA A;  1XJW B;  4B9V A;  2JLE A;  1BQM B;  2C28 A;  2Z30 B;  1S72 S;  2QA2 A;  4EZ6 A;  1WF0 A;  4A8S A;  4KRW A;  2B9X A;  4HTJ A;  4C7Q A;  5KG2 A;  1QAJ A;  5D0G A;  2DKO B;  1FEH A;  4J91 A;  1ICE B;  4OYW A;  4MIA A;  1BAZ A;  4RW7 B;  2QC3 A;  1QM9 A;  2GJI A;  5FD1 A;  4LIW A;  1OYD A;  4OYZ A;  4IFV B;  2DXF A;  4ZVE A;  4RUH A;  2ACY A;  4MIB A;  2RU9 A;  2J6T A;  1RGV A;  3ZZU A;  4TYB A;  3ZTQ A;  4YP3 A;  1UW9 A;  3LH2 S;  5CYQ B;  4FP9 A;  1AXQ A;  4QOT A;  2RJZ A;  3B54 A;  4DFK A;  4OZ5 A;  3Q2S C;  5KFA A;  2CPD A;  2NQP A;  3DLK B;  5F9N A;  4ECS A;  2BQR A;  4ZPT R;  1S9G A;  4JYA J;  3NS7 B;  3R5B A;  4AL7 A;  1DZ5 A;  2PEB A;  4LF9 J;  1RTH B;  4LF5 F;  3NGR A;  1JNZ B;  1H2T Z;  3UVJ A;  1URN A;  8AT1 B;  2GQQ A;  1Z1Z A;  1UFK A;  2B9Y A;  2NUH A;  2OO4 A;  3ETM A;  4LVO P;  4OZ2 A;  4QJV A;  4Q2L A;  4UOC A;  5LT5 A;  5DLG A;  1HD0 A;  4DUT A;  4Y0F A;  5GAG I;  2UUB F;  1S1X B;  2DPI A;  2DPJ A;  4YN3 B;  2VFR A;  4F0H A;  2CWX A;  2VFU A;  3N79 A;  4KPC A;  3DHX A;  4IDK B;  1WC3 A;  5H9E J;  2V94 A;  3PJ9 A;  3DN9 A;  1EIY B;  1YG0 A;  2CXE A;  3KG0 A;  1VBY A;  1JMT A;  1TUW A;  1APS A;  1TV6 A;  4NLU A;  2MQQ A;  1BQX A;  1T0T V;  2UZA A;  3BPS P;  3KK1 B;  3FCW A;  2UUC J;  3C15 B;  5GVQ A;  5T7L A;  4X4Q A;  1U1K A;  4B3O A;  2AP6 A;  4C8L A;  2DNQ A;  2FJW A;  3DYA A;  3CC2 S;  3RW7 A;  2G4B A;  1Y4Z B;  4WFZ A;  4DR6 J;  4F4X A;  3OR1 B;  2BM0 A;  3NGU A;  1FRI A;  1TMJ A;  3NP5 A;  2ADL A;  4RW8 B;  4RW8 A;  3I0R A;  4TKT A;  2FJA B;  3G6E S;  3T5J A;  3VEB A;  2NSC A;  3MM6 B;  5F0W A;  3BEG B;  1QVG R;  3BO2 A;  1UEU A;  3PTW A;  1N5T A;  1JQG A;  4X65 F;  4X4O A;  1FKP A;  1IWA A;  1OY6 A;  2LA6 A;  3TRG A;  2F9J A;  4K5S A;  5KT3 A;  1B0P A;  2XLK A;  4DQR A;  1G1X A;  4ED1 A;  3HHL A;  1MU2 A;  1UZD A;  4RKU C;  4CTA B;  2H3A A;  3MPD A;  1N4L A;  1IR1 A;  4U7U D;  1CQM A;  2BOP A;  1HLW A;  4DV1 J;  3MZI A;  2OD4 A;  2Z2Z A;  1ZPW X;  3H5S A;  4KB7 A;  3ZZT A;  5KG5 A;  1R8A A;  1RHR B;  3D3C J;  3GJS B;  2K6L A;  3HZE A;  1SBR A;  4KBI A;  1TP7 A;  2F5G A;  1OO0 B;  2A6M A;  2ZE2 A;  2V4J B;  5D15 A;  1RWM B;  1S57 A;  3PJX A;  3W1Y C;  5KFH A;  4FF3 A;  3LW5 C;  4S0M A;  4YEA A;  3RZA A;  4FS1 A;  3BS9 A;  4IH7 A;  1WTF A;  1SV5 A;  5F9L A;  3KLE A;  2RH3 A;  2YKN A;  4Q8E A;  3MPW A;  4DJB A;  3BR9 A;  5A8W A;  1PIE A;  5A8K B;  4XDD A;  4DCO B;  4YS2 A;  1R7I A;  2BMB A;  3OL7 A;  2Y1I A;  3CIM A;  1JXL A;  3LWM A;  1SXL A;  3FBB A;  4MT1 A;  5T14 A;  4EBE A;  1RAE B;  3KLH B;  4UUX A;  4RW6 A;  3RR7 A;  2LXU A;  2IJR A;  1VR6 A;  1JJ4 A;  4N56 A;  5ETO A;  1H6K X;  2K1R B;  3QWP A;  2FUG 9;  4I56 A;  2HEK A;  5A76 A;  5IT0 A;  4R5P A;  5GAG U;  3KLG B;  1C4A A;  1ROF A;  4JI7 F;  1D3W A;  1K44 A;  1TQL A;  4Y2C A;  5GMK a;  3TQ1 A;  1XC9 A;  1I94 J;  1F3V A;  1YJR A;  2AEM A;  3DCA A;  4DV4 J;  1VIX A;  1VGY A;  4DV7 F;  2ZBC A;  1X5T A;  5GAH U;  1IBC B;  1V3S A;  3JTN A;  2KI2 A;  4AXI A;  3W3S A;  1WEZ A;  3CUN A;  4NZ6 A;  1VK3 A;  2Y3Y A;  1AZS A;  5KFK A;  3NGK A;  2QLJ B;  1QD1 A;  2CQ2 A;  1PKU A;  2G2Z A;  3N4W A;  2B8Q A;  1ZET A;  2C3M A;  1ULR A;  1KHV A;  4ECU A;  3RB6 A;  3IR6 B;  3G96 A;  2AGO A;  1FJG J;  3QO9 B;  3HFV A;  3PCO B;  4WWS A;  2RF2 B;  4NCG B;  1BGX T;  1RTJ A;  2MXY A;  2LEC A;  2ATL A;  1SKU B;  2DGT A;  1RDR A;  2F63 A;  2CPY A;  3H42 A;  2CJX B;  2P8I A;  4OHW A;  5HVF A;  3QT6 A;  5AE1 A;  3SQO P;  4PCQ A;  4ZN1 A;  2X3D A;  2DO4 A;  3EE3 A;  1GEH A;  4GVB B;  3PKY A;  3BZQ A;  4Y2K A;  3PX4 A;  4FYW B;  4BC9 A;  2XY7 A;  2JXG A;  4H4K A;  4EBD A;  2UV8 G;  4F4W A;  5KFD A;  2DH7 A;  3L7U A;  4A8M P;  3M6V A;  1MLA A;  3ZZP A;  1D9F A;  2ZKU A;  1LOU A;  1HMV A;  2ZVS A;  3QGP A;  4R8U A;  3CED A;  3HXM A;  2GZO A;  2VUG A;  2XMA A;  3CC7 S;  2BR0 A;  4CLF A;  1UMJ A;  3OSP A;  2DNO A;  4DL3 A;  4KV8 B;  4CIO A;  1LW0 B;  1C1B A;  3I87 A;  1S1V A;  2DXD A;  1CJK A;  2QX0 A;  3D66 A;  3GV5 B;  5IS2 A;  2O66 A;  2DNR A;  2VPX B;  4ZVR B;  3TNV A;  2YNI B;  2MZT A;  3HHL C;  1YJV A;  5FLX Y;  3TAP A;  2P6S A;  4YQW A;  2XS5 A;  4RZR A;  1ZA2 B;  2V8G A;  1TKX A;  2M8H A;  4ID8 A;  2DCL A;  1DTT A;  3BN4 A;  2XB2 D;  4H54 A;  4DCJ B;  5E3C A;  2KVI A;  5D4P A;  1EHW A;  3ENA A;  1IBK J;  3EXC X;  2ZJP Q;  3EM1 A;  1S1U B;  2H54 B;  4C0H A;  3VHQ A;  4O0N A;  3J80 Y;  3SV3 A;  2AF6 A;  2C2K B;  2YWH A;  4IG3 A;  1N48 A;  2ZM6 J;  2V8P A;  1LNQ A;  2MKC A;  3RBX A;  2DY1 A;  1BMQ B;  4OHX A;  3VGV A;  1TL7 A;  2AYG A;  2KFZ A;  2LVW A;  2F4V J;  2R4F A;  2UVW A;  4OHY A;  1H72 C;  2KFN A;  3F41 A;  1CBK A;  2NPI A;  2C42 A;  3SDE B;  2BAB A;  1UVM A;  2L3M A;  3GYG A;  4KHM A;  3HD1 A;  2KG1 A;  3N9U C;  4LSL A;  1WC0 A;  1HQ2 A;  2DR6 A;  9ATC B;  4F3Q A;  3F44 A;  5KOX A;  5C25 B;  1F9H A;  2BRK A;  4L3N A;  1U09 A;  3TA0 A;  1DY3 A;  3ZTP A;  3ZTR A;  3PRV A;  4U6P A;  4FPI A;  2VJU A;  3CJ8 A;  3M7V A;  1KNZ A;  1B0V A;  3CW2 C;  4WXW A;  1QAI A;  1V6H A;  2UU9 F;  3B4D A;  1F5C A;  1SJR A;  1YBT A;  3TVK A;  4LF8 F;  3OL8 A;  3MMC B;  5J2N A;  2XMW A;  3I5C A;  4DL6 A;  5HSP A;  3Q0A A;  1T03 A;  2DRB A;  2F7V A;  4ELV A;  3NO7 A;  2CPH A;  4PG8 A;  1T94 A;  3MUM P;  3ZZ0 A;  4AND A;  4CH1 A;  3NGD A;  1QSY A;  2HZA A;  1T03 B;  3CJ3 A;  1NPR A;  2IHR 1;  2ZOM A;  5LMU F;  2AEF A;  2A18 A;  5E7O B;  3I0R B;  1H7X A;  4CLY A;  2IM2 A;  1UVK A;  3V6D A;  2K3I A;  2MTL A;  3AY0 A;  2Q79 A;  3MM9 B;  2WON B;  1V3R A;  2DXE A;  2WSC C;  2HQD A;  3ENV A;  3EGV A;  4IOB A;  4OI2 A;  2GX8 A;  7FDR A;  4GO5 X;  3RRK A;  3RG6 A;  1LWX A;  2IVY A;  2VPW B;  5B09 A;  1HNW J;  3AOA A;  2VB6 A;  1G7C B;  4H4K C;  2EKN A;  1KP6 A;  2D69 A;  2OFG X;  2E29 A;  2ABY A;  1JXE A;  2QL7 B;  2O5D A;  3FEX B;  3TZX A;  1S10 A;  1JKH B;  2V6A A;  4JI0 F;  2W7A A;  3CO9 A;  2R9L A;  1EAR A;  3DMJ B;  4DMZ A;  1HPZ A;  3PW7 A;  1ELO A;  2LLZ A;  1FX4 A;  1WI8 A;  3IBC B;  4QU6 A;  1U1N A;  3V6H A;  1Y5L B;  4ZCM A;  1P9Q C;  2BV3 A;  2RHQ B;  2FVR A;  4IOA Q;  1EKS A;  1OSC A;  5KFY A;  2ASL A;  1K1S A;  3CCZ A;  2B6A B;  3OTD A;  2MKK A;  4LRD A;  3BV8 A;  2XNQ A;  3MPY A;  1RWN B;  3VWS A;  2OSR A;  4N77 A;  1SPB P;  1RA6 A;  1TKZ A;  5C7P A;  1SH3 A;  2ZH9 A;  4ER8 A;  1FD8 A;  1SL1 A;  2DR5 A;  2DNK A;  3O5T B;  3EDQ B;  3PIP Q;  2BNW A;  3T5H A;  3MAA B;  1G2E A;  2MKH A;  2N4D A;  2YQ1 A;  2V69 A;  4RLE A;  1HI8 A;  1PBA A;  1R0C B;  1UPP A;  1XMQ J;  1JJH A;  1UP1 A;  3IO1 A;  5KFQ A;  1VQO S;  5FJ4 A;  3BDP A;  2L08 A;  4KH1 B;  3JS9 A;  3LQV A;  1OHN A;  5D0R A;  1X4C A;  1JLC A;  5KG1 A;  1C2P A;  3QAU A;  1OYE A;  4HH0 A;  4HDG A;  1HI1 A;  2AT1 B;  1O51 A;  2E1A A;  2J0X A;  3H2L A;  3HI9 A;  1C0U A;  3T9N A;  2FVQ A;  3IFE A;  3KNG A;  2R8J A;  3ONQ A;  2HFZ A;  1JXV A;  2HFN A;  5EX0 A;  1IKW A;  4ZPW R;  2VQF J;  1BDV A;  2B5J A;  1DTT B;  2BVZ A;  4I2Q B;  4PR6 A;  4CRJ A;  2MQ8 A;  2PEH A;  2QSF A;  4ITS A;  4LBI A;  1NDP A;  4JI2 J;  1CVJ A;  2AQ4 A;  2BX6 A;  4WF9 Q;  4OYB A;  3LOU A;  1PYS B;  4CI0 B;  3UO0 A;  4OX7 A;  3RAX A;  4TNO A;  4B3R J;  5B08 A;  1QTG A;  1C1B B;  3A8I A;  2EC0 A;  1BLU A;  5AXK A;  2VFS A;  2YNH A;  5I42 A;  4OJ1 A;  2W2N P;  4QWA A;  2ZC3 A;  2K8G A;  2XGP A;  4K8R A;  3QT5 A;  2HVZ A;  3A4T A;  2J0Q D;  3T6B A;  4XAK A;  1TL3 A;  2PI5 A;  4KO0 A;  1JLA A;  2Q66 A;  3M6X A;  5KFG A;  3UDC A;  2JVR A;  2PA3 A;  5AXM A;  4Q5V A;  4YDD B;  2CIM A;  1FK9 B;  3TP2 A;  3MR6 A;  2FQQ B;  1LWC B;  4M5M A;  4ME7 E;  1PBU A;  3MAH A;  1B3T A;  2HZV A;  2GVD A;  1R8H A;  1YX2 A;  2P5V A;  2A1B A;  2A0F B;  2POK A;  3NY0 A;  4KC5 A;  4V1A k;  4YB7 A;  4ETZ A;  2ASY A;  2QLB B;  4NCG A;  4DV2 J;  3TAM A;  2L9N A;  2D3O 1;  2FC9 A;  1TL1 B;  2XHW A;  3I9Z A;  1U6B A;  3CSK A;  1FER A;  5KFT A;  3ZTS A;  1REV B;  3E51 A;  3W64 A;  1KRP A;  2E5I A;  4GKK J;  3EZU A;  4P9S A;  3KLI A;  5B0B A;  4B3M F;  3F0N A;  2W4D A;  1Q8K A;  3ENW A;  4ETX A;  3L95 X;  4JI0 J;  5CXT A;  1TL3 B;  5D6G A;  2RSQ A;  3LGM A;  3QRP A;  3KLI B;  1DHM A;  1SH0 A;  1TAU A;  3TUI C;  2UUA F;  2DNP A;  4P73 A;  1FE0 A;  3L7P A;  1RBL A;  2L48 A;  4IDK A;  1MWQ A;  1ZTW A;  2MSS A;  2HHU A;  3KYL A;  1TL5 A;  3EX7 B;  4NLT A;  3H25 A;  3OXL A;  5HAN A;  3MFH A;  1R3N A;  3PJW A;  3GXQ A;  1LWE A;  3QLH B;  4HEA 9;  4NLS A;  4A4J A;  2R7S A;  5B0G A;  5ETT A;  3OLA A;  1CUL B;  2LQ9 A;  4PRF A;  1NJW A;  1IJF B;  2CQ4 A;  2ZKT A;  3N01 A;  2U1A A;  2EVZ A;  2VDH A;  1RT1 A;  5B0A A;  1B7Y B;  2NPF A;  5IM0 A;  3OJS A;  2PDA A;  3B8H A;  4HT5 A;  4NAS A;  3CME S;  4QYR A;  5ETM A;  2IBO A;  2QMU B;  3W2W B;  2MJN A;  4DR3 J;  1SJ4 P;  5IM0 B;  5IT9 U;  3CVK A;  2LXI A;  4HI2 A;  2AU0 A;  2KEL A;  3Q8R B;  2JNJ A;  3D6H B;  4CLT A;  2XLJ A;  2QFI A;  3LP1 B;  2PD1 A;  4WIQ A;  1S9F A;  1RT7 A;  4NL5 A;  5BR8 J;  3J7Y I;  3G86 A;  1GMW D;  1NHV A;  4ZA1 A;  5CYM B;  2XGQ A;  2DY9 A;  1SIW B;  2G0C A;  1LEO A;  1OSD A;  5K14 B;  3VAG A;  3FFI A;  4CNY A;  2K7J A;  4IOC Q;  4NXN J;  2UXD F;  4B3O B;  3I0S A;  1Q78 A;  4B3R F;  4QW9 A;  2P9C A;  1OQ6 A;  4ZP9 A;  4JP8 A;  3HT0 A;  2HHP A;  2CAJ A;  3DXB A;  3GMG A;  1TK5 A;  1J5O A;  3AT1 B;  4U95 A;  4TYA A;  3VW4 A;  2DNG A;  3JXO A;  2ZH6 A;  3NNC A;  3DOK B;  3S01 A;  3C8Y A;  4OX9 F;  1A6L A;  4P75 A;  1QVF R;  4RU2 A;  2MQP A;  1NKC A;  1RAH B;  2IAJ A;  5L9N A;  3G8S A;  1KLM A;  1KON A;  4YME A;  5C42 A;  1KLM B;  5C42 B;  4E8U A;  2NRE A;  2JSX A;  1XWL A;  2DIV A;  1TK0 A;  1HPZ B;  2CQD A;  3H2U B;  3AOC A;  4CM2 A;  4X64 J;  3HD2 A;  2C2Z B;  1KBR A;  1UW4 A;  3K5P A;  2AMC B;  2B7B B;  2QSW A;  3BGR B;  4X62 J;  1N54 B;  1JKH A;  1MG7 A;  2X1G A;  2HND B;  3Q8Y A;  2R2T A;  1FNX H;  2EXU A;  2DNH A;  3BDE A;  3THV A;  4K50 A;  4E0D A;  2NXE A;  4M5L A;  1J5E F;  1LW2 B;  2ZD1 A;  4LF7 J;  1VLY A;  1RTZ A;  3WZ0 A;  2GVZ A;  4YR3 A;  5ETN A;  2HNZ B;  2UUB J;  4B9N A;  2OPQ B;  3NGT A;  1HBM A;  4M94 A;  4D3G A;  2RDD A;  5DG9 A;  1S4F A;  1TUV A;  1WEX A;  2BJE A;  2NXU A;  1S6U A;  1U6Z A;  3D3B J;  3NEK A;  4RNF A;  5L1I A;  1HBM B;  3FCV A;  2DGQ A;  3VCD A;  2HYI B;  2HHV A;  4Y2M A;  5DGB A;  2GC8 A;  1X9S A;  1NZA A;  5EN1 A;  2DK2 A;  3H4B A;  2GMJ A;  1J5E J;  1H98 A;  3LWL A;  1QY7 A;  2BYC A;  3D6T B;  3D7S B;  3TO8 A;  1EA4 A;  4EYH B;  3QJJ A;  3JSM A;  2HFS A;  2DGO A;  4O44 B;  3FUY A;  4KYZ A;  3PR5 B;  3ET6 B;  1HW9 A;  3NGS A;  1LQ9 A;  5J1P A;  2AJ1 A;  4ZP8 A;  2KU7 A;  1HR0 J;  2J7K A;  4DR4 J;  1HHQ A;  2QE5 A;  4K4Z A;  3M2R A;  4X2B A;  1P1T A;  3SQG B;  1VQ5 S;  3NLC A;  2J8A A;  5L39 A;  4K4S A;  2GQC A;  3CJR A;  5EDW A;  2V4R A;  1PYO B;  1RCO B;  2DEI A;  2LU1 A;  4B3S J;  3KDN A;  2JC1 A;  2KT2 A;  1GMW A;  3D28 A;  4NXM F;  1XMB A;  2HMI A;  3CUL A;  3IG1 B;  2GML A;  3NCR A;  1VQ6 S;  1NSP A;  3CDB A;  1IBK F;  4NYO A;  2FHJ A;  3KJF B;  1D0E A;  2O3D A;  4FYX B;  3MD1 A;  3GFH A;  1FXD A;  3HJV A;  1PYT A;  4UY8 T;  1QE1 B;  3BF4 A;  1H2V Z;  3K89 A;  1Y3J A;  2BJ3 A;  4P7V A;  5C2C A;  1S7I A;  2YPY A;  3F56 A;  5F8J A;  1V5I B;  2R7O A;  3FVY A;  4WE1 A;  1A0O B;  2Y1J A;  1OJ4 A;  1D9D A;  4ES1 A;  3C6U B;  3PAC A;  1FHT A;  1GT8 A;  3TAM B;  4MYU A;  1HW8 A;  4DV6 F;  4USH A;  2VBX A;  3K57 A;  3NNE A;  1T8E A;  5CZV A;  4JI4 F;  1RYS A;  4L6V 3;  5D4N A;  1RT4 B;  1TFY A;  1VQP S;  3OFG A;  3GQC A;  1DTQ B;  5A2Q Y;  1MWZ A;  1FFW B;  5CH7 B;  3MXH P;  1NZ8 A;  3HHL D;  4F4A A;  4IH6 A;  2NUU G;  3FDS A;  4DPU A;  1RT1 B;  4Y00 A;  3W7B A;  2RE1 A;  2RKI A;  1EX8 A;  3QT7 A;  3BQ1 A;  2DGU A;  3CJ2 A;  1HWU A;  3Q86 A;  3ILO A;  4ES2 A;  1M5K C;  3HSG A;  2I2Y A;  3UCU P;  1XNR F;  1B7F A;  2LQ8 A;  3K7R A;  5D77 A;  2XYG B;  4OYM A;  3OHB A;  2WON A;  3OLB A;  3RRG A;  4Y2A A;  2BKN A;  3CCE S;  5L1J A;  2HVH A;  3D54 A;  4N8N A;  2GO9 A;  1U0S A;  4M5D A;  3E8O A;  2KRB A;  3U1M A;  4ED2 A;  1ZYQ A;  3H7H B;  2JXH A;  4WP9 A;  2CZ9 A;  3VZH A;  1N5S A;  3KG1 A;  4C8K A;  2DHH A;  2QO3 A;  4LF2 A;  1X4F A;  2GVD B;  2CPZ A;  4C48 A;  4DLG A;  2VD3 A;  1S0O A;  1M5O C;  4DSJ A;  3HO1 A;  3K0J A;  1TVR B;  4ZHR B;  4N5S A;  1FT8 A;  4ED3 A;  4DQQ A;  3SZ2 A;  3MMC A;  4YDX A;  1RAF B;  5J2N B;  4DWI A;  1WG4 A;  1FKO A;  2HFV A;  3I31 A;  4GMK A;  4KV8 A;  4DSK A;  2D74 B;  5DDR C;  1ARQ A;  4LRA A;  2HBY B;  3CCS S;  1CUL A;  1XN9 A;  2VG5 A;  1ARO P;  3DDK A;  3NAH A;  2AZ1 A;  5IFM A;  3KHR A;  3GCX P;  2CJ9 A;  2VC1 A;  4FDF A;  4USI A;  4YHH J;  2VIH A;  5LXR A;  4OV6 A;  3P5T L;  4GC7 A;  1U1M A;  1HNV A;  2HNY A;  3PNI A;  2AHO B;  3H8Y A;  3FRZ A;  1KDN A;  1OG7 A;  2KOE A;  4UUW A;  1F9F A;  1U8W A;  3R7S B;  4QWE A;  2G13 A;  3QIP A;  1JJC B;  5KFZ A;  4BLG A;  4J9M A;  2MLZ A;  5HI7 A;  1NDL A;  2RDJ A;  1N52 B;  1UWB B;  3D1Q A;  3LP0 B;  2W2M P;  4HAC B;  4NLO A;  4NA1 A;  3IS9 B;  4OLO A;  2KM8 B;  1Q1K A;  3DLE A;  4WK3 A;  1GTE A;  1ARR A;  2V0N A;  2GHP A;  3Q83 A;  5DM7 Q;  4A8Q A;  2QN6 B;  3DRP A;  2ALZ A;  4B9T A;  2XEX A;  3C6T A;  5E5N A;  3WC2 A;  1CC8 A;  1FDN A;  2HGM A;  3FEZ A;  4I2P A;  2OMO A;  3I5A A;  4WFY A;  1UTA A;  5K5M A;  5K8O A;  2R2S A;  3PVX A;  1F5A A;  1C0T A;  3KWM A;  3NS5 A;  1VBK A;  2YNH B;  3CB4 A;  3AHP A;  4OX6 A;  3V2U C;  5BYS A;  5HRO B;  5HRO A;  1X0P A;  4A8W A;  2D1C A;  4HLB A;  2MHE A;  2W2Q P;  3BO4 A;  3IBF B;  2CNL B;  4DS4 A;  2GIF A;  5F3Z A;  4OIX A;  2LQJ A;  3WX8 A;  4K4W A;  1QUV A;  3FJ2 A;  3CD6 S;  1HBO A;  3MM5 B;  1YQH A;  2YKM B;  4DFJ A;  1ZH5 A;  3LA0 A;  4AUK A;  1Q82 T;  1WKL A;  1NPK A;  1RBO B;  2KYZ A;  1NJI T;  1S5Z A;  4LFC J;  1ZAW A;  4HDH A;  2F40 A;  4O4G B;  2OML A;  4PG6 A;  1N0U A;  4BBY A;  4DDF A;  4WZQ A;  3EZO A;  1S76 D;  3MUT P;  1U1Q A;  4FXD A;  1RUS A;  3MMB B;  4BCA A;  4DPO A;  2IVM A;  4OZJ A;  4QQB A;  1DLO A;  2R7U A;  4UW2 A;  4P2M A;  4DR2 F;  3LPE A;  2EFG A;  2FLO A;  1BWV A;  2XZD B;  3AJD A;  4CT8 A;  4WYW A;  1RAD B;  3AH6 A;  1Z2Z A;  2J9C A;  1LW2 A;  2ZD1 B;  4OHZ A;  4Y6I A;  4LFC F;  3O44 A;  4WTO B;  2Z57 B;  1NUE A;  2HRU A;  2LEB A;  3HSD A;  2B5J B;  4I2Q A;  3TA2 A;  1S0V A;  3ZZR A;  4AYB D;  3RYL A;  3J81 j;  7AT1 B;  3POT B;  2DR7 A;  2Z0G A;  1NKB A;  1XNQ F;  4DFM A;  3M05 A;  4PPD A;  1F60 B;  4DR2 J;  3E2E A;  1RT3 B;  2GIR A;  1X4A A;  1YVF A;  3DRY A;  5GAE U;  3KKF A;  4LF8 J;  2DO0 A;  1XTZ A;  1M5V C;  4ECW A;  1QSL A;  4DR5 F;  1L3T A;  3TWZ A;  1HNI B;  4LSL B;  5L46 A;  2YWE A;  5J2P B;  4Q0B A;  4C11 A;  2V2Q A;  3SSS A;  2IDE A;  1N56 A;  4UOF A;  4B3M J;  2GPE A;  2AIR B;  2UUW A;  2VV5 A;  3BN7 A;  1QTM A;  1CQN A;  3CXC R;  3CCQ S;  2ADC A;  1NH8 A;  2CYY A;  2QMX A;  1ZAV A;  2LDI A;  3IR7 B;  1SB6 A;  4OMF G;  3M6U A;  3W5Y A;  2XWY A;  2DGW A;  3ADA C;  4J9S A;  1RLD A;  1QAY A;  5C24 A;  2ZJR Q;  1RT5 A;  5IV4 A;  1UVL A;  1H2U X;  1FRM A;  3GSI A;  4CLS A;  5A6P A;  4DFP A;  3PZP A;  2DVI A;  3L7O A;  1YJU A;  5HMY A;  2RDI A;  1RU2 A;  4DR6 F;  1HNX J;  3RBD A;  5CHC B;  1N5V A;  2KJV A;  4DX5 A;  2ZOG A;  2XC9 A;  4LQ3 A;  5DDO C;  5IQQ A;  3OTB A;  4F0M A;  2RQC A;  4C3K A;  4X66 J;  2MLY A;  3DRS A;  3C15 A;  5KFB A;  2AGQ A;  2BE7 D;  3DRS B;  5E3R A;  1NKE A;  1O8B A;  1RHJ B;  3W2W A;  3G6Y A;  1GXU A;  3BR8 A;  3PFO A;  1WKK A;  1WSR A;  3O8W A;  4KGK A;  4NA3 A;  4I68 A;  1K47 A;  3TVY A;  4DV0 F;  5DQH A;  4USW A;  3UD3 P;  1GNK A;  3TI0 A;  1YTY A;  2MLX A;  4DPY A;  3HT3 A;  5AE3 A;  4EBC A;  3M8Z A;  1B70 B;  1S1X A;  3TQE A;  1PO6 A;  2DHA A;  2VG7 B;  3C14 B;  2EK1 A;  1F2G A;  4DLE A;  1X4H A;  3O2I A;  4DN0 A;  4DV1 F;  2WVF A;  1IXK A;  1M5H A;  4FYY B;  4IG3 B;  2E7W A;  4PG7 A;  5KG4 A;  3UVJ B;  1RT3 A;  2MPU A;  4USU A;  1RWP B;  4MFB B;  2X1B A;  4WII A;  1N88 A;  3OFH A;  4ED7 A;  1NJZ A;  3R2C J;  1MMN A;  2JJ4 D;  2IYI A;  3SXL A;  2ZH3 A;  2J0W A;  3M2U A;  3OR2 B;  3BJY A;  2IM3 A;  4K4U A;  1S1T A;  4F04 B;  4LQ9 A;  1VRU A;  1V3Z A;  3QGH A;  2K1O A;  3P4U B;  5M2U A;  3BSA A;  5CZX A;  3PW4 A;  3M8W A;  5K8M A;  2HSE B;  3AD9 C;  4DF4 A;  3G82 B;  3QBC A;  4P71 A;  5GAE I;  1CJT A;  3HZG A;  4PG4 A;  5KFU A;  1VQN S;  3PXG a;  1MNE A;  2MQM A;  5AXL A;  4JI2 F;  2E44 A;  3J81 Y;  3QGI A;  1TR0 A;  3I96 A;  1SL0 A;  4OX9 J;  3D4J A;  2IBK A;  4TY8 A;  2FLN A;  1X5P A;  3H98 A;  1SKR A;  4DG1 A;  2XMM A;  2BUN A;  3T1H F;  2BJ1 A;  2IRX A;  3PW2 A;  4F4K A;  1WDT A;  4YB1 P;  5F8G A;  1VRT A;  2B4V A;  4AD6 A;  3C19 A;  4ICL A;  2DNN A;  2BOA A;  2C2R A;  2HHQ A;  3H0P A;  2YWK A;  2OGU A;  3EJM A;  1Q5Y A;  1U1P A;  2VG5 B;  2APO A;  2IC3 B;  5K9F A;  1WWH A;  2E1P A;  2BM1 A;  4OYP A;  4BC7 A;  4O4G A;  3KHG A;  2YQ0 A;  2J7U A;  2HAF A;  3B78 A;  1SUQ B;  4B08 A;  3CC4 S;  2VL1 A;  3JSY A;  3X1L B;  2R8I A;  1NRK A;  1KSP A;  2MKY A;  5IZH A;  1GAO A;  1L3K A;  1IBL J;  3R1H A;  2N82 B;  3BH7 B;  2HS3 A;  2HAI A;  4TN2 A;  1P9Y A;  3IS9 A;  4NLP A;  4NYZ A;  1HNZ J;  1D9A A;  3NCQ A;  1UCN A;  2MGZ A;  4EGL A;  1FTC A;  1KFD A;  1OIA A;  2H65 B;  2V2K A;  3BKT A;  3FFI B;  4K5R A;  3TZZ A;  4QWC A;  4AFF A;  4RUC A;  2QFJ A;  3SV4 A;  3OFE A;  4WU3 A;  1TZ0 A;  3EGW B;  1TKT B;  5MLC V;  1LWF A;  1D8Z A;  2OKQ A;  3MMB A;  1R31 A;  2DNM A;  3A1Y G;  4C98 A;  4ZLL A;  5J2M B;  4UOG A;  4ECZ A;  3J80 U;  2KZZ A;  1KHW A;  2WBR A;  1NHK L;  4CLP A;  2XTJ P;  4QCL A;  2KO1 A;  2O67 A;  4QW8 A;  1WD6 A;  3NL0 A;  5K8N A;  3VAM A;  1S6P B;  1KR4 A;  2RAQ A;  3D9B A;  2AWZ A;  3HHL B;  4IG0 B;  5G0R A;  4CP5 A;  4CTA A;  3R7B B;  4YUD A;  1GFW B;  5LOQ A;  5DDP C;  3KLF B;  2R7R A;  3ETO A;  3MAA A;  3PRD A;  3UW1 A;  1OS5 A;  1AFJ A;  1SJ1 A;  3BSO A;  1F2H A;  5U47 A;  3WIV A;  5IC4 B;  2BKP A;  2IA6 A;  1WSV A;  1E6V B;  3GSD A;  3I5B A;  4WTY A;  1Q95 G;  3GP9 A;  3OUY A;  3LP2 B;  4CYU B;  2YKA A;  5HLF A;  3EGN A;  3QO9 A;  1JK9 B;  1FVQ A;  5BYR A;  1KN6 A;  3E01 A;  3HKZ D;  3BYP A;  4XO0 A;  4ZCK A;  4GRS A;  4DV6 J;  4DR1 J;  2CJK A;  2OHD A;  2VF3 A;  1RT5 B;  3BKF A;  2AEJ A;  1WTB A;  2KHC A;  5E33 A;  3IM9 A;  4FBU A;  1FO1 A;  3A8K A;  2P9G A;  4F36 A;  4J9R A;  2ZBQ A;  3W62 A;  4NLD A;  3GV8 B;  5D3G A;  4U67 Q;  1HWK A;  5CAB A;  3MCN A;  5LJ5 Y;  4MJK A;  3IG1 A;  4AAI A;  3Q24 A;  1N32 F;  2G2O A;  4M8L A;  2R3V A;  4P74 A;  1NEE A;  2LDY A;  2MEW A;  2H1O E;  3ZZO A;  3K5N A;  4PEO A;  1V9O A;  1S9E A;  3SCI E;  2WTF A;  2EFV A;  1S99 A;  2K1R A;  3KLG A;  1IUJ A;  3IWL A;  2BDP A;  3QT8 A;  2VKR A;  1FRJ A;  4KHR A;  2M8D B;  2D9P A;  1Z4U A;  1NDK A;  1XMQ F;  1O6X A;  3OR1 A;  3DU6 A;  1L3U A;  3CD0 A;  3OTO J;  3G5O A;  2WBM A;  3BBF A;  2ZUA A;  1FWP A;  3S6E A;  1K9M T;  3FBF A;  1MNT A;  3KJQ B;  3RGI A;  3R5G A;  3CE8 A;  2Y0S D;  2ZH7 A;  1M1H A;  1KVI A;  4AL6 A;  1QE1 A;  1RT4 A;  1FKP B;  5B0C A;  3OTE A;  2E5H A;  3C16 A;  2UP1 A;  3PYD A;  3RR8 A;  3AOB A;  2OD6 A;  5A0Y A;  4OYO A;  4DV4 F;  1VI7 A;  1ZPV A;  5LMN F;  5F8M A;  3MTJ A;  3M8S A;  1DQ9 A;  2CZ4 A;  2CUY A;  2M5Y A;  3H90 A;  4ZP6 A;  3RBE A;  1P6T A;  1BD6 A;  3I6P A;  3SSR A;  3U27 A;  4N8O A;  2W1B A;  3KK2 B;  4KAI A;  3C46 A;  2E9Z A;  5MAO A;  1NU4 A;  1RTI A;  1KEK A;  1I1G A;  3P3D A;  4F3M A;  1U02 A;  2V34 A;  4K59 A;  4DPT A;  3TUZ C;  1SVD A;  2XLI A;  3KK1 A;  4ECR A;  2BA9 A;  1WEY A;  4OZL A;  1W26 A;  2PI4 A;  1OY9 A;  4LRE A;  3AB2 B;  4MTP A;  3VAI A;  3FBC A;  3IRX A;  2BQ3 A;  1R43 A;  4IO1 A;  4ZVG A;  2D3O R;  2IIH A;  1RLC L;  1JLB A;  2C3O A;  4ECX A;  3GFX A;  3I55 S;  2WVD A;  3TAR A;  4B9S A;  1NDC A;  1UJ6 A;  4EI2 A;  2F4V F;  2XSJ A;  5E3A A;  3U1N A;  1Y5I B;  3M1V A;  3A13 A;  3M4X A;  1Q7L B;  1FXL A;  3TUP A;  1SQF A;  3ISZ A;  4CLL A;  4U9R A;  4Z7Y A;  2ZBP A;  1N36 J;  1Y00 A;  3W66 A;  2M70 A;  3KXD A;  3GB0 A;  4DCP B;  4PWW A;  1IKX A;  1BDT A;  2PGC A;  4U7U K;  4F25 A;  5H1S V;  4IQX A;  1NB7 A;  1VQ7 S;  4I2P B;  1M1G A;  3I9V 9;  3DYA B;  4DU8 A;  2XQC A;  2JRS A;  2VOP A;  1KTV A;  3CDW A;  1TKX B;  3MMA B;  5M2R A;  3THP A;  1NK5 A;  2HHH J;  4LSN A;  3PIO Q;  1FEE A;  4QR0 A;  2R7Q A;  2AJQ A;  4C3L A;  2HRY A;  5ADZ A;  1FKA F;  3HKW A;  3PFE A;  3S7R A;  2DRA A;  4YFU A;  1CSJ A;  4MKV A;  2CNO B;  2IRY A;  2ROE A;  4F3O A;  1HQU A;  1S1W B;  1R8C A;  2OPP A;  3VAL A;  4JI1 J;  4PUO B;  4B3S F;  2GV1 A;  1HQE B;  1RAC B;  2RQK A;  2B6A A;  4XDC A;  3EGZ A;  1BQN B;  3TEH B;  5ETL A;  3K5M A;  4C2M A;  1BHN A;  3FSI A;  4J9L A;  3A8E A;  2FLL A;  4PPZ A;  1B0T A;  2I0X A;  4FZV A;  2NXC A;  3M2R B;  4X84 A;  3UD5 A;  4HYK A;  1GX6 A;  3DMJ A;  3OVB A;  1NAQ A;  3VAH A;  1NK4 A;  1E6Y B;  8ATC B;  2DCU B;  1FDB A;  2V8V A;  4DV5 J;  4TLQ A;  2BNZ A;  1TVR A;  2HVE A;  2PE8 A;  3MM7 B;  4GVL A;  5KG0 A;  3CCJ S;  5A2Q U;  2V9K A;  3CO0 P;  2KFY A;  3MM8 A;  4LRF A;  1OPI A;  1CJV B;  2HBR B;  2OTL S;  4FF4 A;  3U1L A;  2IRU A;  1IVZ A;  1QDU B;  4O4R A;  1DJ0 A;  3M2V A;  3QPI A;  3RUB L;  3OVA A;  3HVW A;  3MOZ A;  4ZVU B;  4DSE A;  3Q22 A;  2H4Y B;  1A9N B;  4NLW A;  4RUA A;  2VZ9 A;  5DZ6 A;  4DS5 A;  4I67 A;  4F0K A;  3N6L A;  1Q5V A;  4Y3C A;  2IY5 B;  2HNZ A;  5HMX A;  4Y2I A;  2CQI A;  3GFY A;  4I7F A;  4PXB A;  4TY9 A;  3V81 A;  1Q81 T;  4E98 A;  1VS3 A;  3JQJ A;  3PO5 A;  1RT6 B;  2V9W A;  1BWE A;  1FRK A;  2YKM A;  2V5H G;  4A8Y A;  2E1C A;  3BGR A;  4KSE B;  4LR9 A;  2AY0 A;  3CJQ A;  5CAA A;  2XUL A;  3MCO A;  3OPK A;  1MSW D;  5DRK A;  3TVZ A;  2Z58 B;  4MYT A;  3JB9 k;  1X7V A;  4PYA A;  2WOM B;  4WP8 A;  3BKU A;  5ETR A;  4P2S A;  2KXF A;  8RUC A;  1NK6 A;  1YI2 S;  1JX4 A;  2PO4 A;  2HKE A;  3TZY A;  1O5J A;  1HBN A;  1Y5N B;  1T02 A;  2RQ4 A;  1S9E B;  1X5O A;  2F9D A;  3EVW A;  3MFI A;  3T1Y J;  4LF9 F;  1IRQ A;  1FA0 A;  3CIZ A;  3BGF A;  3JQK A;  1VC0 A;  2E5G A;  3PHT A;  4OQJ A;  1QLN A;  2XNR A;  5G0R B;  4OYA A;  1KVK A;  4WFX A;  2EBG A;  2C2M B;  5HP1 B;  5D3G B;  4LBH A;  1QAX A;  4RW9 B;  1I94 F;  1VQ4 S;  4AL5 A;  1RU1 A;  3MD3 A;  2M3D A;  3E3X A;  1HNX F;  1FFG B;  3ZZY A;  4IRD A;  5IT9 Y;  2HMI B;  3WHI A;  4ZPD A;  4YHH F;  2A2B A;  3MUR P;  4NWB A;  6FDR A;  2D41 A;  3QAT A;  2GJF A;  2XY5 A;  1WHX A;  3M2V B;  4NEZ A;  3FC9 A;  2LQ5 A;  1N33 J;  2EG2 A;  4QIF A;  2WOM A;  1YDL A;  2EW9 A;  5HVG A;  1WI6 A;  4C8N A;  2QV6 A;  4JBC A;  4RW9 A;  5CD4 A;  3CJK B;  3G6X A;  3SYZ A;  1TK8 A;  1WOR A;  1IR0 A;  2VBZ A;  2HHH F;  1FRX A;  1X4D A;  4OI3 A;  3HMJ G;  2Z56 B;  3HK2 A;  2B43 A;  4IFY A;  1ZZN A;  2BJ8 A;  2AX0 A;  2VH7 A;  3FMB A;  1F9E B;  3Q8V A;  1PJ7 A;  4IH5 A;  4DQS A;  2XYH B;  4DN9 A;  3OHA A;  1KQF B;  4EK2 A;  3SCJ E;  4QIW D;  5F8L A;  3M9N B;  2OIH A;  2OPR A;  3P96 A;  4DXL A;  4DQP A;  3HHD A;  2YX4 A;  1U9P A;  3NOG A;  1ZOT A;  3TJA A;  4RL1 A;  4ZPB A;  1EQM A;  4A8F A;  3TYT A;  3IWN C;  4FXW A;  1VBX A;  4EO8 A;  2ACM A;  4KE5 A;  3NMR A;  2VG6 B;  2Q2K A;  4K7Q A;  1NLK L;  2AJ0 A;  2EFQ A;  2I9S A;  3O1L A;  3DOL B;  3QAE A;  3FSY A;  5IV3 A;  3TA1 A;  2QYC A;  1T9U A;  2VU5 A;  3Q23 A;  4X4N A;  4OZN A;  1FJ7 A;  2Q3P A;  2NCK L;  3IWX A;  3JSR A;  4JV0 A;  4AT1 B;  1U49 A;  1CJT B;  3KNA A;  1CS4 A;  4OX8 A;  2V63 A;  2K9I A;  3NWG A;  3M32 B;  3OQ2 A;  4QIE A;  3VGS A;  3VVU A;  5HJY A;  4RBU A;  4EYI B;  4QYZ J;  4LSZ B;  1HL6 A;  4LRB A;  4JI5 J;  1IWG A;  1DBD A;  3K8V A;  3W9H A;  3MMJ A;  5F0U A;  4PQU B;  1ZM2 A;  3R5A A;  2FB0 A;  1O0P A;  4OLP A;  4OI0 A;  3BGO P;  3G9C A;  1UEV A;  2B9W A;  3FSX A;  2BAN A;  2QA4 G;  2VOD A;  5D8H B;  2X7I A;  2ERR A;  4JI3 F;  4NMX A;  5KFI A;  2F3J A;  1JLB B;  2X3G A;  3KK3 B;  1LWC A;  5KOW A;  1I3O B;  1HKA A;  4RBT A;  3NNA A;  2W9C B;  1JWW A;  3GON A;  5A8R B;  2QL9 B;  4TY8 B;  1YIJ S;  1HA1 A;  4DPX A;  3DLB A;  4LSN B;  1IR2 A;  2XO6 A;  3T1Y F;  1D09 B;  3I0S B;  1HWI A;  1RAO A;  5KT5 A;  1B99 A;  1FWK A;  3UE2 A;  2VFT A;  4FKY A;  2ZWP A;  1M0S A;  4YY3 J;  2VG7 A;  3C14 A;  3AOD A;  4LUB A;  4DR5 J;  1X31 C;  1P8G A;  2ZZN A;  1I51 B;  1WAC A;  4W4M A;  1VJW A;  1GXL A;  1HQE A;  1AUS L;  2DT9 A;  3MF5 A;  4FVM A;  2B56 A;  4J9U E;  3MPU B;  5L1L A;  2W4C A;  4C9D A;  2BEF A;  3NCP A;  4USV A;  4X4V A;  3LAL A;  4LF7 F;  2VON A;  1DUR A;  4KGX B;  2XSJ B;  3VTI A;  4DSF A;  3OJU A;  1SV5 B;  1PJ6 A;  1HHS A;  4MMO A;  2HQF A;  3PR4 A;  3OW2 R;  3MM7 A;  2GGP B;  2ZNZ A;  2ZH2 A;  1U1R A;  4CM0 A;  4IRK A;  4G3I A;  1T9Y A;  2OUG A;  3KK3 A;  1WOP A;  3DLH A;  1FJC A;  1R8B A;  1YJT A;  2XHC A;  1ZA1 B;  2GNK A;  1UWA A;  2ZOF A;  2KRR A;  3ELH A;  3GJQ B;  3T41 A;  4ZCI A;  2IC3 A;  1FJE B;  4FXE A;  4B9L A;  4QIG A;  1F0X A;  2DGX A;  4LF5 J;  4JI8 F;  1T3O A;  2JWN A;  3LGH A;  4NPO A;  4URG A;  1RCX B;  3MM9 A;  2FJD B;  4LVN P;  2UVU A;  2ZH4 A;  2CWK A;  4URQ U;  3OSN A;  2R8H A;  1H38 A;  4WYL A;  2OPQ A;  4DV0 J;  5K20 B;  5DG7 A;  1PSD A;  2HRT A;  2X51 A;  2GVZ B;  3LF0 A;  3BGL A;  4O3O A;  3RU0 A;  4D8J A;  4Q45 A;  2Z8Q A;  1KTQ A;  5I3Q A;  1R6Y A;  1U2C A;  3DRR A;  2XMT A;  1FCA A;  4IRC A;  1KS2 A;  2AKW B;  2J7W A;  2KKE A;  2HND A;  3IR5 B;  2BW2 A;  5LSL A;  2BJ9 A;  2B51 A;  2E1R A;  3V4I A;  2CQ3 A;  1RAA B;  3QOQ A;  2JH3 A;  4AQY J;  3FZ2 A;  3SBM A;  4IR1 A;  1YWX A;  1UL3 A;  3DHW C;  3DOM A;  4I1T A;  4RNH A;  1FRL A;  1JLQ B;  2HQG A;  2RU3 A;  2KVQ E;  2VJV A;  3MWB A;  3QJP A;  3LP2 A;  4Z7C A;  1CG2 A;  2DD8 S;  4DR4 F;  2FY8 A;  2DJW A;  3KFW X;  2R42 A;  2MQN A;  2B4P A;  2JC0 A;  3R5J B;  2YNG A;  1LFP A;  1OY8 A;  1U26 A;  5T41 A;  4HTI A;  3DOK A;  3AJ1 A;  3KLF A;  4K0K J;  3QID A;  4LIR A;  1S1V B;  1B01 A;  3HM9 A;  3H5U A;  2H5I B;  3MEC A;  3ISN C;  4L73 A;  4XTT A;  5H9F J;  4N47 A;  4ED8 A;  1EAY C;  2HQI A;  5CQG A;  1X9W A;  2X1F A;  1X93 A;  1NND A;  2FVP A;  3WIU A;  2BW7 A;  4JI3 J;  2VA2 A;  1HMV B;  3MED A;  3W5Z A;  2FDN A;  4K4X A;  2V4Q A;  3ULH A;  1FDA A;  1TKT A;  4MKB A;  2YWG A;  3IRW P;  2GCF A;  3CPW R;  3LAM A;  4DR1 F;  3W63 A;  4CLU A;  1R8P A;  1S1U A;  4J9K A;  3SSQ A;  3GZ7 A;  1FE4 A;  5HAO A;  3SCK E;  1VOM A;  1NK8 A;  5L1K A;  3T5K A;  3TX8 A;  2RD5 C;  2V68 A;  4MAK A;  2UXC F;  3PEJ A;  5HP1 A;  1R6V A;  2E66 A;  5KG6 A;  2CQG A;  4RX6 A;  2QRR A;  4MK8 A;  5FDL B;  4EO6 A;  5GME A;  1L3S A;  2Z2Y B;  2UVR A;  4CLW A;  3R1L A;  5ITH A;  4LRC A;  2DYA A;  3GCW P;  4IFV A;  3LAK A;  1QUP A;  2G1H A;  4CO1 A;  1JIH A;  1H73 A;  2JHE A;  3E01 B;  3CMQ A;  5E2Q A;  3OTC A;  4WKY A;  2PMH A;  3A3P B;  2EFN A;  5KFO A;  2MJU A;  1HYS B;  2Q43 A;  3MEE A;  1LWE B;  3MEK A;  5C24 B;  2AGP A;  2V8H A;  4MJW A;  1JLE A;  4G1Q A;  1RA7 A;  1L3V A;  2J76 E;  3AFG A;  4ICL B;  4F67 A;  2UXB F;  3GJR B;  3H20 A;  4A47 A;  2MB0 B;  4I4B A;  1WG5 A;  2PC6 A;  4P10 A;  4C3M A;  4KIA A;  2ZBI A;  1Q8L A;  3VGU A;  2IYG A;  4ZP7 A;  1FES A;  2JVO A;  5IXU A;  3KUH A;  3RW6 A;  3OUY B;  2DRD A;  3GII A;  3AB4 B;  3UCZ P;  4JOU A;  2ZC4 A;  5DJB A;  3V4M A;  3KMS A;  2ZDO A;  1S0M A;  4ED4 A;  1HAR A;  4NLX A;  5FII A;  3FRY A;  1PAR A;  3MEE B;  2ZEJ A;  3AQO A;  3M9M B;  2M9K A;  4YB5 A;  5F3T A;  3TR5 A;  2KG0 A;  1QSS A;  2QTW A;  2XMV A;  3EXY A;  4M95 A;  2FJE B;  4CH0 S;  3KLV A;  3CCR S;  2FYX A;  2XMJ A;  3CJT A;  2DB1 A;  2WSF C;  5HQM A;  5BYQ A;  1KQS R;  2JLF A;  3M32 A;  5A8K A;  1HBU A;  4NLV A;  1YBA A;  1R27 B;  3H59 A;  1Q16 B;  2AYM A;  4ZHR A;  2W9B A;  4JI1 F;  2R2U A;  1S4E A;  3UDE A;  1CLF A;  2VPY B;  1VQK S;  3B4M A;  2JEJ A;  4O3S A;  4K4Y A;  3KTQ A;  3PHE A;  4JV5 F;  3CJ5 A;  1RKI A;  1OWX A;  2AN7 A;  2WB1 D;  6AT1 B;  2ZE2 B;  2N3O A;  5J1E B;  1VMB A;  1UA0 A;  4DU7 A;  1G4C A;  2YQ3 A;  4IYQ A;  4ZPA A;  3ZNU A;  1U48 A;  2AYB A;  2YX1 A;  3HSJ A;  4R0J A;  1SCJ B;  2E5J A;  1PAE X;  2UV8 A;  2EWH A;  3VQT A;  1YJ9 S;  1VQL S;  4C8Z A;  2FGC A;  5HQ8 A;  5J2M A;  5ETV A;  5LSO A;  2RHS B;  1BQN A;  4ZMM A;  5I3U A;  5IQ6 A;  1VRT B;  2J5A A;  4ZCL A;  5FLX U;  3OL6 A;  1K1Q A;  1YJ7 A;  2C2O B;  2QZ8 A;  4W90 B;  1VCT A;  3HPO A;  3RB0 A;  4JV5 J;  1UA1 A;  2GHV C;  2ZNY A;  2DR8 A;  2ZZM A;  1JLF A;  2QMW A;  3EUN A;  1IKY A;  1VRU B;  4URS A;  5DG8 A;  4QWD A;  2B4O A;  4K0K F;  2XYP B;  4OJG A;  1VK8 A;  4I6A A;  2PFD A;  4DHV A;  4Z37 A;  1XR6 A;  5KT7 A;  3DGV A;  3NRB A;  3TJ9 A;  4ERD A;  2D3U A;  3M8P B;  1RTJ B;  3R6L B;  4CCH A;  1KQK A;  5D0H A;  1SUQ A;  5E41 A;  2ZHA A;  3CWJ A;  3NKY A;  5I4M A;  3ILL A;  1KD1 T;  4K4V A;  3MEG B;  2VQE F;  2WB4 A;  4NOH A;  2HW3 A;  3BQ2 A;  1RAI B;  1JLC B;  2GO8 A;  5A8W B;  4RBV A;  3ZFV A;  4KHP F;  1AZS B;  3BRE A;  2CAD A;  4NRT A;  2AYE A;  4OZ1 A;  5JJB A;  2UVV A;  2O01 C;  4V19 X;  1MML A;  3FT7 A;  3ILI A;  4C4W A;  4IR9 A;  3QYY A;  1CEZ A;  2CQC A;  3DGP B;  3P45 B;  4J90 A;  3DGP A;  5J2Q A;  1IKV B;  3UN3 A;  4NI2 A;  3HHK A;  1UVJ A;  2ZH5 A;  2RUS A;  5H9F K;  1Y11 A;  4FPR A;  4HR2 A;  2QL5 B;  3WX4 A;  1YRT A;  2VQE J;  4ED0 A;  3EVM A;  4UY8 5;  4ZKA A;  2ZHO A;  1U8S A;  4RW6 B;  4K2J A;  3SQG A;  4DX8 H;  4DX7 A;  3EPG A;  2DR9 A;  3J7Y U;  2HFU A;  1WKJ A;  2ALY B;  3DXS X;  4YY3 F;  4DSL A;  3C6U A;  2HVI A;  3THT A;  1EB0 A;  4LRV A;  3GR1 A;  2HGL A;  5A0Y B;  3BB5 A;  2KJW A;  2FHM A;  4I64 A;  3PX0 A;  2FIU A;  3TW0 A;  1TTH B;  2CVE A;  2OEM A;  4X4U A;  3DI6 A;  2IA0 A;  3DI6 B;  1FRH A;  3IR7 A;  2DHG A;  4JV2 A;  4OI6 A;  4X66 F;  3HFZ B;  5DET A;  4CO4 A;  1CJK B;  1S77 D;  4JUZ A;  3M30 A;  1SIZ A;  3PYE A;  4RO0 A;  5IOL A;  4LBP A;  5GAH I;  1UEK A;  4GKK F;  3TAQ A;  4F02 A;  3D6F B;  2Z2M A;  1TAQ A;  1M5P C;  5E0O A;  1RK8 A;  4RW7 A;  4BDP A;  4NLQ A;  2VPZ B;  4R25 A;  3EPI A;  1ZZF A;  4ZK7 M;  4WFB Q;  3CD7 A;  2XY6 A;  2OTJ S;  2OEK A;  2ROP A;  3RB4 A;  4IO9 Q;  4ILL A;  3UI3 A;  4C8O A;  5EX3 A;  1KVJ A;  1IN0 A;  5L8R C;  2UUC F;  4HT7 A;  3CDE A;  2VAS A;  1V5V A;  2DIS A;  3QSI A;  4GVB A;  3ENQ A;  3HDS A;  2RQM A;  4ZOS A;  2KKH A;  2FZK B;  2OI2 A;  3GG1 A;  1CJU B;  3H5Y A;  3I56 S;  1Q8I A;  3GTY X;  5ETS A;  3CD5 A;  3UFC X;  1FFS B;  2HHT A;  5EUH A;  5HO4 A;  3PV8 A;  4GKJ F;  1J27 A;  2WVB A;  1RTH A;  2R8G A;  2PT0 A;  2M52 A;  3M6W A;  4P52 A;  3NS6 A;  1N34 F;  1JNR B;  2EPI A;  5GMD A;  4ATN A;  1XEZ A;  1YGY A;  2EK6 A;  3CCV S;  3DLK A;  1REG X;  5T7L B;  1DFD A;  2HIQ A;  2Y1R I;  2V67 A;  1RWX B;  3O3L A;  3R2D J;  1TV6 B;  1WC1 A;  1WC4 A;  2FTR A;  2VG6 A;  2G0I A;  3D5M A;  2K5J A;  2L41 A;  4UST A;  3GG0 A;  3VAJ A;  4RNM A;  3SEO A;  4FKX A;  1NJY A;  1TFW A;  2G9O A;  4DI6 A;  3AXK A;  2OEL A;  4PYD A;  1ZS6 A;  3K8W A;  2UXB J;  5CA5 A;  1ZAX A;  3LP1 A;  5KT2 A;  4ID5 B;  5EHH A;  1IQT A;  3DNC A;  5HN0 A;  3C2P A;  2GFF A;  4ANC A;  5F8H A;  2EKY A;  1FTR A;  4PWD A;  5C2G A;  1EQ0 A;  2HS4 A;  2C3P A;  3VAF A;  3W2V B;  3DRP B;  2W9A A;  4C97 A;  1SJF A;  3NMA A;  3L3C A;  4RU9 A;  5AXN A;  2J9D A;  4EWT A;  1Y0H A;  1T9T A;  5CCL A;  1UWB A;  3LP0 A;  4X64 F;  2VQF F;  1JLF B;  1HWL A;  3ICL A;  5KFN A;  4UT4 A;  3QLH A;  3MUV P;  3OTO F;  2AD9 A;  2UXC J;  4M5N A;  4MKY A;  2C2N A;  5K14 A;  2AW0 A;  4PQU A;  1R0A A;  4GO7 X;  2WVE A;  2NS1 B;  1C0T B;  4M5I A;  1IM4 A;  1S49 A;  2VBY A;  3IAS 9;  4FXV A;  4LF6 J;  3QFH A;  3ZZZ A;  2CPG A;  2CNN B;  2OLW A;  4DR3 F;  3B82 A;  3PEH A;  1YK9 A;  1FNO A;  4WJB A;  3R8Y A;  1HHT P;  2KT3 A;  1WUU A;  2E7V A;  4ZVH A;  2VC0 A;  2YWW A;  2MKI A;  3AD7 C;  3DOL A;  1RHK B;  5D0E A;  1MU2 B;  1KLN A;  2QJ3 A;  5J1E A;  2B0G A;  4ECV A;  5HMZ A;  4M1K A;  4NX9 A;  1HBO B;  1XQI A;  3MM5 A;  4OZ3 A;  3VAK A;  1W2B R;  4N76 A;  5KTQ A;  4OFZ A;  4W98 A;  4UOH A;  1S79 A;  3CJ0 A;  4CNZ A;  5CYJ A;  4J9V A;  2Y8W A;  2HBZ B;  1T95 A;  5I3P A;  1RXO B;  5BR8 F;  4J5O A;  1LK5 A;  2IFX A;  1HBU B;  3Q89 A;  3KLH A;  2QA4 S;  2G2Y A;  3BBC A;  2XZT B;  3IN5 A;  2KDO A;  2RRB A;  4ZLJ A;  5HL7 Q;  1UET A;  2ZHB A;  2GAG C;  1MW7 A;  2Y9H A;  5L38 A;  4DV2 F;  1GXT A;  3DC2 A;  2JX2 A;  2MY8 A;  1SQE A;  5IT4 A;  2HHS A;  2PA8 D;  1HIY A;  2LFV A;  3JTO A;  3FNN A;  2LA4 A;  3HF5 A;  3KLE B;  1EET A;  3HFK A;  1EET B;  3MGJ A;  1FF2 A;  4EZ9 A;  3BGU A;  4FN5 A;  1YZ7 A;  1WC5 A;  4HVZ A;  3UNY A;  3GR0 A;  3GIM A;  3BSC A;  1D1U A;  4CDI A;  3H40 A;  1ZBT A;  3NOC A;  4TU9 A;  4I6W A;  3MTK A;  1NXI A;  4C6A A;  1SKW A;  1UFW A;  2ZFH A;  2MZQ A;  3BSN A;  3D0G E;  3H2V E;  3OT9 A;  2QT7 A;  2W7O A;  1NCL A;  4F50 A;  5KFS A;  2DNZ A;  2L9W A;  5KG3 A;  3M9O B;  1G3O A;  2R8K A;  5AT1 B;  5F8N A;  1N5Y B;  4USJ C;  1OMS A;  3W65 A;  2FD2 A;  4ED6 A;  1XIQ A;  3UDV A;  2IDL A;  4NML A;  2H9Z A;  3V5R A;  2YX7 A;  3IC1 A;  1BXN A;  1MWY A;  1CPZ A;  5BJR A;  3W8G A;  3GPA A;  4DZD A;  2J9E A;  4YR0 A;  3DM2 B;  2JBV A;  2P2C B;  4QR2 A;  1VC6 A;  2MKJ A;  1KFS A;  3R5D A;  1TKD A;  1NM2 A;  2W8K A;  2QLF B;  3Q8S B;  1VFJ A;  1Y3K A;  3WBZ A;  2HHW A;  4RNN A;  3D1O A;  3D1H A;  4HH1 A;  2EG1 A;  4KT0 C;  2W2P P;  3D2W A;  2N4C A;  3MED B;  4XK8 C;  5KT6 A;  1NK7 A;  1LK7 A;  4JYA F;  2IPO B;  2FHJ D;  3D68 A;  4IQM A;  4CH7 A;  2Y1L B;  3I82 A;  4P2X A;  4L72 B;  2YH0 A;  4FF2 A;  3FGV A;  1MRO A;  4ELU A;  1NHU A;  4EEY A;  3CF5 Q;  1TU0 B;  4PG5 A;  1X9M A;  2DHS A;  1UJ4 A;  2UUT A;  2VA3 A;  3G8Q A;  5HVH A;  1REV A;  2BBE A;  6FD1 A;  3N28 A;  3FMT A;  4U96 A;  3OVS A;  4DR7 J;  3H5X A;  2CZV C;  4ZVO B;  3R9L A;  5AJ3 J;  4H4M A;  2JFD A;  2PMW A;  2HK2 A;  2KXH A;  1VRQ C;  3BM7 A;  4QIV A;  4CO3 A;  4P6Q A;  4Q8F A;  3UDL A;  2NLW A;  1SC4 B;  4H4M B;  1AW0 A;  3UN2 A;  4KTQ A;  4KKO A;  2RBF A;  1PJ5 A;  1Y10 A;  2MDA A;  1FK9 A;  2WW8 A;  2BSQ E;  4C11 B;  2WZ1 A;  4TQR A;  2FJV A;  4LJM A;  4LFB F;  4X62 F;  3GV7 B;  1RTI B;  4TU8 A;  1VIS A;  1EJ7 L;  5KFM A;  5IWA F;  3KK2 A;  4QYZ K;  3RBZ A;  2LEA A;  3M8Q B;  4ZPC A;  2BKO A;  2N7Y A;  3P5B P;  2YKP A;  1ZM9 A;  1GX5 A;  1RAJ A;  1U7L A;  1MN7 A;  2MMY A;  3FEY B;  3HSZ A;  3LO3 A;  3G8T A;  3DM2 A;  1SKS A;  2PN6 A;  1L5U A;  2OPR B;  5DDQ C;  5JVG Q;  3DLJ A;  1NSA A;  3R27 A;  2RS2 A;  3QGG A;  1BQM A;  2MZJ A;  4LFB J;  3GIL A;  3MAQ A;  3M2U B;  4DL5 A;  2MQL A;  2GGP A;  2HWT A;  1S7H A;  3OL9 A;  1IKX B;  4O3R A;  4PWD B;  4LMZ A;  4Z2X A;  1J5O B;  1WOO A;  2DIU A;  3BBB A;  4EMD A;  3HVR A;  1U45 A;  2HPU A;  1N32 J;  2BRL A;  2WVC A;  4ZDN A;  2FZG B;  2YVS A;  3LGN A;  3PYF A;  3C3L A;  3MCM A;  4F8R A;  3M1V B;  3TZW A;  2FHK A;  2XG8 A;  4ENO A;  5J1N A;  4RW4 B;  3MCS A;  4KGM A;  4DL4 A;  3S8S A;  2BZ2 A;  3KHL A;  2OPP B;  1RT2 A;  4GC6 A;  5KFE A;  4PUO A;  1Q53 A;  1IQZ A;  1NME B;  2CJB A;  4PAB A;  2ZVI A;  4V19 J;  1WF2 A;  2KN4 A;  1WDD A;  3CT9 A;  5L9X A;  1BUX A;  4J9O A;  4A8O A;  2L9D A;  4OYX A;  5LJ3 Y;  4FYD A;  5DM6 Q;  5D78 A;  1TKZ B;  1IJE B;  2B3T B;  1EP4 A;  3SIP B;  3DDI A;  2H3E B;  3FBE A;  4F26 A;  3QZ7 A;  1HI0 P;  1RWK B;  5CYM A;  2J6U A;  3PW0 A;  2KTQ A;  4E2F B;  1XBW A;  3ITH A;  1UVI A;  2BAN B;  3RAQ A;  3PYG A;  3X3U A;  1VQ9 S;  4OYI A;  1KWM A;  4WPA A;  1RWW B;  1VQY A;  2W2O P;  1SH2 A;  1AFI A;  2H48 B;  4AXJ A;  1FWL A;  2VKZ G;  3GWC A;  3C66 A;  4NZ7 A;  1FD2 A;  3UN5 A;  5AJ3 F;  2OJ3 A;  2ZBR A;  4Q43 A;  2XWX A;  1WOS A;  4ALZ A;  2A2C A;  1S6P A;  2CPJ A;  3J7Z T;  3ZXW A;  1WF1 A;  1FI4 A;  5KFX A;  4OL8 A;  5I3U B;  2I5J A;  3ILJ A;  4DBQ A;  1R0A B;  2RS8 A;  4NXN F;  4DV3 J;  1WJ9 A;  4L75 A;  3UR0 A;  2Q1L A;  3SI8 A;  2ADB A;  2PII A;  4U7C A;  1EZZ B;  4WP3 A;  5EWG A;  3QRQ A;  2A3J A;  3SMZ A;  3VQS A;  2CPF A;  3N5F A;  2YPZ A;  4F2S A;  2Z2L A;  4CLK A;  4M5G A;  3KMQ A;  2M7S A;  2MKS A;  1S6Q A;  3QZ8 A;  4TU7 A;  3ISN D;  5DQI A;  3QNW B;  3TUJ C;  2ILY A;  5HK4 A;  1GQE A;  5IC6 B;  4G6V B;  1AA1 B;  3B6B A;  1IKW B;  1E6Y A;  4WFN Q;  5CCM A;  2NXJ A;  4IUF A;  3HUL A;  5EWF A;  3V6K A;  1JLA B;  3QMQ A;  2NYI A;  1XK8 A;  5D4L A;  4LT6 A;  3US5 A;  1Q0N A;  2VHG A;  5HLF B;  5C25 A;  4XPC A;  2FLP A;  1U25 A;  2ASD A;  4M63 A;  3R6G B;  5JVH Q;  4WE1 B;  3JYT B;  4YOE A;  3SDE A;  1HNZ F;  1FJG F;  2JZ5 A;  2HGN A;  3GFZ A;  2CKW A;  1X4E A;  4MH8 A;  1U24 A;  1JB0 C;  2MST A;  4KO0 B;  3VR1 A;  3V81 B;  4DQI A;  4N7T A;  5KFR A;  1JLE B;  4RJV A;  1T9V A;  4DF8 A;  1N34 J;  1Q16 A;  5HMW A;  5KFV A;  2JEF A;  1RYR A;  1PCA A;  2NZ4 A;  4FNI A;  2LXF A;  5M2P A;  4MIW A;  1F6T A;  4DL2 A;  2RIJ A;  3M8R A;  4IKA A;  2H5J B;  3SFU A;  2AX1 A;  4TQS A;  1QJH A;  1RB0 A;  2ZH8 A;  4K4T A;  2XI2 A;  4PZV A;  1X0F A;  1DRZ A;  2J0S D;  3R3T A;  5ETP A;  1RSC A;  3HVT B;  4KR0 B;  2I6W A;  5E3P A;  3IXQ A;  4D3H A;  1DAR A;  1FX2 A;  4P72 A;  2NSB A;  3W2V A;  1T9X A;  4DV5 F;  3CTR A;  4H4O B;  5RUB A;  2WW4 A;  3IRX B;  1VQ8 S;  1Q8B A;  2K3K A;  4CZC A;  4CT9 A;  1VHI A;  3WDO A;  2GHW A;  2ZUG A;  5JXS A;  2C2D A;  3MHY A;  1IBM F;  4QU7 A;  2ATC B;  3A12 A;  4WZM A;  4KJI A;  1G6B A;  4Q44 A;  2UU9 J;  2GAH C;  4R8U B;  1VHF A;  4G1Q B;  3SCL E;  3UNG C;  2EEY A;  4NCA A;  3V6J A;  2WRM A;  4B9U A;  1F5B A;  4DPW A;  1KOH A;  2GMH A;  2E5L F;  3UCG A;  1P94 A;  3M8Q A;  2K7K A;  3N6M A;  1VDH A;  3PO4 A;  2XBP A;  3KJV B;  4FS2 A;  4R0E A;  3W9J A;  2GJ2 A;  2NXN A;  4ECT A;  2CDR B;  3K2Y A;  5H9E K;  3W60 A;  1AB8 A;  5FDL A;  2O1P A;  1IBM J;  9RUB A;  2DH8 A;  1MYK A;  2G0J A;  3BYR A;  2XS7 A;  3DU5 A;  1GTH A;  1I5O B;  1ACM B;  2DBB A;  2GQ2 A;  4RPF A;  5KT4 A;  2MHN A;  3MR2 A;  4M5D B;  4OHV A;  5LXY A;  2CJY B;  3FQK A;  3K59 A;  2ZM6 F;  4C8Y A;  3LPY A;  2KZM A;  1F1B B;  2CJA A;  2A2D A;  2JDJ A;  3DDN A;  3DLG B;  4ID5 A;  1UPM B;  2XMU A;  4NE9 C;  5DQG A;  2GS8 A;  3DRX A;  3OFF A;  1XNQ J;  3RB3 A;  4JI5 F;  2ZH1 A;  1Q4R A;  4DSI A;  2E7X A;  1MN9 A;  1NB2 A;  2EBE A;  4W92 B;  1FNM A;  1RWO B;  1YKW A;  1JLG A;  2YWF A;  4L76 A;  3T1A A;  3K5L A;  4A48 A;  2OAU A;  3PDN A;  4QBU A;  1VLO A;  4N41 A;  2WCX A;  2LCW A;  2ROG A;  1JLG B;  1PIL A;  4MK7 A;  3OBI A;  2MY7 A;  2RRA A;  3NWR A;  5DO2 A;  3K17 A;  5BXI A;  2E1M C;  1H0H B;  4ZJL A;  3W61 A;  2OPS A;  1K73 T;  2R7W A;  4ILR A;  1QTN B;  4ZN3 A;  2OFH X;  3MEG A;  2XCA A;  2GA7 A;  2KT5 A;  3CDA A;  3QWU A;  3L4B C;  4KGV B;  1YHQ S;  3JSB A;  1U0H B;  2CQB A;  2EFO A;  3ITH B;  2CG8 A;  2M4M A;  3AJ2 A;  1S48 A;  3R5C A;  3AAW B;  4DEZ A;  4LF6 F;  5THW A;  2ZDP A;  1RWU A;  3KUE A;  4QZV B;  2D9O A;  2F65 A;  3M30 B;  1GH8 A;  3KOA A;  3M8P A;  2NYH A;  4JV1 A;  2WSE C;  3BH6 B;  1E6V A;  3MR7 A;  1VBZ A;  2JXI A;  3ZTO A;  1NLA A;  4ANE A;  3I32 A;  4AE5 A;  4DV7 J;  1XER A;  1XMO J;  1IKY B;  3OR2 A;  2RUG A;  4C0O C;  4YR2 A;  1T3N A;  4IG0 A;  5DS7 A;  3CCM S;  1AUD A;  3MPV A;  2IM0 A;  2B9E A;  2V2Z A;  2Z4P A;  2KHD A;  1N5Y A;  1N5Q A;  3K5O A;  1S6O A;  3CNQ P;  1K8A T;  1N36 F;  4KFB B;  3F73 A;  1MMD A;  2I8E A;  2CPE A;  3A8J A;  1KOO A;  4KH0 B;  3PX6 A;  4ED5 A;  4J9N A;  3AQP A;  1HNW F;  2BQU A;  2LQB A;  5KFJ A;  2EI5 A;  4TLR A;  2KH9 A;  2JEG A;  3Q8P B;  1X4G A;  5HJX A;  3J7A 1;  5GAD I;  4J7C A;  3POT A;  4ZVP B;  2W8L A;  1IKV A;  3ET6 A;  2HQ3 A;  2MGZ B;  2BXJ A;  1N6Q A;  4PWU A;  1YZ6 A;  2OSQ A;  4UQT A;  1NPP A;  2DH9 A;  3UR3 C;  4CO5 A;  2R7V A;  2R7X A;  2RNE A;  2W24 A;  3NAI A;  1NSQ A;  1N0V C;  1U2F A;  2BE9 B;  2J9D E;  3Q8U A;  1HNI A;  4F7V A;  5KG7 A;  4ZPV R;  4HI1 A;  1URR A;  2OEJ A;  2RF2 A;  2YY3 A;  2W01 A;  2DEJ A;  3A3N B;  3IM8 A;  5CYQ A;  4JB8 B;  4NEY A;  2XO7 A;  4J9P A;  4HHH A;  4WFA Q;  1GK8 A;  4NYP A;  3UD4 P;  2CQ1 A;  2RVJ A;  3TX0 A;  3VZI A;  1YSJ A;  2Y8Y A;  3VVT A;  2K06 A;  4FF1 A;  4OZ0 A;  3A3O B;  2FGO A;  3PM9 A;  2V2V A;  1S12 A;  4BWM A;  3EDR B;  4ZJQ A;  2P6T A;  2LKZ A;  4ZIV A;  4B3T J;  3OV7 A;  3KJN B;  3G6V A;  1RHM B;  2YNI A;  1SJQ A;  1UZH A;  2HVD A;  2GIQ A;  3GE9 A;  3W9I A;  4WCE Q;  1X8D A;  3J81 U;  4CO2 A;  2KM8 C;  2HWH A;  2W7P A;  5J2Q B;  2FC8 A;  1LW0 A;  1WG1 A;  1U1O A;  4F2R A;  3Q2T C;  4KHP J;  4KKO B;  1UJ5 A;  1WEL A;  4R5P B;  3P49 B;  2B8P A;  4ECQ A;  3D0I E;  3PW5 A;  4Q0B B;  3JAM U;  2HHX A;  3KDO A;  3VGT A;  2AZ3 A;  3GYX B;  3IMQ J;  1UFL A;  1HYS A;  4B3T F;  5LL6 d;  4B02 A;  3G82 A;  4CWB A;  4DUZ F;  4Y28 C;  4BWJ A;  4DV3 F;  2VDI A;  2A10 A;  2JOQ A;  1C4C A;  2LEP A;  5KFW A;  2RML A;  5LMU J;  3RRH A;  2QEX S;  1YIT S;  2QLX A;  2FVC A;  4CYU A;  1S9G B;  5IWA J;  4A46 A;  4QPX A;  2HG4 A;  4OJ3 A;  1NJX A;  1B4S A;  1YRX A;  4FVC A;  1S97 A;  5A6W A;  4NCB A;  2FPH X;  1N6Q B;  4NLG A;  1FXR A;  1KQG B;  1Z2L A;  1IBL F;  3Q8Q B;  4LFA F;  3PG9 A;  4MFB A;  2DNL A;  3L09 A;  3KJV A;  4QPT A;  1SC6 A;  5KAK A;  1VJQ A;  1C0U B;  1SIW A;  2H4W B;  4FNH A;  3O6Q A;  5SZT A;  2R7T A;  1HNV B;  2HNY B;  2W4P A;  1GMU A;  4OI1 A;  2FZC B;  3ZO7 A;  5KFC A;  4WXO A;  4UQG A;  4KPY A;  5SUH A;  5KFP A;  1YJW S;  1SQG A;  1PGZ A;  3WQP A;  2E9T A;  2FJX A;  5GAD U;  2C3U A;  5A8R A;  3HX9 A;  4EU0 A;  4LF4 J;  2FJB B;  3VF0 B;  2PFF B;  2CNK B;  1XMO F;  2W9C A;  2H51 B;  1DTQ A;  3G4S S;  1PG5 B;  4XPE A;  2YKN B;  2V8D A;  3N6N A;  4P2F A;  1M90 T;  3HHN B;  1T11 A;  3QFW A;  1YRU A;  1RHQ B;  2HIY A;  3MI7 X;  2W9B B;  1LXN A;  3MM6 A;  1EKR A;  3HVT A;  5B0D A;  3NBP A;  4X4S A;  3AA9 A;  3PRB A;  1TMM A;  5LM7 E;  4DL7 A;  1N33 F;  4M5H A;  4WU2 A;  3EVO A;  4DZ6 A;  1U47 A;  4I6Y A;  1H7W A;  2EC2 A;  3ZNJ 1;  1DAX A;  3DFE A;  1N8R T;  4LR8 A;  3PY8 A;  2ZIT A;  4NRU A;  3AXM A;  3M8Y A;  3TAN A;  5D4O A;  2FY1 A;  4JI6 J;  2OPS B;  5JMN A;  2DIT A;  1S1T B;  3BPD A;  3LAN A;  4OJH A;  2D3Z A;  1T05 A;  5HBM A;  2VBW A;  1FDD A;  4HAC A;  3GYN A;  4ZVF A;  2XZW A;  4ZS6 A;  4ZVS B;  3H4D A;  1GMV A;  3EZ5 A;  4ZVT B;  2CQP A;  3DKD A;  1ZTT A;  1RI7 A;  4DG1 B;  4PKD B;  4B17 A;  2KL8 A;  3HP6 A;  4X65 J;  3GIR A;  1TL1 A;  1NSK L;  1SC3 B;  3EIC A;  1MYL A;  3OD2 A;  3HJF A;  2IJN A;  4PXD A;  2HLT A;  4RWX A;  1TL4 A;  4Y65 A;  4ZVQ B;  1U4B A;  4USK A;  4KFB A;  3V6D B;  3J7A N;  2C1E B;  3FCH A;  3TOQ A;  2DNY A;  4UF4 A;  4J9Q A;  2IMO A;  3D67 A;  3MEC B;  2MYF A;  3J7Z 5;  4O44 A;  2XS2 A;  2QLW A;  3NXZ A;  4C8M A;  3D6M B;  2NZC A;  2MZS A;  4EFA C;  3RTV A;  2YNG B;  1W2I A;  2FHO B;  3T6J A;  1RKJ A;  1T7P A;  4UZC A;  4J37 A;  4ZIW A;  4PXC A;  1KKH A;  1RBA A;  2J8S A;  2BE2 B;  4ZJO A;  4O0I A;  3T19 A;  3BQ0 A;  1S6Q B;  2DTJ A;  2BJD A;  2YKQ A;  3CDU A;  1RT2 B;  5F41 A;  1Q7Y T;  1SL2 A;  4WKR A;  4EUV A;  5F8I A;  3LTO A;  4G65 A;  3UWT A;  1U0H A;  2HBQ B;  2ASJ A;  1F3F A;  2LYV A;  2K29 A;  2B7C B;  4DUZ J;  1K0T A;  4YB6 A;  1Q86 T;  5CD4 H;  3GIK A;  2V50 A;  4QWB A;  2PMZ D;  4LFA J;  5G4D A;  1BE4 A;  2F8M A;  2W25 A;  1CJV A;  1VIO A;  4F4Y A;  3DRR B;  3PKM A;  1P27 B;  2JEI A;  1R0B G;  1WC6 A;  4NI2 B;  4M5J A;  3MMA A;  3CMA S;  3HCX A;  4Q2M A;  2Q6B A;  1DQ8 A;  1RP5 A;  4H4O A;  2VFV A;  2CFX A;  2XMK A;  2MZR A;  3UPF A;  3QRR A;  1HWJ A;  3CJ4 A;  4FBT A;  1WNE A;  3LUY A;  2CRL A;  5J2P A;  2M88 A;  1TL7 B;  1NK0 A;  3HLU A;  1RAB B;  3G71 S;  2EFP A;  2YNF A;  1LKZ A;  2PSZ A;  2F8H A;  2XI3 A;  2YNF B;  3IGN A;  3CCT A;  3H87 C;  1JLQ A;  5ETK A;  5EGY A;  1RJJ A;  2CA9 A;  4HKQ A;  2UUA J;  1RTD A;  2CJQ A;  1BY9 A;  4I0W A;  3V4I B;  1H74 A;  2CQ0 A;  1IM6 A;  2DHX A;  4X4T A;  2CAX A;  3FK4 A;  4U8V A;  1C1C A;  1OQ3 A;  1U2R A;  1A7G E;  1C1C B;  2QIF A;  4LR7 A;  4MK9 A;  2RIL A;  3OXG A;  5B7W A;  1DQA A;  4G1I A;  3T5L A;  4A8K A;  1M1K T;  1RWV B;  4TVA B;  1Y9O A;  5LSR A;  4JI6 F;  1SI9 A;  3KUG A;  3JYT A;  2JLG A;  2KYX A;  4Q7A A;  2F4F A;  1NH7 A;  1Q79 A;  5B0F A;  4LF1 A;  1DLO B;  2I38 A;  2ZZT A;  1HFE L;  4L3K A;  4RNO A;  1I6J A;  4JI4 J;  4JI8 J;  1WHW A;  1P1L A;  2CQH A;  2QA1 A;  3TEG A;  1B64 A;  1TUG B;  2LMI A;  3DLG A;  4CO0 A;  3CCL S;  2LP4 A;  3C16 B;  2AJF E;  3IA0 A;  4I69 A;  4L74 A;  4AQY F;  3S1T A;  1CJU A;  4RR5 A;  1YJN S;  2CDQ A;  3P8B B; 
#chains in the Genus database with same CATH homology
 2PC6 A;  1QTG A;  2K5J A;  1P94 A;  2CA9 A;  2JXG A;  3QOQ A;  2BNW A;  2GPE A;  2BJ7 A;  2AY0 A;  2WVE A;  1BDT A;  3QSI A;  2BNZ A;  2H1O E;  2K29 A;  3FMT A;  1ARQ A;  3VEB A;  2CPG A;  1MYL A;  3OD2 A;  3VEA A;  2KEL A;  2CAX A;  3BKU A;  1MYK A;  4FXE A;  2FGC A;  2Y3Y A;  2CAD A;  2F1F A;  2WVF A;  2HZA A;  1PAR A;  3LGH A;  4HV0 A;  2BJ3 A;  3FT7 A;  1EA4 A;  2K9I A;  1BAZ A;  2RBF A;  3BKT A;  1IRQ A;  2WVB A;  1B01 A;  2BJ1 A;  3PHT A;  1MNT A;  2WVD A;  4ME7 E;  2BJ8 A;  1BDV A;  3BKF A;  1Q5V A;  2HZV A;  1X93 A;  4D8J A;  2BSQ E;  2NZC A;  2BA3 A;  2JXH A;  3GXQ A;  2JXI A;  2WVC A;  1ARR A;  1NLA A;  2CAJ A;  1B28 A;  1Q5Y A;  2K6L A;  2K1O A;  3H87 C;  3VW4 A;  2BJ9 A;  1U9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...