3LGHA

Crystal structure of nikr from helicobacter pylori with variable ni site coordination
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
131
Chain Sequence
IIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nickel-responsive regulator
publication title Holo-Ni(II)HpNikR Is an Asymmetric Tetramer Containing Two Different Nickel-Binding Sites.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 42
structure length 131
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3lghA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3lghA02
2BNZA 2BSQE 2CAXA 3BKUA 2WVCA 2WVFA 1ARRA 2FGCA 2CPGA 3PHTA 2JXHA 2F1FA 2BJ9A 3VEAA 2K1OA 3GXQA 2WVBA 2K5JA 2CAJA 1U9PA 1P94A 3QOQA 4FXEA 2RBFA 3BKFA 2BNWA 2HZAA 1B01A 1BDTA 1PARA 1Q5VA 1Q5YA 2KELA 2Y3YA 1QTGA 2BJ7A 3FMTA 1EA4A 2BJ8A 3OD2A 1B28A 1MNTA 1MYLA 3FT7A 2CA9A 2WVEA 3H87C 2PC6A 2NZCA 2BJ3A 1IRQA 2BJ1A 2CADA 2JXGA 2K29A 2HZVA 4HV0A 2BA3A 2JXIA 2H1OE 3BKTA 1BDVA 3VEBA 2K9IA 1MYKA 2AY0A 4ME7E 2K6LA 2GPEA 2WVDA 1NLAA 3VW4A 4D8JA 3QSIA 1X93A 1BAZA 1ARQA 3LGHA
chains in the Genus database with same CATH superfamily
4KTQA 1TMMA 2XY5A 1X9MA 1UEUA 1D09B 3DI6A 4HHUA 3DM2B 4A48A 4B9TA 2KKEA 1YBAA 2OPRA 3AHPA 3EYZA 1U0SA 2OTLS 3L7PA 5AXKA 1ZPWX 5JUMA 3VEAA 3JYTB 2KJVA 4P71A 2V6AA 4RWWA 5AJ3F 1ZA1B 1WOPA 1SBRA 4O3NA 2YKMA 5A8WA 1XC9A 5BYQA 4PQUA 4KT0C 4NRUA 2XMVA 3ZTPA 4OZ0A 3RAXA 1UA1A 3K17A 2A3JA 4IFYB 1OJ4A 2JEFA 4ZCIA 4DPWA 3RG6A 3HPOA 1M5OC 4B3RF 4LQ3A 2AYEA 5BYRA 1WF1A 1Q7YT 2ZH5A 3PTWA 2G1DA 2VICA 5KFYA 2CQ0A 1NPRA 5HMZA 3EZ5A 4USUA 1UVLA 1WSRA 4OI3A 4CLZA 4F04B 3GJRB 3ILOA 3L7UA 4FKYA 3BM7A 5GAGI 3I82A 2MDAA 2UVRA 3H4DA 3UN5A 2HNDB 4DOZA 4ZPWR 5KFMA 4PYAA 3FSXA 3VZIA 4KR0B 4YEAA 1ZM4A 3PW4A 2HFZA 5EN1A 1FT8A 1VQ9S 3JTNA 2R8JA 2O67A 4C0OC 4ED4A 2M52A 4QOTA 2VFUA 3JAMU 2OO4A 3AQOA 3GFZA 5HJYA 1T8EA 2WOMA 4ED3A 2H5IB 4MH8A 4OYOA 3MGJA 2O3DA 4ANEA 1ZBTA 5KFXA 2BX6A 3OTCA 3NBPA 4V19J 2ADLA 1EP4A 2IBOA 1AFJA 4JI1J 1NHKL 3G8QA 2LXFA 3CCZA 4P72A 5CD4A 4BHQA 4J37A 2KKHA 4NWBA 2NXCA 2Y9HA 3MEGB 4DV1J 3W62A 1X93A 1TKDA 1WDTA 3FRYA 2RRAA 2O1PA 2GQQA 4U96A 1U1OA 4KHPJ 5CYMA 2HW3A 5F8MA 4CNZA 4HACA 3QNWB 1CJUB 4CYUA 4OHYA 2BJ9A 4PWDB 3WC2A 3EUNA 1WC1A 3CD5A 4RBVA 3LWMA 1S6QA 2MGZB 1NJYA 3MPVA 2AYGA 3K89A 2MKSA 2MKKA 1FWKA 4I6AA 4YQWA 1FFSB 3HK2A 3MECB 5B0EA 2MTLA 1S0NA 3H5XA 2ZBPA 4MKAA 1VQ8S 5A8KA 3W8PA 3VAMA 3Q8PB 2AY0A 1N33J 1RTZA 1XR6A 4G6VB 2ZOFA 1Y5IB 3FSIA 1NEEA 2KRBA 1N32J 4X66F 5B0BA 2WSEC 3EPGA 3LA0A 3M6WA 5LM7E 2NR0A 4FYVB 4MYTA 2CZ9A 1JMTA 3KLIA 2CAXA 2ZHAA 3G6XA 4YB5A 1D9FA 1JLFB 5K9FA 2ATCB 1NJIT 3UDVA 4ANCA 1JB0C 2UVVA 1T0TV 4YFUA 2J76E 3AXMA 1VC5A 3QLHA 1SC1B 1JJCB 4F7VA 5HI7A 1OS5A 3D0GE 3S1TA 7FD1A 3JQMA 1EZZB 3C19A 3CJ8A 1F5BA 3ENWA 5IC6B 4Q45A 1QJHA 3RB3A 4FPRA 1RAGB 3M8PA 3OD2A 1SKWA 1X4BA 3SFUA 2FHOB 4KKOA 3BZQA 4RW8B 2COLA 1FRJA 4ZLNA 2JNJA 4ZOSA 4DLEA 3DMJB 4DF4A 3J7A1 1SJ4P 1FXRA 1RBAA 3HVWA 3RR7A 1MROB 4C3MA 3DGPA 1RT3B 4X4VA 2J9DE 3PXGa 4OYBA 5EX0A 5FLXY 3UD3P 4WFBQ 2OEMA 5B0DA 3MR7A 4K4YA 1YJNS 4K5SA 3GV7B 4K4UA 5DDRC 3KG1A 4MK8A 2FUG9 4MJWA 3G8SA 2AHOB 5DETA 4MIWA 5KFFA 1ITPA 4KFBA 4X65F 4RU9A 1JLGB 2WW8A 5HROB 2PT0A 1X4AA 3QZ8A 4H4MA 4UY8T 4OI4A 4LIWA 5HP1B 3MPUB 4J9SA 2CQ3A 2EPIA 2E5LF 4JV1A 3CJ2A 2IYGA 1B7YB 3TJAA 4Y2AA 2XO6A 3MOZA 3SZ2A 1U2CA 2HWTA 4CT8A 4LVNP 1NPKA 3BR9A 2EFVA 1TL7A 5ETMA 4TU9A 2PE8A 4K4TA 4OZ2A 3AD8C 2OSQA 3MM7A 3MCSA 2DNHA 2KT3A 2HG4A 4RBUA 3FMBA 5CZXA 3CJ4A 4HV0A 1Y5LB 3TA2A 4UQGA 3WIUA 1OY6A 2BXJA 4WK3A 3T5KA 2DRBA 4Z7CA 3KLEB 2HVZA 1ICEB 3QZ7A 5ETNA 1TQLA 3ILJA 5EUHA 4KV8B 5HVHA 3MEKA 1KONA 3M6UA 1QDUB 1SB6A 4OHXA 2BSQE 5J1EB 1Y10A 2B9YA 3IWLA 3WIVA 1LV5A 1UJ6A 4CO2A 3UR0A 4JI7F 1XQIA 2GHPA 1DHMA 1EETB 2F63A 2YNGB 4O0IA 3IC1A 3FMWA 2E5HA 4ELTA 4G1QA 5D3GB 2OPSB 2P8IA 2RS8A 1K0TA 3UVJB 4DUYF 1F5AA 1AXQA 2QJ3A 2HZVA 1Q81T 1KS2A 1S1WB 3CCTA 1NMEB 2PSZA 1URRA 1R8HA 1LWCA 5LJ5Y 3EGNA 3WHIA 1MLAA 4USWA 4IQMA 3KHHA 4U7UD 3R3TA 3DNCA 3SDEA 2C3PA 2B5JA 3DRSA 1C1BB 2VPXB 5KAKA 2XS2A 3X1LB 1ARQA 1RA7A 2XMTA 4PXEA 3OL7A 4F0KA 1ZYQA 1OYDA 2YWHA 5HVFA 4AYBD 1RT4B 4QQBA 3NOCA 2UUWA 5KFDA 4HTIA 1U2RA 1BY9A 2KZZA 1S1UB 3MUMP 3ZZRA 3ENVA 2RRBA 2RQKA 5EWEA 4MYUA 3DYAB 1U2FA 1YLXA 3GIRA 3HVRA 1HWIA 4NXNJ 2CJYB 2XZWA 3Q89A 5I3UA 5KFPA 3H5SA 1X4GA 6FD1A 4C11A 5FIIA 3KG0A 4DX5A 1D3WA 5IWAF 2YXLA 4IG3A 1LWEA 1JX4A 2E7VA 1REGX 4Q8EA 4J9LA 4GKJJ 2R7VA 2LXIA 3NS5A 1S10A 4OYAA 2I5JB 5E3CA 4JI2F 2JL9A 3MMAB 3P5TL 4PG6A 5F0WA 2X1BA 5LMNF 4Y0FA 3CIZA 1BXNA 4PUOA 1VC6A 2B8QA 2ZKTA 1FKOA 2AQ4A 3BQ1A 4KB7A 4O44A 4GMKA 3PW0A 2BOAA 2BQ3A 1X4DA 3BN7A 1EQMA 4NZ7A 2JH3A 2N3OA 1KC8T 1SUQA 2J9EA 4LSNB 3GR1A 4D3HA 1MW7A 3M9OB 3KHLA 3E2EA 2DNZA 4I7FA 2V8PA 4AUKA 1HR0F 2YBVA 2IA0A 4AFFA 3KK3B 4OYIA 2E9ZA 2C22A 2C2MB 2DRDA 3MM5A 4DV4J 3O6QA 2Y1JA 2GGPA 4B17A 2M0GB 1HBNB 1IKWA 2WONA 4ETXA 2AIRB 5B0GA 5KG5A 3VVTA 1JLBB 2ASYA 1SL1A 3B54A 2M8DB 1PBAA 2H3EB 3MPWA 2B9WA 2MZRA 4D3GA 3WBZA 2IFXA 2ASDA 1N4LA 5A6WA 2HBYB 2ZH6A 2CPEA 3FFIB 4MTPA 2FGOA 2FHJA 5HMYA 4X62J 2BKOA 1DTQA 3D1OA 3K5LA 7AT1B 4TY8B 3EZOA 2EG2A 3K57A 2YKAA 1UZDA 5CZVA 1RT7B 1S1VB 1NK4A 2R7RA 1NDKA 4OMFG 3T6JA 3AA8A 1S59A 1PCAA 3KLGA 3KMQA 4JOUA 4F02A 5A0YB 3QOQA 4NEZA 2KG1A 1UVIA 3GV8B 1R6YA 2VUGA 2DHHA 4H54A 4X4TA 3GE9A 3BGUA 1RAFB 4CCHA 1Q5YA 1G2EA 5G4DA 1LQ9A 4DXLA 1IBKJ 1NKCA 3CIMA 3SV3A 4M5MA 2RS2A 1HWUA 3QJLA 2JX2A 3LPYA 5HO4A 3I9ZA 3HF5A 1RAIB 4U67Q 4ED6A 1VJQA 2V4JA 2ZFHA 1J2VA 3EVMA 2HHHJ 2VG5B 2ZZNA 5DDOC 4ZN3A 2OELA 2H65B 4A8YA 1S97A 2Q79A 1RAEB 2FHKA 1UJ5A 2ZDOA 3R27A 4F4XA 1EX8A 4LFAF 2JRSA 3I0RB 4DV7F 4ECZA 3TZWA 4KO0A 3HHLC 5KT7A 3P8BB 1UWAA 2CYYA 1PG5B 2CPGA 4C4WA 3B8HA 5FDLB 3GB0A 3OLAA 2DY1A 3ILLA 1VQSA 2AZ3A 1HQUB 1IBLJ 5KFNA 2PMWA 3PFOA 3T1HJ 2V94A 4B3OB 3MTKA 2HHSA 1QLNA 3P5BP 2RJZA 3VGTA 1EA4A 4CO4A 3VAHA 3JSBA 2BR0A 4DR5F 1TFWA 1VDHA 3C8YA 1QAYA 1UAWA 2B51A 1TKXA 4O3OA 2W7PA 5B08A 2C2NA 3NGKA 4WPAA 2IPOB 5L46A 4TXSA 4JI8F 2FC8A 1R8AA 2BEFA 4Q2LA 2D9OA 2UUAF 2HS3A 4DR7F 4NLVA 3ZFVA 4DR3F 2KHCA 2GIFA 2MLZA 3T19A 2GO9A 3U1MA 2JEJA 3IR5B 4G1IA 4RW7A 4A8MP 2EEYA 5C42B 4WCEQ 1HARA 3RBEA 3P4UB 3DXSX 1LWFA 2QG9B 2A10A 3IRXB 4WKRA 3FC9A 2W2OP 2H51B 1MG7A 2DGUA 2WVBA 2V0NA 4J9VA 4ELVA 1BDTA 1V5IB 1KD1T 1WG4A 2E5JA 2AF6A 3N6NA 3C14A 3KOAA 1WOSA 3OTOJ 3QRRA 2LA6A 1KNZA 3CNQP 1NK7A 4K50A 2AKWB 5CYQA 3UE2A 1ZS6A 2MKIA 3M8WA 5CABA 1VRTB 6FDRA 5J2MB 3CC4S 1U6BA 2UUCF 2N4DA 5F9LA 2GVDB 4USVA 2A6MA 2IDLA 5HL7Q 3T1YJ 3W64A 5SZTA 3OR1A 3IA0A 3MMCA 5L38A 3CCMS 2RF2A 4MIAA 1LXNA 2WRMA 1WKJA 3IS9B 2JWNA 2XMKA 2X1FA 3PY8A 2C2ZB 4UOFA 2J6TA 4ZCLA 3MM9B 2NS1B 1CS4B 1YJUA 2C3UA 4A8FA 4OX6A 1IVZA 3QBCA 1B4SA 3TQ1A 3GXQA 2VBWA 2G2ZA 2HYIB 5AJ3J 3KLHA 2M9KA 4ID8A 4LF5F 1B28A 1FRLA 2ZZMA 2XZTB 4K0KF 3R97A 1RTIA 1RTDB 3KFWX 1XN9A 4O3RA 3N9UC 1OYEA 4ILLA 2C2KB 1TL1A 4A8XA 4MAKA 4Q7AA 5D0HA 3RBZA 4LMZA 4WYWA 3BYRA 1PJ7A 2JHEA 2ZHOA 3UQSA 2ACMA 4C8YA 2DCUB 4B3RJ 3LGMA 2IMWP 3KJNB 2B0GA 2GQ2A 2R3VA 3N6MA 4YR2A 1FCAA 1U8SA 4DCJB 3A13A 2FYXA 4NPOA 5I3QA 1N34F 3I0SA 4K5RA 2DIVA 1S4EA 1GK8A 3OFGA 5LSLA 2V63A 2DHXA 5BXIA 5L8RC 3IAS9 2A2CA 4X4PA 2DKOB 4YB7A 1CPZA 2LLZA 1UPMB 3FJ2A 2HFVA 1U9PA 2EFQA 3DM2A 5B09A 3F44A 2DD8S 1S0VA 3ZTSA 3E51A 1CG2A 3OV7A 2QMUB 2R8HA 4NOHA 2AP6A 2ZM6F 2VG6B 3R7SB 1FDDA 4OYMA 1TV6B 2C3OA 4WJBA 5KFTA 1X9WA 3CO0P 2N4CA 4WKYA 2CPZA 2BDPA 2BQRA 4ENOA 3JXOA 3K2YA 4FBTA 3N4WA 4IFYA 1LW2A 3UO0A 4F3OA 4H4KC 1C2PA 2R7XA 5CXTA 2G0CA 1NNDA 3ULHA 3CWJA 1NLAA 3D66A 1FA0A 2ASLA 2XGPA 5KG4A 1OY8A 3L95X 2HMIB 2V4RA 3DLLQ 4YDXA 4IR1A 5HQ8A 1GNKA 4NZ0A 5D4PA 3ZZ0A 2ASJA 3BGFA 4N47A 4ZVQB 3OQ2A 3FCVA 5E7OB 4CLFA 1U1PA 2BNWA 3R5DA 1RAHB 1F5CA 3J7ZT 1IKYB 3W5YA 3IMQJ 4U95A 3HT3A 4V19X 3M2VB 1JK9B 1N5QA 1S76D 1SXLA 1UJ4A 3VR1A 3FDSA 1HWLA 4LJMA 1RU1A 1U7LA 2QZ8A 3GJSB 1HNIB 2V9WA 4C98A 1KN6A 3W2WA 3DOKB 2YWFA 5H9EK 3TX8A 2K6LA 4DS4A 2GPEA 1YSJA 4C3KA 3H2UB 2HNYA 3QIPB 3HHLA 1WC5A 2E5GA 3TUPA 2QLWA 1KLMB 4OZ5A 3QSYB 1YBUA 4ICLB 4EEYA 3H0PA 3MEGA 4X4NA 2DGOA 4TLRA 3P6YC 4M5JA 4ZPBA 4RUHA 2DO4A 4C9DA 1IQTA 1LFWA 1UEKA 4CO0A 4DSFA 1U09A 2GV1A 1LKZA 2W24A 4HDGA 2W2NP 4BCAA 1CJUA 4P2SA 2XSJA 2NZ4A 1RHQB 4PWDA 2XNQA 1KDNA 1YJ7A 2MGZA 1VQNS 1ACMB 3JS9A 4LF8F 4DL7A 4W90B 1V3SA 3QFHA 1FRIA 3A8JA 1O8BA 2DT9A 2NLWA 1Y7PA 4IRDA 5E33A 1MMNA 1OO0B 4FF2A 3MECA 4ILMA 3PG9A 4GC7A 2PD1A 2Y8WA 3OJSA 4URQU 2HVIA 1XMOF 3NS7B 3OJUA 2M4MA 1BQNA 4U8VA 1W2BR 2XBPA 2YKMB 5A8WB 3TOQA 4BC9A 3L3CA 2D69A 4RW9B 1FRMA 3H59A 1WG1A 1RHRB 2W8LA 1R0AA 4UZCA 4DSKA 3SQGB 2WVFA 1R8PA 4DHVA 3S01A 1YZ7A 2W2PP 2NPFA 3BH7B 1UP1A 4X65J 1RCOB 4DN9A 4LF6J 3MCMA 5C25B 1N5YB 1RI7A 1PJ6A 1HI1A 5EGYA 2E5LJ 1WEZA 4NLTA 4AL5A 1FXDA 3FT7A 1WHXA 1KQGB 3SBMA 1DTTB 3DKDA 3LAKA 2BJ3A 1RTJB 4M5HA 4W4MA 2CZ4A 3LQVA 4PG8A 1BWVA 3T5HA 5HMWA 3V4IA 2UUBF 3MXHP 1DLOB 3NL0A 5HATA 1NK9A 2Z2YB 2LMIA 2KYXA 4DV2F 3DMJA 1Q86T 1K44A 1MROA 4L6V3 3C6TA 2MY8A 3TEHB 1CVJA 4LVOP 1TU0B 5K5MA 3FNNA 4K4VA 4B3MF 2YH0A 2KVQE 2HBRB 1XBWA 4RKUC 3I5BA 4RNMA 2DGSA 2J8SA 2ZVSA 2QEXS 3Q8QB 5D8HB 4M5DB 2AWZA 2ZOMA 2YWGA 4I1TA 3NWRA 2VFVA 5IXUA 2KFZA 3MFHA 2Z4PA 2R2TA 1P9QC 3TJ9A 4JI7J 2WOMB 1F2GA 2C2EA 1U8WA 4C0HA 1HW8A 3RBXA 1TKTA 2CJAA 3CDWA 4C6AA 1Q8KA 3CCES 4OZJA 4NYZA 1KHVA 4FVCA 1K1QA 3PHEA 1K1SA 5HROA 2RQCA 1Q95G 1IBMF 3NKYA 4B3TJ 3DDNA 2X1AA 3W61A 1KHWA 1TUGB 1TUWA 4Q8FA 4DUYJ 2DY9A 2O66A 2KH9A 1X60A 3R5JB 2MQMA 2GJ2A 1FRKA 2XM3A 3LJPA 3L09A 3DRRB 2R8KA 4X4SA 2CDRB 3D1HA 1ZAWA 2ZE2B 1VRQC 2YX7A 2C42A 2VBZA 3CC7S 3GIMA 1DARA 4I68A 3W66A 2P6SA 1K73T 4WP9A 5HBMB 3DLGA 3HM9A 3PRBA 4C8NA 3NO7A 3ISND 3TVZA 3M32B 2XB2D 2E1RA 2BOPA 1RISA 4MFBB 1RADB 2F8MA 1SVDA 5J1EA 4OV6A 3I5AA 1VK8A 3K5OA 2FDNA 4F3MA 4ZK7M 3CDUA 1S4FA 2XG8A 4A4JA 4OQJA 3GU0A 2XWYA 4XAKA 2EBEA 3BPDA 1R3NA 4U7UK 4DUZJ 2DR8A 3SCJE 5IT4A 3BO2A 1F60B 2CNOB 2OPSA 2F8EX 3FEXB 1GEHA 3KLIB 3D67A 3RB0A 1X0FA 2Y1LB 3I6PA 2BYCA 1G1XA 3ETOA 1X5SA 4H4KA 4KE5A 1SL2A 1NM2A 2JC1A 3CJ5A 3EZUA 5DGBA 2NUHA 2M5YA 3QLHB 1N0VC 4JI6F 1YI2S 2IA6A 1FX4A 5LMNJ 3BBFA 1BQMB 1KSPA 1NH8A 4ATNA 2ZH8A 3M8PB 1C1BA 1SC6A 1VHFA 2OKQA 1N36F 4NCGB 1DURA 3Q8YA 3DHXA 4FZVA 4KKOB 4WFZA 3IWXA 1YRXA 3EVOA 3HSGA 1M90T 3DGPB 4P2MA 3EX7B 1RT4A 5KFOA 3BQ2A 2QSFA 1RHKB 5THWA 3LUYA 4NMXA 1HR0J 3H25A 2ALYB 2DGWA 2X1GA 2ZKUA 1OHNA 2HK3A 2IM1A 1YTYA 1EAYC 1XMQJ 3T5JA 3W65A 2KXFA 2H1OE 4LR7A 2K3IA 4KFBB 2E9RX 1XTZA 4CH1A 1AZSA 1L3TA 3D28A 4DL0C 2UXCF 3LAMA 3NY0A 3OVAA 3BDEA 2FVSA 1HNWF 1QE1A 5KFKA 4ZCKA 2J7KA 3SYZA 3D4JA 3WX4A 2XY6A 4AAIA 2BABA 1QVFR 1FWPA 1NLKL 2PI5A 2RDDA 1ZOTA 1O0PA 4QIEA 2KN4A 4I6WA 4HR2A 2OTJS 1U0HA 2E66A 5JVGQ 3C46A 3N0VA 3R9LA 4DCPB 3G96A 1L3UA 2OD4A 3AD9C 5D0RA 3J80U 2IJFA 3OVBA 3GLJA 3TWZA 2A2BA 3W7BA 2FVRA 3M2UA 2X3DA 3W8GA 2YNIA 2DR5A 3KK3A 1CULB 4N76A 2JXGA 2YY3A 1QUPA 2LQ9A 3VAKA 4NLQA 2CRLA 1ROFA 2ZUGA 1JLBA 2JVOA 2HFSA 5JXSA 2GMHA 3LANA 1MWZA 5FD1A 4FYDA 1ZZNA 2IHR1 2P9CA 3EMTA 2V68A 3HFZB 3D6MB 2ATLA 2XMWA 3K8VA 4LFAJ 4LF7J 1NB2A 4DV7J 1Q16B 8AT1B 2DR9A 2R7TA 3JAMY 1RTHB 2RU3A 3HVTB 3FZ2A 4H4OB 4FNIA 1P27B 3DLHA 1HBMB 2R42A 1RT7A 1S1VA 4ZJOA 4PRFA 1LWCB 3Q8UA 3LWLA 4IUFA 1NK8A 4OFZA 1N6QB 5E41A 2F3JA 3BREA 5A0YA 2ZJQQ 2B5JB 2B9XA 4DV3F 1NJWA 5U47A 1YJTA 3KKFA 5KFVA 2PMHA 5LJ3Y 4KIAA 4P6QA 4KYZA 2X7IA 2FB0A 4NLGA 3FZBA 4FF4A 4CO3A 4ZVPB 5KFJA 4JI0F 3AJ2A 3UN2A 2GIQA 3ETMA 2W7OA 2ZH3A 4JI8J 1N8RT 3BSOA 1R89A 3PKYA 1RBOB 3R8YA 2VG5A 4X4UA 2OMLA 4DR7J 2CPHA 2A6OA 1AA1B 4HTJA 4DR3J 3ILIA 4KHMA 3Q83A 4XK8C 2MHEA 2CQ2A 2L9DA 3CCVS 3SSSA 2PN6A 4I67A 1S77D 2VKRA 3NCPA 1TMJA 2R2UA 3NXZA 3I32A 1V3ZA 5I3UB 1S48A 4LF2A 4N8NA 4C11B 3N79A 3PHTA 1LFPA 3I0RA 4IG3B 5IT9U 1DBDA 1LWEB 1N5TA 2AEMA 1HD1A 2KM8B 2E29A 3HZEA 2F9JA 4LBPA 1PIEA 2Y0BB 4LRCA 1KQFB 1VCTA 4B3OA 5D0GA 3NMAA 4USTA 5AE3A 1VQOS 4PWUA 1FKOB 1K9MT 2QGFB 4O3QA 1C4CA 3M8RA 4LF1A 3VTIA 4YR0A 3HHNB 3OXFA 3LP1A 2W9CA 4DQPA 2GVZA 1Y3KA 1LK5A 2YNHB 2J9DA 4ES3A 4UUXA 2NXUA 4B9NA 1IN0A 3TVYA 4I7FB 3GSIA 2OUGA 4C2MA 3CCRS 5T41A 3SIPB 1X7VA 3B4DA 3MM5B 1HBOB 1WHVA 4HI2A 3DLEA 4X84A 5AXMA 1CJVA 1IKWB 5J2NA 2MQQA 2V34A 3TYTA 2FLNA 4ZCMA 2ZH1A 3BF4A 3SV4A 5C42A 2JC0A 3BH6B 2BW2A 3VZHA 3IRXA 4CLPA 3PYEA 1NZ8A 4PQAA 1UFLA 2HGLA 3KLVA 1H0HB 3C15A 4LBIA 4ZS6A 4I64A 5BR8F 1M1GA 3FCHA 1ZETA 3A3NB 3ZZPA 5FLXU 4MMOA 1FVQA 5IS2A 4OHVA 1QVGR 3ENQA 4K0KJ 3IGVA 3JQJA 3NCRA 1UEVA 4PXBA 1JXVA 1GH8A 2VB6A 1D0EA 2HQFA 3OL8A 4QIVA 4ECXA 1Z2ZA 2J5AA 4M5NA 4X4OA 1VRTA 2FZCB 4PAAA 1RK8A 4CLSA 3FVYA 1HLWA 4UOCA 2GVDA 4E2FB 4ANDA 1PJ5A 1WEXA 3A12A 3LGHA 3JQKA 3IS9A 1WHYA 2CG8A 1CC8A 4DG1A 4ZDNA 5KFSA 4GO5X 1VBZA 3I87A 2ZH4A 1AT1B 2OSRA 3UCGA 2QFIA 2EK1A 2LU2A 3BB5A 1CS4A 2OHDA 1HFEL 2OIHA 4K2JA 1HBUA 2V4JB 1UKUA 2LP4A 2NXJA 2NUUG 5GAEI 4OI0A 2L9WA 5JVHQ 5L1KA 4DR2F 3H42A 1X4HA 2R4FA 3HO1A 4DLGA 3H7HB 3K5MA 3ET6A 4EWTA 3OXGA 2ZM6J 4ZLJA 2Q43A 1U45A 1RWXB 4C8KA 2ADBA 3TUIC 4KO0B 1FO1A 5L39A 3O5TB 4DR6F 1RYRA 3AJ1A 4LRVA 4BWMA 3D5MA 4NRTA 2NCKL 1N88A 3MEEA 4LREA 3CDEA 2AMCB 2PGCA 2PFFB 3HSJA 2U1AA 1OMSA 2IVYA 1KVJA 2W01A 5K8NA 2K8GA 1X4EA 2KZMA 4JI3F 2HWHA 1TVRB 2HQIA 4HEA9 2DVIA 2C2RA 1JJ4A 1TKXB 2WZ1A 3O44A 1YQHA 1DQ8A 5AXNA 1A6LA 4DFKA 1UMJA 4B02A 3KUHA 5IQQA 2YPYA 2EFGA 2HLTA 2DH7A 3G87A 1HI0P 2NQPA 3OTEA 2MJNA 4EBCA 3OTDA 4RW7B 5A6PA 3R2CJ 2DNQA 3MPYA 4LF9F 2E7WA 2DPJA 3Q0AA 2VG6A 5SUHA 2V8VA 4QYZK 5CD4H 3ZTQA 4YDDB 1XMBA 4QIGA 3E8OA 1O51A 4DBQA 4FN5A 1PAEX 2JVRA 2HNZA 1U26A 3NGUA 1SKUB 2AJ0A 3M6XA 2BM1A 2PA8D 3UCUP 3N5FA 3DRXA 3F0NA 4IR9A 4CH7A 2W9AA 4F4AA 1KTQA 1S9EB 3C14B 4QU6A 2DGVA 5CYQB 1FD8A 1IM6A 3GG0A 2FLLA 4DN0A 2GQCA 2K1OA 4ITSA 5C24A 5D15A 1Y4ZB 1XIQA 1FHTA 1RCXB 4FXVA 4M95A 4ES2A 1HWJA 1YJRA 3CEDA 3T3FA 4ECVA 1IR2A 1KP6A 2B7BB 3W9HA 5F8HA 2OLWA 5DDQC 3FEZA 4LF8J 3HHDA 2IMOA 3NOGA 1F3FA 3M2VA 1VIXA 4B9SA 3CJ3A 3O1LA 1SQFA 1XR7A 4YB1P 4ECQA 3RJMB 3T5LA 1XMOJ 1SH3A 2XCAA 1J5EJ 4XTTA 4WF9Q 2XLIA 4DPOA 3QJPA 5HVGA 1VISA 1V9OA 1I6JA 3M05A 1X0PA 1BUXA 2AGOA 2IJRA 3RAQA 1S6PA 4ERDA 3QIPA 1RAOA 2GZOA 1KLMA 4J9QA 1TL1B 1UZHA 3CMES 3CULA 4ICLA 5B7WA 4EFAC 1S0OA 1NUEA 3MI7X 1AB8A 3LO3A 2VDIA 2ZBCA 3R5AA 4GC6A 4J9KA 1SC4B 5KFBA 2OFGX 2B43A 1QAXA 3RRKA 4CT9A 3DDKA 2L9NA 2WCXA 2J0WA 1MWYA 3I0SB 2CA9A 1H2VZ 3IGNA 4NCAA 1XK8A 3AB2B 3ZZTA 4O4RA 2W4DA 4E0DA 2K7JA 4K4ZA 2FD2A 2LQ8A 4CO5A 4R8UB 2UUBJ 5ITHA 1U6FA 4JV5F 3ZTRA 2VONA 4DV2J 3ISZA 1NK6A 3GSDA 4HH0A 2CPFA 3AOCA 2BV3A 4OJ3A 4CTAB 4Q43A 2LXUA 5IM0B 4B3MJ 4DR4J 4AD6A 2BW7A 1FDNA 3LALA 4QCLA 1DFDA 4JB8B 2HS4A 5E2QA 1DY3A 1M5SA 4WFNQ 3J81j 2AYMA 4RW9A 2P5VA 4HKQA 3VAJA 4Q0BB 1FJGF 5IZHA 3JTPA 3SQGA 3TJ8A 1SI9A 1IUJA 2YKNB 4CLTA 3G71S 1G3OA 1ZAXA 2HHUA 2V2QA 5E3AA 1LW2B 2Y1IA 2Y1RI 1Q79A 4IG0B 3U1LA 1FF2A 1S7HA 3MHYA 1JQGA 5C25A 2YVSA 2YNFB 1C1CB 2CWKA 1N5YA 1KTVA 2F5GA 4JV0A 1U1QA 4F67A 2XYGB 4USHA 4ZMMA 4NLDA 2DRAA 4ZVOB 2UXDF 3TA0A 1DTTA 5DDPC 3TAPA 2N82B 1VRUB 1RTJA 4C97A 4QYRA 3RYLA 3TRGA 4X4QA 1X8DA 1UVNA 1DLOA 8ATCB 4LF4F 5K8MA 4R0JA 4Y6IA 5F8IA 1ZZFA 3D6HB 1RA6A 3DC2A 1TL3B 1D8ZA 3A8EA 3BSNA 3HKWA 2EBGA 4WZMA 5D78A 2RKIB 2LEBA 1QSSA 2HGMA 4QR1A 1AROP 2P6TA 4M5DA 5LSRA 2NSCA 4M1KA 1WWHA 3KUGA 3NP5A 4DMZA 3F73A 3VWSA 1P94A 4Q44A 3MTJA 2FVCA 5LSOA 3W2WB 4EO8A 5ETOA 4RR5A 3FMTA 2RD5C 2DXDA 1HI8A 4U6PA 4M94A 1EJ7L 4C7QA 3OR2B 5KG6A 2KM8C 2HNYB 5J2PA 3KYLA 3HHLB 2R2RA 3BPSP 3OFEA 5GAHI 2KU7A 1GMUA 5ETKA 3W1YC 3AFGA 3CJKB 3CO9A 1X31C 1UVKA 4KJIA 2J9CA 4J9OA 3KXDA 4WE1B 3MR6A 2LQ5A 3FRZA 3HDSA 5HJXA 3LW5C 2RNEA 3DRRA 3AJDA 2M7SA 1JXEA 3FBEA 4JI6J 1EIYB 1Q7LB 1WJ9A 4NLXA 1N33F 4FS1A 3PW2A 2ZE2A 3CT9A 2XSJB 3W60A 3Q2TC 5A76A 1REVB 4IH5A 4P73A 4ZHRA 4F2RA 1U1MA 4GKKF 2CJQA 3KNGA 2O5DA 3KHGA 3LPEA 2DH9A 1N36J 2IM0A 5F8JA 3TQEA 1T7PA 3PYDA 5HBMA 2JXHA 1T11A 1N48A 3M32A 1Y0HA 2M8HA 1FJCA 4ZP7A 4MFBA 2NSBA 4KPYA 3N01A 5GADI 3FGVA 1GT8A 1BQNB 1BHNA 2WVEA 4TVAB 3GPAA 1R0AB 3CVKA 1Q78A 2OAUA 3MR2A 1FTRA 1VR6A 3HSZA 3BKTA 1R31A 2EK6A 4RNNA 4MKBA 2W9BA 5LXYA 1F3VA 4F3QA 2MQNA 2KJWA 1VS3A 1DJ0A 3HD2A 4XDCA 2XO7A 1HKAA 2IRXA 4EK2A 2CQBA 1W7WA 2R7SA 1S99A 2J7WA 2VF3A 1XERA 1HNWJ 1JKHA 4RLEA 4QWEA 2QC3A 1BQMA 5GMDA 1S6OA 3POTB 3A3OB 4QWAA 5D77A 4WIQA 2V4QA 2DGXA 4AL6A 2UXBJ 4WXWA 3M8QB 4DDFA 2F1FA 3NAHA 4NCGA 3V4IB 2XMMA 1X5OA 2GIRA 2VDHA 4GVBA 1B01A 2K1RA 3NMRA 2CVEA 2HIQA 2AJ1A 3C6TB 2VPZB 3UDLA 4PPZA 1UVMA 3SSRA 4YHHF 1VK3A 2KXHA 3M4XA 5M2RA 3GFXA 3PJWA 5F0UA 4LFBF 2JOQA 5T14A 1QSLA 1ELOA 2HAIA 2DNPA 3FK4A 2FLOA 4TLQA 1U48A 2HLUA 4QYZJ 1VBYA 3WDOA 2JFKA 1P1TA 1Q82T 2ZZTA 1FDBA 1T9VA 2FJEB 4DU8A 3NGRA 4Z37A 2QV6A 1AUSL 3TI0A 5MAOA 3PKMA 1TKTB 4K7QA 4LT6A 5GAHU 4M8LA 5HQLA 1RT1A 3UR3C 4U7CA 1M5HA 1PC5A 4QU7A 1HHSA 3AH6A 2ZC3A 4M63A 4OHWA 2P9GA 3BGLA 4ZVFA 4NASA 1S9GB 3SMZA 3WZ0A 4DS5A 3FSYA 2HRYA 3IO1A 2RE1A 2ABYA 2JDJA 3GIKA 1Y5NB 1GTHA 2BANB 3DOMA 1PARA 4HHHA 3DLJA 1JNRB 5KFAA 2FJVA 3MCOA 3W5ZA 3GILA 2BQUA 4DV3J 1H7XA 1NHVA 3CJSA 4ZPCA 1C4AA 3DLGB 1IJFB 4YP3A 5GADU 1CULA 3IP0A 4JI0J 3GYXB 2GJIA 2CQCA 3KHRA 3QGIA 3SXLA 1IR1A 1HL6A 2Z8QA 4S0MA 2CXEA 1D9AA 3RB6A 1SQGA 4YB6A 2XYHB 3KLFB 3OW2R 3HKZD 2D3ZA 2I1RA 3SEOA 2CIMA 3QAUA 1SH0A 6AT1B 1G6BA 1T9UA 2VOPA 1Q16A 3UW1A 4N7TA 3CXCR 1U02A 1RAJA 3ICLA 1RTHA 3HVTA 4DPTA 4H4OA 4DX6A 1HBMA 3HZGA 2YX4A 2WSCC 1PYOB 2OPPA 1YITS 2ZHBA 3SCLE 2FJDB 1YVFA 1N6QA 1LOUA 2EVZA 4RU2A 5B0FA 2F40A 1RXOB 2IC3A 3W63A 3RW7A 4Y00A 1RWOB 1WKKA 1RT6B 2H48B 2GA7A 4DFMA 4DV5F 5D6GA 2FJAB 4DV0F 5D0EA 3IRWP 3RAMA 4HH1A 2OFHX 4JYAJ 4EZ6A 1FE0A 2B6AB 1RWVB 3CGIA 3J7YI 2VPWB 2BNZA 4UQTA 1TAUA 2G2OA 2AJ2A 5KOXA 4ZN1A 4YS2A 2MB0B 2MQOA 2LEAA 1FTCA 3DGVA 3DFEA 1FERA 1ZA2B 5DG8A 4DR1J 4KGXB 2H3AA 1TTHB 2QX0A 3X3UA 4CLUA 4P7VA 1JLQA 3M8SA 1AZSB 2XGQA 3BSCA 1UL3A 4XPCA 5HMXA 1YHQS 2MQ8A 3TO8A 1HNZF 1QUVA 3B4MA 3DOLA 1NPPA 3M2RA 3UN3A 1QE1B 4W98A 1U1KA 4DV4F 2CZVC 2ZBIA 2OD6A 4LR8A 4RUAA 4JBCA 1FE4A 1IM4A 4X4RA 1R43A 2LYVA 1NDLA 4CIOA 1TR0A 2IM2A 2YWEA 1E6VA 1FNXH 1U0HB 4WTOB 1WORA 4WWSA 3DRYA 2AJFE 2PDAA 1TZ0A 4WBFA 3CCSS 3TAQA 2YNHA 3JSMB 5BYSA 4DQRA 1VIOA 3M2UB 1Q1KA 4ZJQA 1RYSA 1UWBA 2YNIB 3A1YG 1H74A 3MAQA 2VZ9A 2DYAA 2UU9F 1VJWA 3I31A 2MLXA 1HBOA 4N8OA 5CA5A 2HHPA 4KBIA 2ROPA 2X51A 3MD1A 1DAXA 4DR2J 2GS8A 2J8AA 4DL5A 3QGHA 2WB1D 4OV1A 3VQSA 1EKRA 5AE1A 4NE9C 1VHIA 2FJBB 3UPFA 1ZAVA 1N5SA 4MJKA 1IBKF 3L4BC 5M2PA 4YUDA 1XNRJ 1GMWD 4DR6J 2F4VJ 4ZVHA 3PFEA 1PYTA 1CSJA 2WBRA 3J81U 3V6DA 2LQJA 4OIXA 4Y2KA 2GC8A 2BKPA 2KRRA 2HHHF 3FCWA 3G82A 4DX8H 1VI7A 3ISNC 1S72S 3CE8A 3CCUS 4G1PA 1K8AT 3PRVA 1WI6A 4ZA1A 3M8YA 1NK5A 2LU1A 4JI3J 2JFDA 2QLFB 2JLFA 3GONA 3HHEA 4RW4B 1RDRA 3GWCA 2CFXA 3P45B 4QR2A 2XMJA 2NREA 3J7YU 4FYXB 1HHTP 2LFVA 3R2DJ 4ED5A 2W2QP 5KTQA 3BV8A 1G4CA 4ZP9A 2YKPA 1T9TA 1WELA 3Q22A 1NZAA 2AEJA 4C8MA 2XCPA 2MMYA 1M1HA 1YG0A 1ZM3A 3VAIA 3EGWB 3BSAA 3HP6A 4M5LA 3DHWC 2AYBA 2GMJA 2B4PA 2L3MA 4X64F 2U2FA 4Y2MA 1RUSA 4CNYA 1BWEA 4LRDA 2WVDA 5KFHA 2BRLA 2CJXB 1RHUB 1S79A 3B82A 1SIWB 3CW2C 3CSKA 1XNQF 3QO9A 1VQ6S 2EW9A 5AXLA 3TNVA 1RWNB 1TVRA 2B4UA 3OBIA 4G3IA 4IKAA 1UTAA 3LP1B 3R6GB 3C16A 2W9CB 1WNEA 3KJQB 2GVZB 1SJRA 1KEKA 1TK5A 4PG5A 3C6UB 5DJBA 3VGSA 4EI2A 1YWXA 5IT0A 2AGQA 1RT5B 2V8DA 3DLEB 3CD7A 1CJVB 3K0JA 3QRQA 5J2NB 3SFGA 2MY7A 3GMGA 5ETTA 2VQEF 2FVQA 3TZXA 1KRPA 4A8OA 4JI5F 2ACYA 2CJ9A 3C15B 3HMJG 3H5YA 2BJDA 5DG7A 1H98A 2XS7A 4NMLA 1ZH5A 4WIIA 2K06A 2DB1A 5KG0A 4M5GA 2H5EA 4F8RA 4IYQA 3W2VA 4ZVRB 3CCQS 2AEFA 1BMQB 2ZEJA 3WC0A 4K2XA 1S9EA 1X4FA 3N28A 3NCQA 1ZM2A 2E1CA 5HQMA 3NLCA 3CUNA 2HVHA 3TVKA 3MMBA 2ZNYA 3AB4B 2HFOA 1WI8A 3ZC4A 2D9PA 2JZ5A 3BBBA 3VVUA 1JWWA 1JLCA 1PAUB 1QTMA 1HW9A 1LW0A 4F4WA 5DG9A 1YK9A 5DQGA 2DNGA 1TP7A 1C0UB 4ZVGA 2OEJA 4HL9A 4UZBA 3D3BJ 3DLBA 4DG1B 1KLNA 2A18A 3VEBA 1H73A 2RH3A 4C0BA 4L75A 3G8TA 3HFVA 2F8HA 5IC4B 4JV5J 1HBUB 4NI2B 2CJBA 2PFDA 3EICA 5C2GA 4TYBA 4NA2A 2DEIA 4ZVEA 2XYPB 3US5A 1YJVA 3J80Y 3PNIA 1HQEA 3NNHA 2PI4A 1R8BA 1EHWA 2HQ3A 2VQFF 4JP8A 4DL6A 1F1BB 3ET6B 2OPQB 3J7Z5 2FY1A 2DCLA 4Q5VA 3H8YA 3PW5A 4QR0A 1FJGJ 2MZQA 3L7OA 1M5PC 4PXCA 3QRPA 2IBKA 3VF0B 1YKWA 4B3SF 2QLBB 3OPKA 1HPZA 4XDDA 5E3PA 4RBTA 3WQPA 3H2LA 2C2DA 3JTOA 2VJUA 3LTOA 4QIWD 1M0SA 5JJBA 2ALZA 3MEEB 1FEEA 3UWTA 2DNOA 3V5RA 1GX6A 1ZPVA 3LH2S 1WDDA 3Q8SB 3H2VE 5DZ7A 4USJC 2LVWA 2UXDJ 1GXLA 1D9DA 2RILA 4C8OA 2OGUA 1WF0A 1M5VC 1BE4A 2NYHA 2KOEA 3UI3A 1WOOA 2BE9B 3QPIA 4G65A 1B70B 2W7AA 4R8UA 2M88A 1FKAF 4LF4J 2V8GA 1U1RA 3H5UA 1UW4A 4CTAA 5IM0A 3TARA 4OZ1A 2ILYA 4IRCA 1R6VA 2BRKA 2MLYA 3H4BA 1JNZB 2Z56B 4A8QA 2KB2A 1Z1ZA 1MWQA 4IOCQ 1ZM9A 4J9NA 1RZMA 2ZH9A 4Q0BA 3TZZA 5E5NA 2HNZB 4U8YA 3K8WA 3IR7B 2YKNA 3QWPA 5L1JA 1Y00A 2IIHA 3A8IA 1MYLA 5ADZA 2V2ZA 4IG0A 3OXLA 3G5OA 4J90A 5C5JA 4N77A 4EGLA 2YNFA 1C1CA 4E8UA 4WU2A 4LQ9A 2N7CA 5IT9Y 2PEHA 4ILRA 2C3MA 2CNLB 1VRUA 5C24B 2MKJA 3KK2A 1BGXT 4PZVA 2QA1A 1Q0NA 4KGZB 1OQ3A 2QL7B 2QYGA 3IBFB 1YIJS 3O8WA 2V2VA 4OJ1A 4NLRA 3MM6B 1FK9B 1CJKA 4GKKJ 2X3GA 2J0XA 1OPZA 1MN9A 3I4HX 1TL3A 4ELUA 2JLGA 4OYZA 4WYLA 9RUBA 1TL4A 2RKIA 2MHNA 1D8YA 4LFCF 5CCLA 2E9TA 4NYPA 2XS5A 2EFNA 3VAGA 3THVA 2D3OR 1Z2LA 4NL5A 1RHJB 4X2BA 1GAOA 4L3NA 4ZPDA 2JJ4D 3TAMB 4A47A 3HXMA 1N52B 3HLUA 1WC4A 1IKXB 3I5CA 1S6PB 4OZNA 4P2XA 5GAGU 4ECRA 2JXIA 3OR2A 4X66J 4LRFA 3IWNC 2K9IA 3C66A 1VOMA 4RX6A 1RAAB 4HT5A 3EDQB 3UD5A 2HRUA 1KR4A 3CJKA 4CRJA 2GW8A 2HHXA 5A2QU 4OHZA 3RTVA 2I2YA 3M30A 4WE1A 2HEKA 4YR3A 4IO9Q 4B9UA 1K47A 3PV8A 3L9ZA 3IXQA 1REVA 3QT6A 1CC7A 2AW0A 1IJEB 1XWLA 4FPIA 4TN2A 2HBQB 2G13A 4NEYA 4QBUA 1FKPB 1WKLA 2Q2KA 1LXJA 3IG1B 3KTQA 1WTFA 3H98A 1PGZA 4BDPA 1P8GA 1WACA 1MSWD 4Y2IA 4UF4A 2HVDA 4LF6F 1VMBA 4DPXA 1GFWB 3TP2A 1UW9A 2CQGA 2FVPA 4YHHJ 3QT5A 5KFIA 4O0NA 3PRDA 4MK9A 4LFBJ 5F41A 2V67A 5AT1B 1FD2A 5K14A 3LP0A 1HD0A 2HSEB 2XC9A 2FY8A 1L3SA 3NNCA 4LSLA 4LIRA 5JMNA 1GTEA 1HNXF 4LRAA 1RACB 1TUVA 2HQCA 3DDIA 3LP2A 4QW9A 1W25A 3R5BA 1YBTA 5CAAA 1NB7A 4OI6A 4DU7A 1P9YA 2KI2A 1J27A 4NLUA 4HI1A 1P1LA 4OLPA 2FJWA 2I8EA 1SV5A 2EWHA 3V81B 2MXYA 2YKOA 5F8LA 4KC5A 3BEGB 2W8KA 1URNA 2RQMA 3HSDA 2K5JA 3POTA 2CQDA 2GAHC 3NWGA 1S49A 3M8QA 5GVQA 3CDAA 5L9XA 2JEIA 2KYZA 2QN6B 3PVXA 2K3KA 3OFHA 4NLYA 1CJTB 4L76A 1RSCA 4A8WA 2BJ1A 1O6XA 5DZ6A 1HIYA 4ED8A 1F9HA 1C0TA 1D1UA 1QTNB 4B3TF 2R2SA 2EG1A 1JLAB 2IRYA 5J2QA 1HA1A 5DRKA 3IFEA 4R5PB 3VAFA 3H40A 3BGRB 1I51B 3HVAA 1E6YB 3OVSA 4V1Ak 1JLEA 4OJHA 2C2OB 3AAWB 4P2FA 3TUJC 3ZTOA 1H6KX 4CH0S 3MDFA 5LXRA 2HK2A 1ZTWA 5J2PB 2AX0A 1GX5A 1U47A 2B9EA 5HAOA 4HHJA 3GR0A 2ZITA 4I6YA 1FRHA 4DSIA 1FVSA 2CWXA 4ZLLA 3FKBA 4XIUA 3M1VB 3GTYX 2KFYA 3EGZA 1SCJB 1OSDA 2R8IA 1S9GA 3K58A 1RB0A 1EARA 3OLBA 5KFEA 2Y3YA 1T05A 2MKCA 5L1IA 3DLKA 3NNEA 1HMVA 3LGNA 2AJ4A 1DQ9A 3TW0A 2BANA 2WHOA 1B64A 1NSPA 3PX0A 2YWKA 1WSVA 3P3DA 4ZHRB 2W4PA 2VBYA 1X9SA 4AXJA 4OI1A 1B0PA 2MQLA 3S6EA 1SJFA 5ETLA 2H4WB 4DUZF 1NH7A 2FLPA 4K4SA 3M9NB 4DV5J 3PJXA 2BE7D 4DV0J 1HQ2A 4NLOA 3PZPA 2A2DA 3G4SS 2VC1A 3PM9A 1B0TA 9ATCB 4XO0A 1IBCB 4O3PA 4O23A 4Y3CA 2BE2A 5DO2A 3W3SA 4OI2A 4PWWA 1T03B 2ZWPA 3HJVA 4JI4F 3CTRA 1BQXA 5H9FK 3CJRA 3KLFA 1ULRA 1EB0A 2Z2ZA 3ZNUA 3GV5B 4OZLA 2W9BB 2DNMA 3OHBA 5ETSA 3NS6A 1RT2A 2MYFA 2R7WA 2XHCA 2QRRA 4O4GB 1YJ9S 2BUNA 5EWFA 2W4CA 4DEZA 5IWAJ 1CQMA 3CB4A 4QWCA 3CCWA 1FXLA 2G2YA 4OX8A 2ERRA 4UW2A 1HNZJ 2ZJPQ 3KJVB 3CCJS 4JI2J 1JKHB 4I2PA 5J1PA 4ZPTR 2DNYA 2RVJA 3PEHA 4KAIA 1VLYA 2I38A 4DCOB 1XMQF 2DBBA 4RW6B 3ITHA 1FEHA 5DLGA 1FFWB 2OP5A 4UT4A 3M9MB 1S7IA 1S1TB 4IH6A 1RT6A 2XHWA 4GVBB 5KFUA 3UD4P 2K1RB 2WK4A 3EXCX 4RNOA 1T3OA 3HI9A 3ZZOA 3MPDA 1VQ4S 2DGQA 2KTQA 2GJFA 3BKUA 3ZO7A 2JEGA 3KNAA 3HHKA 2B6AA 4PKDB 2QO3A 3MM8A 2FZKB 2C1EB 2UU9J 4KSEB 2VFTA 1QSYA 2FJXA 2VODA 4DZ6A 4A46A 1NXIA 2Y0SD 2ZD1B 2XI3A 4KH1B 2VOOA 1TKZA 1UFKA 2DTJA 3PW7A 2CDQA 4CI0B 4Z7YA 4I69A 1NK0A 3MMJA 2XQCA 2HRTA 1I3OB 2BJ7A 4RO0A 1S1XB 2RUGA 1RWMB 3MFIA 2DIUA 1RT1B 5EX3A 2UV8G 4QIFA 1SL0A 1HYSA 1X4CA 3QWUA 1SH2A 3V4MA 2VASA 5KT2A 4HVZA 3KDNA 1VFJA 2VG7A 3ENAA 3SI8A 1HNVB 2Y8YA 4WP8A 4RJVA 1VC0A 2F7VA 2CQ4A 1OWXA 1IKVB 4F26A 2CQPA 4HT7A 2UUTA 1U1NA 2KL8A 3DOMB 2P9EA 4ECUA 1A0OB 3KDOA 5GMKa 3MUVP 2C3YA 4OYXA 2LECA 5RUBA 1T3NA 3OSNA 4DV6F 2PMZD 1NDPA 4W92B 3JSMA 1CLFA 2V8HA 3D2WA 1CQNA 2J0QD 5D4OA 4KY3A 2KFNA 4LF7F 3GG1A 3NEKA 2DNNA 2BACA 4PYDA 1EKSA 3IM9A 2FPHX 3CD0A 3RBDA 2W1BA 4K4XA 3J7AN 4ZLPA 3FBBA 5IFMA 5B0CA 1B99A 3H90A 2F4FA 5H9EJ 3PCOB 4RPFA 2WSFC 2HZCA 1H3DA 2AGPA 2A0FB 3EJMA 3RRHA 3GFYA 3OUYA 1RKJA 2V5HG 4Y65A 2KHDA 4F0HA 1TELA 3BO4A 3CPWR 1S0MA 4P75A 5BJRA 4RL1A 1T9WA 4X64J 2R9LA 1KWMA 4A8KA 3AD7C 3BN4A 1QAIA 4LSZB 3CMAS 3U7JA 2D74B 2ZOGA 2OPPB 4BS2A 2KG0A 4IDKA 2GHVC 1XNQJ 5HN0A 3G6ES 4IOBA 2MEWA 3EM1A 4WFAQ 2IC3B 1FRXA 3UNGC 5M2UA 4FXEA 4DR5J 5CYJA 2E1MC 1QAJA 4RW4A 4TNOA 5D4NA 4TYAA 4NLPA 2H54B 1N0UA 1SQEA 3DRPB 3TEGA 2HS0A 4DQIA 4KH0B 4PPDA 1VBKA 4NXMF 2Q66A 4ED2A 3H87C 4R25A 1S57A 1Y3JA 3BGOP 3SCIE 2HGNA 1N5VA 2VU5A 4RWXA 3S8SA 4CLYA 2UUAJ 5I4MA 4KPCA 1MU2B 3BO3A 5LMUF 1WD6A 4CLLA 3B6BA 1M5KC 2E1PA 4OX9F 1GXTA 3AT1B 1V5VA 5KT3A 1EQ0A 2AZ1A 3CDBA 5C7PA 4WFXA 5T7LB 2VQEJ 1WG5A 4EMDA 2DNRA 4JI5J 5CHCB 1JLQB 2JLEA 4FF3A 5A8RA 4PEOA 1B3TA 4DZDA 1GMVA 1JXLA 1RGVA 2DHSA 2CNNB 1WC0A 3GIIA 1U1LA 3DOLB 2LQBA 3T9ZA 3M2RB 3I4PA 2EFOA 1SIWA 1YDLA 4P10A 1VQMS 5F8GA 1DRZA 4USMA 1UA0A 4IFVB 2SXLA 2IYIA 4Y2CA 2DO0A 2UVWA 3QAEA 4CM2A 1TK0A 4P74A 1FX2A 3VHQA 3S7RA 2EKYA 2IAJA 4C48A 4AQYF 2EKNA 1WF2A 4B9VA 4PG7A 2OH2A 1E6VB 2UUCJ 1Q53A 4R0EA 4LBHA 1NSAA 3D9BA 2N3LA 3FUYA 4MKVA 5IOLA 3T41A 4N41A 3C6UA 1A9NB 2B56A 2Z0GA 3KMSA 4YY3F 1UWBB 4CP5A 3IAM9 3TZYA 1H72C 5HLFA 2V9KA 5CH7B 3R7NB 2PO4A 1RT5A 2VFRA 4L3KA 2EC0A 2ZC4A 3GYGA 3Q86A 1H2UX 4I2QA 3W5XA 3KK1B 4ZIVA 2VL1A 3TX0A 4FBUA 3R7BB 3QSIA 3ZZUA 1HWKA 2FHJD 1RLCL 1KFDA 3GZ7A 2V50A 3U02A 3MAAA 5I42B 1J5OA 4DFJA 2DK2A 2LEPA 2BVZA 2VQFJ 3K7RA 3NGTA 1MMDA 4Q2MA 4LF5J 3R1HA 3MOJB 3MUTP 2BA9A 2HQGA 3E01B 2MZJA 5KOWA 2W25A 4KQZA 1BLUA 2FIUA 4IO1A 2YPZA 4B3SJ 1R8CA 1JJHA 2DHGA 2Q3PA 2GFFA 3QFWA 2FZGB 3V6DB 2G0IA 2YQ0A 4ID5B 2EC2A 2P2CB 3G82B 4ER8A 3GJTB 4P9SA 1Y11A 3NNAA 1QM9A 1R0BG 1VQYA 1FFGB 3JYTA 1UFWA 1N34J 2BJEA 5HK4A 1C0UA 3IM8A 2IVFB 2O01C 3DU5A 2WTFA 1DZ5A 3AOAA 4IRKA 3BS9A 1RWWB 1SJ3P 4DQQA 3RU0A 4NI2A 4FYWB 2YTCA 2HBZB 1WHWA 3DN9A 1SKSA 3AXKA 1LNQA 4RUCA 2FC9A 1QD1A 2DISA 3DXBA 5H9FJ 3MR5A 3PDNA 4ETZA 2OPQA 1UVJA 2APOA 2XNRA 2QL9B 3QYYA 4DUTA 2QLXA 2XI2A 2HKEA 2PC6A 1TL5A 2HNDA 3FEYB 4J9UE 4ED0A 4ZITA 2ROEA 3C3LA 3GJQB 4WTYA 3QO9B 1KVIA 2L08A 4J9MA 4J7CA 3TR5A 3VGVA 2MSSA 1YGYA 2Z58B 3ADAC 2AT1B 4IH7A 3MEDB 5KFLA 2HQDA 2H9ZA 5KFGA 2DGTA 1SJ1A 3C16B 3FBFA 1NAQA 3D6TB 4URGA 2LKZA 4DFPA 2LDIA 1XR5A 1RE1B 3BR8A 1KOOA 1V3RA 2KT5A 1NRKA 1FJ7A 2QLJB 5LOQA 1ARRA 5KT5A 5E0OA 2WBMA 3Q2SC 3PO4A 4C8LA 4JV2A 4QJVA 4ZIWA 4GO7X 2I9SA 4NLWA 4N56A 4ED7A 3CJQA 4LFCJ 1Q5VA 3GFHA 2B4OA 2I0XA 3IR7A 3AA9A 3R1LA 3PR4A 3RRGA 3W9JA 2DH8A 3RB4A 4MKYA 1I94F 2PA3A 1X5PA 3NRBA 3W2VB 1KFSA 5K20B 4OX7A 5G0RB 2HVEA 3C2PA 1FESA 1JIHA 2L48A 2QT7A 2QSWA 1R0CB 4FKXA 2V2KA 2M70A 4F25A 2KT2A 3MMBB 1WUUA 3DI6B 2YQ1A 4WP3A 1AFIA 4J9RA 4YMEA 2ZH2A 1JLCB 2OPRB 4F36A 1LW0B 2N7YA 1J5EF 2YX1A 2MKYA 3HCXA 2AJQA 1PSDA 2WW4A 3CJ0A 4PQUB 4ZP6A 3MM6A 1FK9A 3MCNA 1HHQA 4B9LA 4NA1A 1RP5A 4E98A 5DLFA 1H2TZ 2LA4A 4ALZA 1SJQA 2XLKA 3JSYA 3DU6A 1HQEB 4GRSA 1JLFA 2VC0A 2VJVA 3ZZYA 3D68A 4BBYA 3TAMA 5C2CA 2DR6A 2RSQA 1YJWS 1VQ5S 1IKXA 3THTA 3F56A 3VGUA 5KG3A 4QPXA 3GCXP 1HNXJ 2IY5B 2FQQB 3OFFA 2G1HA 4WZQA 3I55S 1UCNA 2ILZA 4AE5A 4GVLA 3SQOP 4RW8A 1HPZB 2VBXA 3SCKE 3PEJA 1TAQA 4QW8A 1NJXA 1QY7A 5KFZA 3A4TA 1RT3A 1S9FA 4DR4F 2FTRA 3G86A 4ZVTB 3AQPA 2QA4G 2IVMA 1FKPA 1S12A 3J81Y 3D1QA 2DITA 4KHRA 3IG1A 5F8NA 1AYEA 5KFRA 2RDJA 3NBPB 4KGKA 1PC4A 1KQKA 1JLGA 1EP4B 2D7SA 2XTJP 1MYKA 3V6HA 4B9MA 2HPUA 3UCZP 2YKQA 3RZAA 5HP1A 4DL2A 5B0AA 3UDCA 1H38A 1B0VA 1I1GA 1XJWB 2CPYA 4UOGA 3V6JA 5EDWA 2GHWA 5CYMB 3CJTA 3HX9A 4ZP8A 4UUWA 2XLJA 1RLDA 3FQKA 1IR0A 3MR3A 1M1KT 1KOHA 4DSJA 5KT4A 4HACB 1NJZA 4CYUB 2B3TB 2RHSB 5I3PA 4BC7A 3LF0A 4FXWA 1S6QB 2PIIA 4KRWA 2MSTA 4YOEA 3KLEA 1L3VA 4DL4A 4CLKA 1IBMJ 3PO5A 3V81A 3M8ZA 2R7QA 4J91A 1OG7A 3T6BA 3I96A 5E3RA 4I4BA 4KV8A 1PKUA 2PEBA 2ZWOA 3FQLA 2POKA 2H1YA 2GMLA 2R7OA 3NGSA 2J7UA 1AW0A 2VKZG 3KK2B 4RUBA 5A8KB 1U25A 4DJBA 3F41A 4ED1A 1MMLA 1LEOA 4Y34A 4O3SA 3OSPA 1A7GE 4F4KA 1U24A 4LR9A 1CJTA 1CJKB 1OSCA 4FNHA 1H7WA 2CQ1A 1OQ6A 1EETA 2VH7A 3VCDA 2BMBA 2YNGA 3PX4A 4JI1F 3RW6A 3Q8VA 3RGIA 3VV2B 3JB9k 3G2XA 4OL8A 2YWWA 5D3GA 2RU9A 3MZIA 4DV1F 1X5TA 1TK8A 1RKIA 3D7SB 3UVJA 1JLAA 2HFNA 2D3UA 3AY0A 1VYAA 4R5PA 5DQIA 4KHPF 5KFWA 1FNMA 8RUCA 1PYSB 3ZNJ1 3BGRA 3ELHA 3I56S 1E6YA 1S1WA 5CQGA 4JI4J 4C8ZA 1NKBA 4J9PA 3HHLD 2H4YB 3JSRA 1BD6A 3BDPA 2MZ1A 2RBFA 2B7CB 2D1CA 3LOUA 3OHAA 2KELA 3KJFB 4EU0A 5KT6A 2Z2MA 1VQLS 3M1VA 4U9RA 5F3TA 4FYYB 3M30B 2EI5A 2VHGA 3OT9A 2QA2A 3KUEA 1VQKS 2CADA 3PYFA 3Q8RB 2GCFA 3ONQA 2QMXA 4F50A 2IJNA 2RB7A 2DR7A 1S1UA 5LL6d 2JBVA 2GO8A 1IQZA 4FS2A 2MZTA 5IV3A 4ZVUB 2Q6CA 1OPIA 1BC6A 2XULA 1N32F 4KGVB 4UY85 3DYAA 3IBWA 4ZJLA 4EUVA 3W9IA 5DS7A 4EO6A 1FDAA 2J0SD 3MD3A 1FWLA 3HULA 3MWBA 3EPIA 3AOBA 1NDCA 2C28A 3HJFA 5IV4A 3D54A 4M5KA 2AU0A 2XZDB 2G4BA 3OL6A 4KGMA 1KQSR 2GNKA 4H4MB 4MIBA 4CWBA 2UZAA 4USKA 2AX1A 2I5JA 1L3KA 2KVIA 1TFYA 3MMAA 5K14B 3LP0B 1T03A 2F65A 4LSLB 2NYIA 1TL7B 1Q8BA 2FHMA 2L41A 1Q8IA 2K2PA 1N56A 2UXBF 3MM7B 4HDHA 3P96A 2MPUA 1Q4RA 5HSPA 3G9CA 3LP2B 2RDIA 1GXUA 4LUBA 2XMAA 5KG7A 4O4GA 4UTGA 4ECSA 3IR6B 4N5SA 3HD1A 5ETQA 3O2IA 3QGGA 3CCLS 2UXCJ 2ZVIA 1SKRA 4LSNA 1SV5B 2EFPA 1NBEB 4QPTA 4AXIA 2HIYA 3KJVA 1W2IA 4DF8A 4ES1A 2CQIA 3NGDA 3N6LA 4FP9A 3U27A 1HBNA 4EBDA 2ZUAA 2Z30B 4RW6A 4DSEA 1WC3A 2M3DA 4OYWA 1CEZA 2R8GA 3K5PA 1S1TA 5E3QA 1KKHA 2QTWA 7FDRA 4TY9A 4DV6J 1FI4A 3FFIA 1RHMB 2IM3A 2WB4A 4G1QB 1C0TB 2AN7A 2G0JA 4P7TA 4TY8A 3TA1A 2M2BA 4NX9A 4F2SA 4RNHA 3R6LB 1R7IA 5J2QB 2DEJA 2NXNA 3D6FB 3GCWP 5EWGA 2ZD1A 2CKWA 4IOAQ 2Z2LA 1T02A 1PBUA 1GMWA 3UNYA 4TQSA 1JLEB 1NU4A 4J5OA 3OL9A 2KDOA 1IWGA 1S1XA 3TANA 3QJJA 4NLSA 4OJGA 2BBEA 4Z2XA 1GQEA 1APSA 1SC3B 3SDEB 3DRSB 1WC6A 3H20A 3EVWA 4AL7A 1VGYA 1Y9OA 2ROGA 2DHAA 3HT0A 5LT5A 2G9OA 4HLBA 1F9FA 1HNVA 1OY9A 4M5IA 2CJKA 3HFKA 4D8JA 3UFCX 4Y28C 1T05B 1IKVA 5D4LA 3DLKB 1IWAA 2RHQB 1SPBP 3VQTA 1HMVB 2DJWA 4L72B 1JJ2R 4MK7A 4B08A 2A1BA 1Z4UA 4BLGA 4TU7A 2RMLA 1OIAA 4IQXA 1YX2A 3ZZZA 3BQ0A 4PXDA 2I6WA 4OLOA 4DPUA 2BJ8A 1MNTA 1I5OB 4CO1A 2CPIA 3KWMA 4NXMJ 3BJYA 3K59A 1PO6A 4CZCA 4LRBA 4DSLA 4JUZA 3U1NA 2BA3A 5FDLA 3M7VA 2J6UA 2BE2B 1HQUA 1YZ6A 5LMUJ 2V69A 4OX9J 4DQSA 1RABB 1NCLA 2VA2A 1U49A 2UP1A 4PUOB 4FXDA 3NG8A 3QQCD 4O44B 1RT2B 3VW4A 4OYPA 3T1AA 5J1NA 4ZVSB 3M6VA 1SUQB 1RWUA 4ECWA 1T94A 3EGVA 3P49B 3G6VA 4JYAF 1CBKA 3O3LA 3GYNA 4ZPVR 4I2PB 5EHHA 3PR5B 5F9NA 2E1AA 3EXYA 4CLWA 2VPYB 2XSFA 3BKFA 2GGPB 1R27B 2WONB 4USIA 4FF1A 3ITHB 2D41A 4AQYJ 2NPIA 1QTGA 1SIZA 2CVIA 2MZSA 5A2QY 4NXNF 2ZNZA 4DR1F 3Q24A 2LCWA 2NZCA 2HURA 4I56A 3DRPA 1DTQB 1O5JA 4GKJF 4YY3J 3IBCB 4ME7E 2CG4A 3MM8B 3PX6A 2XEXA 2E44A 1MU2A 4ECTA 1TKZB 2RUSA 1RWPB 5DM6Q 4DX7A 3PJ9A 2E7XA 5T7LA 3A8KA 3UDEA 3SSQA 1RJJA 1W26A 1VQ7S 5K8OA 5DQHA 5J2MA 3KLGB 5KG2A 4QWBA 4L73A 3EWGA 4RNFA 2MJUA 1AUDA 1HYSB 5BR8J 1P6TA 2WAQD 2VA3A 3BBCA 2VG7B 2KO1A 2XWXA 4NCBA 3V2UC 2HZAA 4IFVA 3Q23A 4EYIB 2DNKA 3MURP 3MM9A 1NHUA 3R5GA 3MAHA 2QL5B 2MQPA 2CPJA 5DGAA 5ETPA 3QIDA 3G6YA 2B8PA 1NSKL 2QE5A 1RBLA 3CD6S 5L9NA 1BDVA 4P52A 4X62F 4XPEA 3CF5Q 4PCQA 2Q1LA 5FJ4A 2HHWA 1VBXA 1LK7A 1N54B 4F4YA 1RTDA 1XNRF 1T9XA 5F3ZA 2HHVA 2F4VF 3KK1A 4FDFA 2RAQA 2IRUA 2K7KA 3MF5A 4HYKA 2ZBRA 1NO8A 5I42A 5GMEA 4CDIA 4UOHA 2ADCA 2CNKB 2CAJA 1RWKB 3GP9A 3OUYB 4DPYA 2CPDA 3TUZC 4CQ1A 2W2MP 1T95A 3E01A 1WEYA 1MNEA 2NXEA 3BYPA 2XY7A 2QFJA 2VIHA 4DL3A 1T9YA 3QT7A 4BWJA 4TQRA 2AD9A 1FNOA 4IDKB 4PABA 1U6ZA 4ID5A 4YN3B 2MKHA 4WK1A 1ZTTA 2YQ3A 2EXUA 4NZ6A 4F4ZA 4A8SA 3EE3A 2GX8A 1YRUA 2BKNA 4OZ3A 3D0IE 1B7FA 1LWFB 4K59A 3QATA 4URSA 1TV6A 2IDEA 1MN7A 1KVKA 1F9EB 2XMUA 2R7UA 1IXKA 1G7CB 4K8RA 2WVCA 3K5NA 2VFSA 3ZXWA 2KXNB 2FGCA 5ETVA 1VLOA 2CUYA 1WTBA 3THPA 1KBRA 2OEKA 1IBLF 2Q6BA 5ETRA 2RRNA 3T1HF 1DQAA 1K0VA 5HANA 4ZPAA 3NAIA 3N5BA 3QT8A 3T9NA 3V6KA 4LF9J 2QYCA 3KG4A 3RUBL 2HMIA 3IN5A 3WX8A 1FJEB 3CMQA 3GQCA 5CCMA 3PIOQ 5A8RB 2B4VA 1IRQA 2OMOA 2QA4S 2UVUA 2K29A 1YRTA 5KFQA 3PIPQ 5K8PA 4EZ9A 2CPXA 2VD3A 2HFUA 4I0WA 2ZH7A 2YH1A 1UETA 3MMCB 3OR1B 4FVMA 4L74A 1I94J 2RF2B 5IQ6A 2BZ2A 2QIFA 1NSQA 1VQPS 3R5CA 4EYHB 1IKYA 2HWIA 2HAFA 4NYOA 3VALA 4NA3A 2BM0A 1U4BA 1F0XA 2IAJB 5GAEU 1RU2A 2DNLA 2H5JB 3MEDA 2RQ4A 4DWIA 2RT3A 4CM0A 5H1SV 3QMQA 2JSXA 2HHTA 2DXEA 3AODA 2OI2A 2ZBQA 4WFYA 4TU8A 2ZDPA 1LWXA 2ZJRQ 1HNIA 3KLHB 3E3XA 2UV8A 2VV5A 4DI6A 3DOKA 2DPIA 3EDRB 5HLFB 4QZVB 2E5IA 5KG1A 1Q8LA 4WU3A 1RTIB 3I9V9 2J6SA 3GIJA 2Z57B 4I2QB 3D3CJ 3OTOF 1F6TA 1S5ZA 2DXFA 1UPPA 1PILA 4ECYA 1L5UA 4PG4A 2RIJA 3MAAB 3A3PB 4EBEA 1J5OB 4PR6A 5L1LA 4C3LA 1RQ0A 2QMWA 1NKEA 5AE2A 3B78A 5KFCA 1XEZA 3D0HE 3PYGA 3T1YF 1S6UA 3DCAA 3OTBA 3RR8A 2OJ3A 4AT1B 4RZRA 4F0MA 2GAGC 3CC2S 2HHQA 4WXOA 2D3O1 3PACA 2LDYA 1V6HA 4QWDA 3FBCA 4ZKAA 1F2HA 5G0RA 5DM7Q 2F9DA 3QGPA 5MLCV 1BAZA 2CQHA 4MT1A 4K4WA 4TKTA 2AV5A
chains in the Genus database with same CATH topology
2BNZA 2BSQE 2CAXA 3BKUA 2WVCA 2WVFA 1ARRA 2FGCA 2CPGA 3PHTA 2JXHA 2F1FA 2BJ9A 3VEAA 2K1OA 3GXQA 2WVBA 2K5JA 2CAJA 1U9PA 1P94A 3QOQA 4FXEA 2RBFA 3BKFA 2BNWA 2HZAA 1B01A 1BDTA 1PARA 1Q5VA 1Q5YA 2KELA 2Y3YA 1QTGA 2BJ7A 3FMTA 1EA4A 2BJ8A 3OD2A 1B28A 1MNTA 1MYLA 3FT7A 2CA9A 2WVEA 3H87C 2PC6A 2NZCA 2BJ3A 1IRQA 2BJ1A 2CADA 2JXGA 2K29A 2HZVA 4HV0A 2BA3A 2JXIA 2H1OE 3BKTA 1BDVA 3VEBA 2K9IA 1MYKA 2AY0A 4ME7E 2K6LA 2GPEA 2WVDA 1NLAA 3VW4A 4D8JA 3QSIA 1X93A 1BAZA 1ARQA 3LGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNZ A;  2BSQ E;  2CAX A;  3BKU A;  2WVC A;  2WVF A;  1ARR A;  2FGC A;  2CPG A;  3PHT A;  2JXH A;  2F1F A;  2BJ9 A;  3VEA A;  2K1O A;  3GXQ A;  2WVB A;  2K5J A;  2CAJ A;  1U9P A;  1P94 A;  3QOQ A;  4FXE A;  2RBF A;  3BKF A;  2BNW A;  2HZA A;  1B01 A;  1BDT A;  1PAR A;  1Q5V A;  1Q5Y A;  2KEL A;  2Y3Y A;  1QTG A;  2BJ7 A;  3FMT A;  1EA4 A;  2BJ8 A;  3OD2 A;  1B28 A;  1MNT A;  1MYL A;  3FT7 A;  2CA9 A;  2WVE A;  3H87 C;  2PC6 A;  2NZC A;  2BJ3 A;  1IRQ A;  2BJ1 A;  2CAD A;  2JXG A;  2K29 A;  2HZV A;  4HV0 A;  2BA3 A;  2JXI A;  2H1O E;  3BKT A;  1BDV A;  3VEB A;  2K9I A;  1MYK A;  2AY0 A;  4ME7 E;  2K6L A;  2GPE A;  2WVD A;  1NLA A;  3VW4 A;  4D8J A;  3QSI A;  1X93 A;  1BAZ A;  1ARQ A;  3LGH A; 
#chains in the Genus database with same CATH topology
 4KTQ A;  1TMM A;  2XY5 A;  1X9M A;  1UEU A;  1D09 B;  3DI6 A;  4HHU A;  3DM2 B;  4A48 A;  4B9T A;  2KKE A;  1YBA A;  2OPR A;  3AHP A;  3EYZ A;  1U0S A;  2OTL S;  3L7P A;  5AXK A;  1ZPW X;  5JUM A;  3VEA A;  3JYT B;  2KJV A;  4P71 A;  2V6A A;  4RWW A;  5AJ3 F;  1ZA1 B;  1WOP A;  1SBR A;  4O3N A;  2YKM A;  5A8W A;  1XC9 A;  5BYQ A;  4PQU A;  4KT0 C;  4NRU A;  2XMV A;  3ZTP A;  4OZ0 A;  3RAX A;  1UA1 A;  3K17 A;  2A3J A;  4IFY B;  1OJ4 A;  2JEF A;  4ZCI A;  4DPW A;  3RG6 A;  3HPO A;  1M5O C;  4B3R F;  4LQ3 A;  2AYE A;  5BYR A;  1WF1 A;  1Q7Y T;  2ZH5 A;  3PTW A;  2G1D A;  2VIC A;  5KFY A;  2CQ0 A;  1NPR A;  5HMZ A;  3EZ5 A;  4USU A;  1UVL A;  1WSR A;  4OI3 A;  4CLZ A;  4F04 B;  3GJR B;  3ILO A;  3L7U A;  4FKY A;  3BM7 A;  5GAG I;  3I82 A;  2MDA A;  2UVR A;  3H4D A;  3UN5 A;  2HND B;  4DOZ A;  4ZPW R;  5KFM A;  4PYA A;  3FSX A;  3VZI A;  4KR0 B;  4YEA A;  1ZM4 A;  3PW4 A;  2HFZ A;  5EN1 A;  1FT8 A;  1VQ9 S;  3JTN A;  2R8J A;  2O67 A;  4C0O C;  4ED4 A;  2M52 A;  4QOT A;  2VFU A;  3JAM U;  2OO4 A;  3AQO A;  3GFZ A;  5HJY A;  1T8E A;  2WOM A;  4ED3 A;  2H5I B;  4MH8 A;  4OYO A;  3MGJ A;  2O3D A;  4ANE A;  1ZBT A;  5KFX A;  2BX6 A;  3OTC A;  3NBP A;  4V19 J;  2ADL A;  1EP4 A;  2IBO A;  1AFJ A;  4JI1 J;  1NHK L;  3G8Q A;  2LXF A;  3CCZ A;  4P72 A;  5CD4 A;  4BHQ A;  4J37 A;  2KKH A;  4NWB A;  2NXC A;  2Y9H A;  3MEG B;  4DV1 J;  3W62 A;  1X93 A;  1TKD A;  1WDT A;  3FRY A;  2RRA A;  2O1P A;  2GQQ A;  4U96 A;  1U1O A;  4KHP J;  5CYM A;  2HW3 A;  5F8M A;  4CNZ A;  4HAC A;  3QNW B;  1CJU B;  4CYU A;  4OHY A;  2BJ9 A;  4PWD B;  3WC2 A;  3EUN A;  1WC1 A;  3CD5 A;  4RBV A;  3LWM A;  1S6Q A;  2MGZ B;  1NJY A;  3MPV A;  2AYG A;  3K89 A;  2MKS A;  2MKK A;  1FWK A;  4I6A A;  4YQW A;  1FFS B;  3HK2 A;  3MEC B;  5B0E A;  2MTL A;  1S0N A;  3H5X A;  2ZBP A;  4MKA A;  1VQ8 S;  5A8K A;  3W8P A;  3VAM A;  3Q8P B;  2AY0 A;  1N33 J;  1RTZ A;  1XR6 A;  4G6V B;  2ZOF A;  1Y5I B;  3FSI A;  1NEE A;  2KRB A;  1N32 J;  4X66 F;  5B0B A;  2WSE C;  3EPG A;  3LA0 A;  3M6W A;  5LM7 E;  2NR0 A;  4FYV B;  4MYT A;  2CZ9 A;  1JMT A;  3KLI A;  2CAX A;  2ZHA A;  3G6X A;  4YB5 A;  1D9F A;  1JLF B;  5K9F A;  2ATC B;  1NJI T;  3UDV A;  4ANC A;  1JB0 C;  2UVV A;  1T0T V;  4YFU A;  2J76 E;  3AXM A;  1VC5 A;  3QLH A;  1SC1 B;  1JJC B;  4F7V A;  5HI7 A;  1OS5 A;  3D0G E;  3S1T A;  7FD1 A;  3JQM A;  1EZZ B;  3C19 A;  3CJ8 A;  1F5B A;  3ENW A;  5IC6 B;  4Q45 A;  1QJH A;  3RB3 A;  4FPR A;  1RAG B;  3M8P A;  3OD2 A;  1SKW A;  1X4B A;  3SFU A;  2FHO B;  4KKO A;  3BZQ A;  4RW8 B;  2COL A;  1FRJ A;  4ZLN A;  2JNJ A;  4ZOS A;  4DLE A;  3DMJ B;  4DF4 A;  3J7A 1;  1SJ4 P;  1FXR A;  1RBA A;  3HVW A;  3RR7 A;  1MRO B;  4C3M A;  3DGP A;  1RT3 B;  4X4V A;  2J9D E;  3PXG a;  4OYB A;  5EX0 A;  5FLX Y;  3UD3 P;  4WFB Q;  2OEM A;  5B0D A;  3MR7 A;  4K4Y A;  1YJN S;  4K5S A;  3GV7 B;  4K4U A;  5DDR C;  3KG1 A;  4MK8 A;  2FUG 9;  4MJW A;  3G8S A;  2AHO B;  5DET A;  4MIW A;  5KFF A;  1ITP A;  4KFB A;  4X65 F;  4RU9 A;  1JLG B;  2WW8 A;  5HRO B;  2PT0 A;  1X4A A;  3QZ8 A;  4H4M A;  4UY8 T;  4OI4 A;  4LIW A;  5HP1 B;  3MPU B;  4J9S A;  2CQ3 A;  2EPI A;  2E5L F;  4JV1 A;  3CJ2 A;  2IYG A;  1B7Y B;  3TJA A;  4Y2A A;  2XO6 A;  3MOZ A;  3SZ2 A;  1U2C A;  2HWT A;  4CT8 A;  4LVN P;  1NPK A;  3BR9 A;  2EFV A;  1TL7 A;  5ETM A;  4TU9 A;  2PE8 A;  4K4T A;  4OZ2 A;  3AD8 C;  2OSQ A;  3MM7 A;  3MCS A;  2DNH A;  2KT3 A;  2HG4 A;  4RBU A;  3FMB A;  5CZX A;  3CJ4 A;  4HV0 A;  1Y5L B;  3TA2 A;  4UQG A;  3WIU A;  1OY6 A;  2BXJ A;  4WK3 A;  3T5K A;  2DRB A;  4Z7C A;  3KLE B;  2HVZ A;  1ICE B;  3QZ7 A;  5ETN A;  1TQL A;  3ILJ A;  5EUH A;  4KV8 B;  5HVH A;  3MEK A;  1KON A;  3M6U A;  1QDU B;  1SB6 A;  4OHX A;  2BSQ E;  5J1E B;  1Y10 A;  2B9Y A;  3IWL A;  3WIV A;  1LV5 A;  1UJ6 A;  4CO2 A;  3UR0 A;  4JI7 F;  1XQI A;  2GHP A;  1DHM A;  1EET B;  2F63 A;  2YNG B;  4O0I A;  3IC1 A;  3FMW A;  2E5H A;  4ELT A;  4G1Q A;  5D3G B;  2OPS B;  2P8I A;  2RS8 A;  1K0T A;  3UVJ B;  4DUY F;  1F5A A;  1AXQ A;  2QJ3 A;  2HZV A;  1Q81 T;  1KS2 A;  1S1W B;  3CCT A;  1NME B;  2PSZ A;  1URR A;  1R8H A;  1LWC A;  5LJ5 Y;  3EGN A;  3WHI A;  1MLA A;  4USW A;  4IQM A;  3KHH A;  4U7U D;  3R3T A;  3DNC A;  3SDE A;  2C3P A;  2B5J A;  3DRS A;  1C1B B;  2VPX B;  5KAK A;  2XS2 A;  3X1L B;  1ARQ A;  1RA7 A;  2XMT A;  4PXE A;  3OL7 A;  4F0K A;  1ZYQ A;  1OYD A;  2YWH A;  5HVF A;  4AYB D;  1RT4 B;  4QQB A;  3NOC A;  2UUW A;  5KFD A;  4HTI A;  1U2R A;  1BY9 A;  2KZZ A;  1S1U B;  3MUM P;  3ZZR A;  3ENV A;  2RRB A;  2RQK A;  5EWE A;  4MYU A;  3DYA B;  1U2F A;  1YLX A;  3GIR A;  3HVR A;  1HWI A;  4NXN J;  2CJY B;  2XZW A;  3Q89 A;  5I3U A;  5KFP A;  3H5S A;  1X4G A;  6FD1 A;  4C11 A;  5FII A;  3KG0 A;  4DX5 A;  1D3W A;  5IWA F;  2YXL A;  4IG3 A;  1LWE A;  1JX4 A;  2E7V A;  1REG X;  4Q8E A;  4J9L A;  4GKJ J;  2R7V A;  2LXI A;  3NS5 A;  1S10 A;  4OYA A;  2I5J B;  5E3C A;  4JI2 F;  2JL9 A;  3MMA B;  3P5T L;  4PG6 A;  5F0W A;  2X1B A;  5LMN F;  4Y0F A;  3CIZ A;  1BXN A;  4PUO A;  1VC6 A;  2B8Q A;  2ZKT A;  1FKO A;  2AQ4 A;  3BQ1 A;  4KB7 A;  4O44 A;  4GMK A;  3PW0 A;  2BOA A;  2BQ3 A;  1X4D A;  3BN7 A;  1EQM A;  4NZ7 A;  2JH3 A;  2N3O A;  1KC8 T;  1SUQ A;  2J9E A;  4LSN B;  3GR1 A;  4D3H A;  1MW7 A;  3M9O B;  3KHL A;  3E2E A;  2DNZ A;  4I7F A;  2V8P A;  4AUK A;  1HR0 F;  2YBV A;  2IA0 A;  4AFF A;  3KK3 B;  4OYI A;  2E9Z A;  2C22 A;  2C2M B;  2DRD A;  3MM5 A;  4DV4 J;  3O6Q A;  2Y1J A;  2GGP A;  4B17 A;  2M0G B;  1HBN B;  1IKW A;  2WON A;  4ETX A;  2AIR B;  5B0G A;  5KG5 A;  3VVT A;  1JLB B;  2ASY A;  1SL1 A;  3B54 A;  2M8D B;  1PBA A;  2H3E B;  3MPW A;  2B9W A;  2MZR A;  4D3G A;  3WBZ A;  2IFX A;  2ASD A;  1N4L A;  5A6W A;  2HBY B;  2ZH6 A;  2CPE A;  3FFI B;  4MTP A;  2FGO A;  2FHJ A;  5HMY A;  4X62 J;  2BKO A;  1DTQ A;  3D1O A;  3K5L A;  7AT1 B;  4TY8 B;  3EZO A;  2EG2 A;  3K57 A;  2YKA A;  1UZD A;  5CZV A;  1RT7 B;  1S1V B;  1NK4 A;  2R7R A;  1NDK A;  4OMF G;  3T6J A;  3AA8 A;  1S59 A;  1PCA A;  3KLG A;  3KMQ A;  4JOU A;  4F02 A;  5A0Y B;  3QOQ A;  4NEZ A;  2KG1 A;  1UVI A;  3GV8 B;  1R6Y A;  2VUG A;  2DHH A;  4H54 A;  4X4T A;  3GE9 A;  3BGU A;  1RAF B;  4CCH A;  1Q5Y A;  1G2E A;  5G4D A;  1LQ9 A;  4DXL A;  1IBK J;  1NKC A;  3CIM A;  3SV3 A;  4M5M A;  2RS2 A;  1HWU A;  3QJL A;  2JX2 A;  3LPY A;  5HO4 A;  3I9Z A;  3HF5 A;  1RAI B;  4U67 Q;  4ED6 A;  1VJQ A;  2V4J A;  2ZFH A;  1J2V A;  3EVM A;  2HHH J;  2VG5 B;  2ZZN A;  5DDO C;  4ZN3 A;  2OEL A;  2H65 B;  4A8Y A;  1S97 A;  2Q79 A;  1RAE B;  2FHK A;  1UJ5 A;  2ZDO A;  3R27 A;  4F4X A;  1EX8 A;  4LFA F;  2JRS A;  3I0R B;  4DV7 F;  4ECZ A;  3TZW A;  4KO0 A;  3HHL C;  5KT7 A;  3P8B B;  1UWA A;  2CYY A;  1PG5 B;  2CPG A;  4C4W A;  3B8H A;  5FDL B;  3GB0 A;  3OLA A;  2DY1 A;  3ILL A;  1VQS A;  2AZ3 A;  1HQU B;  1IBL J;  5KFN A;  2PMW A;  3PFO A;  3T1H J;  2V94 A;  4B3O B;  3MTK A;  2HHS A;  1QLN A;  3P5B P;  2RJZ A;  3VGT A;  1EA4 A;  4CO4 A;  3VAH A;  3JSB A;  2BR0 A;  4DR5 F;  1TFW A;  1VDH A;  3C8Y A;  1QAY A;  1UAW A;  2B51 A;  1TKX A;  4O3O A;  2W7P A;  5B08 A;  2C2N A;  3NGK A;  4WPA A;  2IPO B;  5L46 A;  4TXS A;  4JI8 F;  2FC8 A;  1R8A A;  2BEF A;  4Q2L A;  2D9O A;  2UUA F;  2HS3 A;  4DR7 F;  4NLV A;  3ZFV A;  4DR3 F;  2KHC A;  2GIF A;  2MLZ A;  3T19 A;  2GO9 A;  3U1M A;  2JEJ A;  3IR5 B;  4G1I A;  4RW7 A;  4A8M P;  2EEY A;  5C42 B;  4WCE Q;  1HAR A;  3RBE A;  3P4U B;  3DXS X;  1LWF A;  2QG9 B;  2A10 A;  3IRX B;  4WKR A;  3FC9 A;  2W2O P;  2H51 B;  1MG7 A;  2DGU A;  2WVB A;  2V0N A;  4J9V A;  4ELV A;  1BDT A;  1V5I B;  1KD1 T;  1WG4 A;  2E5J A;  2AF6 A;  3N6N A;  3C14 A;  3KOA A;  1WOS A;  3OTO J;  3QRR A;  2LA6 A;  1KNZ A;  3CNQ P;  1NK7 A;  4K50 A;  2AKW B;  5CYQ A;  3UE2 A;  1ZS6 A;  2MKI A;  3M8W A;  5CAB A;  1VRT B;  6FDR A;  5J2M B;  3CC4 S;  1U6B A;  2UUC F;  2N4D A;  5F9L A;  2GVD B;  4USV A;  2A6M A;  2IDL A;  5HL7 Q;  3T1Y J;  3W64 A;  5SZT A;  3OR1 A;  3IA0 A;  3MMC A;  5L38 A;  3CCM S;  2RF2 A;  4MIA A;  1LXN A;  2WRM A;  1WKJ A;  3IS9 B;  2JWN A;  2XMK A;  2X1F A;  3PY8 A;  2C2Z B;  4UOF A;  2J6T A;  4ZCL A;  3MM9 B;  2NS1 B;  1CS4 B;  1YJU A;  2C3U A;  4A8F A;  4OX6 A;  1IVZ A;  3QBC A;  1B4S A;  3TQ1 A;  3GXQ A;  2VBW A;  2G2Z A;  2HYI B;  5AJ3 J;  3KLH A;  2M9K A;  4ID8 A;  4LF5 F;  1B28 A;  1FRL A;  2ZZM A;  2XZT B;  4K0K F;  3R97 A;  1RTI A;  1RTD B;  3KFW X;  1XN9 A;  4O3R A;  3N9U C;  1OYE A;  4ILL A;  2C2K B;  1TL1 A;  4A8X A;  4MAK A;  4Q7A A;  5D0H A;  3RBZ A;  4LMZ A;  4WYW A;  3BYR A;  1PJ7 A;  2JHE A;  2ZHO A;  3UQS A;  2ACM A;  4C8Y A;  2DCU B;  4B3R J;  3LGM A;  2IMW P;  3KJN B;  2B0G A;  2GQ2 A;  2R3V A;  3N6M A;  4YR2 A;  1FCA A;  1U8S A;  4DCJ B;  3A13 A;  2FYX A;  4NPO A;  5I3Q A;  1N34 F;  3I0S A;  4K5R A;  2DIV A;  1S4E A;  1GK8 A;  3OFG A;  5LSL A;  2V63 A;  2DHX A;  5BXI A;  5L8R C;  3IAS 9;  2A2C A;  4X4P A;  2DKO B;  4YB7 A;  1CPZ A;  2LLZ A;  1UPM B;  3FJ2 A;  2HFV A;  1U9P A;  2EFQ A;  3DM2 A;  5B09 A;  3F44 A;  2DD8 S;  1S0V A;  3ZTS A;  3E51 A;  1CG2 A;  3OV7 A;  2QMU B;  2R8H A;  4NOH A;  2AP6 A;  2ZM6 F;  2VG6 B;  3R7S B;  1FDD A;  4OYM A;  1TV6 B;  2C3O A;  4WJB A;  5KFT A;  1X9W A;  3CO0 P;  2N4C A;  4WKY A;  2CPZ A;  2BDP A;  2BQR A;  4ENO A;  3JXO A;  3K2Y A;  4FBT A;  3N4W A;  4IFY A;  1LW2 A;  3UO0 A;  4F3O A;  4H4K C;  1C2P A;  2R7X A;  5CXT A;  2G0C A;  1NND A;  3ULH A;  3CWJ A;  1NLA A;  3D66 A;  1FA0 A;  2ASL A;  2XGP A;  5KG4 A;  1OY8 A;  3L95 X;  2HMI B;  2V4R A;  3DLL Q;  4YDX A;  4IR1 A;  5HQ8 A;  1GNK A;  4NZ0 A;  5D4P A;  3ZZ0 A;  2ASJ A;  3BGF A;  4N47 A;  4ZVQ B;  3OQ2 A;  3FCV A;  5E7O B;  4CLF A;  1U1P A;  2BNW A;  3R5D A;  1RAH B;  1F5C A;  3J7Z T;  1IKY B;  3W5Y A;  3IMQ J;  4U95 A;  3HT3 A;  4V19 X;  3M2V B;  1JK9 B;  1N5Q A;  1S76 D;  1SXL A;  1UJ4 A;  3VR1 A;  3FDS A;  1HWL A;  4LJM A;  1RU1 A;  1U7L A;  2QZ8 A;  3GJS B;  1HNI B;  2V9W A;  4C98 A;  1KN6 A;  3W2W A;  3DOK B;  2YWF A;  5H9E K;  3TX8 A;  2K6L A;  4DS4 A;  2GPE A;  1YSJ A;  4C3K A;  3H2U B;  2HNY A;  3QIP B;  3HHL A;  1WC5 A;  2E5G A;  3TUP A;  2QLW A;  1KLM B;  4OZ5 A;  3QSY B;  1YBU A;  4ICL B;  4EEY A;  3H0P A;  3MEG A;  4X4N A;  2DGO A;  4TLR A;  3P6Y C;  4M5J A;  4ZPB A;  4RUH A;  2DO4 A;  4C9D A;  1IQT A;  1LFW A;  1UEK A;  4CO0 A;  4DSF A;  1U09 A;  2GV1 A;  1LKZ A;  2W24 A;  4HDG A;  2W2N P;  4BCA A;  1CJU A;  4P2S A;  2XSJ A;  2NZ4 A;  1RHQ B;  4PWD A;  2XNQ A;  1KDN A;  1YJ7 A;  2MGZ A;  1VQN S;  1ACM B;  3JS9 A;  4LF8 F;  4DL7 A;  4W90 B;  1V3S A;  3QFH A;  1FRI A;  3A8J A;  1O8B A;  2DT9 A;  2NLW A;  1Y7P A;  4IRD A;  5E33 A;  1MMN A;  1OO0 B;  4FF2 A;  3MEC A;  4ILM A;  3PG9 A;  4GC7 A;  2PD1 A;  2Y8W A;  3OJS A;  4URQ U;  2HVI A;  1XMO F;  3NS7 B;  3OJU A;  2M4M A;  1BQN A;  4U8V A;  1W2B R;  2XBP A;  2YKM B;  5A8W B;  3TOQ A;  4BC9 A;  3L3C A;  2D69 A;  4RW9 B;  1FRM A;  3H59 A;  1WG1 A;  1RHR B;  2W8L A;  1R0A A;  4UZC A;  4DSK A;  3SQG B;  2WVF A;  1R8P A;  4DHV A;  3S01 A;  1YZ7 A;  2W2P P;  2NPF A;  3BH7 B;  1UP1 A;  4X65 J;  1RCO B;  4DN9 A;  4LF6 J;  3MCM A;  5C25 B;  1N5Y B;  1RI7 A;  1PJ6 A;  1HI1 A;  5EGY A;  2E5L J;  1WEZ A;  4NLT A;  4AL5 A;  1FXD A;  3FT7 A;  1WHX A;  1KQG B;  3SBM A;  1DTT B;  3DKD A;  3LAK A;  2BJ3 A;  1RTJ B;  4M5H A;  4W4M A;  2CZ4 A;  3LQV A;  4PG8 A;  1BWV A;  3T5H A;  5HMW A;  3V4I A;  2UUB F;  3MXH P;  1DLO B;  3NL0 A;  5HAT A;  1NK9 A;  2Z2Y B;  2LMI A;  2KYX A;  4DV2 F;  3DMJ A;  1Q86 T;  1K44 A;  1MRO A;  4L6V 3;  3C6T A;  2MY8 A;  3TEH B;  1CVJ A;  4LVO P;  1TU0 B;  5K5M A;  3FNN A;  4K4V A;  4B3M F;  2YH0 A;  2KVQ E;  2HBR B;  1XBW A;  4RKU C;  3I5B A;  4RNM A;  2DGS A;  2J8S A;  2ZVS A;  2QEX S;  3Q8Q B;  5D8H B;  4M5D B;  2AWZ A;  2ZOM A;  2YWG A;  4I1T A;  3NWR A;  2VFV A;  5IXU A;  2KFZ A;  3MFH A;  2Z4P A;  2R2T A;  1P9Q C;  3TJ9 A;  4JI7 J;  2WOM B;  1F2G A;  2C2E A;  1U8W A;  4C0H A;  1HW8 A;  3RBX A;  1TKT A;  2CJA A;  3CDW A;  4C6A A;  1Q8K A;  3CCE S;  4OZJ A;  4NYZ A;  1KHV A;  4FVC A;  1K1Q A;  3PHE A;  1K1S A;  5HRO A;  2RQC A;  1Q95 G;  1IBM F;  3NKY A;  4B3T J;  3DDN A;  2X1A A;  3W61 A;  1KHW A;  1TUG B;  1TUW A;  4Q8F A;  4DUY J;  2DY9 A;  2O66 A;  2KH9 A;  1X60 A;  3R5J B;  2MQM A;  2GJ2 A;  1FRK A;  2XM3 A;  3LJP A;  3L09 A;  3DRR B;  2R8K A;  4X4S A;  2CDR B;  3D1H A;  1ZAW A;  2ZE2 B;  1VRQ C;  2YX7 A;  2C42 A;  2VBZ A;  3CC7 S;  3GIM A;  1DAR A;  4I68 A;  3W66 A;  2P6S A;  1K73 T;  4WP9 A;  5HBM B;  3DLG A;  3HM9 A;  3PRB A;  4C8N A;  3NO7 A;  3ISN D;  3TVZ A;  3M32 B;  2XB2 D;  2E1R A;  2BOP A;  1RIS A;  4MFB B;  1RAD B;  2F8M A;  1SVD A;  5J1E A;  4OV6 A;  3I5A A;  1VK8 A;  3K5O A;  2FDN A;  4F3M A;  4ZK7 M;  3CDU A;  1S4F A;  2XG8 A;  4A4J A;  4OQJ A;  3GU0 A;  2XWY A;  4XAK A;  2EBE A;  3BPD A;  1R3N A;  4U7U K;  4DUZ J;  2DR8 A;  3SCJ E;  5IT4 A;  3BO2 A;  1F60 B;  2CNO B;  2OPS A;  2F8E X;  3FEX B;  1GEH A;  3KLI B;  3D67 A;  3RB0 A;  1X0F A;  2Y1L B;  3I6P A;  2BYC A;  1G1X A;  3ETO A;  1X5S A;  4H4K A;  4KE5 A;  1SL2 A;  1NM2 A;  2JC1 A;  3CJ5 A;  3EZU A;  5DGB A;  2NUH A;  2M5Y A;  3QLH B;  1N0V C;  4JI6 F;  1YI2 S;  2IA6 A;  1FX4 A;  5LMN J;  3BBF A;  1BQM B;  1KSP A;  1NH8 A;  4ATN A;  2ZH8 A;  3M8P B;  1C1B A;  1SC6 A;  1VHF A;  2OKQ A;  1N36 F;  4NCG B;  1DUR A;  3Q8Y A;  3DHX A;  4FZV A;  4KKO B;  4WFZ A;  3IWX A;  1YRX A;  3EVO A;  3HSG A;  1M90 T;  3DGP B;  4P2M A;  3EX7 B;  1RT4 A;  5KFO A;  3BQ2 A;  2QSF A;  1RHK B;  5THW A;  3LUY A;  4NMX A;  1HR0 J;  3H25 A;  2ALY B;  2DGW A;  2X1G A;  2ZKU A;  1OHN A;  2HK3 A;  2IM1 A;  1YTY A;  1EAY C;  1XMQ J;  3T5J A;  3W65 A;  2KXF A;  2H1O E;  4LR7 A;  2K3I A;  4KFB B;  2E9R X;  1XTZ A;  4CH1 A;  1AZS A;  1L3T A;  3D28 A;  4DL0 C;  2UXC F;  3LAM A;  3NY0 A;  3OVA A;  3BDE A;  2FVS A;  1HNW F;  1QE1 A;  5KFK A;  4ZCK A;  2J7K A;  3SYZ A;  3D4J A;  3WX4 A;  2XY6 A;  4AAI A;  2BAB A;  1QVF R;  1FWP A;  1NLK L;  2PI5 A;  2RDD A;  1ZOT A;  1O0P A;  4QIE A;  2KN4 A;  4I6W A;  4HR2 A;  2OTJ S;  1U0H A;  2E66 A;  5JVG Q;  3C46 A;  3N0V A;  3R9L A;  4DCP B;  3G96 A;  1L3U A;  2OD4 A;  3AD9 C;  5D0R A;  3J80 U;  2IJF A;  3OVB A;  3GLJ A;  3TWZ A;  2A2B A;  3W7B A;  2FVR A;  3M2U A;  2X3D A;  3W8G A;  2YNI A;  2DR5 A;  3KK3 A;  1CUL B;  4N76 A;  2JXG A;  2YY3 A;  1QUP A;  2LQ9 A;  3VAK A;  4NLQ A;  2CRL A;  1ROF A;  2ZUG A;  1JLB A;  2JVO A;  2HFS A;  5JXS A;  2GMH A;  3LAN A;  1MWZ A;  5FD1 A;  4FYD A;  1ZZN A;  2IHR 1;  2P9C A;  3EMT A;  2V68 A;  3HFZ B;  3D6M B;  2ATL A;  2XMW A;  3K8V A;  4LFA J;  4LF7 J;  1NB2 A;  4DV7 J;  1Q16 B;  8AT1 B;  2DR9 A;  2R7T A;  3JAM Y;  1RTH B;  2RU3 A;  3HVT B;  3FZ2 A;  4H4O B;  4FNI A;  1P27 B;  3DLH A;  1HBM B;  2R42 A;  1RT7 A;  1S1V A;  4ZJO A;  4PRF A;  1LWC B;  3Q8U A;  3LWL A;  4IUF A;  1NK8 A;  4OFZ A;  1N6Q B;  5E41 A;  2F3J A;  3BRE A;  5A0Y A;  2ZJQ Q;  2B5J B;  2B9X A;  4DV3 F;  1NJW A;  5U47 A;  1YJT A;  3KKF A;  5KFV A;  2PMH A;  5LJ3 Y;  4KIA A;  4P6Q A;  4KYZ A;  2X7I A;  2FB0 A;  4NLG A;  3FZB A;  4FF4 A;  4CO3 A;  4ZVP B;  5KFJ A;  4JI0 F;  3AJ2 A;  3UN2 A;  2GIQ A;  3ETM A;  2W7O A;  2ZH3 A;  4JI8 J;  1N8R T;  3BSO A;  1R89 A;  3PKY A;  1RBO B;  3R8Y A;  2VG5 A;  4X4U A;  2OML A;  4DR7 J;  2CPH A;  2A6O A;  1AA1 B;  4HTJ A;  4DR3 J;  3ILI A;  4KHM A;  3Q83 A;  4XK8 C;  2MHE A;  2CQ2 A;  2L9D A;  3CCV S;  3SSS A;  2PN6 A;  4I67 A;  1S77 D;  2VKR A;  3NCP A;  1TMJ A;  2R2U A;  3NXZ A;  3I32 A;  1V3Z A;  5I3U B;  1S48 A;  4LF2 A;  4N8N A;  4C11 B;  3N79 A;  3PHT A;  1LFP A;  3I0R A;  4IG3 B;  5IT9 U;  1DBD A;  1LWE B;  1N5T A;  2AEM A;  1HD1 A;  2KM8 B;  2E29 A;  3HZE A;  2F9J A;  4LBP A;  1PIE A;  2Y0B B;  4LRC A;  1KQF B;  1VCT A;  4B3O A;  5D0G A;  3NMA A;  4UST A;  5AE3 A;  1VQO S;  4PWU A;  1FKO B;  1K9M T;  2QGF B;  4O3Q A;  1C4C A;  3M8R A;  4LF1 A;  3VTI A;  4YR0 A;  3HHN B;  3OXF A;  3LP1 A;  2W9C A;  4DQP A;  2GVZ A;  1Y3K A;  1LK5 A;  2YNH B;  2J9D A;  4ES3 A;  4UUX A;  2NXU A;  4B9N A;  1IN0 A;  3TVY A;  4I7F B;  3GSI A;  2OUG A;  4C2M A;  3CCR S;  5T41 A;  3SIP B;  1X7V A;  3B4D A;  3MM5 B;  1HBO B;  1WHV A;  4HI2 A;  3DLE A;  4X84 A;  5AXM A;  1CJV A;  1IKW B;  5J2N A;  2MQQ A;  2V34 A;  3TYT A;  2FLN A;  4ZCM A;  2ZH1 A;  3BF4 A;  3SV4 A;  5C42 A;  2JC0 A;  3BH6 B;  2BW2 A;  3VZH A;  3IRX A;  4CLP A;  3PYE A;  1NZ8 A;  4PQA A;  1UFL A;  2HGL A;  3KLV A;  1H0H B;  3C15 A;  4LBI A;  4ZS6 A;  4I64 A;  5BR8 F;  1M1G A;  3FCH A;  1ZET A;  3A3N B;  3ZZP A;  5FLX U;  4MMO A;  1FVQ A;  5IS2 A;  4OHV A;  1QVG R;  3ENQ A;  4K0K J;  3IGV A;  3JQJ A;  3NCR A;  1UEV A;  4PXB A;  1JXV A;  1GH8 A;  2VB6 A;  1D0E A;  2HQF A;  3OL8 A;  4QIV A;  4ECX A;  1Z2Z A;  2J5A A;  4M5N A;  4X4O A;  1VRT A;  2FZC B;  4PAA A;  1RK8 A;  4CLS A;  3FVY A;  1HLW A;  4UOC A;  2GVD A;  4E2F B;  4AND A;  1PJ5 A;  1WEX A;  3A12 A;  3LGH A;  3JQK A;  3IS9 A;  1WHY A;  2CG8 A;  1CC8 A;  4DG1 A;  4ZDN A;  5KFS A;  4GO5 X;  1VBZ A;  3I87 A;  2ZH4 A;  1AT1 B;  2OSR A;  3UCG A;  2QFI A;  2EK1 A;  2LU2 A;  3BB5 A;  1CS4 A;  2OHD A;  1HFE L;  2OIH A;  4K2J A;  1HBU A;  2V4J B;  1UKU A;  2LP4 A;  2NXJ A;  2NUU G;  5GAE I;  4OI0 A;  2L9W A;  5JVH Q;  5L1K A;  4DR2 F;  3H42 A;  1X4H A;  2R4F A;  3HO1 A;  4DLG A;  3H7H B;  3K5M A;  3ET6 A;  4EWT A;  3OXG A;  2ZM6 J;  4ZLJ A;  2Q43 A;  1U45 A;  1RWX B;  4C8K A;  2ADB A;  3TUI C;  4KO0 B;  1FO1 A;  5L39 A;  3O5T B;  4DR6 F;  1RYR A;  3AJ1 A;  4LRV A;  4BWM A;  3D5M A;  4NRT A;  2NCK L;  1N88 A;  3MEE A;  4LRE A;  3CDE A;  2AMC B;  2PGC A;  2PFF B;  3HSJ A;  2U1A A;  1OMS A;  2IVY A;  1KVJ A;  2W01 A;  5K8N A;  2K8G A;  1X4E A;  2KZM A;  4JI3 F;  2HWH A;  1TVR B;  2HQI A;  4HEA 9;  2DVI A;  2C2R A;  1JJ4 A;  1TKX B;  2WZ1 A;  3O44 A;  1YQH A;  1DQ8 A;  5AXN A;  1A6L A;  4DFK A;  1UMJ A;  4B02 A;  3KUH A;  5IQQ A;  2YPY A;  2EFG A;  2HLT A;  2DH7 A;  3G87 A;  1HI0 P;  2NQP A;  3OTE A;  2MJN A;  4EBC A;  3OTD A;  4RW7 B;  5A6P A;  3R2C J;  2DNQ A;  3MPY A;  4LF9 F;  2E7W A;  2DPJ A;  3Q0A A;  2VG6 A;  5SUH A;  2V8V A;  4QYZ K;  5CD4 H;  3ZTQ A;  4YDD B;  1XMB A;  4QIG A;  3E8O A;  1O51 A;  4DBQ A;  4FN5 A;  1PAE X;  2JVR A;  2HNZ A;  1U26 A;  3NGU A;  1SKU B;  2AJ0 A;  3M6X A;  2BM1 A;  2PA8 D;  3UCU P;  3N5F A;  3DRX A;  3F0N A;  4IR9 A;  4CH7 A;  2W9A A;  4F4A A;  1KTQ A;  1S9E B;  3C14 B;  4QU6 A;  2DGV A;  5CYQ B;  1FD8 A;  1IM6 A;  3GG0 A;  2FLL A;  4DN0 A;  2GQC A;  2K1O A;  4ITS A;  5C24 A;  5D15 A;  1Y4Z B;  1XIQ A;  1FHT A;  1RCX B;  4FXV A;  4M95 A;  4ES2 A;  1HWJ A;  1YJR A;  3CED A;  3T3F A;  4ECV A;  1IR2 A;  1KP6 A;  2B7B B;  3W9H A;  5F8H A;  2OLW A;  5DDQ C;  3FEZ A;  4LF8 J;  3HHD A;  2IMO A;  3NOG A;  1F3F A;  3M2V A;  1VIX A;  4B9S A;  3CJ3 A;  3O1L A;  1SQF A;  1XR7 A;  4YB1 P;  4ECQ A;  3RJM B;  3T5L A;  1XMO J;  1SH3 A;  2XCA A;  1J5E J;  4XTT A;  4WF9 Q;  2XLI A;  4DPO A;  3QJP A;  5HVG A;  1VIS A;  1V9O A;  1I6J A;  3M05 A;  1X0P A;  1BUX A;  2AGO A;  2IJR A;  3RAQ A;  1S6P A;  4ERD A;  3QIP A;  1RAO A;  2GZO A;  1KLM A;  4J9Q A;  1TL1 B;  1UZH A;  3CME S;  3CUL A;  4ICL A;  5B7W A;  4EFA C;  1S0O A;  1NUE A;  3MI7 X;  1AB8 A;  3LO3 A;  2VDI A;  2ZBC A;  3R5A A;  4GC6 A;  4J9K A;  1SC4 B;  5KFB A;  2OFG X;  2B43 A;  1QAX A;  3RRK A;  4CT9 A;  3DDK A;  2L9N A;  2WCX A;  2J0W A;  1MWY A;  3I0S B;  2CA9 A;  1H2V Z;  3IGN A;  4NCA A;  1XK8 A;  3AB2 B;  3ZZT A;  4O4R A;  2W4D A;  4E0D A;  2K7J A;  4K4Z A;  2FD2 A;  2LQ8 A;  4CO5 A;  4R8U B;  2UUB J;  5ITH A;  1U6F A;  4JV5 F;  3ZTR A;  2VON A;  4DV2 J;  3ISZ A;  1NK6 A;  3GSD A;  4HH0 A;  2CPF A;  3AOC A;  2BV3 A;  4OJ3 A;  4CTA B;  4Q43 A;  2LXU A;  5IM0 B;  4B3M J;  4DR4 J;  4AD6 A;  2BW7 A;  1FDN A;  3LAL A;  4QCL A;  1DFD A;  4JB8 B;  2HS4 A;  5E2Q A;  1DY3 A;  1M5S A;  4WFN Q;  3J81 j;  2AYM A;  4RW9 A;  2P5V A;  4HKQ A;  3VAJ A;  4Q0B B;  1FJG F;  5IZH A;  3JTP A;  3SQG A;  3TJ8 A;  1SI9 A;  1IUJ A;  2YKN B;  4CLT A;  3G71 S;  1G3O A;  1ZAX A;  2HHU A;  2V2Q A;  5E3A A;  1LW2 B;  2Y1I A;  2Y1R I;  1Q79 A;  4IG0 B;  3U1L A;  1FF2 A;  1S7H A;  3MHY A;  1JQG A;  5C25 A;  2YVS A;  2YNF B;  1C1C B;  2CWK A;  1N5Y A;  1KTV A;  2F5G A;  4JV0 A;  1U1Q A;  4F67 A;  2XYG B;  4USH A;  4ZMM A;  4NLD A;  2DRA A;  4ZVO B;  2UXD F;  3TA0 A;  1DTT A;  5DDP C;  3TAP A;  2N82 B;  1VRU B;  1RTJ A;  4C97 A;  4QYR A;  3RYL A;  3TRG A;  4X4Q A;  1X8D A;  1UVN A;  1DLO A;  8ATC B;  4LF4 F;  5K8M A;  4R0J A;  4Y6I A;  5F8I A;  1ZZF A;  3D6H B;  1RA6 A;  3DC2 A;  1TL3 B;  1D8Z A;  3A8E A;  3BSN A;  3HKW A;  2EBG A;  4WZM A;  5D78 A;  2RKI B;  2LEB A;  1QSS A;  2HGM A;  4QR1 A;  1ARO P;  2P6T A;  4M5D A;  5LSR A;  2NSC A;  4M1K A;  1WWH A;  3KUG A;  3NP5 A;  4DMZ A;  3F73 A;  3VWS A;  1P94 A;  4Q44 A;  3MTJ A;  2FVC A;  5LSO A;  3W2W B;  4EO8 A;  5ETO A;  4RR5 A;  3FMT A;  2RD5 C;  2DXD A;  1HI8 A;  4U6P A;  4M94 A;  1EJ7 L;  4C7Q A;  3OR2 B;  5KG6 A;  2KM8 C;  2HNY B;  5J2P A;  3KYL A;  3HHL B;  2R2R A;  3BPS P;  3OFE A;  5GAH I;  2KU7 A;  1GMU A;  5ETK A;  3W1Y C;  3AFG A;  3CJK B;  3CO9 A;  1X31 C;  1UVK A;  4KJI A;  2J9C A;  4J9O A;  3KXD A;  4WE1 B;  3MR6 A;  2LQ5 A;  3FRZ A;  3HDS A;  5HJX A;  3LW5 C;  2RNE A;  3DRR A;  3AJD A;  2M7S A;  1JXE A;  3FBE A;  4JI6 J;  1EIY B;  1Q7L B;  1WJ9 A;  4NLX A;  1N33 F;  4FS1 A;  3PW2 A;  2ZE2 A;  3CT9 A;  2XSJ B;  3W60 A;  3Q2T C;  5A76 A;  1REV B;  4IH5 A;  4P73 A;  4ZHR A;  4F2R A;  1U1M A;  4GKK F;  2CJQ A;  3KNG A;  2O5D A;  3KHG A;  3LPE A;  2DH9 A;  1N36 J;  2IM0 A;  5F8J A;  3TQE A;  1T7P A;  3PYD A;  5HBM A;  2JXH A;  1T11 A;  1N48 A;  3M32 A;  1Y0H A;  2M8H A;  1FJC A;  4ZP7 A;  4MFB A;  2NSB A;  4KPY A;  3N01 A;  5GAD I;  3FGV A;  1GT8 A;  1BQN B;  1BHN A;  2WVE A;  4TVA B;  3GPA A;  1R0A B;  3CVK A;  1Q78 A;  2OAU A;  3MR2 A;  1FTR A;  1VR6 A;  3HSZ A;  3BKT A;  1R31 A;  2EK6 A;  4RNN A;  4MKB A;  2W9B A;  5LXY A;  1F3V A;  4F3Q A;  2MQN A;  2KJW A;  1VS3 A;  1DJ0 A;  3HD2 A;  4XDC A;  2XO7 A;  1HKA A;  2IRX A;  4EK2 A;  2CQB A;  1W7W A;  2R7S A;  1S99 A;  2J7W A;  2VF3 A;  1XER A;  1HNW J;  1JKH A;  4RLE A;  4QWE A;  2QC3 A;  1BQM A;  5GMD A;  1S6O A;  3POT B;  3A3O B;  4QWA A;  5D77 A;  4WIQ A;  2V4Q A;  2DGX A;  4AL6 A;  2UXB J;  4WXW A;  3M8Q B;  4DDF A;  2F1F A;  3NAH A;  4NCG A;  3V4I B;  2XMM A;  1X5O A;  2GIR A;  2VDH A;  4GVB A;  1B01 A;  2K1R A;  3NMR A;  2CVE A;  2HIQ A;  2AJ1 A;  3C6T B;  2VPZ B;  3UDL A;  4PPZ A;  1UVM A;  3SSR A;  4YHH F;  1VK3 A;  2KXH A;  3M4X A;  5M2R A;  3GFX A;  3PJW A;  5F0U A;  4LFB F;  2JOQ A;  5T14 A;  1QSL A;  1ELO A;  2HAI A;  2DNP A;  3FK4 A;  2FLO A;  4TLQ A;  1U48 A;  2HLU A;  4QYZ J;  1VBY A;  3WDO A;  2JFK A;  1P1T A;  1Q82 T;  2ZZT A;  1FDB A;  1T9V A;  2FJE B;  4DU8 A;  3NGR A;  4Z37 A;  2QV6 A;  1AUS L;  3TI0 A;  5MAO A;  3PKM A;  1TKT B;  4K7Q A;  4LT6 A;  5GAH U;  4M8L A;  5HQL A;  1RT1 A;  3UR3 C;  4U7C A;  1M5H A;  1PC5 A;  4QU7 A;  1HHS A;  3AH6 A;  2ZC3 A;  4M63 A;  4OHW A;  2P9G A;  3BGL A;  4ZVF A;  4NAS A;  1S9G B;  3SMZ A;  3WZ0 A;  4DS5 A;  3FSY A;  2HRY A;  3IO1 A;  2RE1 A;  2ABY A;  2JDJ A;  3GIK A;  1Y5N B;  1GTH A;  2BAN B;  3DOM A;  1PAR A;  4HHH A;  3DLJ A;  1JNR B;  5KFA A;  2FJV A;  3MCO A;  3W5Z A;  3GIL A;  2BQU A;  4DV3 J;  1H7X A;  1NHV A;  3CJS A;  4ZPC A;  1C4A A;  3DLG B;  1IJF B;  4YP3 A;  5GAD U;  1CUL A;  3IP0 A;  4JI0 J;  3GYX B;  2GJI A;  2CQC A;  3KHR A;  3QGI A;  3SXL A;  1IR1 A;  1HL6 A;  2Z8Q A;  4S0M A;  2CXE A;  1D9A A;  3RB6 A;  1SQG A;  4YB6 A;  2XYH B;  3KLF B;  3OW2 R;  3HKZ D;  2D3Z A;  2I1R A;  3SEO A;  2CIM A;  3QAU A;  1SH0 A;  6AT1 B;  1G6B A;  1T9U A;  2VOP A;  1Q16 A;  3UW1 A;  4N7T A;  3CXC R;  1U02 A;  1RAJ A;  3ICL A;  1RTH A;  3HVT A;  4DPT A;  4H4O A;  4DX6 A;  1HBM A;  3HZG A;  2YX4 A;  2WSC C;  1PYO B;  2OPP A;  1YIT S;  2ZHB A;  3SCL E;  2FJD B;  1YVF A;  1N6Q A;  1LOU A;  2EVZ A;  4RU2 A;  5B0F A;  2F40 A;  1RXO B;  2IC3 A;  3W63 A;  3RW7 A;  4Y00 A;  1RWO B;  1WKK A;  1RT6 B;  2H48 B;  2GA7 A;  4DFM A;  4DV5 F;  5D6G A;  2FJA B;  4DV0 F;  5D0E A;  3IRW P;  3RAM A;  4HH1 A;  2OFH X;  4JYA J;  4EZ6 A;  1FE0 A;  2B6A B;  1RWV B;  3CGI A;  3J7Y I;  2VPW B;  2BNZ A;  4UQT A;  1TAU A;  2G2O A;  2AJ2 A;  5KOX A;  4ZN1 A;  4YS2 A;  2MB0 B;  2MQO A;  2LEA A;  1FTC A;  3DGV A;  3DFE A;  1FER A;  1ZA2 B;  5DG8 A;  4DR1 J;  4KGX B;  2H3A A;  1TTH B;  2QX0 A;  3X3U A;  4CLU A;  4P7V A;  1JLQ A;  3M8S A;  1AZS B;  2XGQ A;  3BSC A;  1UL3 A;  4XPC A;  5HMX A;  1YHQ S;  2MQ8 A;  3TO8 A;  1HNZ F;  1QUV A;  3B4M A;  3DOL A;  1NPP A;  3M2R A;  3UN3 A;  1QE1 B;  4W98 A;  1U1K A;  4DV4 F;  2CZV C;  2ZBI A;  2OD6 A;  4LR8 A;  4RUA A;  4JBC A;  1FE4 A;  1IM4 A;  4X4R A;  1R43 A;  2LYV A;  1NDL A;  4CIO A;  1TR0 A;  2IM2 A;  2YWE A;  1E6V A;  1FNX H;  1U0H B;  4WTO B;  1WOR A;  4WWS A;  3DRY A;  2AJF E;  2PDA A;  1TZ0 A;  4WBF A;  3CCS S;  3TAQ A;  2YNH A;  3JSM B;  5BYS A;  4DQR A;  1VIO A;  3M2U B;  1Q1K A;  4ZJQ A;  1RYS A;  1UWB A;  2YNI B;  3A1Y G;  1H74 A;  3MAQ A;  2VZ9 A;  2DYA A;  2UU9 F;  1VJW A;  3I31 A;  2MLX A;  1HBO A;  4N8O A;  5CA5 A;  2HHP A;  4KBI A;  2ROP A;  2X51 A;  3MD1 A;  1DAX A;  4DR2 J;  2GS8 A;  2J8A A;  4DL5 A;  3QGH A;  2WB1 D;  4OV1 A;  3VQS A;  1EKR A;  5AE1 A;  4NE9 C;  1VHI A;  2FJB B;  3UPF A;  1ZAV A;  1N5S A;  4MJK A;  1IBK F;  3L4B C;  5M2P A;  4YUD A;  1XNR J;  1GMW D;  4DR6 J;  2F4V J;  4ZVH A;  3PFE A;  1PYT A;  1CSJ A;  2WBR A;  3J81 U;  3V6D A;  2LQJ A;  4OIX A;  4Y2K A;  2GC8 A;  2BKP A;  2KRR A;  2HHH F;  3FCW A;  3G82 A;  4DX8 H;  1VI7 A;  3ISN C;  1S72 S;  3CE8 A;  3CCU S;  4G1P A;  1K8A T;  3PRV A;  1WI6 A;  4ZA1 A;  3M8Y A;  1NK5 A;  2LU1 A;  4JI3 J;  2JFD A;  2QLF B;  2JLF A;  3GON A;  3HHE A;  4RW4 B;  1RDR A;  3GWC A;  2CFX A;  3P45 B;  4QR2 A;  2XMJ A;  2NRE A;  3J7Y U;  4FYX B;  1HHT P;  2LFV A;  3R2D J;  4ED5 A;  2W2Q P;  5KTQ A;  3BV8 A;  1G4C A;  4ZP9 A;  2YKP A;  1T9T A;  1WEL A;  3Q22 A;  1NZA A;  2AEJ A;  4C8M A;  2XCP A;  2MMY A;  1M1H A;  1YG0 A;  1ZM3 A;  3VAI A;  3EGW B;  3BSA A;  3HP6 A;  4M5L A;  3DHW C;  2AYB A;  2GMJ A;  2B4P A;  2L3M A;  4X64 F;  2U2F A;  4Y2M A;  1RUS A;  4CNY A;  1BWE A;  4LRD A;  2WVD A;  5KFH A;  2BRL A;  2CJX B;  1RHU B;  1S79 A;  3B82 A;  1SIW B;  3CW2 C;  3CSK A;  1XNQ F;  3QO9 A;  1VQ6 S;  2EW9 A;  5AXL A;  3TNV A;  1RWN B;  1TVR A;  2B4U A;  3OBI A;  4G3I A;  4IKA A;  1UTA A;  3LP1 B;  3R6G B;  3C16 A;  2W9C B;  1WNE A;  3KJQ B;  2GVZ B;  1SJR A;  1KEK A;  1TK5 A;  4PG5 A;  3C6U B;  5DJB A;  3VGS A;  4EI2 A;  1YWX A;  5IT0 A;  2AGQ A;  1RT5 B;  2V8D A;  3DLE B;  3CD7 A;  1CJV B;  3K0J A;  3QRQ A;  5J2N B;  3SFG A;  2MY7 A;  3GMG A;  5ETT A;  2VQE F;  2FVQ A;  3TZX A;  1KRP A;  4A8O A;  4JI5 F;  2ACY A;  2CJ9 A;  3C15 B;  3HMJ G;  3H5Y A;  2BJD A;  5DG7 A;  1H98 A;  2XS7 A;  4NML A;  1ZH5 A;  4WII A;  2K06 A;  2DB1 A;  5KG0 A;  4M5G A;  2H5E A;  4F8R A;  4IYQ A;  3W2V A;  4ZVR B;  3CCQ S;  2AEF A;  1BMQ B;  2ZEJ A;  3WC0 A;  4K2X A;  1S9E A;  1X4F A;  3N28 A;  3NCQ A;  1ZM2 A;  2E1C A;  5HQM A;  3NLC A;  3CUN A;  2HVH A;  3TVK A;  3MMB A;  2ZNY A;  3AB4 B;  2HFO A;  1WI8 A;  3ZC4 A;  2D9P A;  2JZ5 A;  3BBB A;  3VVU A;  1JWW A;  1JLC A;  1PAU B;  1QTM A;  1HW9 A;  1LW0 A;  4F4W A;  5DG9 A;  1YK9 A;  5DQG A;  2DNG A;  1TP7 A;  1C0U B;  4ZVG A;  2OEJ A;  4HL9 A;  4UZB A;  3D3B J;  3DLB A;  4DG1 B;  1KLN A;  2A18 A;  3VEB A;  1H73 A;  2RH3 A;  4C0B A;  4L75 A;  3G8T A;  3HFV A;  2F8H A;  5IC4 B;  4JV5 J;  1HBU B;  4NI2 B;  2CJB A;  2PFD A;  3EIC A;  5C2G A;  4TYB A;  4NA2 A;  2DEI A;  4ZVE A;  2XYP B;  3US5 A;  1YJV A;  3J80 Y;  3PNI A;  1HQE A;  3NNH A;  2PI4 A;  1R8B A;  1EHW A;  2HQ3 A;  2VQF F;  4JP8 A;  4DL6 A;  1F1B B;  3ET6 B;  2OPQ B;  3J7Z 5;  2FY1 A;  2DCL A;  4Q5V A;  3H8Y A;  3PW5 A;  4QR0 A;  1FJG J;  2MZQ A;  3L7O A;  1M5P C;  4PXC A;  3QRP A;  2IBK A;  3VF0 B;  1YKW A;  4B3S F;  2QLB B;  3OPK A;  1HPZ A;  4XDD A;  5E3P A;  4RBT A;  3WQP A;  3H2L A;  2C2D A;  3JTO A;  2VJU A;  3LTO A;  4QIW D;  1M0S A;  5JJB A;  2ALZ A;  3MEE B;  1FEE A;  3UWT A;  2DNO A;  3V5R A;  1GX6 A;  1ZPV A;  3LH2 S;  1WDD A;  3Q8S B;  3H2V E;  5DZ7 A;  4USJ C;  2LVW A;  2UXD J;  1GXL A;  1D9D A;  2RIL A;  4C8O A;  2OGU A;  1WF0 A;  1M5V C;  1BE4 A;  2NYH A;  2KOE A;  3UI3 A;  1WOO A;  2BE9 B;  3QPI A;  4G65 A;  1B70 B;  2W7A A;  4R8U A;  2M88 A;  1FKA F;  4LF4 J;  2V8G A;  1U1R A;  3H5U A;  1UW4 A;  4CTA A;  5IM0 A;  3TAR A;  4OZ1 A;  2ILY A;  4IRC A;  1R6V A;  2BRK A;  2MLY A;  3H4B A;  1JNZ B;  2Z56 B;  4A8Q A;  2KB2 A;  1Z1Z A;  1MWQ A;  4IOC Q;  1ZM9 A;  4J9N A;  1RZM A;  2ZH9 A;  4Q0B A;  3TZZ A;  5E5N A;  2HNZ B;  4U8Y A;  3K8W A;  3IR7 B;  2YKN A;  3QWP A;  5L1J A;  1Y00 A;  2IIH A;  3A8I A;  1MYL A;  5ADZ A;  2V2Z A;  4IG0 A;  3OXL A;  3G5O A;  4J90 A;  5C5J A;  4N77 A;  4EGL A;  2YNF A;  1C1C A;  4E8U A;  4WU2 A;  4LQ9 A;  2N7C A;  5IT9 Y;  2PEH A;  4ILR A;  2C3M A;  2CNL B;  1VRU A;  5C24 B;  2MKJ A;  3KK2 A;  1BGX T;  4PZV A;  2QA1 A;  1Q0N A;  4KGZ B;  1OQ3 A;  2QL7 B;  2QYG A;  3IBF B;  1YIJ S;  3O8W A;  2V2V A;  4OJ1 A;  4NLR A;  3MM6 B;  1FK9 B;  1CJK A;  4GKK J;  2X3G A;  2J0X A;  1OPZ A;  1MN9 A;  3I4H X;  1TL3 A;  4ELU A;  2JLG A;  4OYZ A;  4WYL A;  9RUB A;  1TL4 A;  2RKI A;  2MHN A;  1D8Y A;  4LFC F;  5CCL A;  2E9T A;  4NYP A;  2XS5 A;  2EFN A;  3VAG A;  3THV A;  2D3O R;  1Z2L A;  4NL5 A;  1RHJ B;  4X2B A;  1GAO A;  4L3N A;  4ZPD A;  2JJ4 D;  3TAM B;  4A47 A;  3HXM A;  1N52 B;  3HLU A;  1WC4 A;  1IKX B;  3I5C A;  1S6P B;  4OZN A;  4P2X A;  5GAG U;  4ECR A;  2JXI A;  3OR2 A;  4X66 J;  4LRF A;  3IWN C;  2K9I A;  3C66 A;  1VOM A;  4RX6 A;  1RAA B;  4HT5 A;  3EDQ B;  3UD5 A;  2HRU A;  1KR4 A;  3CJK A;  4CRJ A;  2GW8 A;  2HHX A;  5A2Q U;  4OHZ A;  3RTV A;  2I2Y A;  3M30 A;  4WE1 A;  2HEK A;  4YR3 A;  4IO9 Q;  4B9U A;  1K47 A;  3PV8 A;  3L9Z A;  3IXQ A;  1REV A;  3QT6 A;  1CC7 A;  2AW0 A;  1IJE B;  1XWL A;  4FPI A;  4TN2 A;  2HBQ B;  2G13 A;  4NEY A;  4QBU A;  1FKP B;  1WKL A;  2Q2K A;  1LXJ A;  3IG1 B;  3KTQ A;  1WTF A;  3H98 A;  1PGZ A;  4BDP A;  1P8G A;  1WAC A;  1MSW D;  4Y2I A;  4UF4 A;  2HVD A;  4LF6 F;  1VMB A;  4DPX A;  1GFW B;  3TP2 A;  1UW9 A;  2CQG A;  2FVP A;  4YHH J;  3QT5 A;  5KFI A;  4O0N A;  3PRD A;  4MK9 A;  4LFB J;  5F41 A;  2V67 A;  5AT1 B;  1FD2 A;  5K14 A;  3LP0 A;  1HD0 A;  2HSE B;  2XC9 A;  2FY8 A;  1L3S A;  3NNC A;  4LSL A;  4LIR A;  5JMN A;  1GTE A;  1HNX F;  4LRA A;  1RAC B;  1TUV A;  2HQC A;  3DDI A;  3LP2 A;  4QW9 A;  1W25 A;  3R5B A;  1YBT A;  5CAA A;  1NB7 A;  4OI6 A;  4DU7 A;  1P9Y A;  2KI2 A;  1J27 A;  4NLU A;  4HI1 A;  1P1L A;  4OLP A;  2FJW A;  2I8E A;  1SV5 A;  2EWH A;  3V81 B;  2MXY A;  2YKO A;  5F8L A;  4KC5 A;  3BEG B;  2W8K A;  1URN A;  2RQM A;  3HSD A;  2K5J A;  3POT A;  2CQD A;  2GAH C;  3NWG A;  1S49 A;  3M8Q A;  5GVQ A;  3CDA A;  5L9X A;  2JEI A;  2KYZ A;  2QN6 B;  3PVX A;  2K3K A;  3OFH A;  4NLY A;  1CJT B;  4L76 A;  1RSC A;  4A8W A;  2BJ1 A;  1O6X A;  5DZ6 A;  1HIY A;  4ED8 A;  1F9H A;  1C0T A;  1D1U A;  1QTN B;  4B3T F;  2R2S A;  2EG1 A;  1JLA B;  2IRY A;  5J2Q A;  1HA1 A;  5DRK A;  3IFE A;  4R5P B;  3VAF A;  3H40 A;  3BGR B;  1I51 B;  3HVA A;  1E6Y B;  3OVS A;  4V1A k;  1JLE A;  4OJH A;  2C2O B;  3AAW B;  4P2F A;  3TUJ C;  3ZTO A;  1H6K X;  4CH0 S;  3MDF A;  5LXR A;  2HK2 A;  1ZTW A;  5J2P B;  2AX0 A;  1GX5 A;  1U47 A;  2B9E A;  5HAO A;  4HHJ A;  3GR0 A;  2ZIT A;  4I6Y A;  1FRH A;  4DSI A;  1FVS A;  2CWX A;  4ZLL A;  3FKB A;  4XIU A;  3M1V B;  3GTY X;  2KFY A;  3EGZ A;  1SCJ B;  1OSD A;  2R8I A;  1S9G A;  3K58 A;  1RB0 A;  1EAR A;  3OLB A;  5KFE A;  2Y3Y A;  1T05 A;  2MKC A;  5L1I A;  3DLK A;  3NNE A;  1HMV A;  3LGN A;  2AJ4 A;  1DQ9 A;  3TW0 A;  2BAN A;  2WHO A;  1B64 A;  1NSP A;  3PX0 A;  2YWK A;  1WSV A;  3P3D A;  4ZHR B;  2W4P A;  2VBY A;  1X9S A;  4AXJ A;  4OI1 A;  1B0P A;  2MQL A;  3S6E A;  1SJF A;  5ETL A;  2H4W B;  4DUZ F;  1NH7 A;  2FLP A;  4K4S A;  3M9N B;  4DV5 J;  3PJX A;  2BE7 D;  4DV0 J;  1HQ2 A;  4NLO A;  3PZP A;  2A2D A;  3G4S S;  2VC1 A;  3PM9 A;  1B0T A;  9ATC B;  4XO0 A;  1IBC B;  4O3P A;  4O23 A;  4Y3C A;  2BE2 A;  5DO2 A;  3W3S A;  4OI2 A;  4PWW A;  1T03 B;  2ZWP A;  3HJV A;  4JI4 F;  3CTR A;  1BQX A;  5H9F K;  3CJR A;  3KLF A;  1ULR A;  1EB0 A;  2Z2Z A;  3ZNU A;  3GV5 B;  4OZL A;  2W9B B;  2DNM A;  3OHB A;  5ETS A;  3NS6 A;  1RT2 A;  2MYF A;  2R7W A;  2XHC A;  2QRR A;  4O4G B;  1YJ9 S;  2BUN A;  5EWF A;  2W4C A;  4DEZ A;  5IWA J;  1CQM A;  3CB4 A;  4QWC A;  3CCW A;  1FXL A;  2G2Y A;  4OX8 A;  2ERR A;  4UW2 A;  1HNZ J;  2ZJP Q;  3KJV B;  3CCJ S;  4JI2 J;  1JKH B;  4I2P A;  5J1P A;  4ZPT R;  2DNY A;  2RVJ A;  3PEH A;  4KAI A;  1VLY A;  2I38 A;  4DCO B;  1XMQ F;  2DBB A;  4RW6 B;  3ITH A;  1FEH A;  5DLG A;  1FFW B;  2OP5 A;  4UT4 A;  3M9M B;  1S7I A;  1S1T B;  4IH6 A;  1RT6 A;  2XHW A;  4GVB B;  5KFU A;  3UD4 P;  2K1R B;  2WK4 A;  3EXC X;  4RNO A;  1T3O A;  3HI9 A;  3ZZO A;  3MPD A;  1VQ4 S;  2DGQ A;  2KTQ A;  2GJF A;  3BKU A;  3ZO7 A;  2JEG A;  3KNA A;  3HHK A;  2B6A A;  4PKD B;  2QO3 A;  3MM8 A;  2FZK B;  2C1E B;  2UU9 J;  4KSE B;  2VFT A;  1QSY A;  2FJX A;  2VOD A;  4DZ6 A;  4A46 A;  1NXI A;  2Y0S D;  2ZD1 B;  2XI3 A;  4KH1 B;  2VOO A;  1TKZ A;  1UFK A;  2DTJ A;  3PW7 A;  2CDQ A;  4CI0 B;  4Z7Y A;  4I69 A;  1NK0 A;  3MMJ A;  2XQC A;  2HRT A;  1I3O B;  2BJ7 A;  4RO0 A;  1S1X B;  2RUG A;  1RWM B;  3MFI A;  2DIU A;  1RT1 B;  5EX3 A;  2UV8 G;  4QIF A;  1SL0 A;  1HYS A;  1X4C A;  3QWU A;  1SH2 A;  3V4M A;  2VAS A;  5KT2 A;  4HVZ A;  3KDN A;  1VFJ A;  2VG7 A;  3ENA A;  3SI8 A;  1HNV B;  2Y8Y A;  4WP8 A;  4RJV A;  1VC0 A;  2F7V A;  2CQ4 A;  1OWX A;  1IKV B;  4F26 A;  2CQP A;  4HT7 A;  2UUT A;  1U1N A;  2KL8 A;  3DOM B;  2P9E A;  4ECU A;  1A0O B;  3KDO A;  5GMK a;  3MUV P;  2C3Y A;  4OYX A;  2LEC A;  5RUB A;  1T3N A;  3OSN A;  4DV6 F;  2PMZ D;  1NDP A;  4W92 B;  3JSM A;  1CLF A;  2V8H A;  3D2W A;  1CQN A;  2J0Q D;  5D4O A;  4KY3 A;  2KFN A;  4LF7 F;  3GG1 A;  3NEK A;  2DNN A;  2BAC A;  4PYD A;  1EKS A;  3IM9 A;  2FPH X;  3CD0 A;  3RBD A;  2W1B A;  4K4X A;  3J7A N;  4ZLP A;  3FBB A;  5IFM A;  5B0C A;  1B99 A;  3H90 A;  2F4F A;  5H9E J;  3PCO B;  4RPF A;  2WSF C;  2HZC A;  1H3D A;  2AGP A;  2A0F B;  3EJM A;  3RRH A;  3GFY A;  3OUY A;  1RKJ A;  2V5H G;  4Y65 A;  2KHD A;  4F0H A;  1TEL A;  3BO4 A;  3CPW R;  1S0M A;  4P75 A;  5BJR A;  4RL1 A;  1T9W A;  4X64 J;  2R9L A;  1KWM A;  4A8K A;  3AD7 C;  3BN4 A;  1QAI A;  4LSZ B;  3CMA S;  3U7J A;  2D74 B;  2ZOG A;  2OPP B;  4BS2 A;  2KG0 A;  4IDK A;  2GHV C;  1XNQ J;  5HN0 A;  3G6E S;  4IOB A;  2MEW A;  3EM1 A;  4WFA Q;  2IC3 B;  1FRX A;  3UNG C;  5M2U A;  4FXE A;  4DR5 J;  5CYJ A;  2E1M C;  1QAJ A;  4RW4 A;  4TNO A;  5D4N A;  4TYA A;  4NLP A;  2H54 B;  1N0U A;  1SQE A;  3DRP B;  3TEG A;  2HS0 A;  4DQI A;  4KH0 B;  4PPD A;  1VBK A;  4NXM F;  2Q66 A;  4ED2 A;  3H87 C;  4R25 A;  1S57 A;  1Y3J A;  3BGO P;  3SCI E;  2HGN A;  1N5V A;  2VU5 A;  4RWX A;  3S8S A;  4CLY A;  2UUA J;  5I4M A;  4KPC A;  1MU2 B;  3BO3 A;  5LMU F;  1WD6 A;  4CLL A;  3B6B A;  1M5K C;  2E1P A;  4OX9 F;  1GXT A;  3AT1 B;  1V5V A;  5KT3 A;  1EQ0 A;  2AZ1 A;  3CDB A;  5C7P A;  4WFX A;  5T7L B;  2VQE J;  1WG5 A;  4EMD A;  2DNR A;  4JI5 J;  5CHC B;  1JLQ B;  2JLE A;  4FF3 A;  5A8R A;  4PEO A;  1B3T A;  4DZD A;  1GMV A;  1JXL A;  1RGV A;  2DHS A;  2CNN B;  1WC0 A;  3GII A;  1U1L A;  3DOL B;  2LQB A;  3T9Z A;  3M2R B;  3I4P A;  2EFO A;  1SIW A;  1YDL A;  4P10 A;  1VQM S;  5F8G A;  1DRZ A;  4USM A;  1UA0 A;  4IFV B;  2SXL A;  2IYI A;  4Y2C A;  2DO0 A;  2UVW A;  3QAE A;  4CM2 A;  1TK0 A;  4P74 A;  1FX2 A;  3VHQ A;  3S7R A;  2EKY A;  2IAJ A;  4C48 A;  4AQY F;  2EKN A;  1WF2 A;  4B9V A;  4PG7 A;  2OH2 A;  1E6V B;  2UUC J;  1Q53 A;  4R0E A;  4LBH A;  1NSA A;  3D9B A;  2N3L A;  3FUY A;  4MKV A;  5IOL A;  3T41 A;  4N41 A;  3C6U A;  1A9N B;  2B56 A;  2Z0G A;  3KMS A;  4YY3 F;  1UWB B;  4CP5 A;  3IAM 9;  3TZY A;  1H72 C;  5HLF A;  2V9K A;  5CH7 B;  3R7N B;  2PO4 A;  1RT5 A;  2VFR A;  4L3K A;  2EC0 A;  2ZC4 A;  3GYG A;  3Q86 A;  1H2U X;  4I2Q A;  3W5X A;  3KK1 B;  4ZIV A;  2VL1 A;  3TX0 A;  4FBU A;  3R7B B;  3QSI A;  3ZZU A;  1HWK A;  2FHJ D;  1RLC L;  1KFD A;  3GZ7 A;  2V50 A;  3U02 A;  3MAA A;  5I42 B;  1J5O A;  4DFJ A;  2DK2 A;  2LEP A;  2BVZ A;  2VQF J;  3K7R A;  3NGT A;  1MMD A;  4Q2M A;  4LF5 J;  3R1H A;  3MOJ B;  3MUT P;  2BA9 A;  2HQG A;  3E01 B;  2MZJ A;  5KOW A;  2W25 A;  4KQZ A;  1BLU A;  2FIU A;  4IO1 A;  2YPZ A;  4B3S J;  1R8C A;  1JJH A;  2DHG A;  2Q3P A;  2GFF A;  3QFW A;  2FZG B;  3V6D B;  2G0I A;  2YQ0 A;  4ID5 B;  2EC2 A;  2P2C B;  3G82 B;  4ER8 A;  3GJT B;  4P9S A;  1Y11 A;  3NNA A;  1QM9 A;  1R0B G;  1VQY A;  1FFG B;  3JYT A;  1UFW A;  1N34 J;  2BJE A;  5HK4 A;  1C0U A;  3IM8 A;  2IVF B;  2O01 C;  3DU5 A;  2WTF A;  1DZ5 A;  3AOA A;  4IRK A;  3BS9 A;  1RWW B;  1SJ3 P;  4DQQ A;  3RU0 A;  4NI2 A;  4FYW B;  2YTC A;  2HBZ B;  1WHW A;  3DN9 A;  1SKS A;  3AXK A;  1LNQ A;  4RUC A;  2FC9 A;  1QD1 A;  2DIS A;  3DXB A;  5H9F J;  3MR5 A;  3PDN A;  4ETZ A;  2OPQ A;  1UVJ A;  2APO A;  2XNR A;  2QL9 B;  3QYY A;  4DUT A;  2QLX A;  2XI2 A;  2HKE A;  2PC6 A;  1TL5 A;  2HND A;  3FEY B;  4J9U E;  4ED0 A;  4ZIT A;  2ROE A;  3C3L A;  3GJQ B;  4WTY A;  3QO9 B;  1KVI A;  2L08 A;  4J9M A;  4J7C A;  3TR5 A;  3VGV A;  2MSS A;  1YGY A;  2Z58 B;  3ADA C;  2AT1 B;  4IH7 A;  3MED B;  5KFL A;  2HQD A;  2H9Z A;  5KFG A;  2DGT A;  1SJ1 A;  3C16 B;  3FBF A;  1NAQ A;  3D6T B;  4URG A;  2LKZ A;  4DFP A;  2LDI A;  1XR5 A;  1RE1 B;  3BR8 A;  1KOO A;  1V3R A;  2KT5 A;  1NRK A;  1FJ7 A;  2QLJ B;  5LOQ A;  1ARR A;  5KT5 A;  5E0O A;  2WBM A;  3Q2S C;  3PO4 A;  4C8L A;  4JV2 A;  4QJV A;  4ZIW A;  4GO7 X;  2I9S A;  4NLW A;  4N56 A;  4ED7 A;  3CJQ A;  4LFC J;  1Q5V A;  3GFH A;  2B4O A;  2I0X A;  3IR7 A;  3AA9 A;  3R1L A;  3PR4 A;  3RRG A;  3W9J A;  2DH8 A;  3RB4 A;  4MKY A;  1I94 F;  2PA3 A;  1X5P A;  3NRB A;  3W2V B;  1KFS A;  5K20 B;  4OX7 A;  5G0R B;  2HVE A;  3C2P A;  1FES A;  1JIH A;  2L48 A;  2QT7 A;  2QSW A;  1R0C B;  4FKX A;  2V2K A;  2M70 A;  4F25 A;  2KT2 A;  3MMB B;  1WUU A;  3DI6 B;  2YQ1 A;  4WP3 A;  1AFI A;  4J9R A;  4YME A;  2ZH2 A;  1JLC B;  2OPR B;  4F36 A;  1LW0 B;  2N7Y A;  1J5E F;  2YX1 A;  2MKY A;  3HCX A;  2AJQ A;  1PSD A;  2WW4 A;  3CJ0 A;  4PQU B;  4ZP6 A;  3MM6 A;  1FK9 A;  3MCN A;  1HHQ A;  4B9L A;  4NA1 A;  1RP5 A;  4E98 A;  5DLF A;  1H2T Z;  2LA4 A;  4ALZ A;  1SJQ A;  2XLK A;  3JSY A;  3DU6 A;  1HQE B;  4GRS A;  1JLF A;  2VC0 A;  2VJV A;  3ZZY A;  3D68 A;  4BBY A;  3TAM A;  5C2C A;  2DR6 A;  2RSQ A;  1YJW S;  1VQ5 S;  1IKX A;  3THT A;  3F56 A;  3VGU A;  5KG3 A;  4QPX A;  3GCX P;  1HNX J;  2IY5 B;  2FQQ B;  3OFF A;  2G1H A;  4WZQ A;  3I55 S;  1UCN A;  2ILZ A;  4AE5 A;  4GVL A;  3SQO P;  4RW8 A;  1HPZ B;  2VBX A;  3SCK E;  3PEJ A;  1TAQ A;  4QW8 A;  1NJX A;  1QY7 A;  5KFZ A;  3A4T A;  1RT3 A;  1S9F A;  4DR4 F;  2FTR A;  3G86 A;  4ZVT B;  3AQP A;  2QA4 G;  2IVM A;  1FKP A;  1S12 A;  3J81 Y;  3D1Q A;  2DIT A;  4KHR A;  3IG1 A;  5F8N A;  1AYE A;  5KFR A;  2RDJ A;  3NBP B;  4KGK A;  1PC4 A;  1KQK A;  1JLG A;  1EP4 B;  2D7S A;  2XTJ P;  1MYK A;  3V6H A;  4B9M A;  2HPU A;  3UCZ P;  2YKQ A;  3RZA A;  5HP1 A;  4DL2 A;  5B0A A;  3UDC A;  1H38 A;  1B0V A;  1I1G A;  1XJW B;  2CPY A;  4UOG A;  3V6J A;  5EDW A;  2GHW A;  5CYM B;  3CJT A;  3HX9 A;  4ZP8 A;  4UUW A;  2XLJ A;  1RLD A;  3FQK A;  1IR0 A;  3MR3 A;  1M1K T;  1KOH A;  4DSJ A;  5KT4 A;  4HAC B;  1NJZ A;  4CYU B;  2B3T B;  2RHS B;  5I3P A;  4BC7 A;  3LF0 A;  4FXW A;  1S6Q B;  2PII A;  4KRW A;  2MST A;  4YOE A;  3KLE A;  1L3V A;  4DL4 A;  4CLK A;  1IBM J;  3PO5 A;  3V81 A;  3M8Z A;  2R7Q A;  4J91 A;  1OG7 A;  3T6B A;  3I96 A;  5E3R A;  4I4B A;  4KV8 A;  1PKU A;  2PEB A;  2ZWO A;  3FQL A;  2POK A;  2H1Y A;  2GML A;  2R7O A;  3NGS A;  2J7U A;  1AW0 A;  2VKZ G;  3KK2 B;  4RUB A;  5A8K B;  1U25 A;  4DJB A;  3F41 A;  4ED1 A;  1MML A;  1LEO A;  4Y34 A;  4O3S A;  3OSP A;  1A7G E;  4F4K A;  1U24 A;  4LR9 A;  1CJT A;  1CJK B;  1OSC A;  4FNH A;  1H7W A;  2CQ1 A;  1OQ6 A;  1EET A;  2VH7 A;  3VCD A;  2BMB A;  2YNG A;  3PX4 A;  4JI1 F;  3RW6 A;  3Q8V A;  3RGI A;  3VV2 B;  3JB9 k;  3G2X A;  4OL8 A;  2YWW A;  5D3G A;  2RU9 A;  3MZI A;  4DV1 F;  1X5T A;  1TK8 A;  1RKI A;  3D7S B;  3UVJ A;  1JLA A;  2HFN A;  2D3U A;  3AY0 A;  1VYA A;  4R5P A;  5DQI A;  4KHP F;  5KFW A;  1FNM A;  8RUC A;  1PYS B;  3ZNJ 1;  3BGR A;  3ELH A;  3I56 S;  1E6Y A;  1S1W A;  5CQG A;  4JI4 J;  4C8Z A;  1NKB A;  4J9P A;  3HHL D;  2H4Y B;  3JSR A;  1BD6 A;  3BDP A;  2MZ1 A;  2RBF A;  2B7C B;  2D1C A;  3LOU A;  3OHA A;  2KEL A;  3KJF B;  4EU0 A;  5KT6 A;  2Z2M A;  1VQL S;  3M1V A;  4U9R A;  5F3T A;  4FYY B;  3M30 B;  2EI5 A;  2VHG A;  3OT9 A;  2QA2 A;  3KUE A;  1VQK S;  2CAD A;  3PYF A;  3Q8R B;  2GCF A;  3ONQ A;  2QMX A;  4F50 A;  2IJN A;  2RB7 A;  2DR7 A;  1S1U A;  5LL6 d;  2JBV A;  2GO8 A;  1IQZ A;  4FS2 A;  2MZT A;  5IV3 A;  4ZVU B;  2Q6C A;  1OPI A;  1BC6 A;  2XUL A;  1N32 F;  4KGV B;  4UY8 5;  3DYA A;  3IBW A;  4ZJL A;  4EUV A;  3W9I A;  5DS7 A;  4EO6 A;  1FDA A;  2J0S D;  3MD3 A;  1FWL A;  3HUL A;  3MWB A;  3EPI A;  3AOB A;  1NDC A;  2C28 A;  3HJF A;  5IV4 A;  3D54 A;  4M5K A;  2AU0 A;  2XZD B;  2G4B A;  3OL6 A;  4KGM A;  1KQS R;  2GNK A;  4H4M B;  4MIB A;  4CWB A;  2UZA A;  4USK A;  2AX1 A;  2I5J A;  1L3K A;  2KVI A;  1TFY A;  3MMA A;  5K14 B;  3LP0 B;  1T03 A;  2F65 A;  4LSL B;  2NYI A;  1TL7 B;  1Q8B A;  2FHM A;  2L41 A;  1Q8I A;  2K2P A;  1N56 A;  2UXB F;  3MM7 B;  4HDH A;  3P96 A;  2MPU A;  1Q4R A;  5HSP A;  3G9C A;  3LP2 B;  2RDI A;  1GXU A;  4LUB A;  2XMA A;  5KG7 A;  4O4G A;  4UTG A;  4ECS A;  3IR6 B;  4N5S A;  3HD1 A;  5ETQ A;  3O2I A;  3QGG A;  3CCL S;  2UXC J;  2ZVI A;  1SKR A;  4LSN A;  1SV5 B;  2EFP A;  1NBE B;  4QPT A;  4AXI A;  2HIY A;  3KJV A;  1W2I A;  4DF8 A;  4ES1 A;  2CQI A;  3NGD A;  3N6L A;  4FP9 A;  3U27 A;  1HBN A;  4EBD A;  2ZUA A;  2Z30 B;  4RW6 A;  4DSE A;  1WC3 A;  2M3D A;  4OYW A;  1CEZ A;  2R8G A;  3K5P A;  1S1T A;  5E3Q A;  1KKH A;  2QTW A;  7FDR A;  4TY9 A;  4DV6 J;  1FI4 A;  3FFI A;  1RHM B;  2IM3 A;  2WB4 A;  4G1Q B;  1C0T B;  2AN7 A;  2G0J A;  4P7T A;  4TY8 A;  3TA1 A;  2M2B A;  4NX9 A;  4F2S A;  4RNH A;  3R6L B;  1R7I A;  5J2Q B;  2DEJ A;  2NXN A;  3D6F B;  3GCW P;  5EWG A;  2ZD1 A;  2CKW A;  4IOA Q;  2Z2L A;  1T02 A;  1PBU A;  1GMW A;  3UNY A;  4TQS A;  1JLE B;  1NU4 A;  4J5O A;  3OL9 A;  2KDO A;  1IWG A;  1S1X A;  3TAN A;  3QJJ A;  4NLS A;  4OJG A;  2BBE A;  4Z2X A;  1GQE A;  1APS A;  1SC3 B;  3SDE B;  3DRS B;  1WC6 A;  3H20 A;  3EVW A;  4AL7 A;  1VGY A;  1Y9O A;  2ROG A;  2DHA A;  3HT0 A;  5LT5 A;  2G9O A;  4HLB A;  1F9F A;  1HNV A;  1OY9 A;  4M5I A;  2CJK A;  3HFK A;  4D8J A;  3UFC X;  4Y28 C;  1T05 B;  1IKV A;  5D4L A;  3DLK B;  1IWA A;  2RHQ B;  1SPB P;  3VQT A;  1HMV B;  2DJW A;  4L72 B;  1JJ2 R;  4MK7 A;  4B08 A;  2A1B A;  1Z4U A;  4BLG A;  4TU7 A;  2RML A;  1OIA A;  4IQX A;  1YX2 A;  3ZZZ A;  3BQ0 A;  4PXD A;  2I6W A;  4OLO A;  4DPU A;  2BJ8 A;  1MNT A;  1I5O B;  4CO1 A;  2CPI A;  3KWM A;  4NXM J;  3BJY A;  3K59 A;  1PO6 A;  4CZC A;  4LRB A;  4DSL A;  4JUZ A;  3U1N A;  2BA3 A;  5FDL A;  3M7V A;  2J6U A;  2BE2 B;  1HQU A;  1YZ6 A;  5LMU J;  2V69 A;  4OX9 J;  4DQS A;  1RAB B;  1NCL A;  2VA2 A;  1U49 A;  2UP1 A;  4PUO B;  4FXD A;  3NG8 A;  3QQC D;  4O44 B;  1RT2 B;  3VW4 A;  4OYP A;  3T1A A;  5J1N A;  4ZVS B;  3M6V A;  1SUQ B;  1RWU A;  4ECW A;  1T94 A;  3EGV A;  3P49 B;  3G6V A;  4JYA F;  1CBK A;  3O3L A;  3GYN A;  4ZPV R;  4I2P B;  5EHH A;  3PR5 B;  5F9N A;  2E1A A;  3EXY A;  4CLW A;  2VPY B;  2XSF A;  3BKF A;  2GGP B;  1R27 B;  2WON B;  4USI A;  4FF1 A;  3ITH B;  2D41 A;  4AQY J;  2NPI A;  1QTG A;  1SIZ A;  2CVI A;  2MZS A;  5A2Q Y;  4NXN F;  2ZNZ A;  4DR1 F;  3Q24 A;  2LCW A;  2NZC A;  2HUR A;  4I56 A;  3DRP A;  1DTQ B;  1O5J A;  4GKJ F;  4YY3 J;  3IBC B;  4ME7 E;  2CG4 A;  3MM8 B;  3PX6 A;  2XEX A;  2E44 A;  1MU2 A;  4ECT A;  1TKZ B;  2RUS A;  1RWP B;  5DM6 Q;  4DX7 A;  3PJ9 A;  2E7X A;  5T7L A;  3A8K A;  3UDE A;  3SSQ A;  1RJJ A;  1W26 A;  1VQ7 S;  5K8O A;  5DQH A;  5J2M A;  3KLG B;  5KG2 A;  4QWB A;  4L73 A;  3EWG A;  4RNF A;  2MJU A;  1AUD A;  1HYS B;  5BR8 J;  1P6T A;  2WAQ D;  2VA3 A;  3BBC A;  2VG7 B;  2KO1 A;  2XWX A;  4NCB A;  3V2U C;  2HZA A;  4IFV A;  3Q23 A;  4EYI B;  2DNK A;  3MUR P;  3MM9 A;  1NHU A;  3R5G A;  3MAH A;  2QL5 B;  2MQP A;  2CPJ A;  5DGA A;  5ETP A;  3QID A;  3G6Y A;  2B8P A;  1NSK L;  2QE5 A;  1RBL A;  3CD6 S;  5L9N A;  1BDV A;  4P52 A;  4X62 F;  4XPE A;  3CF5 Q;  4PCQ A;  2Q1L A;  5FJ4 A;  2HHW A;  1VBX A;  1LK7 A;  1N54 B;  4F4Y A;  1RTD A;  1XNR F;  1T9X A;  5F3Z A;  2HHV A;  2F4V F;  3KK1 A;  4FDF A;  2RAQ A;  2IRU A;  2K7K A;  3MF5 A;  4HYK A;  2ZBR A;  1NO8 A;  5I42 A;  5GME A;  4CDI A;  4UOH A;  2ADC A;  2CNK B;  2CAJ A;  1RWK B;  3GP9 A;  3OUY B;  4DPY A;  2CPD A;  3TUZ C;  4CQ1 A;  2W2M P;  1T95 A;  3E01 A;  1WEY A;  1MNE A;  2NXE A;  3BYP A;  2XY7 A;  2QFJ A;  2VIH A;  4DL3 A;  1T9Y A;  3QT7 A;  4BWJ A;  4TQR A;  2AD9 A;  1FNO A;  4IDK B;  4PAB A;  1U6Z A;  4ID5 A;  4YN3 B;  2MKH A;  4WK1 A;  1ZTT A;  2YQ3 A;  2EXU A;  4NZ6 A;  4F4Z A;  4A8S A;  3EE3 A;  2GX8 A;  1YRU A;  2BKN A;  4OZ3 A;  3D0I E;  1B7F A;  1LWF B;  4K59 A;  3QAT A;  4URS A;  1TV6 A;  2IDE A;  1MN7 A;  1KVK A;  1F9E B;  2XMU A;  2R7U A;  1IXK A;  1G7C B;  4K8R A;  2WVC A;  3K5N A;  2VFS A;  3ZXW A;  2KXN B;  2FGC A;  5ETV A;  1VLO A;  2CUY A;  1WTB A;  3THP A;  1KBR A;  2OEK A;  1IBL F;  2Q6B A;  5ETR A;  2RRN A;  3T1H F;  1DQA A;  1K0V A;  5HAN A;  4ZPA A;  3NAI A;  3N5B A;  3QT8 A;  3T9N A;  3V6K A;  4LF9 J;  2QYC A;  3KG4 A;  3RUB L;  2HMI A;  3IN5 A;  3WX8 A;  1FJE B;  3CMQ A;  3GQC A;  5CCM A;  3PIO Q;  5A8R B;  2B4V A;  1IRQ A;  2OMO A;  2QA4 S;  2UVU A;  2K29 A;  1YRT A;  5KFQ A;  3PIP Q;  5K8P A;  4EZ9 A;  2CPX A;  2VD3 A;  2HFU A;  4I0W A;  2ZH7 A;  2YH1 A;  1UET A;  3MMC B;  3OR1 B;  4FVM A;  4L74 A;  1I94 J;  2RF2 B;  5IQ6 A;  2BZ2 A;  2QIF A;  1NSQ A;  1VQP S;  3R5C A;  4EYH B;  1IKY A;  2HWI A;  2HAF A;  4NYO A;  3VAL A;  4NA3 A;  2BM0 A;  1U4B A;  1F0X A;  2IAJ B;  5GAE U;  1RU2 A;  2DNL A;  2H5J B;  3MED A;  2RQ4 A;  4DWI A;  2RT3 A;  4CM0 A;  5H1S V;  3QMQ A;  2JSX A;  2HHT A;  2DXE A;  3AOD A;  2OI2 A;  2ZBQ A;  4WFY A;  4TU8 A;  2ZDP A;  1LWX A;  2ZJR Q;  1HNI A;  3KLH B;  3E3X A;  2UV8 A;  2VV5 A;  4DI6 A;  3DOK A;  2DPI A;  3EDR B;  5HLF B;  4QZV B;  2E5I A;  5KG1 A;  1Q8L A;  4WU3 A;  1RTI B;  3I9V 9;  2J6S A;  3GIJ A;  2Z57 B;  4I2Q B;  3D3C J;  3OTO F;  1F6T A;  1S5Z A;  2DXF A;  1UPP A;  1PIL A;  4ECY A;  1L5U A;  4PG4 A;  2RIJ A;  3MAA B;  3A3P B;  4EBE A;  1J5O B;  4PR6 A;  5L1L A;  4C3L A;  1RQ0 A;  2QMW A;  1NKE A;  5AE2 A;  3B78 A;  5KFC A;  1XEZ A;  3D0H E;  3PYG A;  3T1Y F;  1S6U A;  3DCA A;  3OTB A;  3RR8 A;  2OJ3 A;  4AT1 B;  4RZR A;  4F0M A;  2GAG C;  3CC2 S;  2HHQ A;  4WXO A;  2D3O 1;  3PAC A;  2LDY A;  1V6H A;  4QWD A;  3FBC A;  4ZKA A;  1F2H A;  5G0R A;  5DM7 Q;  2F9D A;  3QGP A;  5MLC V;  1BAZ A;  2CQH A;  4MT1 A;  4K4W A;  4TKT A;  2AV5 A; 
#chains in the Genus database with same CATH homology
 2BNZ A;  2BSQ E;  2CAX A;  3BKU A;  2WVC A;  2WVF A;  1ARR A;  2FGC A;  2CPG A;  3PHT A;  2JXH A;  2F1F A;  2BJ9 A;  3VEA A;  2K1O A;  3GXQ A;  2WVB A;  2K5J A;  2CAJ A;  1U9P A;  1P94 A;  3QOQ A;  4FXE A;  2RBF A;  3BKF A;  2BNW A;  2HZA A;  1B01 A;  1BDT A;  1PAR A;  1Q5V A;  1Q5Y A;  2KEL A;  2Y3Y A;  1QTG A;  2BJ7 A;  3FMT A;  1EA4 A;  2BJ8 A;  3OD2 A;  1B28 A;  1MNT A;  1MYL A;  3FT7 A;  2CA9 A;  2WVE A;  3H87 C;  2PC6 A;  2NZC A;  2BJ3 A;  1IRQ A;  2BJ1 A;  2CAD A;  2JXG A;  2K29 A;  2HZV A;  4HV0 A;  2BA3 A;  2JXI A;  2H1O E;  3BKT A;  1BDV A;  3VEB A;  2K9I A;  1MYK A;  2AY0 A;  4ME7 E;  2K6L A;  2GPE A;  2WVD A;  1NLA A;  3VW4 A;  4D8J A;  3QSI A;  1X93 A;  1BAZ A;  1ARQ A;  3LGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...