3LGHA

Crystal structure of nikr from helicobacter pylori with variable ni site coordination
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
131
Chain Sequence
b'IIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nickel-responsive regulator
publication title Holo-Ni(II)HpNikR Is an Asymmetric Tetramer Containing Two Different Nickel-Binding Sites.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 42
structure length 131
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3lghA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3lghA02
2FGCA 3QSIA 2BA3A 2KELA 4FXEA 2JXIA 2WVDA 2JXHA 2WVBA 1PARA 4HV0A 2BJ7A 3H87C 2BJ3A 1Q5YA 2CAJA 1ARQA 1P94A 1Q5VA 3LGHA 2BJ9A 1MNTA 2K6LA 2CAXA 4D8JA 3VEAA 2BSQE 2K5JA 3OD2A 3GXQA 2HZAA 3BKTA 3BKUA 1QTGA 3VEBA 3BKFA 2K1OA 2PC6A 2BNZA 1U9PA 2CA9A 3QOQA 2K29A 1IRQA 3PHTA 4ME7E 1NLAA 2AY0A 2K9IA 2Y3YA 1X93A 2RBFA 2BJ1A 2WVFA 2HZVA 1MYKA 2GPEA 2NZCA 3VW4A 1B01A 3FMTA 1BDVA 1BAZA 2WVCA 1B28A 2F1FA 3FT7A 2BNWA 2CPGA 2JXGA 2CADA 2H1OE 1EA4A 1MYLA 2WVEA 1BDTA 2BJ8A 1ARRA
chains in the Genus database with same CATH superfamily
1GFWB 4UZBA 1Q16B 3ILLA 4UY8T 4GVBA 4IOCQ 5CYMA 3FNNA 3M8PA 3CJ0A 4RUAA 4WE1B 3PV8A 2ZBQA 4M94A 4LREA 3M8WA 1BQMB 1RXOB 2WW4A 4KO0B 4MIWA 1QE1B 4D8JA 4EO6A 2N82B 1JLQA 1MLAA 3EE3A 4ZCIA 1TL7A 1D8YA 1IWGA 2R2UA 4ED4A 2C3YA 2VFUA 1RT4A 2ZZNA 1HYSA 3QIDA 5KFNA 4B9VA 2IC3A 3UD3P 4LF6F 3W7BA 1H38A 4B3OA 5DQIA 1ZPVA 2OEMA 3C66A 3H2LA 1SJ3P 2E1MC 2OEJA 5GAEI 3C16A 2WVFA 4DL5A 2J7WA 1U2RA 3MR3A 1U0HB 4QPTA 4DFPA 1S9GA 2J7UA 1YRXA 2YKAA 4KE5A 2D69A 2HNDA 4K2JA 2VC0A 2JFKA 4HT7A 3R5BA 3W5YA 1RTIA 1FJEB 2DNNA 3SDEB 2AJ0A 5A0YB 2CNNB 4R5PA 1PARA 2W1BA 4OX8A 4C3LA 1N52B 2V9WA 3PKMA 5HLFB 2FC9A 3DRSA 2HRTA 4OX9F 5AXLA 2ZH2A 4JOUA 1GEHA 4DCOB 2CPIA 3MFHA 2HWHA 3I4HX 5E3CA 2JLEA 3DGVA 2ZBPA 1KSPA 3PHEA 5D4OA 1HQ2A 1NSPA 1MN7A 4DF8A 2NXJA 4M1KA 2RU3A 3MR2A 1R6VA 3CC2S 3VAHA 2G13A 1NEEA 2ASJA 2C2ZB 3I82A 4DZDA 4F7VA 3ENVA 2RBFA 3GE9A 4U6PA 2DY1A 4YDXA 2VKRA 1PBUA 3DRRA 3QT5A 4PWDB 4ED8A 2DPJA 2HK2A 1NK8A 4C8OA 1X4GA 2QL5B 5KFOA 5D0RA 3T5HA 4F3OA 1Q95G 3R6GB 2CPXA 4KT0C 2OP5A 1WF1A 3FQKA 4UOGA 5HROB 4OZ3A 1CVJA 2VOPA 1GMUA 3CCTA 1JNZB 2KI2A 3VALA 4DV6F 1XEZA 4ZLLA 2DTJA 3KTQA 2FJEB 3OL9A 1NK0A 2EWHA 3VTIA 2DNLA 3TEGA 3OQ2A 5T7LB 1S1VA 3M2RB 4F4AA 1OSDA 3ZFVA 2W2QP 2H5JB 3QPIA 2AIRB 4YHHJ 1DURA 2M88A 4DR7J 3UD4P 1E6VA 4X66F 2VBZA 2DEJA 4I7FB 2KN4A 2YWFA 2XSFA 4PG8A 1OHNA 1EIYB 3OVAA 2RDJA 2IM2A 4ME7E 2NXCA 1D8ZA 1JXEA 4EGLA 1V6HA 3DXSX 2JLFA 1B3TA 1B0TA 3VAJA 2CQ2A 3WC0A 1S99A 1VQNS 3ISNC 1RGVA 2ILYA 1G1XA 3BGUA 5GVQA 2QYCA 1Q79A 3CDBA 1FE4A 2J6TA 2R7VA 2RF2A 3CXCR 2MKKA 3GJSB 1LXNA 4ELVA 2CPFA 1VRQC 2BQRA 3DHWC 1EETB 4F36A 1UVJA 1F9EB 2Y1JA 4ECVA 1RAEB 4KHPF 3I6PA 2ERRA 2MKSA 2XMVA 2XZTB 1FESA 4OI3A 1XMOJ 3DRYA 3UN2A 4X62J 4C11B 2MQNA 1H73A 5A8RA 4C97A 1U48A 3GXQA 4CIOA 3M9MB 1UCNA 2YWEA 1CBKA 2WONA 3W5ZA 4B9NA 1DY3A 1U9PA 2HFZA 3R5DA 2UXDJ 2PEBA 4HHJA 4PCQA 4ZP7A 1JQGA 3OVSA 1Y5IB 2CJKA 2IDLA 4DV7J 4NLTA 4PYDA 2YNHB 3R5GA 4OIXA 1HNXJ 5KOXA 1R31A 2CQPA 3KKFA 3LF0A 4HHUA 2IJNA 2F8HA 4NOHA 2C2NA 4HTJA 1S10A 2DRAA 5D4NA 3M8ZA 4U7UD 2CPGA 2H9ZA 3KWMA 3P5TL 3CGIA 3TZWA 3IWNC 3THPA 3I0RB 3ET6A 3ZC4A 3KLEA 1X8DA 1RQ0A 3BDEA 2KG1A 3PX4A 3D1QA 3Q0AA 3POTA 1U8WA 4LRFA 1XMBA 3I4PA 3AD8C 2QGFB 1JLBA 2ZD1B 1N4LA 1H7WA 4IG3B 4K4WA 4TLRA 1TL3B 5KT7A 2BBEA 3UDEA 4HL9A 1MMLA 1CG2A 2E9RX 2DH7A 3Q8RB 4WPAA 1HNIA 2CQGA 4FS2A 3HKZD 4CZCA 1JLCB 1WG5A 4L73A 2BDPA 4J9LA 2NXEA 2HS4A 2HBRB 1HKAA 2DRBA 1OWXA 3RRGA 3CMQA 1IBKJ 4P7VA 2WVEA 1FRHA 2PA8D 4FZVA 2QIFA 4FF3A 1SKWA 2PMHA 3NP5A 2PSZA 3MM6A 5D4LA 3NMAA 3DGPB 1UJ5A 3SV3A 3ZZZA 1EX8A 2YBVA 1T7PA 3M8SA 4ELUA 1VC6A 4DV4J 3OBIA 4PQUA 2FJXA 2UU9F 4F0MA 3Q8VA 3EDQB 2W01A 2MGZA 2HNYB 2JDJA 1H2TZ 1PJ7A 2VQEJ 1PBAA 2K1OA 4QBUA 4JI4J 2RVJA 3G82A 4RU2A 1RHQB 3KHRA 2DNZA 1HWJA 5LMUJ 4NEYA 1RLDA 1WWHA 3HULA 4OYWA 4QJVA 4Y2MA 2KVIA 3IWXA 3CD6S 1S7HA 1DRZA 1AZSB 2XI3A 1S5ZA 3IBCB 3W65A 2D3ZA 1NJWA 2G2YA 3LH2S 3TWZA 1N8RT 2CNOB 1S0OA 5EHHA 4Q0BB 2OGUA 2RRNA 2BJ8A 3JTPA 3BF4A 1FJGJ 1WSRA 3DOKA 4G1IA 4A8KA 1WC4A 1HMVA 4NZ0A 3IC1A 3KJNB 4WFAQ 2EK6A 2YKPA 2W2NP 1RK8A 1H74A 3EM1A 5L9XA 4U7UK 3OR1A 3CJSA 5DETA 5G0RA 5IV4A 1DFDA 1PAUB 2MSSA 1BE4A 4EK2A 1EHWA 2EG2A 2E5LJ 3H5UA 1RU1A 4ILMA 4RBVA 1Q8IA 4MMOA 5F0WA 3BKTA 1JLGB 1R8AA 1FRKA 2GA7A 2E5IA 3DRPB 2YPYA 2VG7B 4F4WA 4RW7B 4ZA1A 1RWNB 2PGCA 1T05A 2NCKL 1CQMA 5K5MA 1LW0B 2O3DA 1ULRA 3RUBL 3H5YA 2GQ2A 3DOLA 4IFVA 3AB2B 3BYRA 2W9BA 1TKZA 3V4MA 1SQGA 5K14A 3JSMA 4USJC 1HI1A 2QLBB 1BQNA 4AE5A 4DN0A 3ZZYA 3CJ4A 3FK4A 1Z2LA 1F3FA 4EYHB 5ETOA 4KIAA 2Y1IA 3QSYB 1UETA 2HIYA 5KFUA 1LW2A 2HBQB 3M6VA 4AQYJ 3BGOP 4PWUA 3VAFA 2V0NA 4WTOB 2YKQA 3V4IA 1VRUB 3BO4A 4WIQA 3PYDA 2QT7A 3PX0A 4HI1A 2E5JA 2B43A 1U4BA 3LWMA 3PCOB 4DPYA 2B3TB 1EARA 4JI1J 4RWWA 1HHSA 3HJFA 1D9AA 2BMBA 2XY7A 1JLQB 4IKAA 2AMCB 3KHHA 5AE3A 4JI8J 3LW5C 1DTTB 2VH7A 3P49B 2GHVC 1RT4B 4GC6A 3DLGA 2D41A 1M1HA 4G1PA 2VF3A 2A2DA 5T14A 2YTCA 4ZOSA 1WC0A 3HF5A 1HIYA 4DSFA 4I0WA 5D15A 1M1KT 1SUQA 1HWUA 3QNWB 1AUDA 2VZ9A 5IXUA 4OMFG 3T5LA 4MJKA 3TUJC 1RAGB 4LRBA 4Z37A 2ZH5A 3IR7A 4OHXA 3UW1A 2BABA 4RW4A 2HNDB 5I42B 2A6OA 2OPQA 3KLIA 3E51A 7FDRA 3HHNB 5KFAA 2ZH6A 1JIHA 2YWHA 4RUBA 3M2UA 4ED5A 1NK4A 4NLXA 1URNA 2K6LA 2CAXA 1GT8A 4N47A 2RH3A 4UF4A 4A48A 1CC8A 1G4CA 3IBFB 3B4MA 1PO6A 2DGTA 3KNGA 2OPRA 2VIHA 3NNEA 4EO8A 1YI2S 4OHVA 2E1RA 5EN1A 1YJRA 3LAKA 2JC0A 2FB0A 1UJ6A 4P2XA 5DDQC 1VCTA 1BHNA 1ZAVA 1VLYA 3MGJA 4E2FB 1HR0F 1U1QA 4NXMF 1AFIA 3JQMA 1X93A 2ROGA 1S77D 5K8NA 2HZVA 2CWKA 3S6EA 4TVAB 1MYKA 4ZLPA 1N0UA 1AXQA 1HI8A 4YB5A 1JJCB 3FFIA 4JI0F 4CRJA 3MM7B 1X5TA 3CWJA 1HNVA 2H1OE 4DV2F 3HHLD 3GIKA 4DR6F 2DR9A 3R8YA 5DG9A 1X7VA 2B9XA 5KG4A 4URSA 1MU2A 4FPIA 4ER8A 2XMMA 2OIHA 2HHSA 3M8QB 1F3VA 2GGPB 4ZJLA 4C3MA 4CP5A 1N32F 1SH0A 3H90A 1N5TA 1WSVA 3CJ3A 3PX6A 4PR6A 1BY9A 4LF9F 3BN4A 3Q8UA 2RQMA 1KNZA 2MY8A 4X4VA 3CCRS 4QIVA 1HW9A 1DBDA 2H54B 1K9MT 1OPIA 4I64A 2V69A 1R8HA 3ETOA 1FD8A 1ZETA 3U1LA 4OI4A 1IBLF 3C14B 3ISZA 3LO3A 5FDLA 1GQEA 4LRAA 4OQJA 4ECRA 3MD1A 2KB2A 3J7YU 4I69A 1OJ4A 4P73A 4YR3A 3QRRA 2DH9A 1HQUA 8ATCB 1RT2B 3TANA 4MK9A 4FXVA 1NH7A 1X4FA 1QAXA 1FKPA 1RWKB 5KFIA 3TW0A 2E1CA 3PYFA 4DV0F 2YX7A 3CT9A 1J27A 4LFBF 3W61A 7FD1A 4ED2A 4IG0B 4USMA 4DI6A 4NI2A 3BKFA 4CLFA 2GO9A 3QT7A 2YX1A 5J2PB 4LUBA 1OY6A 2QLXA 1UWBB 5A8RB 1IKYB 2K29A 3CCZA 2ZBIA 2I5JA 4N77A 8AT1B 5A8WB 1MWQA 2K9IA 3O44A 3KMQA 2O1PA 1U1OA 3DMJA 4IFYB 2K06A 2R7XA 3VW4A 3KJFB 4IRDA 1NK9A 2RDDA 2HURA 3B8HA 4CLUA 2JSXA 4O3NA 3I5CA 5KFQA 1VRTA 5A6PA 3CJ8A 2HFOA 1WHWA 1J5EJ 2ZFHA 4MJWA 2C3UA 3I9V9 3C6TA 2JEIA 2BOAA 3F56A 4FVCA 2GVDA 2RRAA 3L09A 4FDFA 3QIPA 2ZDPA 2B8PA 3ET6B 2CNLB 1WEYA 3OR2A 2LKZA 4AYBD 4DDFA 1M0SA 3BR9A 3GYXB 4RX6A 5A76A 2MKHA 4G1QB 2RSQA 2PI5A 1CJTB 2OTLS 1VISA 2J0QD 4JI5F 1XC9A 1S1XB 1UL3A 3FMWA 3U27A 4CT8A 1PAEX 3W9JA 8RUCA 3HHDA 5HQMA 2XO6A 4Q8FA 3G8TA 4ED7A 3KK3A 4DEZA 5C7PA 2QG9B 3W2WB 2CJYB 4CI0B 4J9MA 4M63A 3BEGB 1GAOA 2XG8A 3S8SA 4RNHA 3A3PB 1SJ1A 3NGDA 1R43A 2KFNA 1Y9OA 1FEEA 3BSAA 1X4HA 1HNIB 3DLKA 2XMJA 3MF5A 4WKRA 4OYMA 1V3ZA 2FY8A 2IVMA 2M5YA 3LUYA 4B3RF 2RIJA 1C0TA 3US5A 2E1PA 1KKHA 3AD9C 2F9DA 1B7FA 2ADLA 3RW6A 4M8LA 3MOZA 2VFVA 4QIEA 2ZITA 4HT5A 3NOCA 4DFJA 4B9UA 1WELA 4OYZA 3GQCA 1U0SA 1W26A 3MECA 3SFUA 1QVGR 1U09A 2B6AA 3I5AA 4DL0C 1JLFB 2AZ1A 2KT5A 4L3KA 4HEA9 4DLGA 3WZ0A 1S0MA 2IM0A 4FXWA 2UZAA 2MGZB 7AT1B 2D9PA 3PM9A 3I87A 5E7OB 2RILA 1VJQA 2RHQB 5ETNA 3PW4A 3G86A 4F02A 3U1NA 4DPXA 3OXGA 3G82B 1V3RA 3RB3A 3G8SA 1S0NA 4B3TJ 1F9FA 1NHVA 1LWCA 3AXMA 1ZZFA 2NR0A 5HVFA 2ZWPA 5DDOC 1TELA 2I2YA 2H1YA 2D3UA 2H65B 2DD8S 3G87A 3M9NB 2RKIB 3S1TA 3RRKA 1V9OA 4ZP6A 1FTCA 2WAQD 3LP1B 3HFZB 4NZ7A 3DOKB 2ZKUA 2BJ7A 1WD6A 1RT1A 5BR8J 1HHQA 4WU3A 1IR1A 3VAIA 4X4QA 2J6UA 3H5XA 3OR1B 5E3QA 5G0RB 4K7QA 1HNZF 3UN5A 2IJRA 2DIUA 6AT1B 2BE2A 4QQBA 4USKA 4J9PA 2KRBA 4Q43A 3DYAB 5J2QA 4ZVSB 4KH0B 5B09A 2ASLA 3CJKA 4PPDA 1SPBP 2JH3A 2XULA 3FEXB 2V5HG 1GXTA 4ZPDA 2JRSA 3W9HA 2MKIA 5IT4A 2UUAF 2IAJA 2AGQA 4GO5X 3H2UB 3RW7A 2XY5A 1HBUA 4M5DB 3L3CA 2CADA 2DR5A 3K7RA 1KQKA 4QWBA 4QWDA 3SV4A 2AYBA 3UCZP 3KFWX 4DQIA 1E6YA 3OPKA 2V8GA 2R7RA 4DL7A 1L3VA 1ZM3A 2UUAJ 1M5SA 3FGVA 2DHXA 1ARQA 1LW2B 2DXDA 4EBEA 4DX8H 4JI6J 1KR4A 5DLGA 2HSEB 3JAMY 3NMRA 4B02A 3CO0P 2YH1A 1N34J 2RU9A 1M5OC 2MKJA 2ZC3A 4C8NA 2KDOA 4KPCA 2P5VA 4RNNA 3V5RA 1MROB 2IIHA 1RT3B 1NDCA 3K8WA 1T95A 1RHJB 3M8YA 4G6VB 1K1QA 1MMDA 1NM2A 2DR7A 1Q1KA 2BA9A 3CMAS 3KLFA 4Q5VA 4ZIWA 5DM6Q 4BLGA 4UY85 1OQ6A 3E01B 1F6TA 3MHYA 3MPDA 1KLMA 2W8KA 1S76D 3KG4A 4L6V3 2FLLA 3MMJA 1VOMA 5KFGA 3DLGB 3PO5A 5KG1A 4B3MJ 2E1AA 4O0IA 1FRIA 3R2CJ 5GADI 4ZN1A 4NEZA 3U02A 2M8HA 2A10A 2CIMA 3TA1A 1XR7A 2JXHA 4FXDA 1KN6A 1HI0P 3GCXP 4D3HA 2CJXB 3IR7B 4RW4B 1S6PB 4X65F 1SJQA 4IYQA 3KLIB 2QV6A 3CD5A 3UDVA 5KFBA 3MR5A 2VB6A 4Y2IA 1RYSA 1FEHA 3IS9A 3M2UB 2G1DA 2PFFB 4H4OA 3PJ9A 5KFLA 2BACA 3VVUA 3F44A 3G8QA 5IS2A 1UFLA 4NMLA 3M9OB 4KYZA 1X4DA 2RJZA 1JXLA 4LF7J 3GTYX 2EC0A 3VGVA 2B4OA 1NDPA 5F9NA 4C8MA 3HT0A 2VQFF 1S9FA 3TUZC 3BJYA 2QSFA 5AXMA 4R8UA 3K5PA 1K0VA 3MMAB 1SJFA 4N8OA 1JXVA 3WX8A 4OJ1A 4YR0A 1S1UB 5D8HB 4IH6A 3QT8A 2XLKA 1IUJA 3CSKA 1HNVB 1Z4UA 2HLUA 4J90A 4M5LA 4KKOB 1MU2B 2VBWA 4NLQA 1H72C 3V81B 5HP1B 4O23A 4FYXB 2X7IA 5KFYA 5L1IA 3NAHA 2PE8A 4LF2A 2EBGA 4YDDB 3LP2B 1IN0A 4I6AA 2HHHJ 3RBDA 4X4OA 1O8BA 2R7QA 4DUZF 4NLSA 1VHFA 2Y8WA 5F3TA 1J2VA 3T1AA 4A46A 4H54A 3D67A 5F41A 2XC9A 3MAHA 3D6MB 4XDDA 1VQ5S 4MKBA 2BW7A 4LSLB 5K20B 1UAWA 2GJ2A 2CUYA 2FJDB 4DU8A 3D66A 1TV6A 1U6ZA 2EPIA 1C1CA 3AA8A 5L9NA 3BSOA 3BH6B 4LT6A 4DFMA 4FYWB 2YPZA 1RHRB 1YJTA 3VQTA 4GRSA 5KFTA 2LFVA 4QWAA 2YWKA 2MJNA 2P9CA 3QBCA 3RBZA 1IWAA 2RQCA 1SB6A 2Y8YA 2DGVA 1WOPA 4PPZA 5KG0A 1UFWA 3BH7B 3BBCA 3T5JA 2Z2MA 3B78A 2VPXB 3OJUA 1H7XA 2ASYA 1RT5B 2AHOB 3ENQA 1AYEA 3GFXA 4ZCLA 4URQU 3PXGa 1HQUB 1FNOA 1S6QA 3DLLQ 1FK9B 4P10A 4EEYA 4RBTA 3MMBA 3BGFA 3NNHA 1WOOA 4USIA 2ZH3A 4ZHRA 1M5VC 3CJQA 2BSQE 3HSDA 2JWNA 2CZ4A 4PWWA 1XMQF 4CO5A 1RWVB 4BBYA 1S1WA 4FN5A 4ZVEA 5KG2A 1JK9B 1EQMA 2DO4A 2V94A 4NI2B 2CJBA 2UXCJ 4B3SJ 5IWAJ 3NCRA 4PG6A 3RYLA 3BREA 4ZIVA 2QEXS 1LWXA 2DB1A 4ETZA 1VS3A 1D9DA 4WFYA 3TA0A 3P6YC 1IBMJ 1RT6A 1L3SA 3T1YJ 2L9DA 5B0CA 4P9SA 3DLEA 1ELOA 4WFXA 4RW9A 4DQPA 5A8KA 3MMCB 1VIOA 4QYRA 2ZHOA 4Y28C 2CAJA 2XYPB 2AV5A 2M4MA 3NWGA 2UUBF 4JV5F 2FUG9 1AA1B 3LAMA 2VUGA 1S6OA 5FIIA 4TY8B 4V1Ak 3ENAA 3CF5Q 1U7LA 1WTBA 2FGOA 4KGZB 2FJBB 3D68A 4H4MB 1RZMA 1KONA 3EPGA 2DGOA 1WG4A 2YKOA 4G65A 1WNEA 2AJ1A 3ZO7A 2UUBJ 5IM0A 1N33F 4CQ1A 3EGVA 4N7TA 2C2MB 3KK3B 2DGWA 1TKTA 1L3UA 1B01A 4ECWA 1RSCA 4NA1A 3IN5A 3RRHA 3HK2A 4C2MA 2V4JB 3CJRA 4FVMA 4CO2A 4TXSA 2MTLA 4ILLA 2GQQA 2XS2A 4DV1F 1SQFA 2A6MA 2L9WA 3AH6A 4ZJOA 2ALYB 4V19X 3A4TA 5I3PA 4I1TA 1N5SA 3W64A 1JX4A 2JOQA 4GKKF 4CM0A 2CPDA 4DR2F 5K8OA 1IM6A 3MECB 3T6JA 4EI2A 2O66A 2OPPB 2LVWA 3G6ES 3CJTA 3DDIA 2K7JA 5AJ3J 4X4UA 2GJIA 4ECYA 2Y0SD 4O3OA 3QFHA 4LVNP 3VF0B 4WE1A 4LBPA 2BJ1A 5DS7A 2HVIA 2JZ5A 3NCQA 3MUMP 1KRPA 4LF4F 4DCJB 1MWYA 1BQMA 4UW2A 3ELHA 4ED1A 2CQ3A 4KO0A 2ZVSA 1XNQF 1B28A 1IBCB 1R8BA 2DHAA 4E0DA 1QE1A 3MM9B 2YWWA 3FKBA 3QRQA 5HANA 1T03B 4JB8B 5EDWA 2G0CA 3HJVA 4EU0A 1QLNA 3EXYA 1RBLA 4K59A 4M5IA 2BKNA 2CQBA 5IFMA 3MEGB 1U6BA 2DNPA 2KFYA 4U67Q 2HBZB 4W90B 1VQMS 1JJHA 4NA3A 3LPYA 2QMWA 3NAIA 2Z30B 3HSJA 1U0HA 4HLBA 4LBHA 1XTZA 2J9CA 5MAOA 2MQ8A 3NY0A 3ONQA 2KFZA 1ZTWA 2IYIA 2UVVA 2HQDA 5KFEA 1D0EA 2A2BA 2J7KA 3UPFA 4ILRA 2LQ8A 5L8RC 4J9VA 4KR0B 3SDEA 2R7WA 4IRCA 1QSSA 4LJMA 5DJBA 5A0YA 3GG0A 4DPOA 5HJYA 4YR2A 5J2QB 5DM7Q 2KZMA 2CWXA 1V5VA 3QRPA 2H48B 5HLFA 2OEKA 1GMWD 4ZMMA 1TK0A 4PEOA 2ZH9A 1R7IA 4JI2J 3VVTA 3CCES 1HBUB 3IGVA 1RTDB 3VHQA 3JAMU 2X51A 2GS8A 4ECXA 3GSIA 4FKYA 4NE9C 4X4SA 2B9EA 3UNGC 2UUCF 2KJVA 3KXDA 3LQVA 2AD9A 4OV6A 3P4UB 1E6YB 1YJ9S 1DQAA 3TJAA 3L9ZA 2E7VA 2DNOA 1RTZA 1UJ4A 1GH8A 1R89A 3MR7A 4RUCA 4UQGA 4ED6A 4OYBA 1Q82T 3W66A 1NB2A 1TL1B 5IC4B 3P45B 4KFBB 2B4PA 5HROA 3R3TA 4LRCA 3CC4S 4I67A 3ZZTA 1HPZA 4FP9A 1KOHA 2IYGA 1NZAA 1TUVA 3AD7C 2HFUA 1NKEA 1IQTA 2V68A 2HHWA 3RB6A 3M2RA 4ZDNA 5LXYA 3OT9A 2YNFB 5ETKA 2KT2A 2QZ8A 3IA0A 2UXBF 1R0CB 3W1YC 4FXEA 4Y6IA 1RDRA 4I7FA 4RNOA 2RS2A 4J9OA 2XM3A 2F5GA 2XMAA 3EUNA 3QAUA 3GG1A 2AEMA 2HPUA 2JVOA 2BEFA 2QLWA 3HVRA 1NB7A 2X1FA 3T5KA 2XMKA 4HKQA 1DTQA 3JYTB 1FRJA 3T1HJ 3CCWA 2ZHBA 2HVDA 1KBRA 4ZCKA 1HNWJ 5C5JA 3QAEA 4H4OB 1VQSA 2MKCA 1M1GA 4DUYF 3SI8A 2XSJB 4YY3J 4RW8B 2KT3A 2LCWA 2LLZA 4QYZK 4FPRA 1SQEA 3OXLA 3N6MA 1LKZA 4KAIA 4GO7X 4F4KA 5DO2A 3Q8YA 1N36J 4LSNB 4H4KC 3BGRA 5ETRA 4TU9A 3M1VB 4F3MA 1TUWA 1DARA 3ULHA 2R42A 2YNHA 3O3LA 1NHKL 2PT0A 4DN9A 3M6UA 4HI2A 4NCGB 4FYYB 1WUUA 2DISA 3IAS9 3K58A 5SZTA 1B7YB 2F9JA 3R5CA 2IRXA 4M5NA 2Q66A 2XCPA 2XGPA 2UUTA 3I0RA 2V8HA 2Y3YA 2MB0B 4HH0A 1VK8A 1REGX 2VPWB 1Y4ZB 3VR1A 2LXIA 3VGTA 3J80Y 1BAZA 1WG1A 2FLPA 3GIRA 3BS9A 2V67A 2ZD1A 3AJDA 1ZOTA 1C1CB 3PTWA 1LV5A 4FNIA 3GCWP 4YOEA 5DGAA 4IG3A 1NPRA 4DR3F 2KELA 3QT6A 1NJXA 1TL3A 4FBTA 4DV3F 4KV8B 4MK8A 4L75A 4BDPA 1WF0A 2FHMA 3TA2A 1D09B 2Y9HA 3DI6B 1Q8KA 2EI5A 4P2MA 5CCLA 1NSAA 1JLCA 4QR2A 3D0GE 2HQCA 3HZGA 3IG1B 3NRBA 3MMBB 4WZQA 2JLGA 1AW0A 4ZKAA 4ZHRB 2QC3A 4YB6A 5E3RA 1YRTA 1B70B 5HO4A 5M2PA 2FHKA 1SIZA 3FSYA 2HGLA 3WDOA 3DGPA 3R1HA 2NXNA 4OX6A 2IRYA 3IRXB 4UOHA 4DS4A 1FRLA 3J7ZT 1Q86T 4ANEA 3CCVS 2KVQE 3MUTP 2Q3PA 1S9EB 3AJ2A 2HNYA 2GQCA 5CH7B 2AEFA 3HM9A 4DR5F 3HHLC 4KHMA 1S12A 4P2SA 5KG5A 1PJ5A 1RUSA 2AYEA 3JXOA 1LWEB 4PG7A 1C0UB 4X84A 1AZSA 2G9OA 2CRLA 3CULA 2KKHA 5DGBA 2D1CA 2KO1A 2RD5C 3KJVB 2CQIA 3EZUA 4EZ9A 5D3GA 4Q0BA 1FX4A 2ZUAA 2DKOB 3TEHB 5ITHA 5LJ5Y 5J2NB 1F2GA 2HQGA 3A8IA 5L39A 3VV2B 4WZMA 1F5BA 3KMSA 4X64F 1U47A 3KDOA 4AL7A 1DAXA 2DPIA 3HI9A 3EVMA 1T9XA 1PIEA 4BCAA 5CCMA 1FI4A 4DR1F 3K5OA 1KQGB 1UZDA 3JTOA 5IM0B 3ENWA 4FYVB 3ZTSA 1IVZA 1JLGA 1XBWA 3OSPA 4EUVA 4DQSA 1BGXT 4E8UA 3TNVA 3DRPA 4X64J 2AYGA 5G4DA 2VG7A 3HLUA 1G3OA 4DS5A 1A6LA 1NJIT 1Q4RA 1LW0A 2FLNA 2UVWA 2JNJA 5B0AA 5F9LA 1IBMF 2MSTA 4Y2AA 1NU4A 4OYPA 3GR1A 1ICEB 3MURP 2YNIA 4PXBA 2VKZG 2FJAB 1UMJA 3JS9A 4QPXA 1OS5A 3D6FB 1QTGA 3G4SS 4OLPA 1VBYA 1TMMA 3FSXA 2VASA 1KS2A 1V3SA 3KHLA 2C3OA 2OLWA 4ID5B 4U95A 2CQ4A 4WYLA 1UKUA 3GR0A 2DITA 5ETTA 3BV8A 1TKDA 1QAIA 4A47A 5IT0A 1YHQS 2HHVA 1AROP 2GIQA 1XERA 1O5JA 1VRUA 3R2DJ 5LXRA 2B4VA 5L46A 5EGYA 5KFJA 2BJEA 4CLZA 2ADBA 1K47A 1YJWS 3M7VA 3OFFA 2DR8A 3ZTRA 3UVJB 2D9OA 3K8VA 1PSDA 3W3SA 3K57A 3R1LA 1G7CB 2HZCA 4X4RA 2GX8A 3EXCX 2HHUA 2HW3A 1DTTA 4DWIA 1EQ0A 1NK7A 2N7YA 4DSJA 1YDLA 2HK3A 2FIUA 1NHUA 2Z2ZA 2ZM6J 1S59A 2FVRA 2HG4A 2MKYA 5CQGA 4GC7A 3BR8A 2LQ9A 2LXFA 4RU9A 4Q7AA 5L1JA 4RW6B 5HMZA 4S0MA 4ITSA 5I42A 3ILIA 5LM7E 5AE2A 3TUPA 4LRVA 2KXNB 3WHIA 4AFFA 1NBEB 4C0HA 3IR5B 3VZHA 1QDUB 2HHXA 3KK1A 2F4FA 1ZBTA 3WBZA 2BXJA 4ZVFA 2E9ZA 4WBFA 1SV5B 4OJGA 3PFOA 4Y65A 3LP0A 4DUTA 5L1LA 4OZ1A 4DX6A 2R7OA 5MLCV 3THVA 4NPOA 4NYOA 2FHJA 1SJRA 1XIQA 3OJSA 1X60A 2GNKA 1TQLA 3HD2A 1JJ4A 3CUNA 2YKNB 3BBBA 1N5QA 5D6GA 3PW5A 3KNAA 2KHDA 2DHGA 3LA0A 1FE0A 4AXIA 4CH0S 4CT9A 1FT8A 4UOCA 3D28A 3MM7A 3HD1A 4DSLA 2ILZA 2V2QA 3SBMA 1HQEB 3H4BA 2HFNA 4ECTA 3MPVA 3OTBA 3OXFA 4DX7A 2RHSB 4Z7CA 1VQ9S 4XK8C 2OELA 1PC5A 2BQUA 2OH2A 1T8EA 3M8QA 1V5IB 2GGPA 1TL5A 3NS5A 2NPIA 2WZ1A 1RWPB 4A8QA 1VQPS 5C42B 3OV7A 4JI3J 4YHHF 4RNFA 4ICLB 4DR7F 1NAQA 5D0HA 2Z8QA 1U45A 1HPZB 1ZAWA 1I3OB 1LWFB 3UN3A 4I2QB 3C6UA 5E5NA 5LL6d 4M5MA 3MEEB 1NRKA 2LA6A 4WP9A 4FS1A 2F63A 2V8VA 4QCLA 3BQ1A 1T02A 1VQKS 5B08A 2QA1A 1L3TA 4PXCA 4IH5A 1SIWB 4LF8J 3MTJA 2KTQA 3C14A 3IR6B 2BR0A 5CYQB 1RWWB 2DXFA 4KGXB 1N5YB 1QUVA 2MZ1A 2IPOB 3VEBA 1P9YA 2BQ3A 2ZOFA 3PEJA 2LU2A 1GX5A 4CWBA 4ZN3A 3N28A 4NCAA 4YEAA 2DEIA 4J9NA 1DTQB 1OYDA 2PN6A 1FD2A 4Z7YA 1XMOF 4CLPA 1RT2A 4OI0A 4OI2A 4X62F 4FF1A 4XDCA 1VQYA 1P1TA 1JLAB 2C2RA 3V6HA 1W2BR 4WFNQ 2M52A 2A1BA 4C8KA 2UXDF 2HAIA 4HHHA 2J9DA 1KLNA 1FXDA 5LSOA 1SC1B 5LT5A 4OZJA 4DV7F 2XGQA 3FZBA 4IG0A 3UCGA 1WKJA 3NGUA 1SKUB 1MWZA 1KFDA 5ETLA 3G6YA 5J2MB 1HNXF 3B54A 4ES1A 5J2PA 4X4NA 1UWBA 1IKYA 1NMEB 4O4GB 4P72A 2MYFA 3KUGA 1TP7A 1I1GA 1Q5YA 1WKLA 5A8WA 2H3EB 5SUHA 3BGRB 2K2PA 3J7YI 2BRLA 1X31C 3JTNA 2I38A 4IFYA 2HHPA 3F73A 4LVOP 4YP3A 1YZ7A 1SH2A 2R8JA 2VHGA 2OFHX 2HBYB 1RWUA 4ZITA 5IQQA 3PRVA 2JBVA 4L72B 2P2CB 2LQ5A 1HD0A 3HXMA 3J80U 4Y2CA 2Q79A 2R8KA 5IV3A 2EFVA 2QTWA 1U1NA 4RWXA 2Q1LA 2AGOA 1QSYA 1FA0A 2QL7B 5KFRA 2K3KA 2FVQA 4O0NA 4JV2A 5LMNJ 3MI7X 2D74B 4JI7J 3EYZA 3OVBA 2YY3A 1BWVA 1R0AB 1IQZA 2HVEA 4G1QA 3RU0A 3KHGA 1CJTA 3TRGA 4MKVA 2QYGA 4G3IA 4J9SA 1TU0B 3EICA 3KLGB 1C1BB 1S1XA 4YN3B 2V4QA 3BO2A 3OUYA 5A2QU 4C9DA 3N5BA 3B4DA 1X4BA 1VR6A 3W5XA 2YVSA 5KOWA 3AXKA 3W62A 1HBNB 1HWLA 3W2WA 4K4SA 2W9CB 1IBKF 2NS1B 3UNYA 4RUHA 1QSLA 2EKYA 2HRUA 1APSA 2HIQA 4U7CA 3R9LA 3SSSA 4DPWA 3CD0A 4NLOA 4O3QA 1WDTA 2ZEJA 1CS4B 1J5OB 2MZQA 4DV4F 2P9GA 3AFGA 2V2VA 4YMEA 2G2ZA 1WORA 3QJLA 2BJDA 4U8VA 3F41A 1S97A 4N56A 4MYUA 3PG9A 2VQEF 3N6NA 4JUZA 2QLFB 3QGGA 2CG4A 1SKSA 4JI4F 4Q2LA 4LIRA 1Q7LB 2JXGA 3IM8A 2CXEA 5LMUF 3G71S 1JLFA 3K17A 4KGVB 1MYLA 1OO0B 5GAHU 3NLCA 1FDBA 4J91A 3SFGA 5KFSA 1RTJB 1HHTP 1CC7A 1WKKA 2X1BA 3Q89A 2A0FB 2ATCB 4PXDA 2N4CA 1GNKA 1FJGF 2U1AA 4CH7A 2OKQA 3PKYA 4CCHA 1B99A 3HSGA 5H9EK 3CCUS 1IJEB 1XJWB 3QATA 3HKWA 2NYHA 4LFCJ 1NCLA 4TKTA 5D77A 1UVLA 1YBAA 4WP3A 1U49A 2L41A 4UOFA 2RKIA 4KC5A 4IDKB 4KHRA 4LF1A 5D3GB 2E5LF 2A18A 2GW8A 3LP1A 3MCNA 3Q23A 4W98A 1H0HB 3QZ7A 3ILJA 3SQGB 2CG8A 1I94J 1FCAA 4ZVTB 1ARRA 1ZA1B 4DSIA 4Q44A 3L95X 3SYZA 2NLWA 4QR0A 3T9ZA 3FRZA 2WCXA 2DY9A 3DYAA 4F4YA 2R4FA 4EZ6A 3ICLA 1RYRA 4DU7A 3S7RA 4QIWD 1HBOB 4O3RA 4WK1A 3MEDB 3KK2B 4YB7A 9ATCB 2ZWOA 4ED0A 4EFAC 4AQYF 3UQSA 2VA2A 4M5DA 5FLXY 4M5JA 2X3DA 2YNIB 2MLZA 3AQPA 4MT1A 1S48A 3M05A 1IKWB 3AOCA 3RTVA 4FKXA 1PGZA 1PC4A 3EVOA 4DR4J 3KLHB 1U6FA 4U96A 2VODA 3EZ5A 3ZNUA 2DGUA 2A3JA 2ATLA 4JI1F 2LP4A 1YJ7A 1TZ0A 2ACYA 4WP8A 2WW8A 3HX9A 2K1RB 4F4ZA 4JI8F 1EKRA 2H5EA 1U1KA 4MFBB 3W9IA 1HWIA 2W2MP 1YX2A 5KFVA 4FNHA 1MROA 3QWPA 5AT1B 2AZ3A 1RT3A 1CEZA 2V34A 4RKUC 2LQJA 3PACA 3QO9B 2J9EA 3MPUB 1HL6A 1Z1ZA 1UA1A 2W24A 3QZ8A 2OD4A 2VC1A 2SXLA 3E01A 2DCUB 4K0KJ 2CFXA 2H4YB 4ECZA 1D3WA 2BOPA 2F4VF 3QQCD 3ZTPA 2F8MA 1PYTA 4DV5J 4IQXA 4DSEA 1UW4A 5C25A 2UP1A 3BDPA 4ECSA 1JLEB 4J9RA 2IFXA 2YQ1A 1N6QB 2E5HA 4QW8A 4MAKA 2LEAA 4GMKA 3TAMB 2EVZA 2R7SA 3KUEA 1QUPA 3IP0A 2VONA 3JSYA 5J1NA 1FKOA 1S6PA 2ZZMA 2F4VJ 4ZP9A 3GYGA 3GV8B 1NKCA 3FMBA 4M5KA 1VQLS 2V8PA 4ZK7M 4I6YA 3CD7A 4CLLA 3KK1B 1BC6A 4LFAJ 3SEOA 2W4DA 3IRWP 3UCUP 2C28A 1HBMB 4NXNJ 1RAIB 1VBKA 4B9TA 5C24B 1CLFA 3RAMA 3LP0B 1T11A 2CQ1A 3FQLA 2UUWA 1KC8T 3A8JA 2KYZA 2YH0A 3VEAA 3MMAA 4OZ0A 4GKJJ 2PD1A 3HP6A 3EVWA 1S1UA 2BNZA 2EFNA 5DQHA 2L08A 1L3KA 5HMXA 4F0KA 5E3AA 2XZWA 2M9KA 3C15B 2Q2KA 1VJWA 5H9FJ 3DRXA 3R5JB 2AW0A 4KKOA 1WHXA 4X4PA 3V81A 5HP1A 1SXLA 4PUOB 4IOAQ 1XQIA 2Q6BA 4URGA 3U7JA 3IFEA 1VQ8S 3LP2A 3R27A 4JYAJ 3PDNA 1X4CA 2HFVA 4A8SA 4C7QA 4QIFA 3C6UB 2WOMB 4F67A 1SH3A 3IM9A 2QX0A 1F2HA 1UVIA 2B0GA 2B8QA 2W9AA 3PW2A 3GIJA 1UPPA 2KXHA 2DXEA 4MK7A 2IVYA 4LSLA 5F8NA 2VDIA 2Y1RI 4Q2MA 4R0EA 2J8AA 1N0VC 1H98A 2RAQA 3W63A 4E98A 1H2VZ 2Y0BB 3FDSA 3PIPQ 2KM8C 5F8IA 1Q78A 3SSRA 1CJKB 2R9LA 2E66A 3LTOA 3PY8A 1QTMA 5IOLA 2BZ2A 3N6LA 1ZYQA 2K7KA 2BKPA 3PEHA 1YRUA 4CM2A 1SKRA 3HVTB 1A7GE 5EX0A 4USVA 2ZH1A 2FVPA 3S01A 3RAQA 4OZ5A 1RT5A 3GB0A 3TP2A 2MZSA 2NUHA 1FK9A 3IBWA 4QYZJ 2Z57B 3OTOF 5LSRA 3V6DB 4IUFA 2I8EA 4Q45A 4N41A 1YWXA 1S49A 4TNOA 4ZVHA 5D0GA 1NPKA 4WFZA 3DM2A 2H51B 4LRDA 4ERDA 5GMKa 2B7BB 5FD1A 4L74A 5BJRA 1SBRA 1NK6A 1FHTA 5HQLA 4XPCA 2EFGA 5KG3A 3M6XA 2RRBA 3GONA 3BSCA 3OTOJ 5EWEA 3M8RA 3O1LA 4O44B 1J5EF 4DPUA 4DX5A 1T9YA 3TO8A 1R0BG 4MTPA 1U1LA 4ZLJA 4ED3A 1VHIA 3M32A 3CJ2A 3O2IA 2CJAA 3TAPA 2RUGA 1JJ2R 1X9MA 3NGKA 4MIBA 3R7SB 4CLWA 4W92B 2U2FA 4I68A 2ZNYA 4WWSA 1HW8A 2C2EA 3MMCA 4F8RA 2B4UA 3CVKA 1FF2A 3T19A 1SC3B 1WC6A 1X5OA 4Y0FA 3PR4A 1ITPA 2BM1A 2ADCA 4WYWA 2DHSA 2F1FA 3A3NB 1RTHA 4OZLA 1WC1A 3K2YA 4TY8A 1JWWA 1YTYA 1U1MA 3CO9A 2AGPA 2HLTA 2E29A 3N79A 3MFIA 4H4MA 2HFSA 3CDEA 2E5GA 3H87C 3OUYB 3QGPA 3V2UC 4ZVPB 3J81j 3Q24A 1Y7PA 4WTYA 4LF6J 5HN0A 2GIFA 1RKIA 4UZCA 1IKVA 2KOEA 4XPEA 4O3PA 3ITHB 5FJ4A 2KM8B 2XCAA 5KFPA 2LDIA 2V4JA 2GCFA 3SXLA 3M2VA 3C2PA 3E8OA 2R8IA 1TVRB 1BD6A 4HACB 2VD3A 3F0NA 3G5OA 2QN6B 3DC2A 2NZCA 3T9NA 1AFJA 1TMJA 2DRDA 3B6BA 4JV0A 4PYAA 3ZXWA 3GJTB 3NKYA 1WJ9A 2CPYA 4K4VA 1JKHA 1FWKA 2V6AA 3MPWA 4OX9J 3GJRB 1PILA 5RUBA 4CYUA 3FEYB 4ZJQA 4B3TF 5I4MA 2OPPA 4PABA 3UR0A 4PRFA 2GFFA 2DHHA 1U2FA 1SVDA 5KAKA 4RNMA 3X1LB 2HNZB 3CC7S 4ZPAA 4K4TA 4RPFA 1DJ0A 3W60A 3H4DA 2NSCA 2CKWA 1VFJA 2FPHX 3QJPA 2QE5A 2K5JA 4F0HA 1H3DA 1TUGB 3MM9A 1Q8BA 2GV1A 5BR8F 1ZA2B 1T03A 3J7Z5 3MPYA 5BYSA 1RAAB 2GVZB 4OYXA 2V9KA 3MEGA 1MNEA 3MAAA 2RMLA 1JMTA 1RISA 4C8LA 2CDQA 4DV6J 1VMBA 4KJIA 2ZZTA 1XR6A 3DCAA 2N7CA 2QMUB 4C8YA 2XYGB 1FERA 3PJXA 3Q83A 1DLOB 3B82A 2IM3A 3HHEA 5HMYA 2FZGB 3A1YG 2B5JB 1BUXA 4CO4A 1OSCA 1YSJA 5L38A 4X66J 1T9VA 2HQFA 2DH8A 5FLXU 2HRYA 2EEYA 2EFQA 4ANDA 2MPUA 3D54A 3GU0A 4BS2A 2VG6B 3MTKA 2Z4PA 3HSZA 2DNRA 1X5PA 2O01C 4P2FA 4ENOA 3CW2C 2FYXA 5BYQA 4USWA 4JI6F 2C3MA 3ZNJ1 1RTDA 5KT2A 1VQ7S 3CIMA 3R97A 5U47A 5ETVA 3NGTA 2VOOA 1N34F 3VQSA 2MZRA 2HYIB 4YUDA 4NLDA 4ETXA 1F5AA 2C2DA 2APOA 4KHPJ 1FFSB 1T3OA 3OL7A 5AE1A 5DDRC 3SMZA 4K4UA 2AQ4A 2QA4S 2LYVA 3TVZA 4F04B 2YNGB 3BM7A 1TL1A 4P52A 1AUSL 2MLYA 4KFBA 2DO0A 5LSLA 1Q5VA 3NGRA 2UVUA 2AKWB 3BYPA 4J9UE 5J1EB 4B3MF 2NQPA 4BC7A 1KWMA 2GAGC 3D2WA 4OL8A 3NOGA 4B9SA 3VWSA 2RDIA 4HDGA 1OMSA 3TZYA 5CABA 4CLTA 4NWBA 3RB4A 2YNFA 2NZ4A 1PYOB 3K0JA 1UEKA 4TU7A 1WOSA 2QRRA 2XZDB 3O8WA 2POKA 3UO0A 1UPMB 4ZVQB 5C25B 2FZCB 3GWCA 4C0OC 5HSPA 2V63A 5LJ3Y 1H6KX 3PR5B 1U2CA 5JJBA 2FLOA 1JNRB 3KG0A 2WVCA 2XMWA 4HVZA 5L1KA 4ALZA 4USHA 1I6JA 1SJ4P 1Y3KA 1IKXB 4LF7F 1FKOB 3JYTA 2NPFA 3M30A 4ELTA 5H1SV 3SCLE 1D9FA 4WF9Q 1L5UA 2WVBA 2IVFB 2ZH4A 2M8DB 3TI0A 2UV8G 2DNKA 3E2EA 4KQZA 1TTHB 5HVHA 2J0SD 2Z58B 4OYOA 4CTAB 3I32A 2MJUA 2XSJA 2WTFA 3SZ2A 3TVYA 2C2OB 4RW8A 2MZJA 4KB7A 2EC2A 5IC6B 2LEPA 1CJUB 3SQOP 1B64A 5JUMA 2ZJPQ 2ZE2B 1REVA 3AA9A 4K5RA 4LSNA 1UVMA 2HHTA 2CQDA 2R2SA 5DG8A 2XY6A 2VFRA 2HHHF 3TAQA 4IO1A 3M1VA 3PRDA 1GK8A 4USTA 3SCJE 1CJVB 2JEGA 3FBFA 2EW9A 3SCKE 2UU9J 4NCGA 3KJQB 2ZHAA 3D3CJ 2HMIB 1S4EA 4DXLA 3TQEA 3MOJB 2KH9A 3VAGA 4XIUA 3CMES 1UVKA 5CZVA 2W7OA 3NS7B 2W4PA 2IMWP 3K89A 3GILA 4OYIA 1B0PA 2BJ9A 1IR2A 4QWEA 1W7WA 2RUSA 1QJHA 5D78A 5IZHA 2XS7A 2JHEA 1EAYC 3CNQP 5B0EA 3AB4B 1M90T 3EGNA 3J7A1 4X2BA 1YZ6A 4IOBA 3I0SB 2CA9A 2WSFC 3H59A 3I96A 3DFEA 2BW2A 3NG8A 2G1HA 1F5CA 3ILOA 2Z2YB 4QZVB 4KV8A 5E3PA 1K0TA 4TY9A 3BO3A 4F2RA 3OW2R 1LNQA 4DHVA 5KFKA 1NZ8A 3FBBA 3DI6A 4AL5A 4KGMA 2CNKB 2H5IB 3WIVA 3IG1A 1K1SA 2UXCF 5KFCA 4B3SF 5IWAF 2D3OR 2PO4A 2B7CB 2VFSA 2QFJA 1WC3A 4R0JA 4ECUA 2YX4A 2OI2A 1RT7B 5HBMB 3HT3A 4I2PA 3DM2B 3T1YF 2JJ4D 3SSQA 1G6BA 3IRXA 3OHBA 1O6XA 5GAEU 2QA2A 2PEHA 2HVZA 2I6WA 5CD4H 4GVBB 5CYMB 1S9EA 2VPYB 1HARA 2XNQA 1N88A 3M8PB 5KFXA 1XNRF 1QY7A 1RBAA 4K4XA 5JXSA 5KTQA 4XAKA 3M32B 2P6TA 4XO0A 1AB8A 3JSRA 4O3SA 3LWLA 2JFDA 4H4KA 3VGSA 5JMNA 2HAFA 4TLQA 3EX7B 4I56A 2FVCA 4ECQA 1LWEA 5BYRA 5ETPA 4OI1A 1EB0A 5K8PA 1C0UA 1LQ9A 5LOQA 1TL7B 1YBTA 4KH1B 2W25A 2RE1A 4DG1A 2AP6A 2COLA 3ZZUA 1XNRJ 3BGLA 2YXLA 3CCMS 1HYSB 1XR5A 4IRKA 3KJVA 4OYAA 2IC3B 2MDAA 2GJFA 3DHXA 4B3OB 1RTHB 1SL0A 1DQ8A 3HCXA 5GAGI 3C16B 5J2NA 2M2BA 3MAQA 2CPZA 2KYXA 2W4CA 3L7OA 1FRMA 4M5HA 2FY1A 1P1LA 1S9GB 4ZVGA 2V50A 3BN7A 3TJ9A 4UUXA 5E41A 4DL4A 2YKMA 3ADAC 1TL4A 1O51A 3L7PA 5B0FA 1RTIB 4Z2XA 3KOAA 1IKVB 4RLEA 4ATNA 1MSWD 4R5PB 4P74A 3QOQA 1FXRA 3FJ2A 2IY5B 3DRSB 4JV1A 3M2VB 1MW7A 4HH1A 4A8OA 4OJHA 2AJ4A 4DOZA 4HYKA 1OPZA 3DU6A 5CA5A 4BHQA 3A8KA 1S7IA 4ZPBA 5AJ3F 3UDCA 2M3DA 1JKHB 1OY8A 3TZXA 1EZZB 2WSCC 3E3XA 4ID5A 4TYBA 4JP8A 2AYMA 3DRRB 4CYUB 4N5SA 1P9QC 3NCPA 2IJFA 2HS0A 3UFCX 2CYYA 1HR0J 2DGXA 5H9EJ 4NXMJ 3Q86A 5KFMA 3GFHA 2XMTA 1FX2A 3MWBA 4J7CA 2PFDA 1NLKL 2HZAA 4FYDA 4A4JA 2FZKB 3OL8A 1S79A 3CCSS 3UR3C 4ZPTR 4JI0J 1VQOS 2F8EX 4U9RA 4F4XA 5E33A 4DV2J 1CSJA 5KFZA 4DR6J 4IR1A 3UVJA 1TR0A 2XB2D 1DHMA 1S1VB 3EPIA 3HHLA 5D0EA 2GMJA 3GLJA 1MG7A 4PZVA 1N32J 3NBPA 4A8YA 4LSZB 3MAAB 4AD6A 1YK9A 2XHCA 1E6VB 2EBEA 3CJ5A 3KG1A 2NYIA 3QSIA 4LF9J 2DK2A 1RCOB 1FNMA 1TKXA 1EP4A 1B0VA 5KT4A 4HV0A 4RW6A 1FVSA 5HATA 3P8BB 2XWXA 3L4BC 2CQHA 3FEZA 3PZPA 2W8LA 4JI2F 3NS6A 3TUIC 1VK3A 1IBLJ 2RF2B 1C4AA 1YGYA 3ZTOA 1YKWA 2CVIA 4NZ6A 2K3IA 1IJFB 1SV5A 1HD1A 2YQ0A 3EJMA 2E44A 1FDAA 1RB0A 3Q8QB 4F25A 1T9TA 3W2VA 1RWXB 1M5PC 5I3UA 5F3ZA 1RA6A 2DBBA 4ZLNA 1RHKB 1RE1B 2JVRA 2YKNA 2WONB 2OFGX 1Y00A 2YQ3A 3HPOA 1IXKA 1RU2A 4DV0J 2NSBA 4LFBJ 1Y5LB 4AL6A 1HQEA 4RO0A 2EXUA 3H42A 2ZBRA 4P71A 2JX2A 1GMVA 4X4TA 2HGNA 2BX6A 3QLHA 5J1PA 3G96A 1P94A 3TX0A 4HTIA 4MKYA 4NYPA 2RQ4A 4EBDA 5JVGQ 2O67A 2VICA 5C42A 1KEKA 2I9SA 1S57A 2C22A 4ICLA 5HQ8A 2DIVA 1LWFA 1B4SA 4I2QA 2I1RA 1VLOA 3KLEB 4KBIA 3H20A 3MEEA 1WC5A 2J6SA 2IDEA 4WXWA 4MYTA 3MEKA 3PHTA 1EKSA 3K5NA 3POTB 4FBUA 3TARA 3MR6A 4ID8A 3T1HF 2K8GA 1JLBB 5KT3A 4PAAA 3UI3A 3GMGA 1SIWA 3NNAA 1WDDA 5CYQA 1VGYA 1HNWF 3BPDA 4KGKA 1N5YA 1I5OB 2GIRA 3N01A 3A3OB 2MQLA 1RACB 1YLXA 3L7UA 2WHOA 3PRBA 4JI5J 3P5BP 1URRA 4YY3F 4BC9A 1FVQA 3M30B 2G0IA 5HAOA 2GMLA 2Z56B 3LGHA 1PG5B 1S1TA 1Q53A 3GIMA 1XN9A 3X3UA 3FCVA 3D5MA 1NJYA 1W2IA 1JLAA 4V19J 4NA2A 1N36F 2KJWA 4N76A 1K8AT 1T9UA 3CCLS 3MM6B 2LEBA 1BQXA 4B08A 3PW7A 4B3RJ 3MCSA 5J2MA 2DGSA 4K4ZA 2XEXA 4DBQA 4PQUB 3NL0A 4O4GA 2CPEA 1T3NA 1REVB 1KD1T 2WB4A 2A2CA 1BLUA 5ADZA 5ETSA 3D1OA 1T94A 3RBEA 5IT9Y 4UTGA 1S4FA 4DZ6A 4AT1B 1U8SA 4OJ3A 5CD4A 3IXQA 3W8PA 1UVNA 3EGWB 3V6JA 4Y00A 2VU5A 3C19A 2WVDA 2OUGA 1NPPA 3ZZ0A 3RBXA 1K44A 1UWAA 4QIGA 3VAMA 3PIOQ 4BWMA 2GMHA 3LOUA 3MZIA 3DN9A 3M6WA 3FCWA 3GFZA 1KTVA 2QJ3A 2RB7A 3P3DA 1LXJA 1VIXA 2R2RA 3GV7B 5AXKA 2BVZA 1HMVB 1R0AA 1NK5A 4D3GA 3V6KA 3MDFA 3DDNA 2VJUA 1FWPA 1WI6A 1FKAF 3KLGA 3DXBA 1C4CA 1C1BA 1F1BB 2MZTA 3PYGA 1NLAA 1RAHB 2VBXA 2VL1A 3ISND 2HVHA 2OAUA 3DKDA 2QSWA 4NLWA 3CTRA 4QWCA 1XWLA 4OV1A 4DCPB 1NSKL 3BQ2A 2M0GB 4EBCA 1RWMB 1HBNA 1PYSB 2W9CA 2AX0A 3O5TB 1TFYA 3R7BB 3DDKA 2X1AA 5B0BA 1FWLA 3K59A 4J37A 2H4WB 1KTQA 1NH8A 2BA3A 2KU7A 2ACMA 1HNZJ 1T05B 4QU7A 1X5SA 1CS4A 1J5OA 3A12A 3C46A 3MUVP 1TAQA 1MMNA 3DOLB 4IFVB 4QW9A 2I0XA 3LJPA 2W9BB 1TKZB 1GXLA 4C8ZA 5K14B 3D3BJ 3JSMB 2OHDA 3FBCA 1WEXA 1BQNB 3QFWA 1JB0C 2Z2LA 2GO8A 2N3LA 1DZ5A 4KRWA 4I2PB 1UTAA 1PKUA 1ZM2A 3M4XA 5GAGU 2CJ9A 4TQRA 2CJQA 3H25A 1R8PA 3PJWA 4WU2A 3V4IB 4QU6A 2FQQB 1RTJA 3DOMA 4F50A 1HWKA 4QOTA 5E2QA 3Q8PB 5A6WA 3AJ1A 3I9ZA 1VC5A 3FMTA 3K5LA 3AOBA 2Q43A 2HHQA 2OPSA 3T41A 1ZPWX 3DLJA 4NCBA 3O6QA 3HZEA 4J9KA 5C2CA 2EK1A 3HMJG 4DG1B 2UVRA 1HFEL 2WBMA 1KHWA 3G6XA 3DNCA 3EMTA 3MXHP 2MQOA 2MXYA 4QR1A 2IMOA 2ZKTA 5E0OA 4IDKA 1X0PA 3FSIA 1NNDA 4WCEQ 1D1UA 3RG6A 5GAHI 1SUQB 2ZVIA 2AU0A 1SL2A 3C3LA 2ZC4A 4LQ3A 4C4WA 3LPEA 2XMUA 3SQGA 1CULA 1TAUA 1BWEA 1YJNS 3IO1A 2VG5A 3G2XA 2OPQB 5F8HA 2YKMB 1KP6A 2L48A 3BSNA 1TK5A 2WBRA 2IBOA 1FXLA 1S6UA 4O4RA 2EKNA 2F3JA 4NMXA 3ZZOA 1RWOB 4IO9Q 5CZXA 2OPRB 1ZH5A 2OJ3A 1RHMB 3AT1B 1HBOA 4ES2A 1SL1A 2DNQA 4NLRA 3MEDA 3N9UC 4B17A 3FVYA 3KK2A 1G2EA 1X4AA 2R8HA 4X65J 3PVXA 4CNYA 1VC0A 2BM0A 2BE7D 1Q7YT 2EFPA 2BYCA 3DLBA 3CE8A 1HA1A 4RL1A 4DF4A 2F65A 3EZOA 1QD1A 2HQ3A 2ZH7A 4NLUA 4IR9A 2L3MA 3P96A 3IWLA 3NWRA 1N5VA 2AT1B 1IKWA 3IAM9 5BXIA 3D7SB 4DFKA 2VPZB 3TQ1A 3LALA 3FFIB 4Q8EA 3KLHA 2HEKA 3LGNA 3CPWR 3QJJA 2Z0GA 4IQMA 2OO4A 4K5SA 1RABB 2VQFJ 2D3O1 3JB9k 5D4PA 1FTRA 1QVFR 1UEVA 3TVKA 2K1RA 3UWTA 1O0PA 2JEFA 2FC8A 3JSBA 4MFBA 3K5MA 4DL2A 4CLKA 4C98A 5JVHQ 2VV5A 4RBUA 2LU1A 4NASA 2O5DA 2N4DA 3QO9A 2ZM6F 3DU5A 1UW9A 3FRYA 4DQQA 4FF4A 2DJWA 2DGQA 3RGIA 3HHLB 3T6BA 3CDUA 5CHCB 3H7HB 1Y5NB 3NBPB 2E7XA 2GAHC 3FC9A 1NSQA 4NLYA 6FDRA 4DUZJ 3QMQA 1JLEA 4P7TA 1N6QA 5FDLB 4LBIA 2XWYA 3MM5A 3H8YA 3TAMA 2XQCA 1OG7A 2ZDOA 1UP1A 4WXOA 1TKXB 1LK7A 1MNTA 1QM9A 2FHOB 3G9CA 3KDNA 3WX4A 1EP4B 2D7SA 2MLXA 2FHJD 5IQ6A 4F3QA 1A9NB 1U02A 3AQOA 2BANA 2VA3A 2BRKA 2ZH8A 3A13A 4J9QA 2W7PA 2PC6A 5CYJA 3CDWA 4RR5A 5DDPC 5HJXA 2XO7A 1FKPB 3R6LB 6FD1A 4LQ9A 3OLAA 2AN7A 3WQPA 5AXNA 4NRTA 4ANCA 4NLVA 2LXUA 2ZOMA 1HBMA 2IHR1 5C24A 2ZUGA 3W2VB 5I3UB 2B9WA 1FO1A 5KFHA 3GP9A 3MCOA 2NREA 1EA4A 2C3PA 2MHEA 5DZ6A 5HL7Q 3PNIA 1P27B 2G0JA 4ZPCA 4CO0A 2NUUG 1S72S 1LK5A 1SCJB 2I5JB 1RAFB 4LR9A 4JI3F 4OFZA 1XMQJ 3DMJB 3CEDA 1VBZA 1WTFA 5THWA 4TN2A 3C15A 2HGMA 2OSRA 2KZZA 1I51B 3QGHA 4MIAA 2J0XA 5F8MA 1LFWA 3D1HA 1KVIA 2ZJQQ 2DNYA 3QLHB 1FJ7A 1YBUA 2VFTA 3OTEA 4PUOA 1VRTB 3OD2A 4YFUA 3MCMA 1R27B 2OMLA 4LIWA 4KTQA 1ZM9A 3C6TB 5DLFA 4J5OA 2GVDB 2GZOA 1WHYA 2IRUA 1RBOB 2R2TA 3FCHA 3QIPB 3QGIA 4LF8F 3HHKA 1N56A 2WK4A 2ALZA 4Y2KA 4LR7A 2WOMA 5GMDA 3OR2B 2HWIA 3JQKA 2KHCA 4PKDB 2QFIA 3MM8A 2IA6A 3IGNA 3UE2A 1FDDA 1OYEA 2V8DA 1NDLA 3HVAA 2KRRA 2OD6A 3HFVA 1TK8A 4L76A 4JV5J 4C48A 2ROEA 4PG5A 3HVWA 2LMIA 3NXZA 3ZZPA 1Q81T 1CJKA 2M70A 5DQGA 2XTJP 2AJFE 3OFGA 1RAJA 2G2OA 2JEJA 3RR8A 5C2GA 5M2UA 3HDSA 5HK4A 1YVFA 2R7UA 2XHWA 3N4WA 2BJ3A 1VBXA 3HVTA 3BZQA 4M95A 3DLKB 2AF6A 2UV8A 1FNXH 1C0TB 3KUHA 3J81Y 5EWFA 3OTCA 1N33J 4EWTA 3LGMA 4MKAA 1S1TB 2G4BA 3V6DA 1U1RA 4BWJA 2RT3A 5ETQA 2BKOA 2IBKA 5KG7A 2CVEA 1UZHA 4AXJA 3FUYA 5IT9U 2CDRB 2WRMA 3NGSA 4USUA 4NLPA 5KG6A 3KYLA 4C3KA 1DQ9A 3EWGA 2B6AB 2BUNA 2KXFA 5F8LA 1RCXB 2J8SA 3H5SA 1Q16A 4DV1J 5I3QA 3H40A 4CH1A 1R3NA 1NXIA 2CZ9A 4O44A 4Y34A 2OSQA 4HDHA 3PO4A 1GXUA 2GHPA 5EUHA 2NXUA 4HR2A 2V4RA 1IM4A 3VZIA 4GKKJ 2F40A 3BPSP 1RLCL 4DR2J 2WB1D 5LMNF 4NYZA 4JI7F 4KSEB 1KFSA 1RADB 1LWCB 4P75A 4A8FA 3H98A 1U1PA 3UD5A 3CDAA 2CPHA 4UT4A 3RB0A 1N48A 3R5AA 4CO3A 4I6WA 1U24A 4LF4J 1WHVA 3Q22A 1XNQJ 3H0PA 1IR0A 1YJVA 4NX9A 3Q2SC 2ZOGA 1IRQA 1NJZA 1SC4B 1RT1B 3KLVA 3BB5A 4TQSA 3GPAA 1FDNA 3GSDA 3TX8A 5CXTA 1FJCA 1ZM4A 1LFPA 2IM1A 2FD2A 4DJBA 2BE2B 2W2PP 5HVGA 3FT7A 1LEOA 2P6SA 2PMWA 2B56A 4TYAA 2PDAA 3ITHA 2XLIA 3VGUA 1HLWA 2MQPA 3CJKB 1ZAXA 3OFEA 4LF5F 5ETMA 4WIIA 1TVRA 1Y10A 2IAJB 2J9DE 4HACA 4NLGA 4B9MA 1RJJA 1R8CA 4R25A 1F60B 1UFKA 4WK3A 3HFKA 5HI7A 2HWTA 2HS3A 2DNGA 4YB1P 3N0VA 3GZ7A 3UDLA 4LF5J 3VAKA 4OI6A 2ASDA 1S0VA 4PWDA 2J76E 4UQTA 4YS2A 1GMWA 1ROFA 5GADU 2KG0A 1QTNB 2HNZA 1A0OB 4LFCF 2MMYA 1QAYA 2XBPA 4TU8A 5GMEA 3I55S 2UUCJ 3DOMB 4ZCMA 1TFWA 1SC6A 1K73T 4LMZA 1BDTA 3AODA 3R7NB 1U26A 5H9FK 3GJQB 3LANA 3EDRB 4F26A 3TR5A 2JXIA 1KHVA 2OPSB 1Q8LA 5T7LA 2W2OP 2YWGA 1FFWB 4DMZA 2QMXA 3KLFB 3RJMB 3GFYA 1VYAA 1ACMB 3CB4A 2GVZA 1I94F 3HO1A 1T9WA 1KLMB 4K50A 4ZVRB 4GVLA 4I4BA 4DLEA 1YIJS 5KFFA 1C2PA 3BKUA 2B51A 3THTA 3I56S 1N54B 4ZPVR 1DLOA 2V2KA 2N3OA 1KQFB 3VCDA 4ZVUB 5KFDA 2LECA 1Y0HA 2FVSA 1VQ6S 2QLJB 1CULB 2B5JA 2AY0A 1PCAA 1NKBA 2DCLA 3SCIE 3D0HE 4OHWA 4ZS6A 2R7TA 1OQ3A 2VG5B 4KPYA 5K8MA 2UXBJ 2OMOA 1VQ4S 1NUEA 1RAOA 3OFHA 2DNMA 1P6TA 3GV5B 3IS9B 4AAIA 1X9WA 2FJWA 2EFOA 3TOQA 2JL9A 2RS8A 3D6HB 2VG6A 3DLHA 3WIUA 1EETA 4DR4F 1R6YA 2XNRA 3PW0A 3TZZA 3CIZA 1VDHA 2DT9A 2M7SA 3D9BA 4C11A 2VJVA 1WEZA 2AJQA 4DPTA 1U25A 4C6AA 2DYAA 4R8UB 4N8NA 1EJ7L 4ZPWR 2QA4G 2ROPA 2MY7A 4C0BA 1CPZA 2QL9B 1WF2A 4DL6A 4W4MA 3I31A 1GX6A 1KVKA 4DUYJ 4EMDA 1KQSR 3I5BA 1KVJA 2X1GA 4OX7A 3ZZRA 4DSKA 4B9LA 1BXNA 4OZ2A 4CLSA 4A8XA 4K4YA 5CAAA 2ZJRQ 2YNGA 4K0KF 3PFEA 2CZVC 4UUWA 1GTEA 4Y3CA 1YITS 3AY0A 5B7WA 3NNCA 4DV5F 4WJBA 5J1EA 3GIIA 2J0WA 1P8GA 2C1EB 2PA3A 2AEJA 1YQHA 1H2UX 1Y3JA 2DR6A 1WACA 2P8IA 3TJ8A 4KY3A 2IA0A 2FGCA 4IH7A 1VI7A 2E9TA 2Q6CA 1KOOA 1X9SA 2MQMA 5KT5A 5M2RA 4DQRA 3QYYA 1MN9A 3GYNA 3D4JA 2KL8A 1YJUA 2C42A 5DRKA 1TV6B 1RA7A 3Q2TC 3T3FA 1ZS6A 4ZP8A 1RI7A 2LDYA 4EYIB 4U8YA 2OTJS 4WFBQ 4F2SA 3U1MA 4YQWA 3MM5B 5EX3A 2XS5A 4LFAF 2MQQA 2C2KB 2H3AA 4NXNF 2X3GA 3Q8SB 2P9EA 1SI9A 1IKXA 4OHZA 4RJVA 1F0XA 3A8EA 2DVIA 5DZ7A 3OLBA 3ETMA 1AT1B 3RAXA 5A2QY 1Z2ZA 1FRXA 2BANB 4MH8A 1FFGB 1S6QB 3BBFA 1W25A 3OL6A 3RR7A 3OTDA 3ZTQA 4GKJF 4DR3J 5F8GA 1KDNA 1UA0A 2GPEA 4DV3J 2HKEA 3TYTA 2GHWA 3OHAA 1BMQB 4CDIA 4CTAA 4OLOA 1X0FA 2XLJA 1S1WB 3SIPB 2CPJA 4L3NA 4A8WA 3NEKA 4PG4A 4M5GA 5F0UA 2KKEA 1CJUA 3AOAA 2E7WA 1M5HA 4AUKA 2ZE2A 3JQJA 2JC1A 4NL5A 3D6TB 2F7VA 3C8YA 1WI8A 1ZZNA 2LQBA 1LOUA 4JYAF 1XK8A 2ZBCA 3CCQS 2QO3A 1RT6B 1OY9A 4WKYA 1YG0A 4CLYA 2DNHA 5B0GA 3AHPA 1RKJA 3DLEB 2PIIA 5HMWA 4K8RA 2XYHB 5K9FA 1CJVA 2ZNZA 4RW9B 5A8KB 3WC2A 2R3VA 3IMQJ 5T41A 2CQ0A 2HMIA 2VDHA 2CQCA 2MEWA 2V2ZA 2WSEC 1NO8A 1M5KC 1F9HA 2ABYA 2Y1LB 4LR8A 3NO7A 5F8JA 9RUBA 4CNZA 4DR5J 4CO1A 4OZNA 4DL3A 2MHNA 1BDVA 2R8GA 2AJ2A 2BNWA 4OHYA 5DG7A 3MM8B 3AAWB 2RNEA 3PYEA 4FF2A 2HQIA 3H2VE 2GC8A 3FBEA 5EWGA 1T0TV 2PI4A 4ZVOB 3I0SA 3J81U 1CQNA 3EGZA 3J7AN 2BV3A 4PXEA 4P6QA 1TKTB 5B0DA 1Q0NA 4XTTA 2RQKA 1QAJA 2L9NA 1ZTTA 3FZ2A 2FDNA 4RW7A 3BQ0A 5KT6A 3G6VA 2AWZA 3QWUA 1PJ6A 3OSNA 4A8MP 4DR1J 1OIAA 2B9YA 1NDKA 4PQAA 5KFWA 2BE9B 2PMZD 2FTRA 2EG1A 1RHUB 4NRUA 2VBYA 4RZRA 3W8GA 3D0IE 4ES3A 1RP5A 1RT7A 5HBMA 4JBCA 1Y11A 1GTHA 1X4EA 4K2XA 3MD3A 2J5AA 2W7AA 2AX1A 2FJVA 3N5FA 3RZAA 2XI2A 3CCJS 2LA4A 1UEUA
chains in the Genus database with same CATH topology
2FGCA 3QSIA 2BA3A 2KELA 4FXEA 2JXIA 2WVDA 2JXHA 2WVBA 1PARA 4HV0A 2BJ7A 3H87C 2BJ3A 1Q5YA 2CAJA 1ARQA 1P94A 1Q5VA 3LGHA 2BJ9A 1MNTA 2K6LA 2CAXA 4D8JA 3VEAA 2BSQE 2K5JA 3OD2A 3GXQA 2HZAA 3BKTA 3BKUA 1QTGA 3VEBA 3BKFA 2K1OA 2PC6A 2BNZA 1U9PA 2CA9A 3QOQA 2K29A 1IRQA 3PHTA 4ME7E 1NLAA 2AY0A 2K9IA 2Y3YA 1X93A 2RBFA 2BJ1A 2WVFA 2HZVA 1MYKA 2GPEA 2NZCA 3VW4A 1B01A 3FMTA 1BDVA 1BAZA 2WVCA 1B28A 2F1FA 3FT7A 2BNWA 2CPGA 2JXGA 2CADA 2H1OE 1EA4A 1MYLA 2WVEA 1BDTA 2BJ8A 1ARRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGC A;  3QSI A;  2BA3 A;  2KEL A;  4FXE A;  2JXI A;  2WVD A;  2JXH A;  2WVB A;  1PAR A;  4HV0 A;  2BJ7 A;  3H87 C;  2BJ3 A;  1Q5Y A;  2CAJ A;  1ARQ A;  1P94 A;  1Q5V A;  3LGH A;  2BJ9 A;  1MNT A;  2K6L A;  2CAX A;  4D8J A;  3VEA A;  2BSQ E;  2K5J A;  3OD2 A;  3GXQ A;  2HZA A;  3BKT A;  3BKU A;  1QTG A;  3VEB A;  3BKF A;  2K1O A;  2PC6 A;  2BNZ A;  1U9P A;  2CA9 A;  3QOQ A;  2K29 A;  1IRQ A;  3PHT A;  4ME7 E;  1NLA A;  2AY0 A;  2K9I A;  2Y3Y A;  1X93 A;  2RBF A;  2BJ1 A;  2WVF A;  2HZV A;  1MYK A;  2GPE A;  2NZC A;  3VW4 A;  1B01 A;  3FMT A;  1BDV A;  1BAZ A;  2WVC A;  1B28 A;  2F1F A;  3FT7 A;  2BNW A;  2CPG A;  2JXG A;  2CAD A;  2H1O E;  1EA4 A;  1MYL A;  2WVE A;  1BDT A;  2BJ8 A;  1ARR A; 
#chains in the Genus database with same CATH topology
 1GFW B;  4UZB A;  1Q16 B;  3ILL A;  4UY8 T;  4GVB A;  4IOC Q;  5CYM A;  3FNN A;  3M8P A;  3CJ0 A;  4RUA A;  4WE1 B;  3PV8 A;  2ZBQ A;  4M94 A;  4LRE A;  3M8W A;  1BQM B;  1RXO B;  2WW4 A;  4KO0 B;  4MIW A;  1QE1 B;  4D8J A;  4EO6 A;  2N82 B;  1JLQ A;  1MLA A;  3EE3 A;  4ZCI A;  1TL7 A;  1D8Y A;  1IWG A;  2R2U A;  4ED4 A;  2C3Y A;  2VFU A;  1RT4 A;  2ZZN A;  1HYS A;  3QID A;  5KFN A;  4B9V A;  2IC3 A;  3UD3 P;  4LF6 F;  3W7B A;  1H38 A;  4B3O A;  5DQI A;  1ZPV A;  2OEM A;  3C66 A;  3H2L A;  1SJ3 P;  2E1M C;  2OEJ A;  5GAE I;  3C16 A;  2WVF A;  4DL5 A;  2J7W A;  1U2R A;  3MR3 A;  1U0H B;  4QPT A;  4DFP A;  1S9G A;  2J7U A;  1YRX A;  2YKA A;  4KE5 A;  2D69 A;  2HND A;  4K2J A;  2VC0 A;  2JFK A;  4HT7 A;  3R5B A;  3W5Y A;  1RTI A;  1FJE B;  2DNN A;  3SDE B;  2AJ0 A;  5A0Y B;  2CNN B;  4R5P A;  1PAR A;  2W1B A;  4OX8 A;  4C3L A;  1N52 B;  2V9W A;  3PKM A;  5HLF B;  2FC9 A;  3DRS A;  2HRT A;  4OX9 F;  5AXL A;  2ZH2 A;  4JOU A;  1GEH A;  4DCO B;  2CPI A;  3MFH A;  2HWH A;  3I4H X;  5E3C A;  2JLE A;  3DGV A;  2ZBP A;  1KSP A;  3PHE A;  5D4O A;  1HQ2 A;  1NSP A;  1MN7 A;  4DF8 A;  2NXJ A;  4M1K A;  2RU3 A;  3MR2 A;  1R6V A;  3CC2 S;  3VAH A;  2G13 A;  1NEE A;  2ASJ A;  2C2Z B;  3I82 A;  4DZD A;  4F7V A;  3ENV A;  2RBF A;  3GE9 A;  4U6P A;  2DY1 A;  4YDX A;  2VKR A;  1PBU A;  3DRR A;  3QT5 A;  4PWD B;  4ED8 A;  2DPJ A;  2HK2 A;  1NK8 A;  4C8O A;  1X4G A;  2QL5 B;  5KFO A;  5D0R A;  3T5H A;  4F3O A;  1Q95 G;  3R6G B;  2CPX A;  4KT0 C;  2OP5 A;  1WF1 A;  3FQK A;  4UOG A;  5HRO B;  4OZ3 A;  1CVJ A;  2VOP A;  1GMU A;  3CCT A;  1JNZ B;  2KI2 A;  3VAL A;  4DV6 F;  1XEZ A;  4ZLL A;  2DTJ A;  3KTQ A;  2FJE B;  3OL9 A;  1NK0 A;  2EWH A;  3VTI A;  2DNL A;  3TEG A;  3OQ2 A;  5T7L B;  1S1V A;  3M2R B;  4F4A A;  1OSD A;  3ZFV A;  2W2Q P;  2H5J B;  3QPI A;  2AIR B;  4YHH J;  1DUR A;  2M88 A;  4DR7 J;  3UD4 P;  1E6V A;  4X66 F;  2VBZ A;  2DEJ A;  4I7F B;  2KN4 A;  2YWF A;  2XSF A;  4PG8 A;  1OHN A;  1EIY B;  3OVA A;  2RDJ A;  2IM2 A;  4ME7 E;  2NXC A;  1D8Z A;  1JXE A;  4EGL A;  1V6H A;  3DXS X;  2JLF A;  1B3T A;  1B0T A;  3VAJ A;  2CQ2 A;  3WC0 A;  1S99 A;  1VQN S;  3ISN C;  1RGV A;  2ILY A;  1G1X A;  3BGU A;  5GVQ A;  2QYC A;  1Q79 A;  3CDB A;  1FE4 A;  2J6T A;  2R7V A;  2RF2 A;  3CXC R;  2MKK A;  3GJS B;  1LXN A;  4ELV A;  2CPF A;  1VRQ C;  2BQR A;  3DHW C;  1EET B;  4F36 A;  1UVJ A;  1F9E B;  2Y1J A;  4ECV A;  1RAE B;  4KHP F;  3I6P A;  2ERR A;  2MKS A;  2XMV A;  2XZT B;  1FES A;  4OI3 A;  1XMO J;  3DRY A;  3UN2 A;  4X62 J;  4C11 B;  2MQN A;  1H73 A;  5A8R A;  4C97 A;  1U48 A;  3GXQ A;  4CIO A;  3M9M B;  1UCN A;  2YWE A;  1CBK A;  2WON A;  3W5Z A;  4B9N A;  1DY3 A;  1U9P A;  2HFZ A;  3R5D A;  2UXD J;  2PEB A;  4HHJ A;  4PCQ A;  4ZP7 A;  1JQG A;  3OVS A;  1Y5I B;  2CJK A;  2IDL A;  4DV7 J;  4NLT A;  4PYD A;  2YNH B;  3R5G A;  4OIX A;  1HNX J;  5KOX A;  1R31 A;  2CQP A;  3KKF A;  3LF0 A;  4HHU A;  2IJN A;  2F8H A;  4NOH A;  2C2N A;  4HTJ A;  1S10 A;  2DRA A;  5D4N A;  3M8Z A;  4U7U D;  2CPG A;  2H9Z A;  3KWM A;  3P5T L;  3CGI A;  3TZW A;  3IWN C;  3THP A;  3I0R B;  3ET6 A;  3ZC4 A;  3KLE A;  1X8D A;  1RQ0 A;  3BDE A;  2KG1 A;  3PX4 A;  3D1Q A;  3Q0A A;  3POT A;  1U8W A;  4LRF A;  1XMB A;  3I4P A;  3AD8 C;  2QGF B;  1JLB A;  2ZD1 B;  1N4L A;  1H7W A;  4IG3 B;  4K4W A;  4TLR A;  1TL3 B;  5KT7 A;  2BBE A;  3UDE A;  4HL9 A;  1MML A;  1CG2 A;  2E9R X;  2DH7 A;  3Q8R B;  4WPA A;  1HNI A;  2CQG A;  4FS2 A;  3HKZ D;  4CZC A;  1JLC B;  1WG5 A;  4L73 A;  2BDP A;  4J9L A;  2NXE A;  2HS4 A;  2HBR B;  1HKA A;  2DRB A;  1OWX A;  3RRG A;  3CMQ A;  1IBK J;  4P7V A;  2WVE A;  1FRH A;  2PA8 D;  4FZV A;  2QIF A;  4FF3 A;  1SKW A;  2PMH A;  3NP5 A;  2PSZ A;  3MM6 A;  5D4L A;  3NMA A;  3DGP B;  1UJ5 A;  3SV3 A;  3ZZZ A;  1EX8 A;  2YBV A;  1T7P A;  3M8S A;  4ELU A;  1VC6 A;  4DV4 J;  3OBI A;  4PQU A;  2FJX A;  2UU9 F;  4F0M A;  3Q8V A;  3EDQ B;  2W01 A;  2MGZ A;  2HNY B;  2JDJ A;  1H2T Z;  1PJ7 A;  2VQE J;  1PBA A;  2K1O A;  4QBU A;  4JI4 J;  2RVJ A;  3G82 A;  4RU2 A;  1RHQ B;  3KHR A;  2DNZ A;  1HWJ A;  5LMU J;  4NEY A;  1RLD A;  1WWH A;  3HUL A;  4OYW A;  4QJV A;  4Y2M A;  2KVI A;  3IWX A;  3CD6 S;  1S7H A;  1DRZ A;  1AZS B;  2XI3 A;  1S5Z A;  3IBC B;  3W65 A;  2D3Z A;  1NJW A;  2G2Y A;  3LH2 S;  3TWZ A;  1N8R T;  2CNO B;  1S0O A;  5EHH A;  4Q0B B;  2OGU A;  2RRN A;  2BJ8 A;  3JTP A;  3BF4 A;  1FJG J;  1WSR A;  3DOK A;  4G1I A;  4A8K A;  1WC4 A;  1HMV A;  4NZ0 A;  3IC1 A;  3KJN B;  4WFA Q;  2EK6 A;  2YKP A;  2W2N P;  1RK8 A;  1H74 A;  3EM1 A;  5L9X A;  4U7U K;  3OR1 A;  3CJS A;  5DET A;  5G0R A;  5IV4 A;  1DFD A;  1PAU B;  2MSS A;  1BE4 A;  4EK2 A;  1EHW A;  2EG2 A;  2E5L J;  3H5U A;  1RU1 A;  4ILM A;  4RBV A;  1Q8I A;  4MMO A;  5F0W A;  3BKT A;  1JLG B;  1R8A A;  1FRK A;  2GA7 A;  2E5I A;  3DRP B;  2YPY A;  2VG7 B;  4F4W A;  4RW7 B;  4ZA1 A;  1RWN B;  2PGC A;  1T05 A;  2NCK L;  1CQM A;  5K5M A;  1LW0 B;  2O3D A;  1ULR A;  3RUB L;  3H5Y A;  2GQ2 A;  3DOL A;  4IFV A;  3AB2 B;  3BYR A;  2W9B A;  1TKZ A;  3V4M A;  1SQG A;  5K14 A;  3JSM A;  4USJ C;  1HI1 A;  2QLB B;  1BQN A;  4AE5 A;  4DN0 A;  3ZZY A;  3CJ4 A;  3FK4 A;  1Z2L A;  1F3F A;  4EYH B;  5ETO A;  4KIA A;  2Y1I A;  3QSY B;  1UET A;  2HIY A;  5KFU A;  1LW2 A;  2HBQ B;  3M6V A;  4AQY J;  3BGO P;  4PWU A;  3VAF A;  2V0N A;  4WTO B;  2YKQ A;  3V4I A;  1VRU B;  3BO4 A;  4WIQ A;  3PYD A;  2QT7 A;  3PX0 A;  4HI1 A;  2E5J A;  2B43 A;  1U4B A;  3LWM A;  3PCO B;  4DPY A;  2B3T B;  1EAR A;  4JI1 J;  4RWW A;  1HHS A;  3HJF A;  1D9A A;  2BMB A;  2XY7 A;  1JLQ B;  4IKA A;  2AMC B;  3KHH A;  5AE3 A;  4JI8 J;  3LW5 C;  1DTT B;  2VH7 A;  3P49 B;  2GHV C;  1RT4 B;  4GC6 A;  3DLG A;  2D41 A;  1M1H A;  4G1P A;  2VF3 A;  2A2D A;  5T14 A;  2YTC A;  4ZOS A;  1WC0 A;  3HF5 A;  1HIY A;  4DSF A;  4I0W A;  5D15 A;  1M1K T;  1SUQ A;  1HWU A;  3QNW B;  1AUD A;  2VZ9 A;  5IXU A;  4OMF G;  3T5L A;  4MJK A;  3TUJ C;  1RAG B;  4LRB A;  4Z37 A;  2ZH5 A;  3IR7 A;  4OHX A;  3UW1 A;  2BAB A;  4RW4 A;  2HND B;  5I42 B;  2A6O A;  2OPQ A;  3KLI A;  3E51 A;  7FDR A;  3HHN B;  5KFA A;  2ZH6 A;  1JIH A;  2YWH A;  4RUB A;  3M2U A;  4ED5 A;  1NK4 A;  4NLX A;  1URN A;  2K6L A;  2CAX A;  1GT8 A;  4N47 A;  2RH3 A;  4UF4 A;  4A48 A;  1CC8 A;  1G4C A;  3IBF B;  3B4M A;  1PO6 A;  2DGT A;  3KNG A;  2OPR A;  2VIH A;  3NNE A;  4EO8 A;  1YI2 S;  4OHV A;  2E1R A;  5EN1 A;  1YJR A;  3LAK A;  2JC0 A;  2FB0 A;  1UJ6 A;  4P2X A;  5DDQ C;  1VCT A;  1BHN A;  1ZAV A;  1VLY A;  3MGJ A;  4E2F B;  1HR0 F;  1U1Q A;  4NXM F;  1AFI A;  3JQM A;  1X93 A;  2ROG A;  1S77 D;  5K8N A;  2HZV A;  2CWK A;  3S6E A;  4TVA B;  1MYK A;  4ZLP A;  1N0U A;  1AXQ A;  1HI8 A;  4YB5 A;  1JJC B;  3FFI A;  4JI0 F;  4CRJ A;  3MM7 B;  1X5T A;  3CWJ A;  1HNV A;  2H1O E;  4DV2 F;  3HHL D;  3GIK A;  4DR6 F;  2DR9 A;  3R8Y A;  5DG9 A;  1X7V A;  2B9X A;  5KG4 A;  4URS A;  1MU2 A;  4FPI A;  4ER8 A;  2XMM A;  2OIH A;  2HHS A;  3M8Q B;  1F3V A;  2GGP B;  4ZJL A;  4C3M A;  4CP5 A;  1N32 F;  1SH0 A;  3H90 A;  1N5T A;  1WSV A;  3CJ3 A;  3PX6 A;  4PR6 A;  1BY9 A;  4LF9 F;  3BN4 A;  3Q8U A;  2RQM A;  1KNZ A;  2MY8 A;  4X4V A;  3CCR S;  4QIV A;  1HW9 A;  1DBD A;  2H54 B;  1K9M T;  1OPI A;  4I64 A;  2V69 A;  1R8H A;  3ETO A;  1FD8 A;  1ZET A;  3U1L A;  4OI4 A;  1IBL F;  3C14 B;  3ISZ A;  3LO3 A;  5FDL A;  1GQE A;  4LRA A;  4OQJ A;  4ECR A;  3MD1 A;  2KB2 A;  3J7Y U;  4I69 A;  1OJ4 A;  4P73 A;  4YR3 A;  3QRR A;  2DH9 A;  1HQU A;  8ATC B;  1RT2 B;  3TAN A;  4MK9 A;  4FXV A;  1NH7 A;  1X4F A;  1QAX A;  1FKP A;  1RWK B;  5KFI A;  3TW0 A;  2E1C A;  3PYF A;  4DV0 F;  2YX7 A;  3CT9 A;  1J27 A;  4LFB F;  3W61 A;  7FD1 A;  4ED2 A;  4IG0 B;  4USM A;  4DI6 A;  4NI2 A;  3BKF A;  4CLF A;  2GO9 A;  3QT7 A;  2YX1 A;  5J2P B;  4LUB A;  1OY6 A;  2QLX A;  1UWB B;  5A8R B;  1IKY B;  2K29 A;  3CCZ A;  2ZBI A;  2I5J A;  4N77 A;  8AT1 B;  5A8W B;  1MWQ A;  2K9I A;  3O44 A;  3KMQ A;  2O1P A;  1U1O A;  3DMJ A;  4IFY B;  2K06 A;  2R7X A;  3VW4 A;  3KJF B;  4IRD A;  1NK9 A;  2RDD A;  2HUR A;  3B8H A;  4CLU A;  2JSX A;  4O3N A;  3I5C A;  5KFQ A;  1VRT A;  5A6P A;  3CJ8 A;  2HFO A;  1WHW A;  1J5E J;  2ZFH A;  4MJW A;  2C3U A;  3I9V 9;  3C6T A;  2JEI A;  2BOA A;  3F56 A;  4FVC A;  2GVD A;  2RRA A;  3L09 A;  4FDF A;  3QIP A;  2ZDP A;  2B8P A;  3ET6 B;  2CNL B;  1WEY A;  3OR2 A;  2LKZ A;  4AYB D;  4DDF A;  1M0S A;  3BR9 A;  3GYX B;  4RX6 A;  5A76 A;  2MKH A;  4G1Q B;  2RSQ A;  2PI5 A;  1CJT B;  2OTL S;  1VIS A;  2J0Q D;  4JI5 F;  1XC9 A;  1S1X B;  1UL3 A;  3FMW A;  3U27 A;  4CT8 A;  1PAE X;  3W9J A;  8RUC A;  3HHD A;  5HQM A;  2XO6 A;  4Q8F A;  3G8T A;  4ED7 A;  3KK3 A;  4DEZ A;  5C7P A;  2QG9 B;  3W2W B;  2CJY B;  4CI0 B;  4J9M A;  4M63 A;  3BEG B;  1GAO A;  2XG8 A;  3S8S A;  4RNH A;  3A3P B;  1SJ1 A;  3NGD A;  1R43 A;  2KFN A;  1Y9O A;  1FEE A;  3BSA A;  1X4H A;  1HNI B;  3DLK A;  2XMJ A;  3MF5 A;  4WKR A;  4OYM A;  1V3Z A;  2FY8 A;  2IVM A;  2M5Y A;  3LUY A;  4B3R F;  2RIJ A;  1C0T A;  3US5 A;  2E1P A;  1KKH A;  3AD9 C;  2F9D A;  1B7F A;  2ADL A;  3RW6 A;  4M8L A;  3MOZ A;  2VFV A;  4QIE A;  2ZIT A;  4HT5 A;  3NOC A;  4DFJ A;  4B9U A;  1WEL A;  4OYZ A;  3GQC A;  1U0S A;  1W26 A;  3MEC A;  3SFU A;  1QVG R;  1U09 A;  2B6A A;  3I5A A;  4DL0 C;  1JLF B;  2AZ1 A;  2KT5 A;  4L3K A;  4HEA 9;  4DLG A;  3WZ0 A;  1S0M A;  2IM0 A;  4FXW A;  2UZA A;  2MGZ B;  7AT1 B;  2D9P A;  3PM9 A;  3I87 A;  5E7O B;  2RIL A;  1VJQ A;  2RHQ B;  5ETN A;  3PW4 A;  3G86 A;  4F02 A;  3U1N A;  4DPX A;  3OXG A;  3G82 B;  1V3R A;  3RB3 A;  3G8S A;  1S0N A;  4B3T J;  1F9F A;  1NHV A;  1LWC A;  3AXM A;  1ZZF A;  2NR0 A;  5HVF A;  2ZWP A;  5DDO C;  1TEL A;  2I2Y A;  2H1Y A;  2D3U A;  2H65 B;  2DD8 S;  3G87 A;  3M9N B;  2RKI B;  3S1T A;  3RRK A;  1V9O A;  4ZP6 A;  1FTC A;  2WAQ D;  3LP1 B;  3HFZ B;  4NZ7 A;  3DOK B;  2ZKU A;  2BJ7 A;  1WD6 A;  1RT1 A;  5BR8 J;  1HHQ A;  4WU3 A;  1IR1 A;  3VAI A;  4X4Q A;  2J6U A;  3H5X A;  3OR1 B;  5E3Q A;  5G0R B;  4K7Q A;  1HNZ F;  3UN5 A;  2IJR A;  2DIU A;  6AT1 B;  2BE2 A;  4QQB A;  4USK A;  4J9P A;  2KRB A;  4Q43 A;  3DYA B;  5J2Q A;  4ZVS B;  4KH0 B;  5B09 A;  2ASL A;  3CJK A;  4PPD A;  1SPB P;  2JH3 A;  2XUL A;  3FEX B;  2V5H G;  1GXT A;  4ZPD A;  2JRS A;  3W9H A;  2MKI A;  5IT4 A;  2UUA F;  2IAJ A;  2AGQ A;  4GO5 X;  3H2U B;  3RW7 A;  2XY5 A;  1HBU A;  4M5D B;  3L3C A;  2CAD A;  2DR5 A;  3K7R A;  1KQK A;  4QWB A;  4QWD A;  3SV4 A;  2AYB A;  3UCZ P;  3KFW X;  4DQI A;  1E6Y A;  3OPK A;  2V8G A;  2R7R A;  4DL7 A;  1L3V A;  1ZM3 A;  2UUA J;  1M5S A;  3FGV A;  2DHX A;  1ARQ A;  1LW2 B;  2DXD A;  4EBE A;  4DX8 H;  4JI6 J;  1KR4 A;  5DLG A;  2HSE B;  3JAM Y;  3NMR A;  4B02 A;  3CO0 P;  2YH1 A;  1N34 J;  2RU9 A;  1M5O C;  2MKJ A;  2ZC3 A;  4C8N A;  2KDO A;  4KPC A;  2P5V A;  4RNN A;  3V5R A;  1MRO B;  2IIH A;  1RT3 B;  1NDC A;  3K8W A;  1T95 A;  1RHJ B;  3M8Y A;  4G6V B;  1K1Q A;  1MMD A;  1NM2 A;  2DR7 A;  1Q1K A;  2BA9 A;  3CMA S;  3KLF A;  4Q5V A;  4ZIW A;  5DM6 Q;  4BLG A;  4UY8 5;  1OQ6 A;  3E01 B;  1F6T A;  3MHY A;  3MPD A;  1KLM A;  2W8K A;  1S76 D;  3KG4 A;  4L6V 3;  2FLL A;  3MMJ A;  1VOM A;  5KFG A;  3DLG B;  3PO5 A;  5KG1 A;  4B3M J;  2E1A A;  4O0I A;  1FRI A;  3R2C J;  5GAD I;  4ZN1 A;  4NEZ A;  3U02 A;  2M8H A;  2A10 A;  2CIM A;  3TA1 A;  1XR7 A;  2JXH A;  4FXD A;  1KN6 A;  1HI0 P;  3GCX P;  4D3H A;  2CJX B;  3IR7 B;  4RW4 B;  1S6P B;  4X65 F;  1SJQ A;  4IYQ A;  3KLI B;  2QV6 A;  3CD5 A;  3UDV A;  5KFB A;  3MR5 A;  2VB6 A;  4Y2I A;  1RYS A;  1FEH A;  3IS9 A;  3M2U B;  2G1D A;  2PFF B;  4H4O A;  3PJ9 A;  5KFL A;  2BAC A;  3VVU A;  3F44 A;  3G8Q A;  5IS2 A;  1UFL A;  4NML A;  3M9O B;  4KYZ A;  1X4D A;  2RJZ A;  1JXL A;  4LF7 J;  3GTY X;  2EC0 A;  3VGV A;  2B4O A;  1NDP A;  5F9N A;  4C8M A;  3HT0 A;  2VQF F;  1S9F A;  3TUZ C;  3BJY A;  2QSF A;  5AXM A;  4R8U A;  3K5P A;  1K0V A;  3MMA B;  1SJF A;  4N8O A;  1JXV A;  3WX8 A;  4OJ1 A;  4YR0 A;  1S1U B;  5D8H B;  4IH6 A;  3QT8 A;  2XLK A;  1IUJ A;  3CSK A;  1HNV B;  1Z4U A;  2HLU A;  4J90 A;  4M5L A;  4KKO B;  1MU2 B;  2VBW A;  4NLQ A;  1H72 C;  3V81 B;  5HP1 B;  4O23 A;  4FYX B;  2X7I A;  5KFY A;  5L1I A;  3NAH A;  2PE8 A;  4LF2 A;  2EBG A;  4YDD B;  3LP2 B;  1IN0 A;  4I6A A;  2HHH J;  3RBD A;  4X4O A;  1O8B A;  2R7Q A;  4DUZ F;  4NLS A;  1VHF A;  2Y8W A;  5F3T A;  1J2V A;  3T1A A;  4A46 A;  4H54 A;  3D67 A;  5F41 A;  2XC9 A;  3MAH A;  3D6M B;  4XDD A;  1VQ5 S;  4MKB A;  2BW7 A;  4LSL B;  5K20 B;  1UAW A;  2GJ2 A;  2CUY A;  2FJD B;  4DU8 A;  3D66 A;  1TV6 A;  1U6Z A;  2EPI A;  1C1C A;  3AA8 A;  5L9N A;  3BSO A;  3BH6 B;  4LT6 A;  4DFM A;  4FYW B;  2YPZ A;  1RHR B;  1YJT A;  3VQT A;  4GRS A;  5KFT A;  2LFV A;  4QWA A;  2YWK A;  2MJN A;  2P9C A;  3QBC A;  3RBZ A;  1IWA A;  2RQC A;  1SB6 A;  2Y8Y A;  2DGV A;  1WOP A;  4PPZ A;  5KG0 A;  1UFW A;  3BH7 B;  3BBC A;  3T5J A;  2Z2M A;  3B78 A;  2VPX B;  3OJU A;  1H7X A;  2ASY A;  1RT5 B;  2AHO B;  3ENQ A;  1AYE A;  3GFX A;  4ZCL A;  4URQ U;  3PXG a;  1HQU B;  1FNO A;  1S6Q A;  3DLL Q;  1FK9 B;  4P10 A;  4EEY A;  4RBT A;  3MMB A;  3BGF A;  3NNH A;  1WOO A;  4USI A;  2ZH3 A;  4ZHR A;  1M5V C;  3CJQ A;  2BSQ E;  3HSD A;  2JWN A;  2CZ4 A;  4PWW A;  1XMQ F;  4CO5 A;  1RWV B;  4BBY A;  1S1W A;  4FN5 A;  4ZVE A;  5KG2 A;  1JK9 B;  1EQM A;  2DO4 A;  2V94 A;  4NI2 B;  2CJB A;  2UXC J;  4B3S J;  5IWA J;  3NCR A;  4PG6 A;  3RYL A;  3BRE A;  4ZIV A;  2QEX S;  1LWX A;  2DB1 A;  4ETZ A;  1VS3 A;  1D9D A;  4WFY A;  3TA0 A;  3P6Y C;  1IBM J;  1RT6 A;  1L3S A;  3T1Y J;  2L9D A;  5B0C A;  4P9S A;  3DLE A;  1ELO A;  4WFX A;  4RW9 A;  4DQP A;  5A8K A;  3MMC B;  1VIO A;  4QYR A;  2ZHO A;  4Y28 C;  2CAJ A;  2XYP B;  2AV5 A;  2M4M A;  3NWG A;  2UUB F;  4JV5 F;  2FUG 9;  1AA1 B;  3LAM A;  2VUG A;  1S6O A;  5FII A;  4TY8 B;  4V1A k;  3ENA A;  3CF5 Q;  1U7L A;  1WTB A;  2FGO A;  4KGZ B;  2FJB B;  3D68 A;  4H4M B;  1RZM A;  1KON A;  3EPG A;  2DGO A;  1WG4 A;  2YKO A;  4G65 A;  1WNE A;  2AJ1 A;  3ZO7 A;  2UUB J;  5IM0 A;  1N33 F;  4CQ1 A;  3EGV A;  4N7T A;  2C2M B;  3KK3 B;  2DGW A;  1TKT A;  1L3U A;  1B01 A;  4ECW A;  1RSC A;  4NA1 A;  3IN5 A;  3RRH A;  3HK2 A;  4C2M A;  2V4J B;  3CJR A;  4FVM A;  4CO2 A;  4TXS A;  2MTL A;  4ILL A;  2GQQ A;  2XS2 A;  4DV1 F;  1SQF A;  2A6M A;  2L9W A;  3AH6 A;  4ZJO A;  2ALY B;  4V19 X;  3A4T A;  5I3P A;  4I1T A;  1N5S A;  3W64 A;  1JX4 A;  2JOQ A;  4GKK F;  4CM0 A;  2CPD A;  4DR2 F;  5K8O A;  1IM6 A;  3MEC B;  3T6J A;  4EI2 A;  2O66 A;  2OPP B;  2LVW A;  3G6E S;  3CJT A;  3DDI A;  2K7J A;  5AJ3 J;  4X4U A;  2GJI A;  4ECY A;  2Y0S D;  4O3O A;  3QFH A;  4LVN P;  3VF0 B;  4WE1 A;  4LBP A;  2BJ1 A;  5DS7 A;  2HVI A;  2JZ5 A;  3NCQ A;  3MUM P;  1KRP A;  4LF4 F;  4DCJ B;  1MWY A;  1BQM A;  4UW2 A;  3ELH A;  4ED1 A;  2CQ3 A;  4KO0 A;  2ZVS A;  1XNQ F;  1B28 A;  1IBC B;  1R8B A;  2DHA A;  4E0D A;  1QE1 A;  3MM9 B;  2YWW A;  3FKB A;  3QRQ A;  5HAN A;  1T03 B;  4JB8 B;  5EDW A;  2G0C A;  3HJV A;  4EU0 A;  1QLN A;  3EXY A;  1RBL A;  4K59 A;  4M5I A;  2BKN A;  2CQB A;  5IFM A;  3MEG B;  1U6B A;  2DNP A;  2KFY A;  4U67 Q;  2HBZ B;  4W90 B;  1VQM S;  1JJH A;  4NA3 A;  3LPY A;  2QMW A;  3NAI A;  2Z30 B;  3HSJ A;  1U0H A;  4HLB A;  4LBH A;  1XTZ A;  2J9C A;  5MAO A;  2MQ8 A;  3NY0 A;  3ONQ A;  2KFZ A;  1ZTW A;  2IYI A;  2UVV A;  2HQD A;  5KFE A;  1D0E A;  2A2B A;  2J7K A;  3UPF A;  4ILR A;  2LQ8 A;  5L8R C;  4J9V A;  4KR0 B;  3SDE A;  2R7W A;  4IRC A;  1QSS A;  4LJM A;  5DJB A;  5A0Y A;  3GG0 A;  4DPO A;  5HJY A;  4YR2 A;  5J2Q B;  5DM7 Q;  2KZM A;  2CWX A;  1V5V A;  3QRP A;  2H48 B;  5HLF A;  2OEK A;  1GMW D;  4ZMM A;  1TK0 A;  4PEO A;  2ZH9 A;  1R7I A;  4JI2 J;  3VVT A;  3CCE S;  1HBU B;  3IGV A;  1RTD B;  3VHQ A;  3JAM U;  2X51 A;  2GS8 A;  4ECX A;  3GSI A;  4FKY A;  4NE9 C;  4X4S A;  2B9E A;  3UNG C;  2UUC F;  2KJV A;  3KXD A;  3LQV A;  2AD9 A;  4OV6 A;  3P4U B;  1E6Y B;  1YJ9 S;  1DQA A;  3TJA A;  3L9Z A;  2E7V A;  2DNO A;  1RTZ A;  1UJ4 A;  1GH8 A;  1R89 A;  3MR7 A;  4RUC A;  4UQG A;  4ED6 A;  4OYB A;  1Q82 T;  3W66 A;  1NB2 A;  1TL1 B;  5IC4 B;  3P45 B;  4KFB B;  2B4P A;  5HRO A;  3R3T A;  4LRC A;  3CC4 S;  4I67 A;  3ZZT A;  1HPZ A;  4FP9 A;  1KOH A;  2IYG A;  1NZA A;  1TUV A;  3AD7 C;  2HFU A;  1NKE A;  1IQT A;  2V68 A;  2HHW A;  3RB6 A;  3M2R A;  4ZDN A;  5LXY A;  3OT9 A;  2YNF B;  5ETK A;  2KT2 A;  2QZ8 A;  3IA0 A;  2UXB F;  1R0C B;  3W1Y C;  4FXE A;  4Y6I A;  1RDR A;  4I7F A;  4RNO A;  2RS2 A;  4J9O A;  2XM3 A;  2F5G A;  2XMA A;  3EUN A;  3QAU A;  3GG1 A;  2AEM A;  2HPU A;  2JVO A;  2BEF A;  2QLW A;  3HVR A;  1NB7 A;  2X1F A;  3T5K A;  2XMK A;  4HKQ A;  1DTQ A;  3JYT B;  1FRJ A;  3T1H J;  3CCW A;  2ZHB A;  2HVD A;  1KBR A;  4ZCK A;  1HNW J;  5C5J A;  3QAE A;  4H4O B;  1VQS A;  2MKC A;  1M1G A;  4DUY F;  3SI8 A;  2XSJ B;  4YY3 J;  4RW8 B;  2KT3 A;  2LCW A;  2LLZ A;  4QYZ K;  4FPR A;  1SQE A;  3OXL A;  3N6M A;  1LKZ A;  4KAI A;  4GO7 X;  4F4K A;  5DO2 A;  3Q8Y A;  1N36 J;  4LSN B;  4H4K C;  3BGR A;  5ETR A;  4TU9 A;  3M1V B;  4F3M A;  1TUW A;  1DAR A;  3ULH A;  2R42 A;  2YNH A;  3O3L A;  1NHK L;  2PT0 A;  4DN9 A;  3M6U A;  4HI2 A;  4NCG B;  4FYY B;  1WUU A;  2DIS A;  3IAS 9;  3K58 A;  5SZT A;  1B7Y B;  2F9J A;  3R5C A;  2IRX A;  4M5N A;  2Q66 A;  2XCP A;  2XGP A;  2UUT A;  3I0R A;  2V8H A;  2Y3Y A;  2MB0 B;  4HH0 A;  1VK8 A;  1REG X;  2VPW B;  1Y4Z B;  3VR1 A;  2LXI A;  3VGT A;  3J80 Y;  1BAZ A;  1WG1 A;  2FLP A;  3GIR A;  3BS9 A;  2V67 A;  2ZD1 A;  3AJD A;  1ZOT A;  1C1C B;  3PTW A;  1LV5 A;  4FNI A;  3GCW P;  4YOE A;  5DGA A;  4IG3 A;  1NPR A;  4DR3 F;  2KEL A;  3QT6 A;  1NJX A;  1TL3 A;  4FBT A;  4DV3 F;  4KV8 B;  4MK8 A;  4L75 A;  4BDP A;  1WF0 A;  2FHM A;  3TA2 A;  1D09 B;  2Y9H A;  3DI6 B;  1Q8K A;  2EI5 A;  4P2M A;  5CCL A;  1NSA A;  1JLC A;  4QR2 A;  3D0G E;  2HQC A;  3HZG A;  3IG1 B;  3NRB A;  3MMB B;  4WZQ A;  2JLG A;  1AW0 A;  4ZKA A;  4ZHR B;  2QC3 A;  4YB6 A;  5E3R A;  1YRT A;  1B70 B;  5HO4 A;  5M2P A;  2FHK A;  1SIZ A;  3FSY A;  2HGL A;  3WDO A;  3DGP A;  3R1H A;  2NXN A;  4OX6 A;  2IRY A;  3IRX B;  4UOH A;  4DS4 A;  1FRL A;  3J7Z T;  1Q86 T;  4ANE A;  3CCV S;  2KVQ E;  3MUT P;  2Q3P A;  1S9E B;  3AJ2 A;  2HNY A;  2GQC A;  5CH7 B;  2AEF A;  3HM9 A;  4DR5 F;  3HHL C;  4KHM A;  1S12 A;  4P2S A;  5KG5 A;  1PJ5 A;  1RUS A;  2AYE A;  3JXO A;  1LWE B;  4PG7 A;  1C0U B;  4X84 A;  1AZS A;  2G9O A;  2CRL A;  3CUL A;  2KKH A;  5DGB A;  2D1C A;  2KO1 A;  2RD5 C;  3KJV B;  2CQI A;  3EZU A;  4EZ9 A;  5D3G A;  4Q0B A;  1FX4 A;  2ZUA A;  2DKO B;  3TEH B;  5ITH A;  5LJ5 Y;  5J2N B;  1F2G A;  2HQG A;  3A8I A;  5L39 A;  3VV2 B;  4WZM A;  1F5B A;  3KMS A;  4X64 F;  1U47 A;  3KDO A;  4AL7 A;  1DAX A;  2DPI A;  3HI9 A;  3EVM A;  1T9X A;  1PIE A;  4BCA A;  5CCM A;  1FI4 A;  4DR1 F;  3K5O A;  1KQG B;  1UZD A;  3JTO A;  5IM0 B;  3ENW A;  4FYV B;  3ZTS A;  1IVZ A;  1JLG A;  1XBW A;  3OSP A;  4EUV A;  4DQS A;  1BGX T;  4E8U A;  3TNV A;  3DRP A;  4X64 J;  2AYG A;  5G4D A;  2VG7 A;  3HLU A;  1G3O A;  4DS5 A;  1A6L A;  1NJI T;  1Q4R A;  1LW0 A;  2FLN A;  2UVW A;  2JNJ A;  5B0A A;  5F9L A;  1IBM F;  2MST A;  4Y2A A;  1NU4 A;  4OYP A;  3GR1 A;  1ICE B;  3MUR P;  2YNI A;  4PXB A;  2VKZ G;  2FJA B;  1UMJ A;  3JS9 A;  4QPX A;  1OS5 A;  3D6F B;  1QTG A;  3G4S S;  4OLP A;  1VBY A;  1TMM A;  3FSX A;  2VAS A;  1KS2 A;  1V3S A;  3KHL A;  2C3O A;  2OLW A;  4ID5 B;  4U95 A;  2CQ4 A;  4WYL A;  1UKU A;  3GR0 A;  2DIT A;  5ETT A;  3BV8 A;  1TKD A;  1QAI A;  4A47 A;  5IT0 A;  1YHQ S;  2HHV A;  1ARO P;  2GIQ A;  1XER A;  1O5J A;  1VRU A;  3R2D J;  5LXR A;  2B4V A;  5L46 A;  5EGY A;  5KFJ A;  2BJE A;  4CLZ A;  2ADB A;  1K47 A;  1YJW S;  3M7V A;  3OFF A;  2DR8 A;  3ZTR A;  3UVJ B;  2D9O A;  3K8V A;  1PSD A;  3W3S A;  3K57 A;  3R1L A;  1G7C B;  2HZC A;  4X4R A;  2GX8 A;  3EXC X;  2HHU A;  2HW3 A;  1DTT A;  4DWI A;  1EQ0 A;  1NK7 A;  2N7Y A;  4DSJ A;  1YDL A;  2HK3 A;  2FIU A;  1NHU A;  2Z2Z A;  2ZM6 J;  1S59 A;  2FVR A;  2HG4 A;  2MKY A;  5CQG A;  4GC7 A;  3BR8 A;  2LQ9 A;  2LXF A;  4RU9 A;  4Q7A A;  5L1J A;  4RW6 B;  5HMZ A;  4S0M A;  4ITS A;  5I42 A;  3ILI A;  5LM7 E;  5AE2 A;  3TUP A;  4LRV A;  2KXN B;  3WHI A;  4AFF A;  1NBE B;  4C0H A;  3IR5 B;  3VZH A;  1QDU B;  2HHX A;  3KK1 A;  2F4F A;  1ZBT A;  3WBZ A;  2BXJ A;  4ZVF A;  2E9Z A;  4WBF A;  1SV5 B;  4OJG A;  3PFO A;  4Y65 A;  3LP0 A;  4DUT A;  5L1L A;  4OZ1 A;  4DX6 A;  2R7O A;  5MLC V;  3THV A;  4NPO A;  4NYO A;  2FHJ A;  1SJR A;  1XIQ A;  3OJS A;  1X60 A;  2GNK A;  1TQL A;  3HD2 A;  1JJ4 A;  3CUN A;  2YKN B;  3BBB A;  1N5Q A;  5D6G A;  3PW5 A;  3KNA A;  2KHD A;  2DHG A;  3LA0 A;  1FE0 A;  4AXI A;  4CH0 S;  4CT9 A;  1FT8 A;  4UOC A;  3D28 A;  3MM7 A;  3HD1 A;  4DSL A;  2ILZ A;  2V2Q A;  3SBM A;  1HQE B;  3H4B A;  2HFN A;  4ECT A;  3MPV A;  3OTB A;  3OXF A;  4DX7 A;  2RHS B;  4Z7C A;  1VQ9 S;  4XK8 C;  2OEL A;  1PC5 A;  2BQU A;  2OH2 A;  1T8E A;  3M8Q A;  1V5I B;  2GGP A;  1TL5 A;  3NS5 A;  2NPI A;  2WZ1 A;  1RWP B;  4A8Q A;  1VQP S;  5C42 B;  3OV7 A;  4JI3 J;  4YHH F;  4RNF A;  4ICL B;  4DR7 F;  1NAQ A;  5D0H A;  2Z8Q A;  1U45 A;  1HPZ B;  1ZAW A;  1I3O B;  1LWF B;  3UN3 A;  4I2Q B;  3C6U A;  5E5N A;  5LL6 d;  4M5M A;  3MEE B;  1NRK A;  2LA6 A;  4WP9 A;  4FS1 A;  2F63 A;  2V8V A;  4QCL A;  3BQ1 A;  1T02 A;  1VQK S;  5B08 A;  2QA1 A;  1L3T A;  4PXC A;  4IH5 A;  1SIW B;  4LF8 J;  3MTJ A;  2KTQ A;  3C14 A;  3IR6 B;  2BR0 A;  5CYQ B;  1RWW B;  2DXF A;  4KGX B;  1N5Y B;  1QUV A;  2MZ1 A;  2IPO B;  3VEB A;  1P9Y A;  2BQ3 A;  2ZOF A;  3PEJ A;  2LU2 A;  1GX5 A;  4CWB A;  4ZN3 A;  3N28 A;  4NCA A;  4YEA A;  2DEI A;  4J9N A;  1DTQ B;  1OYD A;  2PN6 A;  1FD2 A;  4Z7Y A;  1XMO F;  4CLP A;  1RT2 A;  4OI0 A;  4OI2 A;  4X62 F;  4FF1 A;  4XDC A;  1VQY A;  1P1T A;  1JLA B;  2C2R A;  3V6H A;  1W2B R;  4WFN Q;  2M52 A;  2A1B A;  4C8K A;  2UXD F;  2HAI A;  4HHH A;  2J9D A;  1KLN A;  1FXD A;  5LSO A;  1SC1 B;  5LT5 A;  4OZJ A;  4DV7 F;  2XGQ A;  3FZB A;  4IG0 A;  3UCG A;  1WKJ A;  3NGU A;  1SKU B;  1MWZ A;  1KFD A;  5ETL A;  3G6Y A;  5J2M B;  1HNX F;  3B54 A;  4ES1 A;  5J2P A;  4X4N A;  1UWB A;  1IKY A;  1NME B;  4O4G B;  4P72 A;  2MYF A;  3KUG A;  1TP7 A;  1I1G A;  1Q5Y A;  1WKL A;  5A8W A;  2H3E B;  5SUH A;  3BGR B;  2K2P A;  3J7Y I;  2BRL A;  1X31 C;  3JTN A;  2I38 A;  4IFY A;  2HHP A;  3F73 A;  4LVO P;  4YP3 A;  1YZ7 A;  1SH2 A;  2R8J A;  2VHG A;  2OFH X;  2HBY B;  1RWU A;  4ZIT A;  5IQQ A;  3PRV A;  2JBV A;  4L72 B;  2P2C B;  2LQ5 A;  1HD0 A;  3HXM A;  3J80 U;  4Y2C A;  2Q79 A;  2R8K A;  5IV3 A;  2EFV A;  2QTW A;  1U1N A;  4RWX A;  2Q1L A;  2AGO A;  1QSY A;  1FA0 A;  2QL7 B;  5KFR A;  2K3K A;  2FVQ A;  4O0N A;  4JV2 A;  5LMN J;  3MI7 X;  2D74 B;  4JI7 J;  3EYZ A;  3OVB A;  2YY3 A;  1BWV A;  1R0A B;  1IQZ A;  2HVE A;  4G1Q A;  3RU0 A;  3KHG A;  1CJT A;  3TRG A;  4MKV A;  2QYG A;  4G3I A;  4J9S A;  1TU0 B;  3EIC A;  3KLG B;  1C1B B;  1S1X A;  4YN3 B;  2V4Q A;  3BO2 A;  3OUY A;  5A2Q U;  4C9D A;  3N5B A;  3B4D A;  1X4B A;  1VR6 A;  3W5X A;  2YVS A;  5KOW A;  3AXK A;  3W62 A;  1HBN B;  1HWL A;  3W2W A;  4K4S A;  2W9C B;  1IBK F;  2NS1 B;  3UNY A;  4RUH A;  1QSL A;  2EKY A;  2HRU A;  1APS A;  2HIQ A;  4U7C A;  3R9L A;  3SSS A;  4DPW A;  3CD0 A;  4NLO A;  4O3Q A;  1WDT A;  2ZEJ A;  1CS4 B;  1J5O B;  2MZQ A;  4DV4 F;  2P9G A;  3AFG A;  2V2V A;  4YME A;  2G2Z A;  1WOR A;  3QJL A;  2BJD A;  4U8V A;  3F41 A;  1S97 A;  4N56 A;  4MYU A;  3PG9 A;  2VQE F;  3N6N A;  4JUZ A;  2QLF B;  3QGG A;  2CG4 A;  1SKS A;  4JI4 F;  4Q2L A;  4LIR A;  1Q7L B;  2JXG A;  3IM8 A;  2CXE A;  5LMU F;  3G71 S;  1JLF A;  3K17 A;  4KGV B;  1MYL A;  1OO0 B;  5GAH U;  3NLC A;  1FDB A;  4J91 A;  3SFG A;  5KFS A;  1RTJ B;  1HHT P;  1CC7 A;  1WKK A;  2X1B A;  3Q89 A;  2A0F B;  2ATC B;  4PXD A;  2N4C A;  1GNK A;  1FJG F;  2U1A A;  4CH7 A;  2OKQ A;  3PKY A;  4CCH A;  1B99 A;  3HSG A;  5H9E K;  3CCU S;  1IJE B;  1XJW B;  3QAT A;  3HKW A;  2NYH A;  4LFC J;  1NCL A;  4TKT A;  5D77 A;  1UVL A;  1YBA A;  4WP3 A;  1U49 A;  2L41 A;  4UOF A;  2RKI A;  4KC5 A;  4IDK B;  4KHR A;  4LF1 A;  5D3G B;  2E5L F;  2A18 A;  2GW8 A;  3LP1 A;  3MCN A;  3Q23 A;  4W98 A;  1H0H B;  3QZ7 A;  3ILJ A;  3SQG B;  2CG8 A;  1I94 J;  1FCA A;  4ZVT B;  1ARR A;  1ZA1 B;  4DSI A;  4Q44 A;  3L95 X;  3SYZ A;  2NLW A;  4QR0 A;  3T9Z A;  3FRZ A;  2WCX A;  2DY9 A;  3DYA A;  4F4Y A;  2R4F A;  4EZ6 A;  3ICL A;  1RYR A;  4DU7 A;  3S7R A;  4QIW D;  1HBO B;  4O3R A;  4WK1 A;  3MED B;  3KK2 B;  4YB7 A;  9ATC B;  2ZWO A;  4ED0 A;  4EFA C;  4AQY F;  3UQS A;  2VA2 A;  4M5D A;  5FLX Y;  4M5J A;  2X3D A;  2YNI B;  2MLZ A;  3AQP A;  4MT1 A;  1S48 A;  3M05 A;  1IKW B;  3AOC A;  3RTV A;  4FKX A;  1PGZ A;  1PC4 A;  3EVO A;  4DR4 J;  3KLH B;  1U6F A;  4U96 A;  2VOD A;  3EZ5 A;  3ZNU A;  2DGU A;  2A3J A;  2ATL A;  4JI1 F;  2LP4 A;  1YJ7 A;  1TZ0 A;  2ACY A;  4WP8 A;  2WW8 A;  3HX9 A;  2K1R B;  4F4Z A;  4JI8 F;  1EKR A;  2H5E A;  1U1K A;  4MFB B;  3W9I A;  1HWI A;  2W2M P;  1YX2 A;  5KFV A;  4FNH A;  1MRO A;  3QWP A;  5AT1 B;  2AZ3 A;  1RT3 A;  1CEZ A;  2V34 A;  4RKU C;  2LQJ A;  3PAC A;  3QO9 B;  2J9E A;  3MPU B;  1HL6 A;  1Z1Z A;  1UA1 A;  2W24 A;  3QZ8 A;  2OD4 A;  2VC1 A;  2SXL A;  3E01 A;  2DCU B;  4K0K J;  2CFX A;  2H4Y B;  4ECZ A;  1D3W A;  2BOP A;  2F4V F;  3QQC D;  3ZTP A;  2F8M A;  1PYT A;  4DV5 J;  4IQX A;  4DSE A;  1UW4 A;  5C25 A;  2UP1 A;  3BDP A;  4ECS A;  1JLE B;  4J9R A;  2IFX A;  2YQ1 A;  1N6Q B;  2E5H A;  4QW8 A;  4MAK A;  2LEA A;  4GMK A;  3TAM B;  2EVZ A;  2R7S A;  3KUE A;  1QUP A;  3IP0 A;  2VON A;  3JSY A;  5J1N A;  1FKO A;  1S6P A;  2ZZM A;  2F4V J;  4ZP9 A;  3GYG A;  3GV8 B;  1NKC A;  3FMB A;  4M5K A;  1VQL S;  2V8P A;  4ZK7 M;  4I6Y A;  3CD7 A;  4CLL A;  3KK1 B;  1BC6 A;  4LFA J;  3SEO A;  2W4D A;  3IRW P;  3UCU P;  2C28 A;  1HBM B;  4NXN J;  1RAI B;  1VBK A;  4B9T A;  5C24 B;  1CLF A;  3RAM A;  3LP0 B;  1T11 A;  2CQ1 A;  3FQL A;  2UUW A;  1KC8 T;  3A8J A;  2KYZ A;  2YH0 A;  3VEA A;  3MMA A;  4OZ0 A;  4GKJ J;  2PD1 A;  3HP6 A;  3EVW A;  1S1U A;  2BNZ A;  2EFN A;  5DQH A;  2L08 A;  1L3K A;  5HMX A;  4F0K A;  5E3A A;  2XZW A;  2M9K A;  3C15 B;  2Q2K A;  1VJW A;  5H9F J;  3DRX A;  3R5J B;  2AW0 A;  4KKO A;  1WHX A;  4X4P A;  3V81 A;  5HP1 A;  1SXL A;  4PUO B;  4IOA Q;  1XQI A;  2Q6B A;  4URG A;  3U7J A;  3IFE A;  1VQ8 S;  3LP2 A;  3R27 A;  4JYA J;  3PDN A;  1X4C A;  2HFV A;  4A8S A;  4C7Q A;  4QIF A;  3C6U B;  2WOM B;  4F67 A;  1SH3 A;  3IM9 A;  2QX0 A;  1F2H A;  1UVI A;  2B0G A;  2B8Q A;  2W9A A;  3PW2 A;  3GIJ A;  1UPP A;  2KXH A;  2DXE A;  4MK7 A;  2IVY A;  4LSL A;  5F8N A;  2VDI A;  2Y1R I;  4Q2M A;  4R0E A;  2J8A A;  1N0V C;  1H98 A;  2RAQ A;  3W63 A;  4E98 A;  1H2V Z;  2Y0B B;  3FDS A;  3PIP Q;  2KM8 C;  5F8I A;  1Q78 A;  3SSR A;  1CJK B;  2R9L A;  2E66 A;  3LTO A;  3PY8 A;  1QTM A;  5IOL A;  2BZ2 A;  3N6L A;  1ZYQ A;  2K7K A;  2BKP A;  3PEH A;  1YRU A;  4CM2 A;  1SKR A;  3HVT B;  1A7G E;  5EX0 A;  4USV A;  2ZH1 A;  2FVP A;  3S01 A;  3RAQ A;  4OZ5 A;  1RT5 A;  3GB0 A;  3TP2 A;  2MZS A;  2NUH A;  1FK9 A;  3IBW A;  4QYZ J;  2Z57 B;  3OTO F;  5LSR A;  3V6D B;  4IUF A;  2I8E A;  4Q45 A;  4N41 A;  1YWX A;  1S49 A;  4TNO A;  4ZVH A;  5D0G A;  1NPK A;  4WFZ A;  3DM2 A;  2H51 B;  4LRD A;  4ERD A;  5GMK a;  2B7B B;  5FD1 A;  4L74 A;  5BJR A;  1SBR A;  1NK6 A;  1FHT A;  5HQL A;  4XPC A;  2EFG A;  5KG3 A;  3M6X A;  2RRB A;  3GON A;  3BSC A;  3OTO J;  5EWE A;  3M8R A;  3O1L A;  4O44 B;  1J5E F;  4DPU A;  4DX5 A;  1T9Y A;  3TO8 A;  1R0B G;  4MTP A;  1U1L A;  4ZLJ A;  4ED3 A;  1VHI A;  3M32 A;  3CJ2 A;  3O2I A;  2CJA A;  3TAP A;  2RUG A;  1JJ2 R;  1X9M A;  3NGK A;  4MIB A;  3R7S B;  4CLW A;  4W92 B;  2U2F A;  4I68 A;  2ZNY A;  4WWS A;  1HW8 A;  2C2E A;  3MMC A;  4F8R A;  2B4U A;  3CVK A;  1FF2 A;  3T19 A;  1SC3 B;  1WC6 A;  1X5O A;  4Y0F A;  3PR4 A;  1ITP A;  2BM1 A;  2ADC A;  4WYW A;  2DHS A;  2F1F A;  3A3N B;  1RTH A;  4OZL A;  1WC1 A;  3K2Y A;  4TY8 A;  1JWW A;  1YTY A;  1U1M A;  3CO9 A;  2AGP A;  2HLT A;  2E29 A;  3N79 A;  3MFI A;  4H4M A;  2HFS A;  3CDE A;  2E5G A;  3H87 C;  3OUY B;  3QGP A;  3V2U C;  4ZVP B;  3J81 j;  3Q24 A;  1Y7P A;  4WTY A;  4LF6 J;  5HN0 A;  2GIF A;  1RKI A;  4UZC A;  1IKV A;  2KOE A;  4XPE A;  4O3P A;  3ITH B;  5FJ4 A;  2KM8 B;  2XCA A;  5KFP A;  2LDI A;  2V4J A;  2GCF A;  3SXL A;  3M2V A;  3C2P A;  3E8O A;  2R8I A;  1TVR B;  1BD6 A;  4HAC B;  2VD3 A;  3F0N A;  3G5O A;  2QN6 B;  3DC2 A;  2NZC A;  3T9N A;  1AFJ A;  1TMJ A;  2DRD A;  3B6B A;  4JV0 A;  4PYA A;  3ZXW A;  3GJT B;  3NKY A;  1WJ9 A;  2CPY A;  4K4V A;  1JKH A;  1FWK A;  2V6A A;  3MPW A;  4OX9 J;  3GJR B;  1PIL A;  5RUB A;  4CYU A;  3FEY B;  4ZJQ A;  4B3T F;  5I4M A;  2OPP A;  4PAB A;  3UR0 A;  4PRF A;  2GFF A;  2DHH A;  1U2F A;  1SVD A;  5KAK A;  4RNM A;  3X1L B;  2HNZ B;  3CC7 S;  4ZPA A;  4K4T A;  4RPF A;  1DJ0 A;  3W60 A;  3H4D A;  2NSC A;  2CKW A;  1VFJ A;  2FPH X;  3QJP A;  2QE5 A;  2K5J A;  4F0H A;  1H3D A;  1TUG B;  3MM9 A;  1Q8B A;  2GV1 A;  5BR8 F;  1ZA2 B;  1T03 A;  3J7Z 5;  3MPY A;  5BYS A;  1RAA B;  2GVZ B;  4OYX A;  2V9K A;  3MEG A;  1MNE A;  3MAA A;  2RML A;  1JMT A;  1RIS A;  4C8L A;  2CDQ A;  4DV6 J;  1VMB A;  4KJI A;  2ZZT A;  1XR6 A;  3DCA A;  2N7C A;  2QMU B;  4C8Y A;  2XYG B;  1FER A;  3PJX A;  3Q83 A;  1DLO B;  3B82 A;  2IM3 A;  3HHE A;  5HMY A;  2FZG B;  3A1Y G;  2B5J B;  1BUX A;  4CO4 A;  1OSC A;  1YSJ A;  5L38 A;  4X66 J;  1T9V A;  2HQF A;  2DH8 A;  5FLX U;  2HRY A;  2EEY A;  2EFQ A;  4AND A;  2MPU A;  3D54 A;  3GU0 A;  4BS2 A;  2VG6 B;  3MTK A;  2Z4P A;  3HSZ A;  2DNR A;  1X5P A;  2O01 C;  4P2F A;  4ENO A;  3CW2 C;  2FYX A;  5BYQ A;  4USW A;  4JI6 F;  2C3M A;  3ZNJ 1;  1RTD A;  5KT2 A;  1VQ7 S;  3CIM A;  3R97 A;  5U47 A;  5ETV A;  3NGT A;  2VOO A;  1N34 F;  3VQS A;  2MZR A;  2HYI B;  4YUD A;  4NLD A;  4ETX A;  1F5A A;  2C2D A;  2APO A;  4KHP J;  1FFS B;  1T3O A;  3OL7 A;  5AE1 A;  5DDR C;  3SMZ A;  4K4U A;  2AQ4 A;  2QA4 S;  2LYV A;  3TVZ A;  4F04 B;  2YNG B;  3BM7 A;  1TL1 A;  4P52 A;  1AUS L;  2MLY A;  4KFB A;  2DO0 A;  5LSL A;  1Q5V A;  3NGR A;  2UVU A;  2AKW B;  3BYP A;  4J9U E;  5J1E B;  4B3M F;  2NQP A;  4BC7 A;  1KWM A;  2GAG C;  3D2W A;  4OL8 A;  3NOG A;  4B9S A;  3VWS A;  2RDI A;  4HDG A;  1OMS A;  3TZY A;  5CAB A;  4CLT A;  4NWB A;  3RB4 A;  2YNF A;  2NZ4 A;  1PYO B;  3K0J A;  1UEK A;  4TU7 A;  1WOS A;  2QRR A;  2XZD B;  3O8W A;  2POK A;  3UO0 A;  1UPM B;  4ZVQ B;  5C25 B;  2FZC B;  3GWC A;  4C0O C;  5HSP A;  2V63 A;  5LJ3 Y;  1H6K X;  3PR5 B;  1U2C A;  5JJB A;  2FLO A;  1JNR B;  3KG0 A;  2WVC A;  2XMW A;  4HVZ A;  5L1K A;  4ALZ A;  4USH A;  1I6J A;  1SJ4 P;  1Y3K A;  1IKX B;  4LF7 F;  1FKO B;  3JYT A;  2NPF A;  3M30 A;  4ELT A;  5H1S V;  3SCL E;  1D9F A;  4WF9 Q;  1L5U A;  2WVB A;  2IVF B;  2ZH4 A;  2M8D B;  3TI0 A;  2UV8 G;  2DNK A;  3E2E A;  4KQZ A;  1TTH B;  5HVH A;  2J0S D;  2Z58 B;  4OYO A;  4CTA B;  3I32 A;  2MJU A;  2XSJ A;  2WTF A;  3SZ2 A;  3TVY A;  2C2O B;  4RW8 A;  2MZJ A;  4KB7 A;  2EC2 A;  5IC6 B;  2LEP A;  1CJU B;  3SQO P;  1B64 A;  5JUM A;  2ZJP Q;  2ZE2 B;  1REV A;  3AA9 A;  4K5R A;  4LSN A;  1UVM A;  2HHT A;  2CQD A;  2R2S A;  5DG8 A;  2XY6 A;  2VFR A;  2HHH F;  3TAQ A;  4IO1 A;  3M1V A;  3PRD A;  1GK8 A;  4UST A;  3SCJ E;  1CJV B;  2JEG A;  3FBF A;  2EW9 A;  3SCK E;  2UU9 J;  4NCG A;  3KJQ B;  2ZHA A;  3D3C J;  2HMI B;  1S4E A;  4DXL A;  3TQE A;  3MOJ B;  2KH9 A;  3VAG A;  4XIU A;  3CME S;  1UVK A;  5CZV A;  2W7O A;  3NS7 B;  2W4P A;  2IMW P;  3K89 A;  3GIL A;  4OYI A;  1B0P A;  2BJ9 A;  1IR2 A;  4QWE A;  1W7W A;  2RUS A;  1QJH A;  5D78 A;  5IZH A;  2XS7 A;  2JHE A;  1EAY C;  3CNQ P;  5B0E A;  3AB4 B;  1M90 T;  3EGN A;  3J7A 1;  4X2B A;  1YZ6 A;  4IOB A;  3I0S B;  2CA9 A;  2WSF C;  3H59 A;  3I96 A;  3DFE A;  2BW2 A;  3NG8 A;  2G1H A;  1F5C A;  3ILO A;  2Z2Y B;  4QZV B;  4KV8 A;  5E3P A;  1K0T A;  4TY9 A;  3BO3 A;  4F2R A;  3OW2 R;  1LNQ A;  4DHV A;  5KFK A;  1NZ8 A;  3FBB A;  3DI6 A;  4AL5 A;  4KGM A;  2CNK B;  2H5I B;  3WIV A;  3IG1 A;  1K1S A;  2UXC F;  5KFC A;  4B3S F;  5IWA F;  2D3O R;  2PO4 A;  2B7C B;  2VFS A;  2QFJ A;  1WC3 A;  4R0J A;  4ECU A;  2YX4 A;  2OI2 A;  1RT7 B;  5HBM B;  3HT3 A;  4I2P A;  3DM2 B;  3T1Y F;  2JJ4 D;  3SSQ A;  1G6B A;  3IRX A;  3OHB A;  1O6X A;  5GAE U;  2QA2 A;  2PEH A;  2HVZ A;  2I6W A;  5CD4 H;  4GVB B;  5CYM B;  1S9E A;  2VPY B;  1HAR A;  2XNQ A;  1N88 A;  3M8P B;  5KFX A;  1XNR F;  1QY7 A;  1RBA A;  4K4X A;  5JXS A;  5KTQ A;  4XAK A;  3M32 B;  2P6T A;  4XO0 A;  1AB8 A;  3JSR A;  4O3S A;  3LWL A;  2JFD A;  4H4K A;  3VGS A;  5JMN A;  2HAF A;  4TLQ A;  3EX7 B;  4I56 A;  2FVC A;  4ECQ A;  1LWE A;  5BYR A;  5ETP A;  4OI1 A;  1EB0 A;  5K8P A;  1C0U A;  1LQ9 A;  5LOQ A;  1TL7 B;  1YBT A;  4KH1 B;  2W25 A;  2RE1 A;  4DG1 A;  2AP6 A;  2COL A;  3ZZU A;  1XNR J;  3BGL A;  2YXL A;  3CCM S;  1HYS B;  1XR5 A;  4IRK A;  3KJV A;  4OYA A;  2IC3 B;  2MDA A;  2GJF A;  3DHX A;  4B3O B;  1RTH B;  1SL0 A;  1DQ8 A;  3HCX A;  5GAG I;  3C16 B;  5J2N A;  2M2B A;  3MAQ A;  2CPZ A;  2KYX A;  2W4C A;  3L7O A;  1FRM A;  4M5H A;  2FY1 A;  1P1L A;  1S9G B;  4ZVG A;  2V50 A;  3BN7 A;  3TJ9 A;  4UUX A;  5E41 A;  4DL4 A;  2YKM A;  3ADA C;  1TL4 A;  1O51 A;  3L7P A;  5B0F A;  1RTI B;  4Z2X A;  3KOA A;  1IKV B;  4RLE A;  4ATN A;  1MSW D;  4R5P B;  4P74 A;  3QOQ A;  1FXR A;  3FJ2 A;  2IY5 B;  3DRS B;  4JV1 A;  3M2V B;  1MW7 A;  4HH1 A;  4A8O A;  4OJH A;  2AJ4 A;  4DOZ A;  4HYK A;  1OPZ A;  3DU6 A;  5CA5 A;  4BHQ A;  3A8K A;  1S7I A;  4ZPB A;  5AJ3 F;  3UDC A;  2M3D A;  1JKH B;  1OY8 A;  3TZX A;  1EZZ B;  2WSC C;  3E3X A;  4ID5 A;  4TYB A;  4JP8 A;  2AYM A;  3DRR B;  4CYU B;  4N5S A;  1P9Q C;  3NCP A;  2IJF A;  2HS0 A;  3UFC X;  2CYY A;  1HR0 J;  2DGX A;  5H9E J;  4NXM J;  3Q86 A;  5KFM A;  3GFH A;  2XMT A;  1FX2 A;  3MWB A;  4J7C A;  2PFD A;  1NLK L;  2HZA A;  4FYD A;  4A4J A;  2FZK B;  3OL8 A;  1S79 A;  3CCS S;  3UR3 C;  4ZPT R;  4JI0 J;  1VQO S;  2F8E X;  4U9R A;  4F4X A;  5E33 A;  4DV2 J;  1CSJ A;  5KFZ A;  4DR6 J;  4IR1 A;  3UVJ A;  1TR0 A;  2XB2 D;  1DHM A;  1S1V B;  3EPI A;  3HHL A;  5D0E A;  2GMJ A;  3GLJ A;  1MG7 A;  4PZV A;  1N32 J;  3NBP A;  4A8Y A;  4LSZ B;  3MAA B;  4AD6 A;  1YK9 A;  2XHC A;  1E6V B;  2EBE A;  3CJ5 A;  3KG1 A;  2NYI A;  3QSI A;  4LF9 J;  2DK2 A;  1RCO B;  1FNM A;  1TKX A;  1EP4 A;  1B0V A;  5KT4 A;  4HV0 A;  4RW6 A;  1FVS A;  5HAT A;  3P8B B;  2XWX A;  3L4B C;  2CQH A;  3FEZ A;  3PZP A;  2W8L A;  4JI2 F;  3NS6 A;  3TUI C;  1VK3 A;  1IBL J;  2RF2 B;  1C4A A;  1YGY A;  3ZTO A;  1YKW A;  2CVI A;  4NZ6 A;  2K3I A;  1IJF B;  1SV5 A;  1HD1 A;  2YQ0 A;  3EJM A;  2E44 A;  1FDA A;  1RB0 A;  3Q8Q B;  4F25 A;  1T9T A;  3W2V A;  1RWX B;  1M5P C;  5I3U A;  5F3Z A;  1RA6 A;  2DBB A;  4ZLN A;  1RHK B;  1RE1 B;  2JVR A;  2YKN A;  2WON B;  2OFG X;  1Y00 A;  2YQ3 A;  3HPO A;  1IXK A;  1RU2 A;  4DV0 J;  2NSB A;  4LFB J;  1Y5L B;  4AL6 A;  1HQE A;  4RO0 A;  2EXU A;  3H42 A;  2ZBR A;  4P71 A;  2JX2 A;  1GMV A;  4X4T A;  2HGN A;  2BX6 A;  3QLH A;  5J1P A;  3G96 A;  1P94 A;  3TX0 A;  4HTI A;  4MKY A;  4NYP A;  2RQ4 A;  4EBD A;  5JVG Q;  2O67 A;  2VIC A;  5C42 A;  1KEK A;  2I9S A;  1S57 A;  2C22 A;  4ICL A;  5HQ8 A;  2DIV A;  1LWF A;  1B4S A;  4I2Q A;  2I1R A;  1VLO A;  3KLE B;  4KBI A;  3H20 A;  3MEE A;  1WC5 A;  2J6S A;  2IDE A;  4WXW A;  4MYT A;  3MEK A;  3PHT A;  1EKS A;  3K5N A;  3POT B;  4FBU A;  3TAR A;  3MR6 A;  4ID8 A;  3T1H F;  2K8G A;  1JLB B;  5KT3 A;  4PAA A;  3UI3 A;  3GMG A;  1SIW A;  3NNA A;  1WDD A;  5CYQ A;  1VGY A;  1HNW F;  3BPD A;  4KGK A;  1N5Y A;  1I5O B;  2GIR A;  3N01 A;  3A3O B;  2MQL A;  1RAC B;  1YLX A;  3L7U A;  2WHO A;  3PRB A;  4JI5 J;  3P5B P;  1URR A;  4YY3 F;  4BC9 A;  1FVQ A;  3M30 B;  2G0I A;  5HAO A;  2GML A;  2Z56 B;  3LGH A;  1PG5 B;  1S1T A;  1Q53 A;  3GIM A;  1XN9 A;  3X3U A;  3FCV A;  3D5M A;  1NJY A;  1W2I A;  1JLA A;  4V19 J;  4NA2 A;  1N36 F;  2KJW A;  4N76 A;  1K8A T;  1T9U A;  3CCL S;  3MM6 B;  2LEB A;  1BQX A;  4B08 A;  3PW7 A;  4B3R J;  3MCS A;  5J2M A;  2DGS A;  4K4Z A;  2XEX A;  4DBQ A;  4PQU B;  3NL0 A;  4O4G A;  2CPE A;  1T3N A;  1REV B;  1KD1 T;  2WB4 A;  2A2C A;  1BLU A;  5ADZ A;  5ETS A;  3D1O A;  1T94 A;  3RBE A;  5IT9 Y;  4UTG A;  1S4F A;  4DZ6 A;  4AT1 B;  1U8S A;  4OJ3 A;  5CD4 A;  3IXQ A;  3W8P A;  1UVN A;  3EGW B;  3V6J A;  4Y00 A;  2VU5 A;  3C19 A;  2WVD A;  2OUG A;  1NPP A;  3ZZ0 A;  3RBX A;  1K44 A;  1UWA A;  4QIG A;  3VAM A;  3PIO Q;  4BWM A;  2GMH A;  3LOU A;  3MZI A;  3DN9 A;  3M6W A;  3FCW A;  3GFZ A;  1KTV A;  2QJ3 A;  2RB7 A;  3P3D A;  1LXJ A;  1VIX A;  2R2R A;  3GV7 B;  5AXK A;  2BVZ A;  1HMV B;  1R0A A;  1NK5 A;  4D3G A;  3V6K A;  3MDF A;  3DDN A;  2VJU A;  1FWP A;  1WI6 A;  1FKA F;  3KLG A;  3DXB A;  1C4C A;  1C1B A;  1F1B B;  2MZT A;  3PYG A;  1NLA A;  1RAH B;  2VBX A;  2VL1 A;  3ISN D;  2HVH A;  2OAU A;  3DKD A;  2QSW A;  4NLW A;  3CTR A;  4QWC A;  1XWL A;  4OV1 A;  4DCP B;  1NSK L;  3BQ2 A;  2M0G B;  4EBC A;  1RWM B;  1HBN A;  1PYS B;  2W9C A;  2AX0 A;  3O5T B;  1TFY A;  3R7B B;  3DDK A;  2X1A A;  5B0B A;  1FWL A;  3K59 A;  4J37 A;  2H4W B;  1KTQ A;  1NH8 A;  2BA3 A;  2KU7 A;  2ACM A;  1HNZ J;  1T05 B;  4QU7 A;  1X5S A;  1CS4 A;  1J5O A;  3A12 A;  3C46 A;  3MUV P;  1TAQ A;  1MMN A;  3DOL B;  4IFV B;  4QW9 A;  2I0X A;  3LJP A;  2W9B B;  1TKZ B;  1GXL A;  4C8Z A;  5K14 B;  3D3B J;  3JSM B;  2OHD A;  3FBC A;  1WEX A;  1BQN B;  3QFW A;  1JB0 C;  2Z2L A;  2GO8 A;  2N3L A;  1DZ5 A;  4KRW A;  4I2P B;  1UTA A;  1PKU A;  1ZM2 A;  3M4X A;  5GAG U;  2CJ9 A;  4TQR A;  2CJQ A;  3H25 A;  1R8P A;  3PJW A;  4WU2 A;  3V4I B;  4QU6 A;  2FQQ B;  1RTJ A;  3DOM A;  4F50 A;  1HWK A;  4QOT A;  5E2Q A;  3Q8P B;  5A6W A;  3AJ1 A;  3I9Z A;  1VC5 A;  3FMT A;  3K5L A;  3AOB A;  2Q43 A;  2HHQ A;  2OPS A;  3T41 A;  1ZPW X;  3DLJ A;  4NCB A;  3O6Q A;  3HZE A;  4J9K A;  5C2C A;  2EK1 A;  3HMJ G;  4DG1 B;  2UVR A;  1HFE L;  2WBM A;  1KHW A;  3G6X A;  3DNC A;  3EMT A;  3MXH P;  2MQO A;  2MXY A;  4QR1 A;  2IMO A;  2ZKT A;  5E0O A;  4IDK A;  1X0P A;  3FSI A;  1NND A;  4WCE Q;  1D1U A;  3RG6 A;  5GAH I;  1SUQ B;  2ZVI A;  2AU0 A;  1SL2 A;  3C3L A;  2ZC4 A;  4LQ3 A;  4C4W A;  3LPE A;  2XMU A;  3SQG A;  1CUL A;  1TAU A;  1BWE A;  1YJN S;  3IO1 A;  2VG5 A;  3G2X A;  2OPQ B;  5F8H A;  2YKM B;  1KP6 A;  2L48 A;  3BSN A;  1TK5 A;  2WBR A;  2IBO A;  1FXL A;  1S6U A;  4O4R A;  2EKN A;  2F3J A;  4NMX A;  3ZZO A;  1RWO B;  4IO9 Q;  5CZX A;  2OPR B;  1ZH5 A;  2OJ3 A;  1RHM B;  3AT1 B;  1HBO A;  4ES2 A;  1SL1 A;  2DNQ A;  4NLR A;  3MED A;  3N9U C;  4B17 A;  3FVY A;  3KK2 A;  1G2E A;  1X4A A;  2R8H A;  4X65 J;  3PVX A;  4CNY A;  1VC0 A;  2BM0 A;  2BE7 D;  1Q7Y T;  2EFP A;  2BYC A;  3DLB A;  3CE8 A;  1HA1 A;  4RL1 A;  4DF4 A;  2F65 A;  3EZO A;  1QD1 A;  2HQ3 A;  2ZH7 A;  4NLU A;  4IR9 A;  2L3M A;  3P96 A;  3IWL A;  3NWR A;  1N5V A;  2AT1 B;  1IKW A;  3IAM 9;  5BXI A;  3D7S B;  4DFK A;  2VPZ B;  3TQ1 A;  3LAL A;  3FFI B;  4Q8E A;  3KLH A;  2HEK A;  3LGN A;  3CPW R;  3QJJ A;  2Z0G A;  4IQM A;  2OO4 A;  4K5S A;  1RAB B;  2VQF J;  2D3O 1;  3JB9 k;  5D4P A;  1FTR A;  1QVF R;  1UEV A;  3TVK A;  2K1R A;  3UWT A;  1O0P A;  2JEF A;  2FC8 A;  3JSB A;  4MFB A;  3K5M A;  4DL2 A;  4CLK A;  4C98 A;  5JVH Q;  2VV5 A;  4RBU A;  2LU1 A;  4NAS A;  2O5D A;  2N4D A;  3QO9 A;  2ZM6 F;  3DU5 A;  1UW9 A;  3FRY A;  4DQQ A;  4FF4 A;  2DJW A;  2DGQ A;  3RGI A;  3HHL B;  3T6B A;  3CDU A;  5CHC B;  3H7H B;  1Y5N B;  3NBP B;  2E7X A;  2GAH C;  3FC9 A;  1NSQ A;  4NLY A;  6FDR A;  4DUZ J;  3QMQ A;  1JLE A;  4P7T A;  1N6Q A;  5FDL B;  4LBI A;  2XWY A;  3MM5 A;  3H8Y A;  3TAM A;  2XQC A;  1OG7 A;  2ZDO A;  1UP1 A;  4WXO A;  1TKX B;  1LK7 A;  1MNT A;  1QM9 A;  2FHO B;  3G9C A;  3KDN A;  3WX4 A;  1EP4 B;  2D7S A;  2MLX A;  2FHJ D;  5IQ6 A;  4F3Q A;  1A9N B;  1U02 A;  3AQO A;  2BAN A;  2VA3 A;  2BRK A;  2ZH8 A;  3A13 A;  4J9Q A;  2W7P A;  2PC6 A;  5CYJ A;  3CDW A;  4RR5 A;  5DDP C;  5HJX A;  2XO7 A;  1FKP B;  3R6L B;  6FD1 A;  4LQ9 A;  3OLA A;  2AN7 A;  3WQP A;  5AXN A;  4NRT A;  4ANC A;  4NLV A;  2LXU A;  2ZOM A;  1HBM A;  2IHR 1;  5C24 A;  2ZUG A;  3W2V B;  5I3U B;  2B9W A;  1FO1 A;  5KFH A;  3GP9 A;  3MCO A;  2NRE A;  1EA4 A;  2C3P A;  2MHE A;  5DZ6 A;  5HL7 Q;  3PNI A;  1P27 B;  2G0J A;  4ZPC A;  4CO0 A;  2NUU G;  1S72 S;  1LK5 A;  1SCJ B;  2I5J B;  1RAF B;  4LR9 A;  4JI3 F;  4OFZ A;  1XMQ J;  3DMJ B;  3CED A;  1VBZ A;  1WTF A;  5THW A;  4TN2 A;  3C15 A;  2HGM A;  2OSR A;  2KZZ A;  1I51 B;  3QGH A;  4MIA A;  2J0X A;  5F8M A;  1LFW A;  3D1H A;  1KVI A;  2ZJQ Q;  2DNY A;  3QLH B;  1FJ7 A;  1YBU A;  2VFT A;  3OTE A;  4PUO A;  1VRT B;  3OD2 A;  4YFU A;  3MCM A;  1R27 B;  2OML A;  4LIW A;  4KTQ A;  1ZM9 A;  3C6T B;  5DLF A;  4J5O A;  2GVD B;  2GZO A;  1WHY A;  2IRU A;  1RBO B;  2R2T A;  3FCH A;  3QIP B;  3QGI A;  4LF8 F;  3HHK A;  1N56 A;  2WK4 A;  2ALZ A;  4Y2K A;  4LR7 A;  2WOM A;  5GMD A;  3OR2 B;  2HWI A;  3JQK A;  2KHC A;  4PKD B;  2QFI A;  3MM8 A;  2IA6 A;  3IGN A;  3UE2 A;  1FDD A;  1OYE A;  2V8D A;  1NDL A;  3HVA A;  2KRR A;  2OD6 A;  3HFV A;  1TK8 A;  4L76 A;  4JV5 J;  4C48 A;  2ROE A;  4PG5 A;  3HVW A;  2LMI A;  3NXZ A;  3ZZP A;  1Q81 T;  1CJK A;  2M70 A;  5DQG A;  2XTJ P;  2AJF E;  3OFG A;  1RAJ A;  2G2O A;  2JEJ A;  3RR8 A;  5C2G A;  5M2U A;  3HDS A;  5HK4 A;  1YVF A;  2R7U A;  2XHW A;  3N4W A;  2BJ3 A;  1VBX A;  3HVT A;  3BZQ A;  4M95 A;  3DLK B;  2AF6 A;  2UV8 A;  1FNX H;  1C0T B;  3KUH A;  3J81 Y;  5EWF A;  3OTC A;  1N33 J;  4EWT A;  3LGM A;  4MKA A;  1S1T B;  2G4B A;  3V6D A;  1U1R A;  4BWJ A;  2RT3 A;  5ETQ A;  2BKO A;  2IBK A;  5KG7 A;  2CVE A;  1UZH A;  4AXJ A;  3FUY A;  5IT9 U;  2CDR B;  2WRM A;  3NGS A;  4USU A;  4NLP A;  5KG6 A;  3KYL A;  4C3K A;  1DQ9 A;  3EWG A;  2B6A B;  2BUN A;  2KXF A;  5F8L A;  1RCX B;  2J8S A;  3H5S A;  1Q16 A;  4DV1 J;  5I3Q A;  3H40 A;  4CH1 A;  1R3N A;  1NXI A;  2CZ9 A;  4O44 A;  4Y34 A;  2OSQ A;  4HDH A;  3PO4 A;  1GXU A;  2GHP A;  5EUH A;  2NXU A;  4HR2 A;  2V4R A;  1IM4 A;  3VZI A;  4GKK J;  2F40 A;  3BPS P;  1RLC L;  4DR2 J;  2WB1 D;  5LMN F;  4NYZ A;  4JI7 F;  4KSE B;  1KFS A;  1RAD B;  1LWC B;  4P75 A;  4A8F A;  3H98 A;  1U1P A;  3UD5 A;  3CDA A;  2CPH A;  4UT4 A;  3RB0 A;  1N48 A;  3R5A A;  4CO3 A;  4I6W A;  1U24 A;  4LF4 J;  1WHV A;  3Q22 A;  1XNQ J;  3H0P A;  1IR0 A;  1YJV A;  4NX9 A;  3Q2S C;  2ZOG A;  1IRQ A;  1NJZ A;  1SC4 B;  1RT1 B;  3KLV A;  3BB5 A;  4TQS A;  3GPA A;  1FDN A;  3GSD A;  3TX8 A;  5CXT A;  1FJC A;  1ZM4 A;  1LFP A;  2IM1 A;  2FD2 A;  4DJB A;  2BE2 B;  2W2P P;  5HVG A;  3FT7 A;  1LEO A;  2P6S A;  2PMW A;  2B56 A;  4TYA A;  2PDA A;  3ITH A;  2XLI A;  3VGU A;  1HLW A;  2MQP A;  3CJK B;  1ZAX A;  3OFE A;  4LF5 F;  5ETM A;  4WII A;  1TVR A;  1Y10 A;  2IAJ B;  2J9D E;  4HAC A;  4NLG A;  4B9M A;  1RJJ A;  1R8C A;  4R25 A;  1F60 B;  1UFK A;  4WK3 A;  3HFK A;  5HI7 A;  2HWT A;  2HS3 A;  2DNG A;  4YB1 P;  3N0V A;  3GZ7 A;  3UDL A;  4LF5 J;  3VAK A;  4OI6 A;  2ASD A;  1S0V A;  4PWD A;  2J76 E;  4UQT A;  4YS2 A;  1GMW A;  1ROF A;  5GAD U;  2KG0 A;  1QTN B;  2HNZ A;  1A0O B;  4LFC F;  2MMY A;  1QAY A;  2XBP A;  4TU8 A;  5GME A;  3I55 S;  2UUC J;  3DOM B;  4ZCM A;  1TFW A;  1SC6 A;  1K73 T;  4LMZ A;  1BDT A;  3AOD A;  3R7N B;  1U26 A;  5H9F K;  3GJQ B;  3LAN A;  3EDR B;  4F26 A;  3TR5 A;  2JXI A;  1KHV A;  2OPS B;  1Q8L A;  5T7L A;  2W2O P;  2YWG A;  1FFW B;  4DMZ A;  2QMX A;  3KLF B;  3RJM B;  3GFY A;  1VYA A;  1ACM B;  3CB4 A;  2GVZ A;  1I94 F;  3HO1 A;  1T9W A;  1KLM B;  4K50 A;  4ZVR B;  4GVL A;  4I4B A;  4DLE A;  1YIJ S;  5KFF A;  1C2P A;  3BKU A;  2B51 A;  3THT A;  3I56 S;  1N54 B;  4ZPV R;  1DLO A;  2V2K A;  2N3O A;  1KQF B;  3VCD A;  4ZVU B;  5KFD A;  2LEC A;  1Y0H A;  2FVS A;  1VQ6 S;  2QLJ B;  1CUL B;  2B5J A;  2AY0 A;  1PCA A;  1NKB A;  2DCL A;  3SCI E;  3D0H E;  4OHW A;  4ZS6 A;  2R7T A;  1OQ3 A;  2VG5 B;  4KPY A;  5K8M A;  2UXB J;  2OMO A;  1VQ4 S;  1NUE A;  1RAO A;  3OFH A;  2DNM A;  1P6T A;  3GV5 B;  3IS9 B;  4AAI A;  1X9W A;  2FJW A;  2EFO A;  3TOQ A;  2JL9 A;  2RS8 A;  3D6H B;  2VG6 A;  3DLH A;  3WIU A;  1EET A;  4DR4 F;  1R6Y A;  2XNR A;  3PW0 A;  3TZZ A;  3CIZ A;  1VDH A;  2DT9 A;  2M7S A;  3D9B A;  4C11 A;  2VJV A;  1WEZ A;  2AJQ A;  4DPT A;  1U25 A;  4C6A A;  2DYA A;  4R8U B;  4N8N A;  1EJ7 L;  4ZPW R;  2QA4 G;  2ROP A;  2MY7 A;  4C0B A;  1CPZ A;  2QL9 B;  1WF2 A;  4DL6 A;  4W4M A;  3I31 A;  1GX6 A;  1KVK A;  4DUY J;  4EMD A;  1KQS R;  3I5B A;  1KVJ A;  2X1G A;  4OX7 A;  3ZZR A;  4DSK A;  4B9L A;  1BXN A;  4OZ2 A;  4CLS A;  4A8X A;  4K4Y A;  5CAA A;  2ZJR Q;  2YNG A;  4K0K F;  3PFE A;  2CZV C;  4UUW A;  1GTE A;  4Y3C A;  1YIT S;  3AY0 A;  5B7W A;  3NNC A;  4DV5 F;  4WJB A;  5J1E A;  3GII A;  2J0W A;  1P8G A;  2C1E B;  2PA3 A;  2AEJ A;  1YQH A;  1H2U X;  1Y3J A;  2DR6 A;  1WAC A;  2P8I A;  3TJ8 A;  4KY3 A;  2IA0 A;  2FGC A;  4IH7 A;  1VI7 A;  2E9T A;  2Q6C A;  1KOO A;  1X9S A;  2MQM A;  5KT5 A;  5M2R A;  4DQR A;  3QYY A;  1MN9 A;  3GYN A;  3D4J A;  2KL8 A;  1YJU A;  2C42 A;  5DRK A;  1TV6 B;  1RA7 A;  3Q2T C;  3T3F A;  1ZS6 A;  4ZP8 A;  1RI7 A;  2LDY A;  4EYI B;  4U8Y A;  2OTJ S;  4WFB Q;  4F2S A;  3U1M A;  4YQW A;  3MM5 B;  5EX3 A;  2XS5 A;  4LFA F;  2MQQ A;  2C2K B;  2H3A A;  4NXN F;  2X3G A;  3Q8S B;  2P9E A;  1SI9 A;  1IKX A;  4OHZ A;  4RJV A;  1F0X A;  3A8E A;  2DVI A;  5DZ7 A;  3OLB A;  3ETM A;  1AT1 B;  3RAX A;  5A2Q Y;  1Z2Z A;  1FRX A;  2BAN B;  4MH8 A;  1FFG B;  1S6Q B;  3BBF A;  1W25 A;  3OL6 A;  3RR7 A;  3OTD A;  3ZTQ A;  4GKJ F;  4DR3 J;  5F8G A;  1KDN A;  1UA0 A;  2GPE A;  4DV3 J;  2HKE A;  3TYT A;  2GHW A;  3OHA A;  1BMQ B;  4CDI A;  4CTA A;  4OLO A;  1X0F A;  2XLJ A;  1S1W B;  3SIP B;  2CPJ A;  4L3N A;  4A8W A;  3NEK A;  4PG4 A;  4M5G A;  5F0U A;  2KKE A;  1CJU A;  3AOA A;  2E7W A;  1M5H A;  4AUK A;  2ZE2 A;  3JQJ A;  2JC1 A;  4NL5 A;  3D6T B;  2F7V A;  3C8Y A;  1WI8 A;  1ZZN A;  2LQB A;  1LOU A;  4JYA F;  1XK8 A;  2ZBC A;  3CCQ S;  2QO3 A;  1RT6 B;  1OY9 A;  4WKY A;  1YG0 A;  4CLY A;  2DNH A;  5B0G A;  3AHP A;  1RKJ A;  3DLE B;  2PII A;  5HMW A;  4K8R A;  2XYH B;  5K9F A;  1CJV A;  2ZNZ A;  4RW9 B;  5A8K B;  3WC2 A;  2R3V A;  3IMQ J;  5T41 A;  2CQ0 A;  2HMI A;  2VDH A;  2CQC A;  2MEW A;  2V2Z A;  2WSE C;  1NO8 A;  1M5K C;  1F9H A;  2ABY A;  2Y1L B;  4LR8 A;  3NO7 A;  5F8J A;  9RUB A;  4CNZ A;  4DR5 J;  4CO1 A;  4OZN A;  4DL3 A;  2MHN A;  1BDV A;  2R8G A;  2AJ2 A;  2BNW A;  4OHY A;  5DG7 A;  3MM8 B;  3AAW B;  2RNE A;  3PYE A;  4FF2 A;  2HQI A;  3H2V E;  2GC8 A;  3FBE A;  5EWG A;  1T0T V;  2PI4 A;  4ZVO B;  3I0S A;  3J81 U;  1CQN A;  3EGZ A;  3J7A N;  2BV3 A;  4PXE A;  4P6Q A;  1TKT B;  5B0D A;  1Q0N A;  4XTT A;  2RQK A;  1QAJ A;  2L9N A;  1ZTT A;  3FZ2 A;  2FDN A;  4RW7 A;  3BQ0 A;  5KT6 A;  3G6V A;  2AWZ A;  3QWU A;  1PJ6 A;  3OSN A;  4A8M P;  4DR1 J;  1OIA A;  2B9Y A;  1NDK A;  4PQA A;  5KFW A;  2BE9 B;  2PMZ D;  2FTR A;  2EG1 A;  1RHU B;  4NRU A;  2VBY A;  4RZR A;  3W8G A;  3D0I E;  4ES3 A;  1RP5 A;  1RT7 A;  5HBM A;  4JBC A;  1Y11 A;  1GTH A;  1X4E A;  4K2X A;  3MD3 A;  2J5A A;  2W7A A;  2AX1 A;  2FJV A;  3N5F A;  3RZA A;  2XI2 A;  3CCJ S;  2LA4 A;  1UEU A; 
#chains in the Genus database with same CATH homology
 2FGC A;  3QSI A;  2BA3 A;  2KEL A;  4FXE A;  2JXI A;  2WVD A;  2JXH A;  2WVB A;  1PAR A;  4HV0 A;  2BJ7 A;  3H87 C;  2BJ3 A;  1Q5Y A;  2CAJ A;  1ARQ A;  1P94 A;  1Q5V A;  3LGH A;  2BJ9 A;  1MNT A;  2K6L A;  2CAX A;  4D8J A;  3VEA A;  2BSQ E;  2K5J A;  3OD2 A;  3GXQ A;  2HZA A;  3BKT A;  3BKU A;  1QTG A;  3VEB A;  3BKF A;  2K1O A;  2PC6 A;  2BNZ A;  1U9P A;  2CA9 A;  3QOQ A;  2K29 A;  1IRQ A;  3PHT A;  4ME7 E;  1NLA A;  2AY0 A;  2K9I A;  2Y3Y A;  1X93 A;  2RBF A;  2BJ1 A;  2WVF A;  2HZV A;  1MYK A;  2GPE A;  2NZC A;  3VW4 A;  1B01 A;  3FMT A;  1BDV A;  1BAZ A;  2WVC A;  1B28 A;  2F1F A;  3FT7 A;  2BNW A;  2CPG A;  2JXG A;  2CAD A;  2H1O E;  1EA4 A;  1MYL A;  2WVE A;  1BDT A;  2BJ8 A;  1ARR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...