3LGLA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k382me2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
b'SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
molecule tags Cell cycle
source organism Homo sapiens
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA01
4ZN3A 2RHUA 1M90U 3OYCA 3S3NA 4GY5A 1X6OA 2R58A 2LTOA 3OMCA 1S72T 2M16A 3PNWC 3MP6A 2LVMA 2GFUA 5KCHA 1QVFS 3LGFA 3OYEA 3OYLA 3P8DA 3H6ZA 3ZEHA 2MWOA 3OMGA 5DLQE 2RI5A 2WACA 1NPPA 3S3MA 1NPRA 2VYTA 1M1GA 3MEAA 1QVGS 3LYIA 4QQDA 3OYKA 4A4GA 3MEWA 1VQ7A 3GOXA 1VQPT 3LX7A 1YJ9T 3NTIA 1KQSA 4ZTFA 3MO8A 3CCRT 1RL2A 3CCUA 3CCET 2R57A 1YJNT 3FLGA 1YJWA 3TREA 3UT1A 1VQ9A 1VQ7T 2JUFA 3CCLA 4II1A 1YBYA 5DM7R 3G4SA 3CMEA 5KE2A 5J39A 3OYJA 1VQ4A 2X35A 1S72A 2D9TA 3C4SA 2M0OA 3E9GA 4IKFA 1BKBA 3CEYA 1K8AU 4Q5WA 1W2BS 1M1KU 1NZ9A 1OZ3A 2BKDN 3HKSA 2EKOA 3OYNA 3CC2T 5D6YA 4BE0A 3OYAA 1Q86U 4IUQA 2LDMA 1WJSA 5C0MA 4B9WA 4X34A 1VQ8A 4BE1A 1KHCA 2GFAA 3CC2A 4UC4A 5IT9E 4E7HA 3A5ZB 4QVZA 3CCEA 5IN1A 3F70A 3CC4A 3CC4T 5KH6A 3G71A 2R5MA 2NLUA 4ZN1A 1VQKA 1OYXA 3G6EA 2QQRA 3S6WA 5FROA 3CMET 2QEXT 2O4XB 4N4IA 3OYIA 3CC7T 2EQMA 1Q7YC 3J7AF 4L59A 2EQJA 3DB3A 2RHZA 3ME9A 1M90C 4FL6A 4BD3A 4QW2A 3PMIA 2G3RA 3DB4A 3UWNA 3QKJA 3CCQA 2L8DA 1VQNA 1YJWT 3CD6A 1K73C 1YJ9A 2QA4A 2JNGA 2CKKA 2F5KA 4IUTA 3OS0A 2DAQA 2PQWA 3CXCA 4IUPA 3H8ZA 1Q81C 1JJ2A 3CMAT 2K3XA 1KHIA 3CCVT 3CD6T 2RHYA 1KD1U 4E7KA 3CCLT 4BACA 2KDSA 3OQ5A 4E7LA 3CCUT 4A4HA 3P8HA 3PFSA 1YIJT 4E7JA 5D6XA 1VQPA 4YTLA 1OZ2A 3I55T 1VQLA 4PLLA 3CCRA 2RHXA 2EIFA 1YHQT 1YHQA 1VQOT 4CRIA 3PMTA 2QEXA 1OI1A 3CCMT 4EDUA 2RO0A 3CCST 3CXCS 2OTLT 3MP1A 2LQ8A 3NTKA 3J81E 2BIVA 1WJQA 3NTHA 2JVVA 1N8RC 1MHNA 3OW2S 4OVAA 2RJDA 1N27A 4A4EA 2MWPA 3CMAA 2O4XA 2X4WA 2JZ2A 3CC7A 3EAEA 5J3BA 1M1KC 1Q7YU 1K8AC 2QQSA 3PIPA 3Q1JA 5KE3A 2DIGA 3CCJA 3L2WA 4PLIA 2P0KA 1VQ6A 2RHIA 1VQMA 3MEUA 2OTJA 2QA4T 3SD4A 5C6SA 4Z02A 2L3RA 4BDYA 3DLMA 2XHCA 2LCLA 2E6ZA 1YITT 1YITA 5J26A 3OYBA 3G4ST 3FC3A 4C5GA 1EIFA 1KC8C 1VQ5A 2EQKA 1JJ2S 4C5IA 1VQ9T 4C5EA 3OY9A 1WGSA 3CPWS 2X4XA 4PL6A 2E70A 3ASKA 1VQNT 5M9OA 4N4GA 2EQUA 2HQXA 1K9MC 2RJFA 4QQ6A 2IG0A 3LH0A 5IAYA 2KVQG 3I56A 3META 4A4FA 3L42A 1SSFA 1VQ8T 2LCCA 1W2BA 4N4HA 3OYFA 3OYGA 3CCVA 3CCJT 4QQGA 3CCMA 5CIUA 1VQ4T 3P8BB 3L2RA 2DO3A 4RG2A 4B9XA 2E5QA 3OA6A 3I56T 3OS2A 1YI2A 3L2UA 1KC8U 3CPWA 4BE2A 2B8AA 3LGLA 1VQMT 5LL6S 3OYDA 3O8VA 1IZ6A 2BUDA 3BDLA 3FEOA 3M9QA 3KBGA 2K3YA 3QJ6A 1YIJA 1NJIC 5FRMA 3I55A 1Q82C 1K9MU 2GF7A 3QIIA 1QVFA 2XK0A 2JTFA 1Q82U 3LLRA 3DLLA 3FDRA 2LRQA 4LD6A 5D6WA 1XNIA 3OYMA 1KQSS 1VQ6T 5KCOA 2RI2A 2E6NA 3CCSA 2OTLA 5FLXE 3PIOA 3MEVA 4HCZA 2HQEA 1K73U 1N8RU 2JOYA 1WJRA 3G6ET 2YRVA 2RJEA 4BDZA 2EFIA 1G5VA 3S3OA 3OB9A 2R5AA 2RJCA 4E7IA 2MI6A 5A2QE 1YJNA 1UEBA 3J80E 1Q86C 3JAME 1YI2T 3OW2A 2RI3A 3CPFA 4IURA 4FU6A 3MP8A 4IUVA 2XDPA 2OTJT 1VQKT 1VQ5T 5HY6A 3ER0A 2L89A 4ZTJA 3OS1A 5FRNA 1KD1C 4NS5A 1H3ZA 1VQLT 3G71T 3E9FA 3KUFA 2DIQA 1NJIU 3QBYA 2X4YA 1Q81U 3CCQT 3L2VA 1QVGA 4IUUA 1RI0A 1VQOA 4C5HA 4TVRA 2M1HA 3L2QA 1XTDA 2FHDA 3OYYA 3OYHA
chains in the Genus database with same CATH superfamily
3OYCA 5GMKh 1W6XA 5GAN3 3S3NA 2M0YA 4GY5A 1X6OA 1ZA2B 2R58A 1WXUA 3MP6A 2FPDA 1I1JA 1QKWA 5KCHA 4CC2A 2NUZA 1UG1A 3H0FA 1PRMC 3RBBB 4FT2A 4RG8A 5HCKA 2X51A 4QT7A 2CZ1B 4XK8E 3P8DA 3H6ZA 4M75B 3OMGA 2RI5A 1SRLA 4M78B 1NPPA 4HT8A 5FU6C 3MEAA 2K79A 2PVDB 1X6GA 3LYIA 4X9CA 2EGEA 3HFOA 4ZGDB 2XDBA 1G3TA 4HVUA 1M3CA 2K5IA 4C92C 2KT1A 2EJGA 3CCQQ 3LX7A 2JS0A 1MUZA 4C0DC 5IHKA 1BIBA 4ZTFA 2V26A 1I07A 2DLPA 4BI4A 1SRMA 1YJNT 1YJWA 5LJ3g 2E1HA 2L3PA 1FXXA 3CBMA 3GIBA 1VQ9A 2DX1A 3X24B 2DEQA 3M0QA 1ARKA 1QP2A 1GBQA 2EWNA 2PUKB 4II1A 3CCLA 2HBWA 1YBYA 3ZFJA 4J9FA 5J39A 3JCMP 4RMOA 3L1AA 1S72A 3QSUA 2EYZA 1MMGA 3SDZA 1VIFA 2W10A 2M0OA 4JLGA 4FYWB 1Q7YR 3E9GA 4IKFA 1PD1A 1PNJA 2KT8A 1C6VX 1K8AU 2L3QA 1M1KU 1OZ3A 1WI7A 2JM9A 1UGRB 3CC2T 2DJQA 2CP3A 4BE0A 4JPBW 3CXCP 1WJSA 5C0MA 3C12A 2CP0A 4B9WA 4HCCA 3H9NA 1VQ8A 4BE1A 2PZ1A 1QP3A 1UHFA 2F2WA 1I81A 5GAN5 1M3BA 5IT9E 3FJPA 1R77A 1VOMA 4C92G 5IXBA 2MPXC 2LP5A 3GP8A 2NYSA 5GMKe 2CZ7B 2IVWA 2RQWA 2HCKA 1U5SA 1QVFP 3G6EA 2HSPA 1ZLMA 5FROA 2DK3A 2CP6A 5GANd 3OYIA 3CC7T 1AOJA 4QVDA 3J7AF 1YCSB 4A54A 5GAN4 3ME9A 3I5SA 1YP5A 1IO6A 5CVIA 2L8DA 1R8OB 1VQNA 4HVVA 2AZVA 3A8GB 4M77C 8AT1B 1U1TA 2FZKB 2F5KA 3VYGA 2RPNA 3HHTB 3CXCA 2AZSA 2M02A 1KHIA 1WX6A 2DFUA 3WVEB 2EJFA 1KQ1A 2DXCA 4BACA 2KDSA 2RQVA 4A4HA 4F7UA 5FU7B 4E7JA 1VQPA 4YTLA 2E3IA 1HD3A 3JB9G 3CCRA 2E65A 3N5BB 2PU9B 2RHXA 4AG1C 5CR2A 4E6RA 1YHQA 2QEXA 4C92A 2E5KA 2YUNA 3MP1A 2BIVA 1WJQA 3HFNA 3NTHA 4EMKB 1MHNA 3A8LB 4E7ZA 2DL8A 1X69A 4RTZA 2MWPA 1K8AR 2JZ2A 4DBQA 3EAEA 2HEQA 1M1KC 3IQLA 1Q7YU 1X2QA 1K8AC 1WPYA 2JM8A 2L2PA 1H92A 3CCJA 4M78A 1ACMB 4AFUC 3LWHA 2OTJA 3E19A 4KT0E 2JS2A 1ZSZB 4M77E 3SD4A 1M27C 4C0FA 4F7UF 1GRIA 1GCQA 3QHSA 3DLMA 3VS1A 1QW1A 1BYMA 1FMVA 2DL3A 3HRTA 2E6ZA 2VGMA 1YITT 4CI0C 2QK0A 3UPUA 1IXDA 2ZPFB 4C5GA 3R6OA 4C92F 5L23A 4Y92A 1FWZA 1W4SA 3OY9A 1WGSA 1MGQA 2DBKA 3ASKA 5CK9A 3M59A 1B3QA 1WQ7A 2EQUA 2J6OA 1UGPB 3QO3A 2DTIA 1EFNA 2KVQG 1LNXA 4N0AC 3I5RA 4BY6C 4M75F 5CKFA 1SSFA 4LUDA 3A8OB 2LCCA 3UATA 1GBRA 4N4HA 2RQRA 3CC7Q 3SHWA 2VWFA 1VQ4T 4M75C 2DL5A 1X6BA 5GAN6 4AFZC 2DVEA 2E5QA 3CCRQ 2JMAA 3OS2A 4V2SA 2LMJA 3HPWA 2BZ8A 2WSFE 4F7UE 2VXEA 3CPWA 1PHTA 2O9VA 3LGLA 1VQMT 4ANJA 2VC8A 1IZ6A 1MMAA 3BDLA 3QXEB 1G3SA 1OULA 4HA8A 4E2FB 4RKUE 3FEOA 2H3JA 2NUPA 2KSSA 1KIKA 3EFOB 1T0HA 4J7IA 1PSEA 4OMOA 3I55A 3GNGA 3INZA 3UDCA 4J9IA 2XK0A 1IHWA 2P4TA 1J3TA 1Q82U 1NBEB 1Q95G 2EYYA 1D0YA 5D6WA 1XNIA 4XU0A 2KK4A 3CCJQ 2RK1A 2FPFA 3MEVA 2GBQA 2BTTA 1K73U 4J9DA 3LWIA 1NM7A 1AWWA 2KRMA 3WXMB 1WJRA 1F1BB 3I55Q 1AZGB 4FT4A 3OB9A 5GANe 5EG2A 1I0CA 3M0PA 2MI6A 2DTHA 4C8QE 1YJNA 4M75G 2WSCE 3CC4Q 2K4YA 4FU6A 5LJ3d 4IUVA 4KGXB 1W1FA 5CAIA 2OTJT 2RA2A 3QYGB 1Y7XA 3ER0A 4ZTJA 5GAOr 3OS1A 3VS6A 2HL3A 2V8IA 1OV3A 1YIJQ 2ZPIB 1RI9A 3BE3A 3G71T 1YN8A 3VS3A 1NEBA 3QBYA 3HTRA 3JCMV 2X4YA 1HJDA 2V1QA 3JCMW 3QYHB 1X27A 3RMSA 5IHNA 3L2VA 4AMCA 1RI0A 1QVPA 2H8HA 1TUGB 2M1HA 3M53A 3L2QA 1AVZC 3QWYA 1O75A 1ZUYA 3JCMX 1M90U 5A0DA 3JCMJ 1S72Q 2C0TA 2LTOA 4OMLA 2XU8A 2QXFA 1QVFS 2AT1B 4OMFB 2OTJQ 3OYEA 3OYLA 1ZX6A 2KRSA 4XTVA 3JCMg 2DMOA 3ZEHA 2MWOA 1C1AA 4NOYA 5DLQE 2WACA 1NPRA 5ECAA 2LNHB 3OYKA 4A4GA 3C0CA 4MZMA 3X28B 1G83A 3TSWA 3GF5A 1VQPT 2X9HA 1YJ9T 2OAWA 1ZBJA 4KUIA 3VJPA 2HZYA 3CCET 2I2LA 2R57A 3A8HB 2GTOA 4M7DG 2VKNA 1AEYA 1VQ7T 5GMKm 1SPKA 2YRDA 4LE9A 3AT1B 5LJ5g 2EGCA 4PJNA 1NLPC 4J9GA 2FRYA 2MOXA 4BB7A 5I11A 1WFWA 4L6V5 4PFOA 1XQHA 2G6FX 5CKBA 5LJ5f 2EYWA 3PGGA 4M77D 4RTVA 2YUOA 1KSWA 3REAB 5A0LA 5I2SA 3CEYA 4Q5WA 2QI2A 1VQ4Q 2LT4A 3KXTA 2BKDN 3HKSA 3H41A 4JRPA 3CBPA 2A36A 2DL4A 5D6YA 2DVJA 3V8JA 2XKOC 2LDMA 5FU6B 2EQIA 1CSKA 1GFCA 3EGDB 4X34A 1ZSGA 3QZ5B 1BBZA 1V76A 3JB9D 1KHCA 1Y96B 2KQWA 2ZCFB 2QGGA 2SRCA 3CC2A 3CCEA 1K9AA 3CC4A 3CC4T 4LDYA 3G71A 3BDUA 2RQUA 1RACB 3V7SA 4EMGA 2NLUA 3R6NA 1VQKA 4PJOG 1U8RA 1YNZA 2DZCA 2J6KA 2QQRA 1YJ9Q 3CMET 1RAGB 2M9UA 2KYMA 2O4XB 2EQMA 1JXMA 2QASA 4AFQC 1Q7YC 4L59A 2EQJA 1B07A 2RHZA 3DB3A 3PVQA 4O5VA 2RM4A 2DM1A 4BD3A 3JB9I 3UWNA 4J8OA 4M4ZA 1YJWT 3CD6A 2JTMA 4HT9A 1QLYA 5GAOl 2QQAA 3CCEQ 1PCXA 4C92D 4IUTA 1AWJA 1Q86R 3V7CA 1UTIA 3H8ZA 1FMKA 1PKTA 4HKEA 1JJ2A 4HVWA 4RCBA 3TU4K 4JRKA 3JB9J 3CCVT 1D0ZA 3CD6T 1KD1U 3NMZC 3JCMh 3QPHA 2PTKA 4BI3A 3HP9A 4E7LA 1RLQC 1EZZB 2PUOB 3P8HA 4OF1A 4KUDK 5D6XA 1OZ2A 3I55T 4PLLA 2DILA 1OEBA 1GFDA 3VS5A 4OB3B 1KQ2A 4PJMA 4M78D 3C94A 4XU3A 1NLOC 2V1RA 4ESRA 4BY6B 4JRQA 2DEUA 2P0QA 1UDLA 3CCST 3CXCS 3M0SA 3HRSA 2JVVA 3OW2S 2OX7A 2HAXA 1M30A 3EHRA 4C8QC 2XICA 1KD1R 1KQSP 4A4EA 1CKAA 3MKDA 3CCMQ 4BI8B 2X4WA 1PKSA 2PVGB 2L3SA 3CMEQ 3EGXA 3OSVA 3M55A 4CC4B 2O9SA 2KI7A 2LJ1A 4M77A 5KE3A 4BUGA 4F7UG 2EW3A 2YLBA 2QGFB 3EGUA 5KYUB 2K2MA 3MEUA 2QDLA 1Z9QA 2L0AA 5C6SA 4Z02A 5GAOn 4KRTA 2QDYB 1RABB 2LCLA 4PJLA 3T9NA 3H0IA 3A8MB 1YITA 1UJ0A 1MV3A 1OPLA 3EH2A 2HL5C 5GANh 1VYUA 1GCQC 1Y0MA 4C0DB 4PJOD 1U1SA 4DBFA 5GAOm 3M4GA 4C5IA 1BCOA 2PNIA 1N9RA 1SF9A 2MK5A 2CH4A 1ABQA 2K5FA 4HCBA 2C0OA 5HKCA 2LX9A 2CP5A 2BE7D 1VQNT 3VKIA 5M9OA 1VQMQ 1KC8R 2FRWA 4QQ6A 2IG0A 1UGSB 4JZ4A 1K0SA 4RCCA 3JRZA 3META 3I56A 1K73R 4XTUA 3FB9A 2DXBA 5GAOp 2LQKA 2XMFA 2DYBA 1W2BA 2JW4A 2ENMA 4QQGA 5CIUA 1JJ2P 3FIFA 3L2RA 1QWFA 4RG2A 5GAMf 3I56Q 1I8FA 2KGTA 3HL8A 4LUEA 3I56T 1KG1A 5GMKj 2D8JA 1YI2A 1SSHA 4J5YA 3THKA 1SG5A 1M8MA 4M77G 1D0XA 1KC8U 1RAIB 2CGHA 3OYDA 1OOTA 1Y96A 2BUDA 1Z9ZA 2DA9A 1GCPA 2ED0A 2LQNA 2C0IA 1ZUUA 3QJ6A 1YIJA 1WHJA 4JJNK 2MCNA 3EGXB 2KBTA 1LCKA 5FRMA 5GAMj 1M2VB 2QAZA 1VYTA 3I35A 3E2UA 6AT1B 1XOVA 2KXDA 2CSIA 1VQ5Q 1QVFA 3D7SB 2QA4Q 1X43A 3DLLA 2JTEA 2AKLA 1V29B 4LN2A 2ZPHB 1M2OA 4DBRA 3ZL7C 3CCSA 2HQEA 2Y4XA 1QCFA 1N8RU 3OBWA 4J83A 1HSQA 3U23A 4PKCC 2RJEA 3CMAQ 4BDZA 3EG9B 2P4RA 1G5VA 3S3OA 2RJCA 2XI9A 1UEBA 3TCJA 2X4JA 1Q86C 3JAME 3CCSQ 4M7AD 3CPFA 2HD0A 2JT4A 2XDDA 2XDPA 2PVOB 1QKXA 1Y57A 5HY6A 2O01E 4EMHA 5FRNA 5CO7A 4M7AC 2JXBA 3EG3A 1VQOQ 4KH0B 1WDXA 3M58A 1MNEA 1NJIU 2VXFA 2CZ6B 3L2ZA 1Q81U 1I4K1 3CCQT 1BK2A 2DRKA 4FIBA 4IUUA 1VQOA 4C5HA 5GANg 1W70A 2FB7A 2KRNA 4JS5A 1YJNQ 1TH7A 1M8VA 2FHDA 3SWNA 4ZN3A 2RHUA 4F04B 2RQTA 4CC7A 1BIAA 3BFMA 3OMCA 3VS2A 4OMQA 1S72T 3PNWC 3PE0A 2LVMA 2D1XA 1IHVA 1OX9A 2CREA 3I9QA 2COYA 4GBQA 2QTVA 1M2VA 2CUDA 5GMKl 2ZPGB 4J6XA 2VYTA 2HNIA 3ULRB 4IIMA 2ZPEB 1QVGS 4QQDA 2J05A 2EYXA 2MMPA 1TUCA 1O9SA 3MEWA 4DEXA 1VQ6Q 4J7FA 2LQWA 2GCXA 4JUVA 2LNVA 1RLPC 2K7AA 5FWBA 4ZGJB 2DBMA 3MHXA 2NUTB 1CKBA 3CCRT 2IIMA 2IPOB 2AHJB 3CCUA 3GLXA 3NHNA 4M78E 4DOVA 3FLGA 1VUBA 1U06A 3UA6A 4CC3A 1PSFA 3BW1A 3TREA 3UT1A 3JSCA 3JCMb 1MMDA 2JUFA 2O2OA 3A1PA 3URGA 3RNJA 3CMEA 5KE2A 2FEIA 5GJVB 2FL7A 4M78G 2X35A 3TEEA 1NE8A 1D3BB 3C4SA 2FZCB 4DA4A 4P5NA 1UUEA 2HMAA 5GANj 1EX4A 4KBMB 2EGAA 2CP7A 2DD4A 2E10A 5GAMg 1M4ZA 4JJBA 4C92E 2K3BA 4ELYC 2KMTA 1W2BS 1M1KR 3BY7A 4L5GA 1NZ9A 5KYUA 1YWOA 5CCAA 2CP2A 2EKOA 2BZXA 2VGNA 1WHLA 2A7YA 2YLCA 4M75E 2LC4A 1UGVA 3VV0A 3OYAA 2RH2A 1Q86U 2K5LA 3G1JA 4IUQA 1YCYA 4MMLA 2YDLA 5LJ5j 2P0PA 3CQTA 4XTZA 4FSXA 3SWNB 2BE9B 5KYXB 1IREB 1IB8A 4NL3A 1Q81R 1PC0A 2GFAA 3VRYA 2D6FA 1NJIR 2KY9A 4QVZA 2CZ0B 2DKGA 2JN0A 3MJXA 1TU0B 5KH6A 5KYYA 2H3EB 1VQNQ 1TOVA 4LNPA 4OGEA 4ZN1A 2KR3A 1TXQA 1OYXA 4JZ3A 2DYIA 2CUBA 2CT3A 1IGUA 3M5AA 5HK3A 4M7DA 1WNLA 4RTUA 3QG1A 2HDAA 5CKEA 5GAN8 4FM4B 3VS0A 2G3RA 2K2VA 2AKKA 3DB4A 2LJ0A 2CT4A 2WSEE 3QKJA 3CCQA 1TS9A 1SKUB 1HXDA 1YJ9A 1UECA 1RUWA 2V8KA 3OS0A 2DAQA 1OX8A 2PQWA 2DERA 2F2XA 4A63B 4XTWA 2QQBA 1Q81C 2K3XA 3VS4A 3NFCA 2RHYA 1TSFA 2JMCA 2KE9A 2LCSA 2F1LA 3CCLT 5LJ3j 3PVLA 3OQ5A 3CCUT 3OSSC 2YSQA 2J6FA 4C8QG 4R56A 1YIJT 2W0ZA 1VQLA 1GL5A 3JV3A 2HKNA 2QTXA 4D8DA 2ZPBB 1V1CA 2EIFA 1YHQT 3JCMQ 4N0AA 4OB1B 3PMTA 4C0ZA 1KFZA 2LT1A 1OI1A 2FVUA 3CCMT 2DTOA 4PJJA 1N8RC 1K4US 4F14A 2RJDA 4AFSC 1N27A 4PFPA 3GPLA 5KYXA 2MYSA 4WCIA 3CMAA 4IIOA 1VQ9Q 1DJ7B 3OW2P 3QWXX 5J3BA 4C8QF 3Q1JA 3PIPA 2DIGA 1X75C 4NL2A 5GAN7 2QQ9A 2P0KA 1G3WA 2RHIA 1VQMA 1QVGP 2YUPA 1K1ZA 3A98A 1SHGA 4BDYA 4QKUA 4Z88A 4M77B 3VYHB 1T0JA 3VU3C 1E7OA 3QJYA 2CDTA 2E64A 4MZTA 3FC3A 1EIFA 4XQ3A 3QUIA 3JCMe 3V8KA 2FO0A 1VQ5A 1N6AA 2Y4YA 3VUBA 3MPUB 2DXTA 1VQ9T 1QCOA 4C5EA 2GQVA 1HYOA 1MV0B 1K0XA 3JCMc 4JJDA 1X2KA 3EGDA 4FW1A 2X4XA 2DL7A 2YT6A 4OMNA 4X9DA 2HQXA 1H8KA 2RJFA 5IAYA 1NG2A 5I21A 1AZEA 2DF6A 1VQ8T 1MNDA 1RAHB 2DE0X 3OYFA 4D8KA 3OYGA 4RTYA 3REBB 3P8BB 4DQ2A 4FW2A 4OGCA 2BZYA 4XU1A 1TUDA 3TQ7P 1H3HA 4LDUA 3HSBA 3L2UA 4RTWA 2RMOA 1QWEA 5EC7A 1N9SA 1FYNA 2I0NA 2OAUA 4BE2A 2B8AA 2ECZA 1E6GA 5LL6S 4JDSA 4OMMA 4PNOA 3EG9A 1TTHB 2VASA 2QYZA 4RUGA 2A28A 3KBGA 4B6MA 1I5OB 2CYZB 1NJIC 2O88A 3RESA 2VUBA 1QQJA 3CCUQ 1H641 4A4KA 1Q82C 4FYXB 4JLIA 2KAFA 2ED1A 3M57A 2JTFA 2RNAA 4EIKA 3G71Q 1UE9A 3PTAA 4LD6A 1M3AA 4M7DE 1WXTA 3OYMA 1VQ6T 1OU9A 1K76A 5FLXE 4J6YA 4HCZA 4OB2B 3M4YA 2KXCA 4OB0B 4LD9K 5LJ3e 4EPCA 2JOYA 1M5Q1 2CH4W 4MZPA 2RF0A 3M0TA 3M0UA 3JCMf 1B34A 2DRMA 7AT1B 4E7IA 3CC2Q 2L5QA 5A2QE 2ROTA 3J80E 1YI2T 3CCVQ 4J9CA 3OW2A 4R55A 1WHMA 1OPKA 1M9SA 5CQXA 1VQKT 4O6JA 2MAMA 1VQ5T 1KJWA 2L89A 1I5LA 1WHHA 1ABOA 1FX7A 1WXBA 4NS5A 2D0NA 1UFFA 4WTOB 3KUFA 4J9EA 2DIQA 1WYXA 3O5ZA 4RTTA 5GAMe 4R0KA 4Z8AA 1TG0A 3AHUA 3EFRA 4E7SA 5LJ3h 2AIRB 3OYHA 1K9MR 4KULA 4FYYB 4M75A 4RTXA 5D7UA 5GAN2 5DLOA 1JB0E 2M16A 4LDWA 2GFUA 2KEAA 3LGFA 1G8XA 4ME7A 1PD0A 2EAYA 3V8LA 5FW9A 1PRLC 2GNCA 3G7ZA 4LDXA 4GLKA 4DBHA 3S3MA 4WF2A 1M1GA 5IXFA 2FYKA 1D3BA 3RIRA 4JRIA 3TSZA 3V7RA 1VQ7A 2DXUA 4ZGEB 3RDVA 2E12A 4XU2A 1VQ7Q 4KGZB 4K11A 3GOXA 2YWWA 1M90R 4ORZA 3NTIA 1KQSA 1LJOA 3MO8A 1RL2A 1D09B 2A37A 2YHTA 2MIOA 3NGPA 2K57A 1PM3A 4DOWA 3M56A 2A08A 4PFZA 3FJ5A 1B34B 1YWPA 1WQWA 4AT1B 2E4HA 4C8QA 3RKYA 2V8JA 3RKXA 5DM7R 3G4SA 1VQLQ 3C95A 5I22A 2RD1A 4D6WA 3OYJA 1VQ4A 2D9TA 3X20B 3HRUA 1M1FA 1AWXA 1WLPB 4Y91A 1BKBA 1BI2A 3PT9A 3RKWA 1BU1A 4VUBA 1IGQA 1LVKA 1G2BA 2ZZDA 2EKHA 2KYBA 2YUQA 3OYNA 5HK0A 1G3YA 1RAAB 2GQIA 2ROLA 5FWCA 2ZAEA 2OI3A 1FMWA 1X01A 2P84A 2EVRA 5CKDA 4PJOB 1KK7A 4UC4A 4E7HA 3A5ZB 4J9BA 2E3HA 5IN1A 3F70A 1JQQA 1WIEA 2OJ2A 1N5ZA 1ZSZC 2C06A 1AWOA 1LOJA 2R5MA 1JO8A 2RK2A 3QZ9B 4OMPA 2COZA 4M7DD 1D1BA 1NYGA 3S6WA 2QEXT 4J6WA 2XG8D 1WZOA 4N4IA 1QMCA 3DKMA 2DPPB 2B86A 1RAFB 2HQHA 5KYYB 3X26B 1U3OA 2CS7A 1M90C 4FL6A 4QW2A 3PMIA 4HCKA 3QDRB 2NUPB 3EFOA 1K73C 2EBPA 5KYWA 4KGVB 2QA4A 2EYQA 5GMKi 1WHKA 2F5TX 2JNGA 2CKKA 3EHQA 1P92A 2NWMA 4IUPA 4XTYA 2ESWA 5CQYA 2O31A 3ZBDA 4Z89A 2JJ9A 3SFMA 3CMAT 1YFNA 1S1NA 4M7AF 1UHCA 1Q82R 4E7KA 4M7AA 3VS7A 8ATCB 1OQKA 1VIEA 5DY9A 5FU7C 2ATCB 4M78C 2HBPA 1JXOA 1MMNA 2VVKA 4PJOC 3PFSA 1VQPQ 1JBMA 1AD5A 2D0QB 1JU5C 5LJ5d 2DJZA 2YRCA 2SEMA 2X3WD 1R0CB 1A0NB 5AYFA 1VQOT 4CRIA 4EDUA 2QEXQ 1W2BP 1IRXA 2RO0A 2OTLT 5AT1B 4MDXA 1VQ8Q 5A0GA 2LQ8A 3NTKA 3J81E 1UGQB 3EG0A 3EH1A 1UB4A 3NPFA 3G4SQ 4C0GA 2AK5A 4OVAA 5L8RE 1ZQ1A 3RR6A 2EPDA 4GLMA 5CKHA 4PJOE 1BI3A 2Z0WA 2DETA 2LJ3A 2O4XA 5LJ5e 4J9HA 5GAMh 3CC7A 1C0MA 1NYFA 1XJWB 3FRNA 4JS4A 4M75D 2ZGWA 4XAXB 1T3SA 2QQSA 3UA7A 1TWBA 2KROA 1ZBXA 2ABLA 3L2WA 4Y28E 4PLIA 1VQ6A 2LZ6B 4FCYA 3OS5A 2QA4T 2DD5A 2E41A 2FG0A 2L3RA 4EMKC 3CCLQ 2XHCA 1ZHIA 1JEGA 4X1VA 1PG5B 3M54A 1BI0A 3G6EQ 5J26A 1BB9A 3OYBA 4HXJA 5IHIA 2RN8A 3G4ST 3M0RA 1ZUKA 2A0FB 2DZ9A 2M51A 3GBQA 4AG2C 1KC8C 9ATCB 2DNUA 2EQKA 1JJ2S 4OP0A 1WA7A 1YITQ 3EFSA 5GAMd 3CBOA 1YI2Q 1OU8A 1JRIA 3CPWS 3E1SA 3H0HA 2E70A 4PL6A 1VA7A 2YXYA 2K6DA 4N4GA 4QVCA 5GJWB 2J06A 3JB9F 1K9MC 2KNBB 4F17A 1SEMA 4F16A 3LH0A 1GXIE 1Y71A 5I2MA 1B7TA 4A4FA 2FPEA 3L42A 4C8QD 2COWA 2A3LA 3CCVA 1VYVA 3CCJT 4XTXA 3CCMA 3OBYA 2DO3A 2XD0A 4B9XA 3WVDB 3MCAB 3OA6A 4M7DB 4ATOA 1SHFA 2CSQA 3GNFB 3CD6Q 1RADB 1QCNA 1T3LA 2J7IA 4LXCA 3O8VA 2GGRA 1YHQQ 1AHJB 4DEYA 1ZA1B 2EJ9A 3M9QA 2K3YA 4MMKA 3QDFA 1WHGA 3EG1A 4C8QB 5LJ3f 4FSSA 2LX7A 3LW5E 1K9MU 2GF7A 3QIIA 4M7AG 2QG9B 3VRZA 4A53A 4KH1B 4MDWA 5GANf 3VUZA 3SB2A 4LDVA 3RERA 3LLRA 2F69A 3FDRA 2GTJA 2LRQA 2VB6A 2VV5A 2K9GA 5IH2A 5KCOA 3X25B 2HSEB 2RI2A 2E6NA 1KQSS 2OTLA 3UF4A 1HK9A 3PIOA 1BI1A 1E6HA 4M7DF 4M77F 4EMKA 2RB6A 4JJCA 4M7AE 2MF2A 3G6ET 2YRVA 4PK4A 1UJYA 4M7DC 2EFIA 5KYWB 1Y07A 5GAOq 2X3XD 3RUXA 1D1CA 2R5AA 2FZGB 2F2VA 3SEMA 2OTLQ 2RI3A 2HKQB 4IURA 1NEGA 3MP8A 4PJOF 4PJOA 2NUTA 4M7AB 1AT1B 3SWNC 3TVTA 1ZSZA 1LPLA 1VQKQ 4F7UB 1KD1C 1RAEB 5KYNA 2Y90A 1H3ZA 1VQLT 1BCMA 3E9FA 1N8RR 4FYVB 4M78F 3JB9H 3RMQA 2XIDA 1D1AA 1R0BG 4ELZC 3EG2A 5LJ5h 3CPWP 1QVGA 4ZNXA 4C92B 1YJWQ 3LH5A 1PWTA 4TVRA 4E47A 2D8HA 3JCMd 1XTDA 3KFVA 3OYYA
chains in the Genus database with same CATH topology
4ZN3A 2RHUA 4KULA 3JCMX 3OYCA 5GMKh 1M90U 4M75A 5GAN3 3S3NA 1BIAA 5A0DA 4GY5A 3BFMA 5GAN2 3JCMJ 1X6OA 2R58A 2LTOA 3OMCA 5DLOA 1JB0E 2M16A 4LDWA 1S72T 3PNWC 3MP6A 2XU8A 2QXFA 2LVMA 2GFUA 5KCHA 1QVFS 3LGFA 4OMFB 4ME7A 3OYEA 3OYLA 4FT2A 4RG8A 2EAYA 3V8LA 2CZ1B 4XK8E 3P8DA 3H6ZA 4XTVA 3JCMg 4M75B 3ZEHA 5GMKl 2MWOA 3OMGA 5DLQE 4NOYA 2RI5A 2ZPGB 3G7ZA 4M78B 2WACA 4LDXA 4GLKA 4J6XA 1NPPA 4HT8A 3S3MA 1NPRA 2VYTA 4WF2A 5FU6C 1M1GA 2HNIA 3MEAA 2FYKA 2ZPEB 1D3BA 1QVGS 2PVDB 4JRIA 3RIRA 3LYIA 4QQDA 4X9CA 3OYKA 3HFOA 2MMPA 4ZGDB 3V7RA 4A4GA 1O9SA 3MEWA 4MZMA 2XDBA 3X28B 1VQ7A 1G3TA 2DXUA 4J7FA 4ZGEB 2GCXA 2E12A 4XU2A 2K5IA 4JUVA 4C92C 3GOXA 2LNVA 3GF5A 2EJGA 1VQPT 3LX7A 1YJ9T 4ZGJB 3NTIA 1KQSA 4C0DC 1BIBA 4ZTFA 1LJOA 3MHXA 3MO8A 4KUIA 3CCRT 1RL2A 2AHJB 3VJPA 3CCUA 3CCET 2YHTA 3GLXA 4M78E 2I2LA 2R57A 3A8HB 4BI4A 4DOVA 3FLGA 1YJNT 1VUBA 3QSUA 2K57A 4DOWA 1YJWA 4M7DG 3M56A 2E1HA 5LJ3g 1PSFA 3BW1A 3CBMA 1B34B 1FXXA 3TREA 1WQWA 3UT1A 3GIBA 1VQ9A 1VQ7T 3JSCA 5GMKm 3JCMb 3X24B 2DEQA 4C8QA 3RKYA 2JUFA 1QP2A 5LJ5g 2V8JA 2EWNA 2PUKB 4II1A 3URGA 3RKXA 3CCLA 1YBYA 3ZFJA 5DM7R 3G4SA 5KE2A 3CMEA 4BB7A 3C95A 5J39A 4L6V5 3JCMP 1XQHA 2RD1A 4RMOA 5CKBA 4D6WA 3OYJA 3L1AA 1VQ4A 2FL7A 4M78G 2X35A 2D9TA 1NE8A 1D3BB 3C4SA 3HRUA 3TEEA 1M1FA 3SDZA 3X20B 1VIFA 5LJ5f 4DA4A 4P5NA 2M0OA 4JLGA 3PGGA 4M77D 5GANj 3E9GA 4IKFA 4KBMB 4Y91A 2DD4A 1BKBA 2E10A 1BI2A 5A0LA 3PT9A 5GAMg 3RKWA 5I2SA 3CEYA 1M4ZA 4C92E 1K8AU 4Q5WA 4VUBA 4ELYC 2KMTA 1W2BS 2QI2A 3BY7A 2LT4A 1NZ9A 4L5GA 3KXTA 1M1KU 1OZ3A 2ZZDA 2BKDN 5CCAA 3HKSA 2EKOA 2VGNA 3OYNA 1UGRB 4JRPA 2A7YA 3CBPA 5HK0A 2YLCA 4M75E 5D6YA 3CC2T 4BE0A 2LC4A 1G3YA 3VV0A 3V8JA 2XKOC 3OYAA 2RH2A 1Q86U 2K5LA 4IUQA 2LDMA 1WJSA 1YCYA 3C12A 4MMLA 5FU6B 5C0MA 4B9WA 3OYYA 5LJ5j 2P0PA 4XTZA 4HCCA 4X34A 1VQ8A 4BE1A 4FSXA 3QZ5B 3SWNB 3JB9D 1KHCA 1QP3A 1Y96B 5GAN5 1I81A 1IREB 4NL3A 2KQWA 1X01A 2ZCFB 5CKDA 2GFAA 4PJOB 3CC2A 2D6FA 4UC4A 5IT9E 4E7HA 3FJPA 2KY9A 3A5ZB 4QVZA 4C92G 3CCEA 2CZ0B 2DKGA 2JN0A 5IN1A 3F70A 3CC4A 5KH6A 3CC4T 4LDYA 3GP8A 3G71A 2C06A 3BDUA 3V7SA 4EMGA 1LOJA 5GMKe 2R5MA 2CZ7B 2IVWA 2NLUA 2RK2A 1N8RC 3QZ9B 4OGEA 4ZN1A 4M7DD 1VQKA 4PJOG 1OYXA 1U8RA 2DZCA 3G6EA 2QQRA 3S6WA 5FROA 3CMET 2QEXT 2DK3A 4J6WA 2M9UA 2XG8D 2O4XB 5GANd 4N4IA 3OYIA 2EQMA 3DKMA 3CC7T 3M5AA 5HK3A 1Q7YC 4QVDA 2DPPB 3J7AF 4L59A 1WNLA 2EQJA 4A54A 4M7DA 5GAN4 3DB3A 2RHZA 3ME9A 3QG1A 3X26B 4O5VA 2CS7A 2RM4A 4FL6A 5CKEA 4BD3A 5GAN8 3JB9I 1M90C 4QW2A 4FM4B 3PMIA 2G3RA 2K2VA 3DB4A 5CVIA 3UWNA 2WSEE 3QKJA 4J8OA 3CCQA 2L8DA 3QDRB 1R8OB 1VQNA 1YJWT 3CD6A 2JTMA 4HT9A 3A8GB 1K73C 5GAOl 4M77C 1HXDA 1YJ9A 1S72A 2QA4A 2QQAA 1U1TA 2EYQA 5GMKi 2F5TX 2JNGA 2CKKA 2F5KA 2V8KA 4C92D 4IUTA 3VYGA 3OS0A 2DAQA 2PQWA 1P92A 3V7CA 3HHTB 3CXCA 4IUPA 4XTWA 4XTYA 3H8ZA 5CQYA 3ZBDA 2QQBA 3SFMA 4HKEA 1Q81C 1JJ2A 2K3XA 4RCBA 3CMAT 3TU4K 4JRKA 1KHIA 3NFCA 3CCVT 3JB9J 3CD6T 2RHYA 4M7AF 3WVEB 2EJFA 1KD1U 4E7KA 4M7AA 3CCLT 1KQ1A 3QPHA 3JCMh 2DXCA 4BACA 1VIEA 5DY9A 2KDSA 5LJ3j 5FU7C 3OQ5A 4BI3A 3HP9A 4E7LA 3CCUT 3OSSC 4M78C 2HBPA 4A4HA 2PUOB 3P8HA 4OF1A 4PJOC 3PFSA 4F7UA 4C8QG 4R56A 5FU7B 1YIJT 4E7JA 4KUDK 5D6XA 1VQPA 4YTLA 1OZ2A 3I55T 1VQLA 4PLLA 1JBMA 3JB9G 2D0QB 3CCRA 2E65A 3N5BB 4OB3B 1KQ2A 2QTXA 5LJ5d 2DJZA 4M78D 2ZPBB 3C94A 2PU9B 2RHXA 4XU3A 2EIFA 5CR2A 1YHQT 3JCMQ 1YHQA 4N0AA 5AYFA 4BY6B 4OB1B 3PMTA 4C0ZA 4CRIA 2LT1A 1OI1A 2FVUA 4C92A 2QEXA 4EDUA 2DTOA 3CCMT 2P0QA 2RO0A 3CCST 3MP1A 3CXCS 1VQOT 2OTLT 4MDXA 5A0GA 2LQ8A 3NTKA 3J81E 2BIVA 1UGQB 1WJQA 3HFNA 1UB4A 2JVVA 3HRSA 3NTHA 1MHNA 4C0GA 4EMKB 3OW2S 4OVAA 3A8LB 2RJDA 5L8RE 1ZQ1A 2HAXA 5CKHA 4PJOE 1BI3A 1N27A 4C8QC 2XICA 3GPLA 4A4EA 2MWPA 3CMAA 5LJ5e 1DJ7B 2O4XA 4BI8B 2X4WA 5GAMh 2JZ2A 3CC7A 3EAEA 2PVGB 3FRNA 5J3BA 3OSVA 4JS4A 3M55A 4M75D 4C8QF 2ZGWA 1M1KC 4XAXB 1Q7YU 3Q1JA 2QQSA 3PIPA 1K8AC 1WPYA 4M77A 5KE3A 4BUGA 4F7UG 1ZBXA 1X75C 2DIGA 4NL2A 3CCJA 5GAN7 2YLBA 3L2WA 2QQ9A 4Y28E 4PLIA 4M78A 2P0KA 1VQ6A 1G3WA 2RHIA 1VQMA 3MEUA 3LWHA 3OS5A 3E19A 4KT0E 4M77E 2QA4T 2DD5A 3SD4A 2E41A 2OTJA 4C0FA 5C6SA 4Z02A 2L3RA 4EMKC 4F7UF 4BDYA 5GAOn 3QHSA 3DLMA 2QDYB 2XHCA 1QW1A 1ZHIA 2LCLA 1BYMA 4M77B 3M54A 3HRTA 3T9NA 3VYHB 1BI0A 2E6ZA 2VGMA 3A8MB 1YITT 1YITA 3VU3C 4CI0C 5J26A 3OYBA 3QJYA 5GANh 3UPUA 2E64A 4MZTA 3G4ST 3FC3A 2ZPFB 4C5GA 1EIFA 4XQ3A 2DZ9A 3QUIA 3R6OA 3JCMe 1KC8C 3V8KA 4C92F 1VQ5A 1N6AA 2EQKA 4C0DB 4PJOD 1U1SA 1FWZA 4OP0A 1JJ2S 2Y4YA 3VUBA 5GAOm 3M4GA 4C5IA 2DXTA 1VQ9T 4C5EA 3EFSA 1W4SA 5GAMd 3CBOA 2GQVA 1WGSA 3OY9A 1MGQA 1N9RA 3JCMc 1JRIA 3CPWS 2X4XA 2K5FA 3E1SA 4HCBA 4PL6A 2E70A 2LX9A 3ASKA 5HKCA 5CK9A 1VQNT 3VKIA 3M59A 5M9OA 4N4GA 4X9DA 4QVCA 1WQ7A 2EQUA 2HQXA 3JB9F 1K9MC 1UGPB 3QO3A 2DTIA 2RJFA 4QQ6A 2IG0A 1UGSB 3LH0A 5IAYA 2KVQG 1LNXA 4N0AC 4RCCA 3JRZA 3META 5I21A 1Y71A 3I56A 1GXIE 5I2MA 4XTUA 4A4FA 4BY6C 3L42A 3FB9A 2DXBA 4M75F 1SSFA 2LQKA 5CKFA 3A8OB 2LCCA 4C8QD 5GAOp 1VQ8T 1W2BA 2A3LA 4N4HA 3OYFA 3OYGA 3CCVA 3CCJT 4XTXA 4QQGA 3CCMA 5CIUA 1VQ4T 3FIFA 3P8BB 4M75C 3L2RA 4DQ2A 3OBYA 2DO3A 4RG2A 2XD0A 5GAMf 4OGCA 1I8FA 5GAN6 2DVEA 4XU1A 3HL8A 2E5QA 3WVDB 3MCAB 4B9XA 3OA6A 3I56T 1KG1A 5GMKj 4LDUA 3OS2A 3L2UA 1YI2A 3HSBA 4ATOA 4M7DB 4J5YA 3HPWA 4V2SA 3GNFB 2WSFE 4F7UE 1N9SA 4M77G 1KC8U 2VXEA 3CPWA 2OAUA 4BE2A 2B8AA 3LGLA 1VQMT 5LL6S 2CGHA 3OYDA 3O8VA 4JDSA 4PNOA 1AHJB 1Y96A 1IZ6A 2BUDA 2VC8A 3BDLA 3QXEB 1G3SA 4HA8A 2EJ9A 4RKUE 3FEOA 2H3JA 2KSSA 3M9QA 3KBGA 4J7IA 2K3YA 2CYZB 4MMKA 3QJ6A 1YIJA 4JJNK 1NJIC 1PSEA 5FRMA 5GAMj 4C8QB 3RESA 3I55A 2VUBA 5LJ3f 3GNGA 3INZA 1H641 4A4KA 3LW5E 3UDCA 4JLIA 2KAFA 4JRQA 1Q82C 1XOVA 2GF7A 1K9MU 3QIIA 4M7AG 3M57A 2XK0A 4A53A 4MDWA 1QVFA 2P4TA 5GANf 2JTFA 3VUZA 3SB2A 4LDVA 1Q82U 2F69A 3LLRA 3DLLA 3RERA 3FDRA 2LRQA 4LD6A 3PTAA 2VV5A 5D6WA 1V29B 1XNIA 4M7DE 4XU0A 2KK4A 3OYMA 2ZPHB 5KCOA 3X25B 1KQSS 2RI2A 2E6NA 2RK1A 3CCSA 2OTLA 1VQ6T 1HK9A 3MEVA 4J6YA 4HCZA 4OB2B 5FLXE 3PIOA 3M4YA 1BI1A 2HQEA 1K73U 4M7DF 2Y4XA 4M77F 4EMKA 4OB0B 4LD9K 2RB6A 3LWIA 5LJ3e 4EPCA 1N8RU 2JOYA 3OBWA 1M5Q1 3WXMB 4J83A 4M7AE 1WJRA 2MF2A 3G6ET 2YRVA 4PKCC 2RJEA 4MZPA 4BDZA 4M7DC 2EFIA 1G5VA 3JCMf 1B34A 1Y07A 4FT4A 5GAOq 3S3OA 3OB9A 3RUXA 5GANe 5EG2A 2R5AA 2RJCA 4E7IA 2MI6A 2DTHA 2L5QA 2XI9A 4C8QE 5A2QE 1YJNA 1UEBA 3TCJA 3J80E 2X4JA 1Q86C 4M75G 3JAME 2WSCE 1YI2T 3OW2A 4M7AD 2RI3A 3CPFA 2K4YA 4R55A 4IURA 4FU6A 2HD0A 5LJ3d 3MP8A 2XDDA 4IUVA 4PJOF 1M9SA 2XDPA 5CAIA 4PJOA 4M7AB 2OTJT 2PVOB 5CQXA 2RA2A 3SWNC 1VQKT 4O6JA 2MAMA 1VQ5T 5HY6A 2O01E 1Y7XA 3QYGB 3ER0A 2L89A 4EMHA 4ZTJA 5GAOr 3OS1A 1I5LA 5FRNA 5CO7A 4M7AC 4F7UB 1KD1C 2V8IA 1FX7A 2Y90A 4NS5A 1H3ZA 1VQLT 2ZPIB 3G71T 3E9FA 3M58A 3KUFA 4M78F 2DIQA 1NJIU 2VXFA 2CZ6B 3QBYA 3JB9H 3RMQA 3JCMV 2X4YA 2XIDA 3L2ZA 1Q81U 4ELZC 3JCMW 3QYHB 3RMSA 5GAMe 1I4K1 5LJ5h 3CCQT 3L2VA 1QVGA 4FIBA 1RI0A 4IUUA 1VQOA 4C5HA 4C92B 5GANg 2FB7A 4TVRA 1QVPA 4E47A 2M1HA 3M53A 3JCMd 3EFRA 3L2QA 4JS5A 1TH7A 1XTDA 3AHUA 1M8VA 2FHDA 3SWNA 1O75A 5LJ3h 3OYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN3 A;  2RHU A;  1M90 U;  3OYC A;  3S3N A;  4GY5 A;  1X6O A;  2R58 A;  2LTO A;  3OMC A;  1S72 T;  2M16 A;  3PNW C;  3MP6 A;  2LVM A;  2GFU A;  5KCH A;  1QVF S;  3LGF A;  3OYE A;  3OYL A;  3P8D A;  3H6Z A;  3ZEH A;  2MWO A;  3OMG A;  5DLQ E;  2RI5 A;  2WAC A;  1NPP A;  3S3M A;  1NPR A;  2VYT A;  1M1G A;  3MEA A;  1QVG S;  3LYI A;  4QQD A;  3OYK A;  4A4G A;  3MEW A;  1VQ7 A;  3GOX A;  1VQP T;  3LX7 A;  1YJ9 T;  3NTI A;  1KQS A;  4ZTF A;  3MO8 A;  3CCR T;  1RL2 A;  3CCU A;  3CCE T;  2R57 A;  1YJN T;  3FLG A;  1YJW A;  3TRE A;  3UT1 A;  1VQ9 A;  1VQ7 T;  2JUF A;  3CCL A;  4II1 A;  1YBY A;  5DM7 R;  3G4S A;  3CME A;  5KE2 A;  5J39 A;  3OYJ A;  1VQ4 A;  2X35 A;  1S72 A;  2D9T A;  3C4S A;  2M0O A;  3E9G A;  4IKF A;  1BKB A;  3CEY A;  1K8A U;  4Q5W A;  1W2B S;  1M1K U;  1NZ9 A;  1OZ3 A;  2BKD N;  3HKS A;  2EKO A;  3OYN A;  3CC2 T;  5D6Y A;  4BE0 A;  3OYA A;  1Q86 U;  4IUQ A;  2LDM A;  1WJS A;  5C0M A;  4B9W A;  4X34 A;  1VQ8 A;  4BE1 A;  1KHC A;  2GFA A;  3CC2 A;  4UC4 A;  5IT9 E;  4E7H A;  3A5Z B;  4QVZ A;  3CCE A;  5IN1 A;  3F70 A;  3CC4 A;  3CC4 T;  5KH6 A;  3G71 A;  2R5M A;  2NLU A;  4ZN1 A;  1VQK A;  1OYX A;  3G6E A;  2QQR A;  3S6W A;  5FRO A;  3CME T;  2QEX T;  2O4X B;  4N4I A;  3OYI A;  3CC7 T;  2EQM A;  1Q7Y C;  3J7A F;  4L59 A;  2EQJ A;  3DB3 A;  2RHZ A;  3ME9 A;  1M90 C;  4FL6 A;  4BD3 A;  4QW2 A;  3PMI A;  2G3R A;  3DB4 A;  3UWN A;  3QKJ A;  3CCQ A;  2L8D A;  1VQN A;  1YJW T;  3CD6 A;  1K73 C;  1YJ9 A;  2QA4 A;  2JNG A;  2CKK A;  2F5K A;  4IUT A;  3OS0 A;  2DAQ A;  2PQW A;  3CXC A;  4IUP A;  3H8Z A;  1Q81 C;  1JJ2 A;  3CMA T;  2K3X A;  1KHI A;  3CCV T;  3CD6 T;  2RHY A;  1KD1 U;  4E7K A;  3CCL T;  4BAC A;  2KDS A;  3OQ5 A;  4E7L A;  3CCU T;  4A4H A;  3P8H A;  3PFS A;  1YIJ T;  4E7J A;  5D6X A;  1VQP A;  4YTL A;  1OZ2 A;  3I55 T;  1VQL A;  4PLL A;  3CCR A;  2RHX A;  2EIF A;  1YHQ T;  1YHQ A;  1VQO T;  4CRI A;  3PMT A;  2QEX A;  1OI1 A;  3CCM T;  4EDU A;  2RO0 A;  3CCS T;  3CXC S;  2OTL T;  3MP1 A;  2LQ8 A;  3NTK A;  3J81 E;  2BIV A;  1WJQ A;  3NTH A;  2JVV A;  1N8R C;  1MHN A;  3OW2 S;  4OVA A;  2RJD A;  1N27 A;  4A4E A;  2MWP A;  3CMA A;  2O4X A;  2X4W A;  2JZ2 A;  3CC7 A;  3EAE A;  5J3B A;  1M1K C;  1Q7Y U;  1K8A C;  2QQS A;  3PIP A;  3Q1J A;  5KE3 A;  2DIG A;  3CCJ A;  3L2W A;  4PLI A;  2P0K A;  1VQ6 A;  2RHI A;  1VQM A;  3MEU A;  2OTJ A;  2QA4 T;  3SD4 A;  5C6S A;  4Z02 A;  2L3R A;  4BDY A;  3DLM A;  2XHC A;  2LCL A;  2E6Z A;  1YIT T;  1YIT A;  5J26 A;  3OYB A;  3G4S T;  3FC3 A;  4C5G A;  1EIF A;  1KC8 C;  1VQ5 A;  2EQK A;  1JJ2 S;  4C5I A;  1VQ9 T;  4C5E A;  3OY9 A;  1WGS A;  3CPW S;  2X4X A;  4PL6 A;  2E70 A;  3ASK A;  1VQN T;  5M9O A;  4N4G A;  2EQU A;  2HQX A;  1K9M C;  2RJF A;  4QQ6 A;  2IG0 A;  3LH0 A;  5IAY A;  2KVQ G;  3I56 A;  3MET A;  4A4F A;  3L42 A;  1SSF A;  1VQ8 T;  2LCC A;  1W2B A;  4N4H A;  3OYF A;  3OYG A;  3CCV A;  3CCJ T;  4QQG A;  3CCM A;  5CIU A;  1VQ4 T;  3P8B B;  3L2R A;  2DO3 A;  4RG2 A;  4B9X A;  2E5Q A;  3OA6 A;  3I56 T;  3OS2 A;  1YI2 A;  3L2U A;  1KC8 U;  3CPW A;  4BE2 A;  2B8A A;  3LGL A;  1VQM T;  5LL6 S;  3OYD A;  3O8V A;  1IZ6 A;  2BUD A;  3BDL A;  3FEO A;  3M9Q A;  3KBG A;  2K3Y A;  3QJ6 A;  1YIJ A;  1NJI C;  5FRM A;  3I55 A;  1Q82 C;  1K9M U;  2GF7 A;  3QII A;  1QVF A;  2XK0 A;  2JTF A;  1Q82 U;  3LLR A;  3DLL A;  3FDR A;  2LRQ A;  4LD6 A;  5D6W A;  1XNI A;  3OYM A;  1KQS S;  1VQ6 T;  5KCO A;  2RI2 A;  2E6N A;  3CCS A;  2OTL A;  5FLX E;  3PIO A;  3MEV A;  4HCZ A;  2HQE A;  1K73 U;  1N8R U;  2JOY A;  1WJR A;  3G6E T;  2YRV A;  2RJE A;  4BDZ A;  2EFI A;  1G5V A;  3S3O A;  3OB9 A;  2R5A A;  2RJC A;  4E7I A;  2MI6 A;  5A2Q E;  1YJN A;  1UEB A;  3J80 E;  1Q86 C;  3JAM E;  1YI2 T;  3OW2 A;  2RI3 A;  3CPF A;  4IUR A;  4FU6 A;  3MP8 A;  4IUV A;  2XDP A;  2OTJ T;  1VQK T;  1VQ5 T;  5HY6 A;  3ER0 A;  2L89 A;  4ZTJ A;  3OS1 A;  5FRN A;  1KD1 C;  4NS5 A;  1H3Z A;  1VQL T;  3G71 T;  3E9F A;  3KUF A;  2DIQ A;  1NJI U;  3QBY A;  2X4Y A;  1Q81 U;  3CCQ T;  3L2V A;  1QVG A;  4IUU A;  1RI0 A;  1VQO A;  4C5H A;  4TVR A;  2M1H A;  3L2Q A;  1XTD A;  2FHD A;  3OYY A;  3OYH A; 
#chains in the Genus database with same CATH topology
 3OYC A;  5GMK h;  1W6X A;  5GAN 3;  3S3N A;  2M0Y A;  4GY5 A;  1X6O A;  1ZA2 B;  2R58 A;  1WXU A;  3MP6 A;  2FPD A;  1I1J A;  1QKW A;  5KCH A;  4CC2 A;  2NUZ A;  1UG1 A;  3H0F A;  1PRM C;  3RBB B;  4FT2 A;  4RG8 A;  5HCK A;  2X51 A;  4QT7 A;  2CZ1 B;  4XK8 E;  3P8D A;  3H6Z A;  4M75 B;  3OMG A;  2RI5 A;  1SRL A;  4M78 B;  1NPP A;  4HT8 A;  5FU6 C;  3MEA A;  2K79 A;  2PVD B;  1X6G A;  3LYI A;  4X9C A;  2EGE A;  3HFO A;  4ZGD B;  2XDB A;  1G3T A;  4HVU A;  1M3C A;  2K5I A;  4C92 C;  2KT1 A;  2EJG A;  3CCQ Q;  3LX7 A;  2JS0 A;  1MUZ A;  4C0D C;  5IHK A;  1BIB A;  4ZTF A;  2V26 A;  1I07 A;  2DLP A;  4BI4 A;  1SRM A;  1YJN T;  1YJW A;  5LJ3 g;  2E1H A;  2L3P A;  1FXX A;  3CBM A;  3GIB A;  1VQ9 A;  2DX1 A;  3X24 B;  2DEQ A;  3M0Q A;  1ARK A;  1QP2 A;  1GBQ A;  2EWN A;  2PUK B;  4II1 A;  3CCL A;  2HBW A;  1YBY A;  3ZFJ A;  4J9F A;  5J39 A;  3JCM P;  4RMO A;  3L1A A;  1S72 A;  3QSU A;  2EYZ A;  1MMG A;  3SDZ A;  1VIF A;  2W10 A;  2M0O A;  4JLG A;  4FYW B;  1Q7Y R;  3E9G A;  4IKF A;  1PD1 A;  1PNJ A;  2KT8 A;  1C6V X;  1K8A U;  2L3Q A;  1M1K U;  1OZ3 A;  1WI7 A;  2JM9 A;  1UGR B;  3CC2 T;  2DJQ A;  2CP3 A;  4BE0 A;  4JPB W;  3CXC P;  1WJS A;  5C0M A;  3C12 A;  2CP0 A;  4B9W A;  4HCC A;  3H9N A;  1VQ8 A;  4BE1 A;  2PZ1 A;  1QP3 A;  1UHF A;  2F2W A;  1I81 A;  5GAN 5;  1M3B A;  5IT9 E;  3FJP A;  1R77 A;  1VOM A;  4C92 G;  5IXB A;  2MPX C;  2LP5 A;  3GP8 A;  2NYS A;  5GMK e;  2CZ7 B;  2IVW A;  2RQW A;  2HCK A;  1U5S A;  1QVF P;  3G6E A;  2HSP A;  1ZLM A;  5FRO A;  2DK3 A;  2CP6 A;  5GAN d;  3OYI A;  3CC7 T;  1AOJ A;  4QVD A;  3J7A F;  1YCS B;  4A54 A;  5GAN 4;  3ME9 A;  3I5S A;  1YP5 A;  1IO6 A;  5CVI A;  2L8D A;  1R8O B;  1VQN A;  4HVV A;  2AZV A;  3A8G B;  4M77 C;  8AT1 B;  1U1T A;  2FZK B;  2F5K A;  3VYG A;  2RPN A;  3HHT B;  3CXC A;  2AZS A;  2M02 A;  1KHI A;  1WX6 A;  2DFU A;  3WVE B;  2EJF A;  1KQ1 A;  2DXC A;  4BAC A;  2KDS A;  2RQV A;  4A4H A;  4F7U A;  5FU7 B;  4E7J A;  1VQP A;  4YTL A;  2E3I A;  1HD3 A;  3JB9 G;  3CCR A;  2E65 A;  3N5B B;  2PU9 B;  2RHX A;  4AG1 C;  5CR2 A;  4E6R A;  1YHQ A;  2QEX A;  4C92 A;  2E5K A;  2YUN A;  3MP1 A;  2BIV A;  1WJQ A;  3HFN A;  3NTH A;  4EMK B;  1MHN A;  3A8L B;  4E7Z A;  2DL8 A;  1X69 A;  4RTZ A;  2MWP A;  1K8A R;  2JZ2 A;  4DBQ A;  3EAE A;  2HEQ A;  1M1K C;  3IQL A;  1Q7Y U;  1X2Q A;  1K8A C;  1WPY A;  2JM8 A;  2L2P A;  1H92 A;  3CCJ A;  4M78 A;  1ACM B;  4AFU C;  3LWH A;  2OTJ A;  3E19 A;  4KT0 E;  2JS2 A;  1ZSZ B;  4M77 E;  3SD4 A;  1M27 C;  4C0F A;  4F7U F;  1GRI A;  1GCQ A;  3QHS A;  3DLM A;  3VS1 A;  1QW1 A;  1BYM A;  1FMV A;  2DL3 A;  3HRT A;  2E6Z A;  2VGM A;  1YIT T;  4CI0 C;  2QK0 A;  3UPU A;  1IXD A;  2ZPF B;  4C5G A;  3R6O A;  4C92 F;  5L23 A;  4Y92 A;  1FWZ A;  1W4S A;  3OY9 A;  1WGS A;  1MGQ A;  2DBK A;  3ASK A;  5CK9 A;  3M59 A;  1B3Q A;  1WQ7 A;  2EQU A;  2J6O A;  1UGP B;  3QO3 A;  2DTI A;  1EFN A;  2KVQ G;  1LNX A;  4N0A C;  3I5R A;  4BY6 C;  4M75 F;  5CKF A;  1SSF A;  4LUD A;  3A8O B;  2LCC A;  3UAT A;  1GBR A;  4N4H A;  2RQR A;  3CC7 Q;  3SHW A;  2VWF A;  1VQ4 T;  4M75 C;  2DL5 A;  1X6B A;  5GAN 6;  4AFZ C;  2DVE A;  2E5Q A;  3CCR Q;  2JMA A;  3OS2 A;  4V2S A;  2LMJ A;  3HPW A;  2BZ8 A;  2WSF E;  4F7U E;  2VXE A;  3CPW A;  1PHT A;  2O9V A;  3LGL A;  1VQM T;  4ANJ A;  2VC8 A;  1IZ6 A;  1MMA A;  3BDL A;  3QXE B;  1G3S A;  1OUL A;  4HA8 A;  4E2F B;  4RKU E;  3FEO A;  2H3J A;  2NUP A;  2KSS A;  1KIK A;  3EFO B;  1T0H A;  4J7I A;  1PSE A;  4OMO A;  3I55 A;  3GNG A;  3INZ A;  3UDC A;  4J9I A;  2XK0 A;  1IHW A;  2P4T A;  1J3T A;  1Q82 U;  1NBE B;  1Q95 G;  2EYY A;  1D0Y A;  5D6W A;  1XNI A;  4XU0 A;  2KK4 A;  3CCJ Q;  2RK1 A;  2FPF A;  3MEV A;  2GBQ A;  2BTT A;  1K73 U;  4J9D A;  3LWI A;  1NM7 A;  1AWW A;  2KRM A;  3WXM B;  1WJR A;  1F1B B;  3I55 Q;  1AZG B;  4FT4 A;  3OB9 A;  5GAN e;  5EG2 A;  1I0C A;  3M0P A;  2MI6 A;  2DTH A;  4C8Q E;  1YJN A;  4M75 G;  2WSC E;  3CC4 Q;  2K4Y A;  4FU6 A;  5LJ3 d;  4IUV A;  4KGX B;  1W1F A;  5CAI A;  2OTJ T;  2RA2 A;  3QYG B;  1Y7X A;  3ER0 A;  4ZTJ A;  5GAO r;  3OS1 A;  3VS6 A;  2HL3 A;  2V8I A;  1OV3 A;  1YIJ Q;  2ZPI B;  1RI9 A;  3BE3 A;  3G71 T;  1YN8 A;  3VS3 A;  1NEB A;  3QBY A;  3HTR A;  3JCM V;  2X4Y A;  1HJD A;  2V1Q A;  3JCM W;  3QYH B;  1X27 A;  3RMS A;  5IHN A;  3L2V A;  4AMC A;  1RI0 A;  1QVP A;  2H8H A;  1TUG B;  2M1H A;  3M53 A;  3L2Q A;  1AVZ C;  3QWY A;  1O75 A;  1ZUY A;  3JCM X;  1M90 U;  5A0D A;  3JCM J;  1S72 Q;  2C0T A;  2LTO A;  4OML A;  2XU8 A;  2QXF A;  1QVF S;  2AT1 B;  4OMF B;  2OTJ Q;  3OYE A;  3OYL A;  1ZX6 A;  2KRS A;  4XTV A;  3JCM g;  2DMO A;  3ZEH A;  2MWO A;  1C1A A;  4NOY A;  5DLQ E;  2WAC A;  1NPR A;  5ECA A;  2LNH B;  3OYK A;  4A4G A;  3C0C A;  4MZM A;  3X28 B;  1G83 A;  3TSW A;  3GF5 A;  1VQP T;  2X9H A;  1YJ9 T;  2OAW A;  1ZBJ A;  4KUI A;  3VJP A;  2HZY A;  3CCE T;  2I2L A;  2R57 A;  3A8H B;  2GTO A;  4M7D G;  2VKN A;  1AEY A;  1VQ7 T;  5GMK m;  1SPK A;  2YRD A;  4LE9 A;  3AT1 B;  5LJ5 g;  2EGC A;  4PJN A;  1NLP C;  4J9G A;  2FRY A;  2MOX A;  4BB7 A;  5I11 A;  1WFW A;  4L6V 5;  4PFO A;  1XQH A;  2G6F X;  5CKB A;  5LJ5 f;  2EYW A;  3PGG A;  4M77 D;  4RTV A;  2YUO A;  1KSW A;  3REA B;  5A0L A;  5I2S A;  3CEY A;  4Q5W A;  2QI2 A;  1VQ4 Q;  2LT4 A;  3KXT A;  2BKD N;  3HKS A;  3H41 A;  4JRP A;  3CBP A;  2A36 A;  2DL4 A;  5D6Y A;  2DVJ A;  3V8J A;  2XKO C;  2LDM A;  5FU6 B;  2EQI A;  1CSK A;  1GFC A;  3EGD B;  4X34 A;  1ZSG A;  3QZ5 B;  1BBZ A;  1V76 A;  3JB9 D;  1KHC A;  1Y96 B;  2KQW A;  2ZCF B;  2QGG A;  2SRC A;  3CC2 A;  3CCE A;  1K9A A;  3CC4 A;  3CC4 T;  4LDY A;  3G71 A;  3BDU A;  2RQU A;  1RAC B;  3V7S A;  4EMG A;  2NLU A;  3R6N A;  1VQK A;  4PJO G;  1U8R A;  1YNZ A;  2DZC A;  2J6K A;  2QQR A;  1YJ9 Q;  3CME T;  1RAG B;  2M9U A;  2KYM A;  2O4X B;  2EQM A;  1JXM A;  2QAS A;  4AFQ C;  1Q7Y C;  4L59 A;  2EQJ A;  1B07 A;  2RHZ A;  3DB3 A;  3PVQ A;  4O5V A;  2RM4 A;  2DM1 A;  4BD3 A;  3JB9 I;  3UWN A;  4J8O A;  4M4Z A;  1YJW T;  3CD6 A;  2JTM A;  4HT9 A;  1QLY A;  5GAO l;  2QQA A;  3CCE Q;  1PCX A;  4C92 D;  4IUT A;  1AWJ A;  1Q86 R;  3V7C A;  1UTI A;  3H8Z A;  1FMK A;  1PKT A;  4HKE A;  1JJ2 A;  4HVW A;  4RCB A;  3TU4 K;  4JRK A;  3JB9 J;  3CCV T;  1D0Z A;  3CD6 T;  1KD1 U;  3NMZ C;  3JCM h;  3QPH A;  2PTK A;  4BI3 A;  3HP9 A;  4E7L A;  1RLQ C;  1EZZ B;  2PUO B;  3P8H A;  4OF1 A;  4KUD K;  5D6X A;  1OZ2 A;  3I55 T;  4PLL A;  2DIL A;  1OEB A;  1GFD A;  3VS5 A;  4OB3 B;  1KQ2 A;  4PJM A;  4M78 D;  3C94 A;  4XU3 A;  1NLO C;  2V1R A;  4ESR A;  4BY6 B;  4JRQ A;  2DEU A;  2P0Q A;  1UDL A;  3CCS T;  3CXC S;  3M0S A;  3HRS A;  2JVV A;  3OW2 S;  2OX7 A;  2HAX A;  1M30 A;  3EHR A;  4C8Q C;  2XIC A;  1KD1 R;  1KQS P;  4A4E A;  1CKA A;  3MKD A;  3CCM Q;  4BI8 B;  2X4W A;  1PKS A;  2PVG B;  2L3S A;  3CME Q;  3EGX A;  3OSV A;  3M55 A;  4CC4 B;  2O9S A;  2KI7 A;  2LJ1 A;  4M77 A;  5KE3 A;  4BUG A;  4F7U G;  2EW3 A;  2YLB A;  2QGF B;  3EGU A;  5KYU B;  2K2M A;  3MEU A;  2QDL A;  1Z9Q A;  2L0A A;  5C6S A;  4Z02 A;  5GAO n;  4KRT A;  2QDY B;  1RAB B;  2LCL A;  4PJL A;  3T9N A;  3H0I A;  3A8M B;  1YIT A;  1UJ0 A;  1MV3 A;  1OPL A;  3EH2 A;  2HL5 C;  5GAN h;  1VYU A;  1GCQ C;  1Y0M A;  4C0D B;  4PJO D;  1U1S A;  4DBF A;  5GAO m;  3M4G A;  4C5I A;  1BCO A;  2PNI A;  1N9R A;  1SF9 A;  2MK5 A;  2CH4 A;  1ABQ A;  2K5F A;  4HCB A;  2C0O A;  5HKC A;  2LX9 A;  2CP5 A;  2BE7 D;  1VQN T;  3VKI A;  5M9O A;  1VQM Q;  1KC8 R;  2FRW A;  4QQ6 A;  2IG0 A;  1UGS B;  4JZ4 A;  1K0S A;  4RCC A;  3JRZ A;  3MET A;  3I56 A;  1K73 R;  4XTU A;  3FB9 A;  2DXB A;  5GAO p;  2LQK A;  2XMF A;  2DYB A;  1W2B A;  2JW4 A;  2ENM A;  4QQG A;  5CIU A;  1JJ2 P;  3FIF A;  3L2R A;  1QWF A;  4RG2 A;  5GAM f;  3I56 Q;  1I8F A;  2KGT A;  3HL8 A;  4LUE A;  3I56 T;  1KG1 A;  5GMK j;  2D8J A;  1YI2 A;  1SSH A;  4J5Y A;  3THK A;  1SG5 A;  1M8M A;  4M77 G;  1D0X A;  1KC8 U;  1RAI B;  2CGH A;  3OYD A;  1OOT A;  1Y96 A;  2BUD A;  1Z9Z A;  2DA9 A;  1GCP A;  2ED0 A;  2LQN A;  2C0I A;  1ZUU A;  3QJ6 A;  1YIJ A;  1WHJ A;  4JJN K;  2MCN A;  3EGX B;  2KBT A;  1LCK A;  5FRM A;  5GAM j;  1M2V B;  2QAZ A;  1VYT A;  3I35 A;  3E2U A;  6AT1 B;  1XOV A;  2KXD A;  2CSI A;  1VQ5 Q;  1QVF A;  3D7S B;  2QA4 Q;  1X43 A;  3DLL A;  2JTE A;  2AKL A;  1V29 B;  4LN2 A;  2ZPH B;  1M2O A;  4DBR A;  3ZL7 C;  3CCS A;  2HQE A;  2Y4X A;  1QCF A;  1N8R U;  3OBW A;  4J83 A;  1HSQ A;  3U23 A;  4PKC C;  2RJE A;  3CMA Q;  4BDZ A;  3EG9 B;  2P4R A;  1G5V A;  3S3O A;  2RJC A;  2XI9 A;  1UEB A;  3TCJ A;  2X4J A;  1Q86 C;  3JAM E;  3CCS Q;  4M7A D;  3CPF A;  2HD0 A;  2JT4 A;  2XDD A;  2XDP A;  2PVO B;  1QKX A;  1Y57 A;  5HY6 A;  2O01 E;  4EMH A;  5FRN A;  5CO7 A;  4M7A C;  2JXB A;  3EG3 A;  1VQO Q;  4KH0 B;  1WDX A;  3M58 A;  1MNE A;  1NJI U;  2VXF A;  2CZ6 B;  3L2Z A;  1Q81 U;  1I4K 1;  3CCQ T;  1BK2 A;  2DRK A;  4FIB A;  4IUU A;  1VQO A;  4C5H A;  5GAN g;  1W70 A;  2FB7 A;  2KRN A;  4JS5 A;  1YJN Q;  1TH7 A;  1M8V A;  2FHD A;  3SWN A;  4ZN3 A;  2RHU A;  4F04 B;  2RQT A;  4CC7 A;  1BIA A;  3BFM A;  3OMC A;  3VS2 A;  4OMQ A;  1S72 T;  3PNW C;  3PE0 A;  2LVM A;  2D1X A;  1IHV A;  1OX9 A;  2CRE A;  3I9Q A;  2COY A;  4GBQ A;  2QTV A;  1M2V A;  2CUD A;  5GMK l;  2ZPG B;  4J6X A;  2VYT A;  2HNI A;  3ULR B;  4IIM A;  2ZPE B;  1QVG S;  4QQD A;  2J05 A;  2EYX A;  2MMP A;  1TUC A;  1O9S A;  3MEW A;  4DEX A;  1VQ6 Q;  4J7F A;  2LQW A;  2GCX A;  4JUV A;  2LNV A;  1RLP C;  2K7A A;  5FWB A;  4ZGJ B;  2DBM A;  3MHX A;  2NUT B;  1CKB A;  3CCR T;  2IIM A;  2IPO B;  2AHJ B;  3CCU A;  3GLX A;  3NHN A;  4M78 E;  4DOV A;  3FLG A;  1VUB A;  1U06 A;  3UA6 A;  4CC3 A;  1PSF A;  3BW1 A;  3TRE A;  3UT1 A;  3JSC A;  3JCM b;  1MMD A;  2JUF A;  2O2O A;  3A1P A;  3URG A;  3RNJ A;  3CME A;  5KE2 A;  2FEI A;  5GJV B;  2FL7 A;  4M78 G;  2X35 A;  3TEE A;  1NE8 A;  1D3B B;  3C4S A;  2FZC B;  4DA4 A;  4P5N A;  1UUE A;  2HMA A;  5GAN j;  1EX4 A;  4KBM B;  2EGA A;  2CP7 A;  2DD4 A;  2E10 A;  5GAM g;  1M4Z A;  4JJB A;  4C92 E;  2K3B A;  4ELY C;  2KMT A;  1W2B S;  1M1K R;  3BY7 A;  4L5G A;  1NZ9 A;  5KYU A;  1YWO A;  5CCA A;  2CP2 A;  2EKO A;  2BZX A;  2VGN A;  1WHL A;  2A7Y A;  2YLC A;  4M75 E;  2LC4 A;  1UGV A;  3VV0 A;  3OYA A;  2RH2 A;  1Q86 U;  2K5L A;  3G1J A;  4IUQ A;  1YCY A;  4MML A;  2YDL A;  5LJ5 j;  2P0P A;  3CQT A;  4XTZ A;  4FSX A;  3SWN B;  2BE9 B;  5KYX B;  1IRE B;  1IB8 A;  4NL3 A;  1Q81 R;  1PC0 A;  2GFA A;  3VRY A;  2D6F A;  1NJI R;  2KY9 A;  4QVZ A;  2CZ0 B;  2DKG A;  2JN0 A;  3MJX A;  1TU0 B;  5KH6 A;  5KYY A;  2H3E B;  1VQN Q;  1TOV A;  4LNP A;  4OGE A;  4ZN1 A;  2KR3 A;  1TXQ A;  1OYX A;  4JZ3 A;  2DYI A;  2CUB A;  2CT3 A;  1IGU A;  3M5A A;  5HK3 A;  4M7D A;  1WNL A;  4RTU A;  3QG1 A;  2HDA A;  5CKE A;  5GAN 8;  4FM4 B;  3VS0 A;  2G3R A;  2K2V A;  2AKK A;  3DB4 A;  2LJ0 A;  2CT4 A;  2WSE E;  3QKJ A;  3CCQ A;  1TS9 A;  1SKU B;  1HXD A;  1YJ9 A;  1UEC A;  1RUW A;  2V8K A;  3OS0 A;  2DAQ A;  1OX8 A;  2PQW A;  2DER A;  2F2X A;  4A63 B;  4XTW A;  2QQB A;  1Q81 C;  2K3X A;  3VS4 A;  3NFC A;  2RHY A;  1TSF A;  2JMC A;  2KE9 A;  2LCS A;  2F1L A;  3CCL T;  5LJ3 j;  3PVL A;  3OQ5 A;  3CCU T;  3OSS C;  2YSQ A;  2J6F A;  4C8Q G;  4R56 A;  1YIJ T;  2W0Z A;  1VQL A;  1GL5 A;  3JV3 A;  2HKN A;  2QTX A;  4D8D A;  2ZPB B;  1V1C A;  2EIF A;  1YHQ T;  3JCM Q;  4N0A A;  4OB1 B;  3PMT A;  4C0Z A;  1KFZ A;  2LT1 A;  1OI1 A;  2FVU A;  3CCM T;  2DTO A;  4PJJ A;  1N8R C;  1K4U S;  4F14 A;  2RJD A;  4AFS C;  1N27 A;  4PFP A;  3GPL A;  5KYX A;  2MYS A;  4WCI A;  3CMA A;  4IIO A;  1VQ9 Q;  1DJ7 B;  3OW2 P;  3QWX X;  5J3B A;  4C8Q F;  3Q1J A;  3PIP A;  2DIG A;  1X75 C;  4NL2 A;  5GAN 7;  2QQ9 A;  2P0K A;  1G3W A;  2RHI A;  1VQM A;  1QVG P;  2YUP A;  1K1Z A;  3A98 A;  1SHG A;  4BDY A;  4QKU A;  4Z88 A;  4M77 B;  3VYH B;  1T0J A;  3VU3 C;  1E7O A;  3QJY A;  2CDT A;  2E64 A;  4MZT A;  3FC3 A;  1EIF A;  4XQ3 A;  3QUI A;  3JCM e;  3V8K A;  2FO0 A;  1VQ5 A;  1N6A A;  2Y4Y A;  3VUB A;  3MPU B;  2DXT A;  1VQ9 T;  1QCO A;  4C5E A;  2GQV A;  1HYO A;  1MV0 B;  1K0X A;  3JCM c;  4JJD A;  1X2K A;  3EGD A;  4FW1 A;  2X4X A;  2DL7 A;  2YT6 A;  4OMN A;  4X9D A;  2HQX A;  1H8K A;  2RJF A;  5IAY A;  1NG2 A;  5I21 A;  1AZE A;  2DF6 A;  1VQ8 T;  1MND A;  1RAH B;  2DE0 X;  3OYF A;  4D8K A;  3OYG A;  4RTY A;  3REB B;  3P8B B;  4DQ2 A;  4FW2 A;  4OGC A;  2BZY A;  4XU1 A;  1TUD A;  3TQ7 P;  1H3H A;  4LDU A;  3HSB A;  3L2U A;  4RTW A;  2RMO A;  1QWE A;  5EC7 A;  1N9S A;  1FYN A;  2I0N A;  2OAU A;  4BE2 A;  2B8A A;  2ECZ A;  1E6G A;  5LL6 S;  4JDS A;  4OMM A;  4PNO A;  3EG9 A;  1TTH B;  2VAS A;  2QYZ A;  4RUG A;  2A28 A;  3KBG A;  4B6M A;  1I5O B;  2CYZ B;  1NJI C;  2O88 A;  3RES A;  2VUB A;  1QQJ A;  3CCU Q;  1H64 1;  4A4K A;  1Q82 C;  4FYX B;  4JLI A;  2KAF A;  2ED1 A;  3M57 A;  2JTF A;  2RNA A;  4EIK A;  3G71 Q;  1UE9 A;  3PTA A;  4LD6 A;  1M3A A;  4M7D E;  1WXT A;  3OYM A;  1VQ6 T;  1OU9 A;  1K76 A;  5FLX E;  4J6Y A;  4HCZ A;  4OB2 B;  3M4Y A;  2KXC A;  4OB0 B;  4LD9 K;  5LJ3 e;  4EPC A;  2JOY A;  1M5Q 1;  2CH4 W;  4MZP A;  2RF0 A;  3M0T A;  3M0U A;  3JCM f;  1B34 A;  2DRM A;  7AT1 B;  4E7I A;  3CC2 Q;  2L5Q A;  5A2Q E;  2ROT A;  3J80 E;  1YI2 T;  3CCV Q;  4J9C A;  3OW2 A;  4R55 A;  1WHM A;  1OPK A;  1M9S A;  5CQX A;  1VQK T;  4O6J A;  2MAM A;  1VQ5 T;  1KJW A;  2L89 A;  1I5L A;  1WHH A;  1ABO A;  1FX7 A;  1WXB A;  4NS5 A;  2D0N A;  1UFF A;  4WTO B;  3KUF A;  4J9E A;  2DIQ A;  1WYX A;  3O5Z A;  4RTT A;  5GAM e;  4R0K A;  4Z8A A;  1TG0 A;  3AHU A;  3EFR A;  4E7S A;  5LJ3 h;  2AIR B;  3OYH A;  1K9M R;  4KUL A;  4FYY B;  4M75 A;  4RTX A;  5D7U A;  5GAN 2;  5DLO A;  1JB0 E;  2M16 A;  4LDW A;  2GFU A;  2KEA A;  3LGF A;  1G8X A;  4ME7 A;  1PD0 A;  2EAY A;  3V8L A;  5FW9 A;  1PRL C;  2GNC A;  3G7Z A;  4LDX A;  4GLK A;  4DBH A;  3S3M A;  4WF2 A;  1M1G A;  5IXF A;  2FYK A;  1D3B A;  3RIR A;  4JRI A;  3TSZ A;  3V7R A;  1VQ7 A;  2DXU A;  4ZGE B;  3RDV A;  2E12 A;  4XU2 A;  1VQ7 Q;  4KGZ B;  4K11 A;  3GOX A;  2YWW A;  1M90 R;  4ORZ A;  3NTI A;  1KQS A;  1LJO A;  3MO8 A;  1RL2 A;  1D09 B;  2A37 A;  2YHT A;  2MIO A;  3NGP A;  2K57 A;  1PM3 A;  4DOW A;  3M56 A;  2A08 A;  4PFZ A;  3FJ5 A;  1B34 B;  1YWP A;  1WQW A;  4AT1 B;  2E4H A;  4C8Q A;  3RKY A;  2V8J A;  3RKX A;  5DM7 R;  3G4S A;  1VQL Q;  3C95 A;  5I22 A;  2RD1 A;  4D6W A;  3OYJ A;  1VQ4 A;  2D9T A;  3X20 B;  3HRU A;  1M1F A;  1AWX A;  1WLP B;  4Y91 A;  1BKB A;  1BI2 A;  3PT9 A;  3RKW A;  1BU1 A;  4VUB A;  1IGQ A;  1LVK A;  1G2B A;  2ZZD A;  2EKH A;  2KYB A;  2YUQ A;  3OYN A;  5HK0 A;  1G3Y A;  1RAA B;  2GQI A;  2ROL A;  5FWC A;  2ZAE A;  2OI3 A;  1FMW A;  1X01 A;  2P84 A;  2EVR A;  5CKD A;  4PJO B;  1KK7 A;  4UC4 A;  4E7H A;  3A5Z B;  4J9B A;  2E3H A;  5IN1 A;  3F70 A;  1JQQ A;  1WIE A;  2OJ2 A;  1N5Z A;  1ZSZ C;  2C06 A;  1AWO A;  1LOJ A;  2R5M A;  1JO8 A;  2RK2 A;  3QZ9 B;  4OMP A;  2COZ A;  4M7D D;  1D1B A;  1NYG A;  3S6W A;  2QEX T;  4J6W A;  2XG8 D;  1WZO A;  4N4I A;  1QMC A;  3DKM A;  2DPP B;  2B86 A;  1RAF B;  2HQH A;  5KYY B;  3X26 B;  1U3O A;  2CS7 A;  1M90 C;  4FL6 A;  4QW2 A;  3PMI A;  4HCK A;  3QDR B;  2NUP B;  3EFO A;  1K73 C;  2EBP A;  5KYW A;  4KGV B;  2QA4 A;  2EYQ A;  5GMK i;  1WHK A;  2F5T X;  2JNG A;  2CKK A;  3EHQ A;  1P92 A;  2NWM A;  4IUP A;  4XTY A;  2ESW A;  5CQY A;  2O31 A;  3ZBD A;  4Z89 A;  2JJ9 A;  3SFM A;  3CMA T;  1YFN A;  1S1N A;  4M7A F;  1UHC A;  1Q82 R;  4E7K A;  4M7A A;  3VS7 A;  8ATC B;  1OQK A;  1VIE A;  5DY9 A;  5FU7 C;  2ATC B;  4M78 C;  2HBP A;  1JXO A;  1MMN A;  2VVK A;  4PJO C;  3PFS A;  1VQP Q;  1JBM A;  1AD5 A;  2D0Q B;  1JU5 C;  5LJ5 d;  2DJZ A;  2YRC A;  2SEM A;  2X3W D;  1R0C B;  1A0N B;  5AYF A;  1VQO T;  4CRI A;  4EDU A;  2QEX Q;  1W2B P;  1IRX A;  2RO0 A;  2OTL T;  5AT1 B;  4MDX A;  1VQ8 Q;  5A0G A;  2LQ8 A;  3NTK A;  3J81 E;  1UGQ B;  3EG0 A;  3EH1 A;  1UB4 A;  3NPF A;  3G4S Q;  4C0G A;  2AK5 A;  4OVA A;  5L8R E;  1ZQ1 A;  3RR6 A;  2EPD A;  4GLM A;  5CKH A;  4PJO E;  1BI3 A;  2Z0W A;  2DET A;  2LJ3 A;  2O4X A;  5LJ5 e;  4J9H A;  5GAM h;  3CC7 A;  1C0M A;  1NYF A;  1XJW B;  3FRN A;  4JS4 A;  4M75 D;  2ZGW A;  4XAX B;  1T3S A;  2QQS A;  3UA7 A;  1TWB A;  2KRO A;  1ZBX A;  2ABL A;  3L2W A;  4Y28 E;  4PLI A;  1VQ6 A;  2LZ6 B;  4FCY A;  3OS5 A;  2QA4 T;  2DD5 A;  2E41 A;  2FG0 A;  2L3R A;  4EMK C;  3CCL Q;  2XHC A;  1ZHI A;  1JEG A;  4X1V A;  1PG5 B;  3M54 A;  1BI0 A;  3G6E Q;  5J26 A;  1BB9 A;  3OYB A;  4HXJ A;  5IHI A;  2RN8 A;  3G4S T;  3M0R A;  1ZUK A;  2A0F B;  2DZ9 A;  2M51 A;  3GBQ A;  4AG2 C;  1KC8 C;  9ATC B;  2DNU A;  2EQK A;  1JJ2 S;  4OP0 A;  1WA7 A;  1YIT Q;  3EFS A;  5GAM d;  3CBO A;  1YI2 Q;  1OU8 A;  1JRI A;  3CPW S;  3E1S A;  3H0H A;  2E70 A;  4PL6 A;  1VA7 A;  2YXY A;  2K6D A;  4N4G A;  4QVC A;  5GJW B;  2J06 A;  3JB9 F;  1K9M C;  2KNB B;  4F17 A;  1SEM A;  4F16 A;  3LH0 A;  1GXI E;  1Y71 A;  5I2M A;  1B7T A;  4A4F A;  2FPE A;  3L42 A;  4C8Q D;  2COW A;  2A3L A;  3CCV A;  1VYV A;  3CCJ T;  4XTX A;  3CCM A;  3OBY A;  2DO3 A;  2XD0 A;  4B9X A;  3WVD B;  3MCA B;  3OA6 A;  4M7D B;  4ATO A;  1SHF A;  2CSQ A;  3GNF B;  3CD6 Q;  1RAD B;  1QCN A;  1T3L A;  2J7I A;  4LXC A;  3O8V A;  2GGR A;  1YHQ Q;  1AHJ B;  4DEY A;  1ZA1 B;  2EJ9 A;  3M9Q A;  2K3Y A;  4MMK A;  3QDF A;  1WHG A;  3EG1 A;  4C8Q B;  5LJ3 f;  4FSS A;  2LX7 A;  3LW5 E;  1K9M U;  2GF7 A;  3QII A;  4M7A G;  2QG9 B;  3VRZ A;  4A53 A;  4KH1 B;  4MDW A;  5GAN f;  3VUZ A;  3SB2 A;  4LDV A;  3RER A;  3LLR A;  2F69 A;  3FDR A;  2GTJ A;  2LRQ A;  2VB6 A;  2VV5 A;  2K9G A;  5IH2 A;  5KCO A;  3X25 B;  2HSE B;  2RI2 A;  2E6N A;  1KQS S;  2OTL A;  3UF4 A;  1HK9 A;  3PIO A;  1BI1 A;  1E6H A;  4M7D F;  4M77 F;  4EMK A;  2RB6 A;  4JJC A;  4M7A E;  2MF2 A;  3G6E T;  2YRV A;  4PK4 A;  1UJY A;  4M7D C;  2EFI A;  5KYW B;  1Y07 A;  5GAO q;  2X3X D;  3RUX A;  1D1C A;  2R5A A;  2FZG B;  2F2V A;  3SEM A;  2OTL Q;  2RI3 A;  2HKQ B;  4IUR A;  1NEG A;  3MP8 A;  4PJO F;  4PJO A;  2NUT A;  4M7A B;  1AT1 B;  3SWN C;  3TVT A;  1ZSZ A;  1LPL A;  1VQK Q;  4F7U B;  1KD1 C;  1RAE B;  5KYN A;  2Y90 A;  1H3Z A;  1VQL T;  1BCM A;  3E9F A;  1N8R R;  4FYV B;  4M78 F;  3JB9 H;  3RMQ A;  2XID A;  1D1A A;  1R0B G;  4ELZ C;  3EG2 A;  5LJ5 h;  3CPW P;  1QVG A;  4ZNX A;  4C92 B;  1YJW Q;  3LH5 A;  1PWT A;  4TVR A;  4E47 A;  2D8H A;  3JCM d;  1XTD A;  3KFV A;  3OYY A; 
#chains in the Genus database with same CATH homology
 4ZN3 A;  2RHU A;  4KUL A;  3JCM X;  3OYC A;  5GMK h;  1M90 U;  4M75 A;  5GAN 3;  3S3N A;  1BIA A;  5A0D A;  4GY5 A;  3BFM A;  5GAN 2;  3JCM J;  1X6O A;  2R58 A;  2LTO A;  3OMC A;  5DLO A;  1JB0 E;  2M16 A;  4LDW A;  1S72 T;  3PNW C;  3MP6 A;  2XU8 A;  2QXF A;  2LVM A;  2GFU A;  5KCH A;  1QVF S;  3LGF A;  4OMF B;  4ME7 A;  3OYE A;  3OYL A;  4FT2 A;  4RG8 A;  2EAY A;  3V8L A;  2CZ1 B;  4XK8 E;  3P8D A;  3H6Z A;  4XTV A;  3JCM g;  4M75 B;  3ZEH A;  5GMK l;  2MWO A;  3OMG A;  5DLQ E;  4NOY A;  2RI5 A;  2ZPG B;  3G7Z A;  4M78 B;  2WAC A;  4LDX A;  4GLK A;  4J6X A;  1NPP A;  4HT8 A;  3S3M A;  1NPR A;  2VYT A;  4WF2 A;  5FU6 C;  1M1G A;  2HNI A;  3MEA A;  2FYK A;  2ZPE B;  1D3B A;  1QVG S;  2PVD B;  4JRI A;  3RIR A;  3LYI A;  4QQD A;  4X9C A;  3OYK A;  3HFO A;  2MMP A;  4ZGD B;  3V7R A;  4A4G A;  1O9S A;  3MEW A;  4MZM A;  2XDB A;  3X28 B;  1VQ7 A;  1G3T A;  2DXU A;  4J7F A;  4ZGE B;  2GCX A;  2E12 A;  4XU2 A;  2K5I A;  4JUV A;  4C92 C;  3GOX A;  2LNV A;  3GF5 A;  2EJG A;  1VQP T;  3LX7 A;  1YJ9 T;  4ZGJ B;  3NTI A;  1KQS A;  4C0D C;  1BIB A;  4ZTF A;  1LJO A;  3MHX A;  3MO8 A;  4KUI A;  3CCR T;  1RL2 A;  2AHJ B;  3VJP A;  3CCU A;  3CCE T;  2YHT A;  3GLX A;  4M78 E;  2I2L A;  2R57 A;  3A8H B;  4BI4 A;  4DOV A;  3FLG A;  1YJN T;  1VUB A;  3QSU A;  2K57 A;  4DOW A;  1YJW A;  4M7D G;  3M56 A;  2E1H A;  5LJ3 g;  1PSF A;  3BW1 A;  3CBM A;  1B34 B;  1FXX A;  3TRE A;  1WQW A;  3UT1 A;  3GIB A;  1VQ9 A;  1VQ7 T;  3JSC A;  5GMK m;  3JCM b;  3X24 B;  2DEQ A;  4C8Q A;  3RKY A;  2JUF A;  1QP2 A;  5LJ5 g;  2V8J A;  2EWN A;  2PUK B;  4II1 A;  3URG A;  3RKX A;  3CCL A;  1YBY A;  3ZFJ A;  5DM7 R;  3G4S A;  5KE2 A;  3CME A;  4BB7 A;  3C95 A;  5J39 A;  4L6V 5;  3JCM P;  1XQH A;  2RD1 A;  4RMO A;  5CKB A;  4D6W A;  3OYJ A;  3L1A A;  1VQ4 A;  2FL7 A;  4M78 G;  2X35 A;  2D9T A;  1NE8 A;  1D3B B;  3C4S A;  3HRU A;  3TEE A;  1M1F A;  3SDZ A;  3X20 B;  1VIF A;  5LJ5 f;  4DA4 A;  4P5N A;  2M0O A;  4JLG A;  3PGG A;  4M77 D;  5GAN j;  3E9G A;  4IKF A;  4KBM B;  4Y91 A;  2DD4 A;  1BKB A;  2E10 A;  1BI2 A;  5A0L A;  3PT9 A;  5GAM g;  3RKW A;  5I2S A;  3CEY A;  1M4Z A;  4C92 E;  1K8A U;  4Q5W A;  4VUB A;  4ELY C;  2KMT A;  1W2B S;  2QI2 A;  3BY7 A;  2LT4 A;  1NZ9 A;  4L5G A;  3KXT A;  1M1K U;  1OZ3 A;  2ZZD A;  2BKD N;  5CCA A;  3HKS A;  2EKO A;  2VGN A;  3OYN A;  1UGR B;  4JRP A;  2A7Y A;  3CBP A;  5HK0 A;  2YLC A;  4M75 E;  5D6Y A;  3CC2 T;  4BE0 A;  2LC4 A;  1G3Y A;  3VV0 A;  3V8J A;  2XKO C;  3OYA A;  2RH2 A;  1Q86 U;  2K5L A;  4IUQ A;  2LDM A;  1WJS A;  1YCY A;  3C12 A;  4MML A;  5FU6 B;  5C0M A;  4B9W A;  3OYY A;  5LJ5 j;  2P0P A;  4XTZ A;  4HCC A;  4X34 A;  1VQ8 A;  4BE1 A;  4FSX A;  3QZ5 B;  3SWN B;  3JB9 D;  1KHC A;  1QP3 A;  1Y96 B;  5GAN 5;  1I81 A;  1IRE B;  4NL3 A;  2KQW A;  1X01 A;  2ZCF B;  5CKD A;  2GFA A;  4PJO B;  3CC2 A;  2D6F A;  4UC4 A;  5IT9 E;  4E7H A;  3FJP A;  2KY9 A;  3A5Z B;  4QVZ A;  4C92 G;  3CCE A;  2CZ0 B;  2DKG A;  2JN0 A;  5IN1 A;  3F70 A;  3CC4 A;  5KH6 A;  3CC4 T;  4LDY A;  3GP8 A;  3G71 A;  2C06 A;  3BDU A;  3V7S A;  4EMG A;  1LOJ A;  5GMK e;  2R5M A;  2CZ7 B;  2IVW A;  2NLU A;  2RK2 A;  1N8R C;  3QZ9 B;  4OGE A;  4ZN1 A;  4M7D D;  1VQK A;  4PJO G;  1OYX A;  1U8R A;  2DZC A;  3G6E A;  2QQR A;  3S6W A;  5FRO A;  3CME T;  2QEX T;  2DK3 A;  4J6W A;  2M9U A;  2XG8 D;  2O4X B;  5GAN d;  4N4I A;  3OYI A;  2EQM A;  3DKM A;  3CC7 T;  3M5A A;  5HK3 A;  1Q7Y C;  4QVD A;  2DPP B;  3J7A F;  4L59 A;  1WNL A;  2EQJ A;  4A54 A;  4M7D A;  5GAN 4;  3DB3 A;  2RHZ A;  3ME9 A;  3QG1 A;  3X26 B;  4O5V A;  2CS7 A;  2RM4 A;  4FL6 A;  5CKE A;  4BD3 A;  5GAN 8;  3JB9 I;  1M90 C;  4QW2 A;  4FM4 B;  3PMI A;  2G3R A;  2K2V A;  3DB4 A;  5CVI A;  3UWN A;  2WSE E;  3QKJ A;  4J8O A;  3CCQ A;  2L8D A;  3QDR B;  1R8O B;  1VQN A;  1YJW T;  3CD6 A;  2JTM A;  4HT9 A;  3A8G B;  1K73 C;  5GAO l;  4M77 C;  1HXD A;  1YJ9 A;  1S72 A;  2QA4 A;  2QQA A;  1U1T A;  2EYQ A;  5GMK i;  2F5T X;  2JNG A;  2CKK A;  2F5K A;  2V8K A;  4C92 D;  4IUT A;  3VYG A;  3OS0 A;  2DAQ A;  2PQW A;  1P92 A;  3V7C A;  3HHT B;  3CXC A;  4IUP A;  4XTW A;  4XTY A;  3H8Z A;  5CQY A;  3ZBD A;  2QQB A;  3SFM A;  4HKE A;  1Q81 C;  1JJ2 A;  2K3X A;  4RCB A;  3CMA T;  3TU4 K;  4JRK A;  1KHI A;  3NFC A;  3CCV T;  3JB9 J;  3CD6 T;  2RHY A;  4M7A F;  3WVE B;  2EJF A;  1KD1 U;  4E7K A;  4M7A A;  3CCL T;  1KQ1 A;  3QPH A;  3JCM h;  2DXC A;  4BAC A;  1VIE A;  5DY9 A;  2KDS A;  5LJ3 j;  5FU7 C;  3OQ5 A;  4BI3 A;  3HP9 A;  4E7L A;  3CCU T;  3OSS C;  4M78 C;  2HBP A;  4A4H A;  2PUO B;  3P8H A;  4OF1 A;  4PJO C;  3PFS A;  4F7U A;  4C8Q G;  4R56 A;  5FU7 B;  1YIJ T;  4E7J A;  4KUD K;  5D6X A;  1VQP A;  4YTL A;  1OZ2 A;  3I55 T;  1VQL A;  4PLL A;  1JBM A;  3JB9 G;  2D0Q B;  3CCR A;  2E65 A;  3N5B B;  4OB3 B;  1KQ2 A;  2QTX A;  5LJ5 d;  2DJZ A;  4M78 D;  2ZPB B;  3C94 A;  2PU9 B;  2RHX A;  4XU3 A;  2EIF A;  5CR2 A;  1YHQ T;  3JCM Q;  1YHQ A;  4N0A A;  5AYF A;  4BY6 B;  4OB1 B;  3PMT A;  4C0Z A;  4CRI A;  2LT1 A;  1OI1 A;  2FVU A;  4C92 A;  2QEX A;  4EDU A;  2DTO A;  3CCM T;  2P0Q A;  2RO0 A;  3CCS T;  3MP1 A;  3CXC S;  1VQO T;  2OTL T;  4MDX A;  5A0G A;  2LQ8 A;  3NTK A;  3J81 E;  2BIV A;  1UGQ B;  1WJQ A;  3HFN A;  1UB4 A;  2JVV A;  3HRS A;  3NTH A;  1MHN A;  4C0G A;  4EMK B;  3OW2 S;  4OVA A;  3A8L B;  2RJD A;  5L8R E;  1ZQ1 A;  2HAX A;  5CKH A;  4PJO E;  1BI3 A;  1N27 A;  4C8Q C;  2XIC A;  3GPL A;  4A4E A;  2MWP A;  3CMA A;  5LJ5 e;  1DJ7 B;  2O4X A;  4BI8 B;  2X4W A;  5GAM h;  2JZ2 A;  3CC7 A;  3EAE A;  2PVG B;  3FRN A;  5J3B A;  3OSV A;  4JS4 A;  3M55 A;  4M75 D;  4C8Q F;  2ZGW A;  1M1K C;  4XAX B;  1Q7Y U;  3Q1J A;  2QQS A;  3PIP A;  1K8A C;  1WPY A;  4M77 A;  5KE3 A;  4BUG A;  4F7U G;  1ZBX A;  1X75 C;  2DIG A;  4NL2 A;  3CCJ A;  5GAN 7;  2YLB A;  3L2W A;  2QQ9 A;  4Y28 E;  4PLI A;  4M78 A;  2P0K A;  1VQ6 A;  1G3W A;  2RHI A;  1VQM A;  3MEU A;  3LWH A;  3OS5 A;  3E19 A;  4KT0 E;  4M77 E;  2QA4 T;  2DD5 A;  3SD4 A;  2E41 A;  2OTJ A;  4C0F A;  5C6S A;  4Z02 A;  2L3R A;  4EMK C;  4F7U F;  4BDY A;  5GAO n;  3QHS A;  3DLM A;  2QDY B;  2XHC A;  1QW1 A;  1ZHI A;  2LCL A;  1BYM A;  4M77 B;  3M54 A;  3HRT A;  3T9N A;  3VYH B;  1BI0 A;  2E6Z A;  2VGM A;  3A8M B;  1YIT T;  1YIT A;  3VU3 C;  4CI0 C;  5J26 A;  3OYB A;  3QJY A;  5GAN h;  3UPU A;  2E64 A;  4MZT A;  3G4S T;  3FC3 A;  2ZPF B;  4C5G A;  1EIF A;  4XQ3 A;  2DZ9 A;  3QUI A;  3R6O A;  3JCM e;  1KC8 C;  3V8K A;  4C92 F;  1VQ5 A;  1N6A A;  2EQK A;  4C0D B;  4PJO D;  1U1S A;  1FWZ A;  4OP0 A;  1JJ2 S;  2Y4Y A;  3VUB A;  5GAO m;  3M4G A;  4C5I A;  2DXT A;  1VQ9 T;  4C5E A;  3EFS A;  1W4S A;  5GAM d;  3CBO A;  2GQV A;  1WGS A;  3OY9 A;  1MGQ A;  1N9R A;  3JCM c;  1JRI A;  3CPW S;  2X4X A;  2K5F A;  3E1S A;  4HCB A;  4PL6 A;  2E70 A;  2LX9 A;  3ASK A;  5HKC A;  5CK9 A;  1VQN T;  3VKI A;  3M59 A;  5M9O A;  4N4G A;  4X9D A;  4QVC A;  1WQ7 A;  2EQU A;  2HQX A;  3JB9 F;  1K9M C;  1UGP B;  3QO3 A;  2DTI A;  2RJF A;  4QQ6 A;  2IG0 A;  1UGS B;  3LH0 A;  5IAY A;  2KVQ G;  1LNX A;  4N0A C;  4RCC A;  3JRZ A;  3MET A;  5I21 A;  1Y71 A;  3I56 A;  1GXI E;  5I2M A;  4XTU A;  4A4F A;  4BY6 C;  3L42 A;  3FB9 A;  2DXB A;  4M75 F;  1SSF A;  2LQK A;  5CKF A;  3A8O B;  2LCC A;  4C8Q D;  5GAO p;  1VQ8 T;  1W2B A;  2A3L A;  4N4H A;  3OYF A;  3OYG A;  3CCV A;  3CCJ T;  4XTX A;  4QQG A;  3CCM A;  5CIU A;  1VQ4 T;  3FIF A;  3P8B B;  4M75 C;  3L2R A;  4DQ2 A;  3OBY A;  2DO3 A;  4RG2 A;  2XD0 A;  5GAM f;  4OGC A;  1I8F A;  5GAN 6;  2DVE A;  4XU1 A;  3HL8 A;  2E5Q A;  3WVD B;  3MCA B;  4B9X A;  3OA6 A;  3I56 T;  1KG1 A;  5GMK j;  4LDU A;  3OS2 A;  3L2U A;  1YI2 A;  3HSB A;  4ATO A;  4M7D B;  4J5Y A;  3HPW A;  4V2S A;  3GNF B;  2WSF E;  4F7U E;  1N9S A;  4M77 G;  1KC8 U;  2VXE A;  3CPW A;  2OAU A;  4BE2 A;  2B8A A;  3LGL A;  1VQM T;  5LL6 S;  2CGH A;  3OYD A;  3O8V A;  4JDS A;  4PNO A;  1AHJ B;  1Y96 A;  1IZ6 A;  2BUD A;  2VC8 A;  3BDL A;  3QXE B;  1G3S A;  4HA8 A;  2EJ9 A;  4RKU E;  3FEO A;  2H3J A;  2KSS A;  3M9Q A;  3KBG A;  4J7I A;  2K3Y A;  2CYZ B;  4MMK A;  3QJ6 A;  1YIJ A;  4JJN K;  1NJI C;  1PSE A;  5FRM A;  5GAM j;  4C8Q B;  3RES A;  3I55 A;  2VUB A;  5LJ3 f;  3GNG A;  3INZ A;  1H64 1;  4A4K A;  3LW5 E;  3UDC A;  4JLI A;  2KAF A;  4JRQ A;  1Q82 C;  1XOV A;  2GF7 A;  1K9M U;  3QII A;  4M7A G;  3M57 A;  2XK0 A;  4A53 A;  4MDW A;  1QVF A;  2P4T A;  5GAN f;  2JTF A;  3VUZ A;  3SB2 A;  4LDV A;  1Q82 U;  2F69 A;  3LLR A;  3DLL A;  3RER A;  3FDR A;  2LRQ A;  4LD6 A;  3PTA A;  2VV5 A;  5D6W A;  1V29 B;  1XNI A;  4M7D E;  4XU0 A;  2KK4 A;  3OYM A;  2ZPH B;  5KCO A;  3X25 B;  1KQS S;  2RI2 A;  2E6N A;  2RK1 A;  3CCS A;  2OTL A;  1VQ6 T;  1HK9 A;  3MEV A;  4J6Y A;  4HCZ A;  4OB2 B;  5FLX E;  3PIO A;  3M4Y A;  1BI1 A;  2HQE A;  1K73 U;  4M7D F;  2Y4X A;  4M77 F;  4EMK A;  4OB0 B;  4LD9 K;  2RB6 A;  3LWI A;  5LJ3 e;  4EPC A;  1N8R U;  2JOY A;  3OBW A;  1M5Q 1;  3WXM B;  4J83 A;  4M7A E;  1WJR A;  2MF2 A;  3G6E T;  2YRV A;  4PKC C;  2RJE A;  4MZP A;  4BDZ A;  4M7D C;  2EFI A;  1G5V A;  3JCM f;  1B34 A;  1Y07 A;  4FT4 A;  5GAO q;  3S3O A;  3OB9 A;  3RUX A;  5GAN e;  5EG2 A;  2R5A A;  2RJC A;  4E7I A;  2MI6 A;  2DTH A;  2L5Q A;  2XI9 A;  4C8Q E;  5A2Q E;  1YJN A;  1UEB A;  3TCJ A;  3J80 E;  2X4J A;  1Q86 C;  4M75 G;  3JAM E;  2WSC E;  1YI2 T;  3OW2 A;  4M7A D;  2RI3 A;  3CPF A;  2K4Y A;  4R55 A;  4IUR A;  4FU6 A;  2HD0 A;  5LJ3 d;  3MP8 A;  2XDD A;  4IUV A;  4PJO F;  1M9S A;  2XDP A;  5CAI A;  4PJO A;  4M7A B;  2OTJ T;  2PVO B;  5CQX A;  2RA2 A;  3SWN C;  1VQK T;  4O6J A;  2MAM A;  1VQ5 T;  5HY6 A;  2O01 E;  1Y7X A;  3QYG B;  3ER0 A;  2L89 A;  4EMH A;  4ZTJ A;  5GAO r;  3OS1 A;  1I5L A;  5FRN A;  5CO7 A;  4M7A C;  4F7U B;  1KD1 C;  2V8I A;  1FX7 A;  2Y90 A;  4NS5 A;  1H3Z A;  1VQL T;  2ZPI B;  3G71 T;  3E9F A;  3M58 A;  3KUF A;  4M78 F;  2DIQ A;  1NJI U;  2VXF A;  2CZ6 B;  3QBY A;  3JB9 H;  3RMQ A;  3JCM V;  2X4Y A;  2XID A;  3L2Z A;  1Q81 U;  4ELZ C;  3JCM W;  3QYH B;  3RMS A;  5GAM e;  1I4K 1;  5LJ5 h;  3CCQ T;  3L2V A;  1QVG A;  4FIB A;  1RI0 A;  4IUU A;  1VQO A;  4C5H A;  4C92 B;  5GAN g;  2FB7 A;  4TVR A;  1QVP A;  4E47 A;  2M1H A;  3M53 A;  3JCM d;  3EFR A;  3L2Q A;  4JS5 A;  1TH7 A;  1XTD A;  3AHU A;  1M8V A;  2FHD A;  3SWN A;  1O75 A;  5LJ3 h;  3OYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...