3LGLA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k382me2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA01
3CCMA 2L3RA 5KE3A 1VQ8A 1VQ6T 3Q1JA 3PMIA 1W2BA 5FLXE 1N8RC 3MO8A 3CC7T 1JJ2A 3UT1A 2DO3A 2M0OA 3CCVT 1VQPT 2RJCA 3PFSA 5D6XA 3LYIA 3OYIA 3CCMT 4ZN3A 4RG2A 4Z02A 1VQKT 2RI3A 1Q7YU 3MEWA 3CCVA 1VQPA 5KE2A 5C0MA 3MEAA 3OYLA 4CRIA 3E9FA 1VQ9T 2GFUA 3OYBA 3KUFA 4C5GA 4BACA 2DIGA 4LD6A 1YITT 1QVFS 3LLRA 1VQ5T 2QQSA 1N27A 1WGSA 3CMAA 2EKOA 1K8AC 4FL6A 3DLMA 1VQOA 3DB4A 2HQEA 3QJ6A 3CC4T 1VQ5A 1YIJT 3A5ZB 2E70A 1MHNA 2EQJA 1YITA 1VQLA 2B8AA 5J3BA 2LVMA 1JJ2S 3E9GA 3MEVA 2QEXT 2OTJA 3L42A 3SD4A 1M1GA 5KH6A 4QQGA 4A4EA 1VQ8T 1YHQA 2MWPA 3G6EA 1KD1U 2R5MA 3MP6A 3QKJA 3CC4A 2L8DA 1KD1C 1WJSA 1Q82U 3OYYA 2X35A 5IN1A 3META 3ER0A 3CC2T 3OY9A 1VQNA 3CMEA 2MWOA 2XHCA 3H8ZA 3OYEA 1QVFA 3S3OA 5A2QE 3CXCS 1OZ3A 2BKDN 4IUTA 4N4GA 3J81E 1VQ6A 1KC8C 3CD6T 3UWNA 2RHZA 2RJDA 3P8HA 1OI1A 1X6OA 4C5EA 2MI6A 1WJRA 2JVVA 1S72A 1XNIA 3CCET 4E7KA 2IG0A 3PMTA 3G4SA 4A4FA 1K73U 3OMGA 2M16A 2FHDA 1OZ2A 3OYFA 3DB3A 3P8BB 5KCOA 4BE1A 5LL6S 5M9OA 2KDSA 1VQMA 2EQKA 2XDPA 2R58A 3G71T 3CCSA 1NPRA 4TVRA 3LX7A 1YI2A 3ZEHA 3CXCA 1YJ9T 2QQRA 3MEUA 2LTOA 3EAEA 2GF7A 1SSFA 3S3MA 3OYDA 4BDZA 4EDUA 1YJ9A 3OYCA 5C6SA 2OTLT 3NTHA 1M90C 5KCHA 3OYGA 2X4WA 4BE0A 2JTFA 3J7AF 3OS0A 3CCQT 4IUVA 4Q5WA 1VQNT 4FU6A 5D6WA 4ZN1A 5FRMA 1K9MC 1VQ7T 4QQ6A 2O4XB 2GFAA 3NTIA 3OB9A 3ASKA 1NZ9A 2X4YA 2RO0A 1VQ4A 4QVZA 4IURA 2RHYA 2JOYA 4X34A 2E5QA 1VQOT 1NPPA 3CCQA 1WJQA 3OS2A 3O8VA 1OYXA 2O4XA 4N4HA 3KBGA 2LQ8A 1Q81C 2RI2A 3PIPA 2JZ2A 3OMCA 1Q82C 2EQMA 2BIVA 2PQWA 1BKBA 4C5IA 2EFIA 4IUUA 3ME9A 1KQSA 2JNGA 1Q7YC 2RI5A 3OQ5A 3L2RA 4QQDA 1QVGS 1VQLT 1M1KU 4BDYA 1KHIA 5D6YA 5CIUA 3CC7A 3GOXA 1N8RU 4PLLA 3I56A 1NJIU 3PNWC 3MP8A 3OYJA 3L2WA 2CKKA 2KVQG 3CD6A 4II1A 2E6ZA 3LH0A 4QW2A 3I55T 1Q86U 2K3XA 3CPFA 3G6ET 1YJWT 3S3NA 2WACA 1VQ4T 1Q81U 3L2UA 1VQ9A 4NS5A 2QA4A 5J26A 4IUPA 3I56T 3QBYA 3CCJT 3I55A 4OVAA 2R5AA 5DM7R 1VQMT 4GY5A 1G5VA 1KQSS 5HY6A 1RL2A 3CCJA 4E7IA 1UEBA 2LCCA 3CCST 1K73C 1YIJA 2E6NA 1QVGA 4IKFA 5IT9E 5FRNA 4ZTFA 4PLIA 3CEYA 2P0KA 4YTLA 1EIFA 3P8DA 3L2VA 2RJEA 3CCRA 2RHUA 3DLLA 2XK0A 2R57A 3OYHA 4BE2A 4E7HA 4HCZA 1Q86C 2D9TA 2K3YA 4BD3A 3J80E 1YBYA 5DLQE 4C5HA 3G71A 3CMET 1VQKA 5J39A 2LCLA 4PL6A 1M1KC 3OYAA 1RI0A 5FROA 3FC3A 2HQXA 4E7JA 2DIQA 2F5KA 3OW2A 3C4SA 3QIIA 2L89A 4E7LA 3CCLA 3CCEA 1KHCA 3CPWA 2NLUA 2RHIA 4ZTJA 3G4ST 1NJIC 3TREA 3CCUA 3F70A 3FEOA 3HKSA 3OYMA 1YJNA 5IAYA 3FDRA 3OS1A 3M9QA 2JUFA 3NTKA 3CC2A 1YJWA 3OA6A 4A4HA 2OTLA 1H3ZA 4B9XA 1K8AU 2EQUA 4IUQA 3H6ZA 1YJNT 3CMAT 2DAQA 1VQ7A 2YRVA 2G3RA 3OYKA 2RJFA 2EIFA 2QA4T 1W2BS 2VYTA 1YHQT 1S72T 3PIOA 2RHXA 3JAME 1YI2T 2BUDA 3OW2S 3BDLA 1K9MU 3CCLT 3OYNA 3CPWS 2QEXA 2OTJT 4A4GA 4B9WA 1KC8U 3MP1A 2LDMA 3LGLA 2X4XA 4N4IA 3S6WA 3CCUT 1M90U 3LGFA 3FLGA 1XTDA 4UC4A 3CCRT 1IZ6A 2LRQA 2M1HA 4L59A 3L2QA
chains in the Genus database with same CATH superfamily
3UF4A 1JO8A 2X4JA 3OW2P 1VQ8A 3Q1JA 3PMIA 1YCSB 4C8QE 4HT9A 1N8RC 1YI2Q 2XDDA 3D7SB 2DO3A 1OULA 2DZ9A 2ED0A 4XTUA 2KAFA 5D6XA 3LYIA 3OYIA 2I0NA 4LN2A 1ZUUA 4RG2A 4AFZC 3V8LA 4ATOA 1VYVA 4XQ3A 2H3JA 2K2MA 3JCMb 2DVEA 2H8HA 3CCVA 4HCBA 2RN8A 2K79A 4LDXA 3VS6A 2RQRA 2J05A 2ECZA 3A8LB 4F04B 4BACA 1X75C 4F7UF 4LD6A 1QVFS 1GFCA 4JJCA 3M53A 2QQSA 5GJVB 1WI7A 2RNAA 1K8AC 1G3SA 3JB9H 3C12A 2KY9A 1BCMA 1X01A 1E6HA 1VQ5A 3HP9A 2E70A 2OI3A 2EYYA 2B8AA 5J3BA 1JB0E 2J06A 2X9HA 2YHTA 3SHWA 2RK2A 3FB9A 2DLPA 4M7DD 2DE0X 3RKWA 1D3BB 2L8DA 3ZL7C 1WJSA 4FT2A 4F17A 3META 3CC2T 2FPFA 3G1JA 1NE8A 4AFQC 1AZGB 1W70A 2HD0A 2HSEB 3OYEA 1G83A 4E7ZA 1BB9A 3CXCS 2DD4A 2BKDN 3QPHA 4RKUE 1KC8C 1K8AR 5CR2A 2O88A 2RF0A 1Y96B 1N9RA 1VQPQ 4RCBA 3L1AA 1OI1A 3L2ZA 1X6OA 3QYHB 1R77A 1WJRA 3G4SQ 2JVVA 3QZ5B 2PVOB 4RCCA 4C8QD 3CCET 2ABLA 4JS4A 2OAWA 3PMTA 1O75A 5LJ5h 4A4FA 3G4SA 1ABQA 3DB3A 4J9CA 4ELYC 4RTUA 1M2VA 3NGPA 3QWYA 2PZ1A 2EQKA 5I2SA 1JU5C 3G71T 2D6FA 1SKUB 4ME7A 4M77B 1BI2A 1S72Q 2EBPA 1M27C 3TSWA 3SEMA 1U8RA 3TSZA 3LX7A 2FRWA 3CXCA 2LTOA 2L0AA 3TVTA 4C0ZA 2COWA 1QMCA 5ECAA 1HD3A 3OYDA 3VS1A 2CH4A 2LT4A 2ZCFB 5CKDA 4BDZA 4EDUA 2F69A 3I35A 4J7IA 1EX4A 3M0QA 1TU0B 3NTHA 1M90C 2YSQA 3RNJA 5GMKe 1M30A 4AG1C 4BE0A 1UJYA 2MMPA 4FYYB 2QTXA 1X6BA 3GP8A 5HK3A 1I5LA 4F7UB 1ARKA 5DY9A 1PM3A 3CMAQ 4FT4A 4QQ6A 5CCAA 1UG1A 2GFAA 2LP5A 1B07A 3RR6A 1RI9A 4ZNXA 1MNEA 2X4YA 4BI8B 3EG9B 3RMSA 3BW1A 3JCMV 3JCMP 2RHYA 2JOYA 2J6KA 2E5QA 1NPPA 1MMNA 1OYXA 1UJ0A 4X1VA 2Y4YA 3KBGA 4M78F 2KT8A 4PJOG 3UA7A 4V2SA 1VYUA 3I5RA 2L3PA 4ANJA 2RI2A 2JZ2A 2J6FA 2PQWA 1BKBA 2QK0A 2A0FB 1SEMA 2EFIA 3CPWP 1LPLA 3ME9A 5LJ5g 1KQSA 2ED1A 2JNGA 1YJ9Q 5A0GA 1QP3A 5KYUA 3M54A 3OQ5A 3L2RA 4BI3A 4ZGDB 2L3SA 4C92E 5D6YA 1XOVA 5CIUA 1ZSZB 1KQSP 2DL8A 4PLLA 1AWOA 3OYJA 3GIBA 2KVQG 4AMCA 5FU6C 4C8QB 1Q86U 1G3WA 1UGSB 4N0AC 2E4HA 5GAN8 3CPFA 2K57A 4A54A 3G6ET 3M0TA 1BI0A 3HFOA 1PWTA 2F5TX 1Q86R 5CKBA 4M75B 1VQ9A 4NS5A 3PTAA 2QA4A 4RTVA 3JB9G 2HBPA 1OPKA 3CCJT 3I55A 1SPKA 2OAUA 2PU9B 4NL3A 1VQ6Q 2LX9A 3UDCA 1RLPC 1G5VA 1KSWA 1WNLA 5HY6A 1M1FA 2CS7A 1G8XA 3JCMX 1G3TA 1UEBA 4JJBA 4J6YA 3CCST 2DRKA 1QVFP 1QVGA 4IKFA 4ZTFA 3M59A 3CEYA 3RUXA 2Z0WA 2OJ2A 1JQQA 3CCRA 2IVWA 1C0MA 2LJ3A 3VV0A 2XK0A 4A4KA 2AK5A 4BE2A 4E7HA 3REBB 2FZGB 1N8RR 3FRNA 4J8OA 5IXFA 2E65A 2HSPA 1YBYA 4PFOA 3HL8A 4M75C 1RAGB 4PL6A 1RI0A 3U23A 2PUKB 5FROA 2HQXA 4D8KA 1WHGA 2CSIA 4HVUA 3CCEA 3M58A 1KHCA 1SG5A 2DYBA 5KYXA 2NLUA 3VKIA 2GQVA 5GAMe 3H0FA 1UGPB 3M0PA 2QQBA 3G4ST 5FWBA 2MOXA 1VQ8Q 1MGQA 3CCUA 4Y92A 1VQ4Q 2EJFA 3M9QA 4PFPA 2E5KA 3NTKA 2CYZB 3CCUQ 2OTLA 1H3ZA 1ZUYA 5CKEA 1D3BA 4PJOB 1QP2A 4LNPA 2HEQA 4FYVB 4K11A 3H6ZA 1YJNT 1YWOA 3MKDA 1PCXA 2DNUA 1NLPC 1WYXA 2RJFA 2EIFA 1W2BS 2RD1A 1S72T 1QLYA 1Y96A 1PKSA 1RAFB 1I0CA 2K5LA 2HDAA 2QQ9A 4MDWA 3QYGB 4MDXA 1BI1A 1FMKA 4M7DE 2FZKB 3GF5A 4P5NA 1K9MU 1GCQC 1RAEB 1U1TA 2CP6A 5GAN7 1OPLA 2KXDA 2QEXA 2OTJT 4JS5A 4A4GA 5GAOr 3MP1A 4J9GA 1WZOA 1KC8U 2LDMA 1FWZA 2K4YA 2QDYB 1TUDA 2DRMA 3LH5A 3VJPA 4GLKA 3JSCA 1PSEA 2OX7A 3LGFA 2LNVA 5DLOA 3OBWA 3EFSA 3CCRT 5LJ5d 1PC0A 1WHJA 1ZA2B 1VIEA 4WCIA 5LJ3h 1H3HA 1VQ6T 3C94A 4KUIA 4XU1A 3A8HB 3SWNC 1TOVA 5CKFA 1YIJQ 1IB8A 1M5Q1 2M0OA 3CCVT 2EYWA 2NUPB 2AT1B 2A3LA 1B7TA 4J9DA 4XU2A 3CCMT 1TH7A 4ZN3A 3CQTA 2RM4A 4Z02A 4AG2C 1Q7YU 3QWXX 4VUBA 1VQPA 2D8JA 4JRPA 3JCMd 3KFVA 5C0MA 4M78B 3WXMB 1X27A 2O31A 3OYLA 1Z9ZA 3X25B 1ZUKA 4C5GA 3RERA 1YITT 4HT8A 2IPOB 1VQ5T 1JXMA 1WGSA 3M4GA 4FYWB 5GAN2 2MAMA 2X3WD 3WVDB 4LDVA 3CMAA 4AFSC 3DLMA 1M90R 2JJ9A 2CP3A 3DB4A 2HQEA 1LCKA 3QJ6A 5HK0A 3CC4T 3QO3A 4BUGA 3BDUA 4JUVA 2JTEA 3O5ZA 2KR3A 4M7AA 1JJ2S 1AHJB 3E9GA 2EJGA 1OOTA 4BY6C 3VRYA 2ZAEA 3EGUA 3SD4A 2K6DA 5KH6A 1P92A 4QQGA 2XU8A 1VQ8T 1G3YA 3EG9A 5LJ5f 1U3OA 3G6EA 1KD1U 2EVRA 4XTYA 1BIAA 1B3QA 1QCFA 4MZPA 1GFDA 3JCMc 4LXCA 3OSSC 4EMKC 3EFOB 3OYYA 1WHHA 3ER0A 1WDXA 1I07A 1VQNA 2XHCA 3H8ZA 4AT1B 3S3OA 5A2QE 1PRLC 4M78A 4D6WA 3J81E 5GAN3 3CD6T 3UWNA 2RHZA 1ACMB 4FW2A 5AT1B 1C6VX 3P8HA 3PVQA 4M78C 5GAOp 2DVJA 3RKXA 4IIOA 2RMOA 2KK4A 1D1CA 5KYYA 3X20B 4EMHA 1OZ2A 2EYXA 3NMZC 2ROTA 3A98A 2J7IA 2P4RA 3EGDA 2HMAA 5M9OA 1K0SA 2KDSA 1TS9A 1JBMA 2HBWA 1FXXA 2LT1A 2F1LA 3M55A 5GJWB 1RABB 2R58A 2QA4Q 1UGQB 5GANf 2AKLA 1XJWB 1UHCA 4Z89A 4CC7A 3H9NA 4J7FA 2KRNA 1SF9A 3ZEHA 2O9VA 2DERA 5GANg 3EAEA 2GF7A 2PTKA 1SSFA 3CCLQ 3S3MA 4FSSA 4JZ3A 3JB9I 4J9IA 5C6SA 1WX6A 3CBMA 2OTLT 3C95A 1AWXA 4OB3B 4M7AD 2NUTA 2RQWA 1PSFA 1WHKA 2JTFA 1FMWA 2CREA 3J7AF 2E10A 1WLPB 1MMAA 4IUVA 1I8FA 2GTOA 3IQLA 1K9AA 2LJ1A 5D6WA 5FRMA 1KQ1A 2JT4A 1YP5A 5KYWB 1VQ7T 4O6JA 3JCMJ 4LDWA 1TUCA 4WF2A 3HTRA 2O4XB 2QDLA 2AIRB 2CUDA 3ASKA 4PK4A 2M02A 2FZCB 2YDLA 1NZ9A 1WXUA 2KROA 3CCEQ 4NL2A 2HCKA 2B86A 3MJXA 4IURA 1SSHA 3JRZA 1I5OB 4X34A 1M4ZA 3V7RA 1IHVA 4E47A 2V1QA 3O8VA 4KBMB 2DA9A 2YUOA 1KC8R 4F14A 4M77G 3VS2A 4R56A 2LQ8A 1VQ9Q 4HKEA 2DK3A 4C92G 2MF2A 2A7YA 2EAYA 3PIPA 4PJOF 2LJ0A 4R55A 1UGRB 4J6XA 3EHRA 5GAMj 1Q7YC 4RUGA 2XDBA 4N0AA 1E6GA 6AT1B 3VU3C 1QVGS 4OMPA 1M1KU 5FWCA 3CC7A 3MHXA 4J9BA 1PG5B 3GOXA 3I56A 2DL3A 4LUDA 1NJIU 4QVCA 2LQKA 3MP8A 1BYMA 2CKKA 4F7UG 5GMKl 3PVLA 1UFFA 1Y71A 3H41A 2K2VA 2DXUA 3VYGA 1YJWT 2JTMA 1WXBA 1T3LA 3M0RA 4L5GA 3UPUA 2GCXA 4BY6B 1Q81U 4M7AE 1KQ2A 3E2UA 1QQJA 5J26A 4ESRA 1M8MA 2QG9B 2YUPA 3I56T 3QBYA 1V1CA 5IHNA 1YITQ 4J9HA 2DL7A 1H641 3WVEB 4GY5A 2DKGA 5DM7R 1FMVA 2PNIA 3LWHA 2L2PA 2CZ1B 5IH2A 2XMFA 4M77F 4DQ2A 3QHSA 1ABOA 4E7IA 2KI7A 1KJWA 3JB9F 2NUPA 1YIJA 4DBRA 5IT9E 5FRNA 2D8HA 4CI0C 2VASA 4PLIA 1K9MR 3M4YA 5CO7A 4M7AC 3P8DA 1EIFA 2E64A 3L2VA 1TG0A 2KXCA 2RJEA 4M78D 2LZ6B 3DLLA 4RTTA 3EGDB 2YRDA 2R57A 4EIKA 4PJOA 4HCZA 2D9TA 5GANj 2DYIA 1VQ5Q 4BD3A 1IGUA 3J80E 5DLQE 4C5HA 3CMET 3GPLA 1ZLMA 1M1KC 1Q81R 5LJ3d 3C4SA 4BB7A 4M4ZA 2VKNA 4QT7A 2EKHA 1JRIA 3RDVA 4Z8AA 2Y4XA 1YJNA 5IHKA 4M77C 1KG1A 2LMJA 1BI3A 3OA6A 3R6OA 4KT0E 2JMCA 3V7SA 1K8AU 1K4US 4JRIA 2E3IA 4A63B 2DAQA 3RESA 5CAIA 2YRVA 5GAOn 2YLCA 3AHUA 3VUBA 2VXEA 4EPCA 1CKAA 2E41A 2ZPGB 3CBPA 1YFNA 4FM4B 3I5SA 2EJ9A 1IREB 1QWFA 2BUDA 2GBQA 3JAME 1YI2T 2DD5A 1UDLA 2QTVA 5LJ3e 3CCLT 1TUGB 3OYNA 2YRCA 3CCMQ 1Z9QA 5GANe 2QYZA 4B9WA 1X2KA 7AT1B 3GLXA 3JCMe 2X4XA 3LGLA 4PJOE 1HYOA 1ZX6A 4OB2B 5GMKi 3OBYA 4GBQA 2EYQA 2BE9B 3FLGA 2DF6A 1EFNA 2K7AA 2LRQA 2CP7A 2M1HA 1YCYA 4ORZA 4JPBW 5KE3A 1IRXA 1VA7A 2VWFA 2DL5A 3HRUA 1VQLQ 4M7DB 1IO6A 2RA2A 3MO8A 4MZTA 1K0XA 2V8JA 4PJJA 4DBHA 2CUBA 1VQPT 2RJCA 2CH4W 2KRSA 4M75E 4E6RA 1OEBA 1VQKT 1OU9A 1TTHB 2RI3A 4FSXA 4M7DF 1LJOA 1OV3A 4J9EA 4C0GA 1QVGP 3SWNA 1LNXA 2KQWA 2V8KA 2KGTA 5FU7B 3JCMQ 1VQ9T 1BK2A 2GFUA 3OYBA 1NYFA 3KUFA 2BE7D 1TWBA 4RG8A 4E2FB 3PE0A 2ZPEB 3UATA 5CQYA 4PKCC 3RIRA 2A37A 1K1ZA 2YUQA 4OMFB 2EKOA 4FL6A 1A0NB 2DEUA 1KK7A 2NUZA 1MHNA 2EQJA 2VV5A 2M51A 1VQLA 2OTJQ 1QW1A 1T0JA 3ULRB 3MEVA 3L42A 1M1GA 3QXEB 4A4EA 2QAZA 4MZMA 1YHQA 4M77D 2MWPA 3MCAB 2FRYA 2ENMA 5KYYB 3M0UA 1TXQA 2EGEA 3H0IA 1KD1C 3G6EQ 4MMLA 4L6V5 2VB6A 3HSBA 2X35A 5IN1A 2WSEE 2K5FA 5KYWA 1I4K1 5FU7C 2IIMA 2MWOA 1GL5A 8AT1B 4JDSA 2ESWA 1JEGA 1OZ3A 1VQNQ 1Y07A 1GBQA 2FEIA 1YHQQ 1D09B 3REAB 5A0DA 3T9NA 2JS0A 1D1AA 2M0YA 2QQAA 2F2WA 1Q82R 3CCSQ 4C0DB 2CZ7B 3HPWA 1XNIA 1ZA1B 2IG0A 1WQ7A 1V29B 2EW3A 1WPYA 1K73U 2DMOA 2M16A 3E19A 3VS0A 2FHDA 3OYFA 3P8BB 3R6NA 3JB9J 3QJYA 2XIDA 1M3CA 5GAMh 4BE1A 5LL6S 3EH2A 2XICA 5HKCA 1HXDA 1WXTA 2MCNA 3VS7A 3EH1A 1UGVA 2M9UA 3M0SA 2XI9A 3M56A 4J6WA 3CCSA 3RBBB 1NPRA 3VS5A 4X9DA 3CMEQ 2LNHB 4PJLA 2HNIA 2ZGWA 2DXTA 2CT4A 1GRIA 1W1FA 1YJ9A 4X9CA 4JJDA 4ZGJB 2KBTA 3JCMh 2CDTA 2LCSA 2JMAA 5KCHA 3OYGA 2K5IA 2C0IA 3MPUB 1RAAB 1V76A 3FJ5A 2RK1A 3DKMA 1AWWA 1Y57A 2ZPFB 1K73R 1RADB 1VIFA 1W6XA 4Q5WA 1SHGA 1K9MC 2DXCA 5A0LA 2VC8A 3EFOA 1N9SA 2CT3A 2JXBA 1M2OA 4C8QG 5GANd 1ZSZA 4XTXA 2RH2A 2GGRA 4XU3A 5I22A 2W0ZA 4M7AF 2RPNA 1C1AA 2RO0A 2CP2A 1VQ4A 4C92C 2PUOB 3H0HA 4M78E 5GAMd 1ZHIA 2E1HA 1D0ZA 4LD9K 2YXYA 3INZA 5LJ3j 1UHFA 1YNZA 4HA8A 3JCMf 3V7CA 1WJQA 2O4XA 5HCKA 4PFZA 1FX7A 2SEMA 2QEXQ 3EHQA 2QXFA 1M1KR 5LJ3g 2DXBA 2I2LA 1Q81C 4J5YA 4Z88A 5GAOm 2E3HA 3EGXB 3A8OB 2HQHA 2PVGB 1UTIA 2MYSA 3OMCA 2EQMA 1HSQA 4C5IA 4OMLA 5EG2A 1AWJA 1NG2A 2AHJB 2LC4A 3QUIA 5LJ3f 5CKHA 4OMOA 3CCRQ 3SDZA 2BZXA 2LX7A 4OMNA 1R0BG 3VYHB 2E12A 2L5QA 1VOMA 2V1RA 1NLOC 2JN0A 4QQDA 1HJDA 3UA6A 2KEAA 4BDYA 1MUZA 2DJQA 2G6FX 3RKYA 1QVPA 2O2OA 4A53A 1N8RU 1GBRA 3PNWC 3SFMA 3L2WA 3VRZA 2DPPB 2E6ZA 3NPFA 2BTTA 4QW2A 1QKXA 1ZBJA 3OSVA 3I55T 2DJZA 4MMKA 2FG0A 2K3XA 3EFRA 2BZYA 2YWWA 3S3NA 4J9FA 4QKUA 2A08A 2D0QB 5AYFA 3L2UA 1ZQ1A 3HRTA 1SRLA 4OMQA 1GCPA 1YJNQ 3I9QA 5FW9A 3HRSA 4ELZC 4BI4A 1H92A 1RL2A 4DBQA 4OB1B 2YLBA 1I1JA 2EGAA 5CVIA 4PJOD 2FPEA 1X2QA 5GAN5 2P0KA 1VQKQ 1KFZA 4YTLA 3QZ9B 2ZPBB 2JS2A 2COYA 2C06A 2RHUA 2X3XD 2O01E 4JJNK 3EG2A 4M75F 1DJ7B 2FVUA 4QVDA 1OU8A 1Q86C 4NOYA 3G71Q 2QI2A 3TQ7P 2D1XA 2KT1A 2V26A 1VQKA 4M7DA 3V8JA 2VGMA 4E7JA 4C8QC 2DIQA 2F5KA 3M5AA 2L89A 4E7LA 3CCLA 1IGQA 4LDYA 1B34B 1WIEA 4M75G 4M7DC 3CPWA 4EMGA 2FO0A 4M77A 1J3TA 1LOJA 1YWPA 2RHIA 5L8RE 5GAMg 4EMKB 1NJIC 2GQIA 3FEOA 3OYMA 3FDRA 3OS1A 2QGGA 3CCQQ 3TU4K 2EGCA 5D7UA 2EQUA 5GANh 3CCJQ 1QKWA 3CMAT 1VQ7A 3BFMA 3ZFJA 1R8OB 1AOJA 2QA4T 2VYTA 3GBQA 1YHQT 1W2BP 4XTVA 4XK8E 4CC2A 4PJOC 2ZPHB 3OW2S 2HKQB 3RMQA 3BDLA 4HVVA 4C0DC 4JRKA 1X69A 2VVKA 4PJNA 2P0PA 1NJIR 1M3AA 2KYMA 2Y90A 4N4IA 1XQHA 3GNGA 4XU0A 3S6WA 4OGEA 1AVZC 2DBMA 3JCMg 2DILA 3VS3A 1M90U 1JJ2P 2RQTA 1AT1B 4LE9A 2QASA 1IZ6A 5I11A 4HCCA 4GLMA 4M78G 2VGNA 2CP0A 1D0XA 2VUBA 2DFUA 3L2QA 3CCMA 1AEYA 1MMDA 2L3RA 2XD0A 2HL5C 1F1BB 3A8GB 1W2BA 5FLXE 1U5SA 1UECA 4F7UE 2DTHA 3CC7T 1JJ2A 3UT1A 2A36A 1KIKA 2DEQA 2BZ8A 3PFSA 1RACB 1GXIE 3X26B 3JV3A 4M7AB 4DOVA 4J83A 4XTWA 4PJMA 1NEBA 2MIOA 3MEWA 3TEEA 5KE2A 1NEGA 3MEAA 3SWNB 4CRIA 3E9FA 3FIFA 2GNCA 1ZSGA 2DIGA 2KSSA 4R0KA 1WQWA 3FJPA 1K76A 1NBEB 3LLRA 1N27A 4IIMA 2MK5A 4CC3A 3C0CA 4OP0A 3QG1A 4C92A 3QSUA 1R0CB 3CD6Q 3CXCP 4Y91A 1VQOA 4B6MA 4JZ4A 1S1NA 1YIJT 2DETA 3A5ZB 1IHWA 3HFNA 1YITA 1VQOQ 3GNFB 2LVMA 2RQVA 1W4SA 1CKBA 1U06A 3X28B 2QEXT 2OTJA 1RLQC 3EG3A 2R5MA 2V8IA 3I55Q 2OTLQ 3MP6A 3QKJA 3CC4A 1D1BA 5CK9A 1Q82U 2RQUA 5IXBA 3G7ZA 5L23A 3OY9A 4DBFA 4HVWA 2P84A 3CMEA 5GAN6 1QVFA 5KYNA 4XAXB 4IUTA 4LDUA 4N4GA 2FYKA 1T3SA 1VQ6A 1MV3A 2ROLA 4DEYA 3EG1A 2FPDA 2RJDA 3BY7A 4WTOB 3CCVQ 3CC4Q 4C5EA 2MI6A 2AZSA 1S72A 4E7KA 4C92F 8ATCB 2WSCE 3OMGA 1OX8A 1T0HA 3OS5A 5KCOA 1VQMA 4F16A 1D0YA 2XDPA 4FCYA 2L3QA 1PHTA 1E7OA 1VQMQ 5GAOl 1Y0MA 4TVRA 2AZVA 1QCNA 1YI2A 2QQRA 1YJ9T 3MEUA 2JM8A 5I21A 1BCOA 2ZZDA 2P4TA 3VS4A 1I81A 1UB4A 3OYCA 1ZBXA 5LJ5j 2XG8D 2ATCB 3EG0A 4Y28E 2NUTB 2X4WA 1JXOA 2RB6A 1O9SA 4C0FA 1IXDA 4RTXA 1BBZA 3OS0A 1TSFA 3CCQT 2PVDB 4OF1A 1VUBA 1VQNT 4FU6A 4OMMA 2KMTA 3V8KA 4ZN1A 3M57A 4OGCA 1Q7YR 2FB7A 1Q95G 1PRMC 1SHFA 3NTIA 1AZEA 3OB9A 2C0TA 2AKKA 2EYZA 1KD1R 4KH1B 4EMKA 1PD0A 4QVZA 2COZA 2K3BA 2WSFE 1VQOT 4M75D 1N6AA 3CCQA 9ATCB 2K9GA 1B34A 3OS2A 3PGGA 4N4HA 2DZCA 2F2XA 4RTWA 3URGA 1U1SA 1OQKA 4D8DA 4FYXB 2YUNA 4JRQA 4F7UA 1Q82C 2BIVA 4KH0B 4O5VA 4IUUA 3N5BB 2CGHA 2FL7A 3LWIA 1VQ7Q 3NFCA 2DTOA 3BE3A 4XTZA 2RI5A 1H8KA 4KGVB 2KRMA 1VQLT 1KHIA 2KE9A 5FU6B 4C8QF 3TCJA 1UUEA 1QWEA 4M75A 1QCOA 1WHMA 2VXFA 4JLGA 4KUDK 4II1A 3CD6A 3LH0A 1NM7A 1N5ZA 2KNBB 3KXTA 4FW1A 2HL3A 2MPXC 2DX1A 2A28A 2WACA 1VQ4T 3A8MB 2DBKA 5GMKm 1RUWA 1MMGA 3E1SA 1X6GA 4IUPA 2HZYA 3X24B 1AD5A 3PT9A 4DOWA 4OVAA 2R5AA 4E7SA 1M9SA 1VQMT 5KYUB 1KQSS 4RTYA 4C92B 4HXJA 2JM9A 4C8QA 1M8VA 3HHTB 3CCJA 2LCCA 4RMOA 1UE9A 1K73C 1MV0B 2QGFB 3CBOA 1FYNA 2E6NA 4KGXB 1BIBA 3A1PA 1PNJA 2NWMA 1RAHB 1PKTA 1SRMA 1WHLA 2HAXA 2CZ6B 4M77E 1GCQA 1VYTA 4LUEA 4DA4A 3OYHA 3QDFA 2EWNA 2K3YA 2GTJA 3AT1B 2H3EB 1WA7A 5GAN4 3EGXA 3I56Q 3VUZA 2YT6A 3G71A 4CC4B 3SB2A 5J39A 2LCLA 1LVKA 3OYAA 3JB9D 5IHIA 3FC3A 4OB0B 4FIBA 3QIIA 4JLIA 3OW2A 5EC7A 5KYXB 1M3BA 4RTZA 1BU1A 1ZSZC 1EZZB 2EPDA 1X43A 1NYGA 3NHNA 2J6OA 2NYSA 4KGZB 4ZTJA 5GMKh 2O9SA 5CQXA 3TREA 1YJWQ 2C0OA 3F70A 4C92D 3HKSA 5GMKj 1YN8A 5IAYA 3JCMW 2JUFA 1PD1A 3CC2A 1YJWA 4A4HA 5GAMf 4B9XA 1RAIB 3CC2Q 4IUQA 2KYBA 2DTIA 1HK9A 2G3RA 2XKOC 4KRTA 3OYKA 2W10A 1CSKA 1Y7XA 1MNDA 3THKA 5I2MA 2CP5A 4AFUC 3PIOA 4PNOA 4DEXA 2D0NA 2RHXA 4KULA 3CC7Q 2EQIA 2CSQA 3LW5E 4ZGEB 3CPWS 2SRCA 4M7DG 2F2VA 5GAOq 2DM1A 1WFWA 2DL4A 5LJ5e 2HKNA 2LQWA 3CCUT 4HCKA 1OX9A 3ZBDA 2JW4A 3QDRB 1G2BA 2ZPIB 2P0QA 2LQNA 4M7AG 1XTDA 4UC4A 2CZ0B 2X51A 1M2VB 4L59A
chains in the Genus database with same CATH topology
3CCMA 1VIEA 5LJ3h 2X4JA 2L3RA 5KE3A 1VQ8A 1VQ6T 3Q1JA 3C94A 2XD0A 3HRUA 3PMIA 4KUIA 4C8QE 4M7DB 4XU1A 3A8HB 3A8GB 1W2BA 2RA2A 3SWNC 4HT9A 5FLXE 1N8RC 4F7UE 3MO8A 2DTHA 4MZTA 5CKFA 2XDDA 3CC7T 1JJ2A 1M5Q1 3UT1A 2V8JA 2DO3A 2DZ9A 2M0OA 4XTUA 2DEQA 2KAFA 2RJCA 3PFSA 3CCVT 1VQPT 1GXIE 5D6XA 3X26B 2A3LA 3LYIA 4XU2A 3OYIA 4M75E 4M7AB 3CCMT 1TH7A 4ZN3A 2RM4A 4RG2A 4ATOA 4Z02A 4J83A 3V8LA 4XTWA 4DOVA 1VQKT 2RI3A 4FSXA 4XQ3A 1LJOA 2H3JA 1Q7YU 4M7DF 4VUBA 3JCMb 4HCBA 2DVEA 3MEWA 3TEEA 4C0GA 3SWNA 3CCVA 4JRPA 5KE2A 1LNXA 2KQWA 5C0MA 3JCMd 4LDXA 4M78B 3MEAA 3WXMB 2V8KA 3SWNB 3X25B 3OYLA 4CRIA 3E9FA 3FIFA 5FU7B 3JCMQ 1VQ9T 2GFUA 3A8LB 3OYBA 3KUFA 4C5GA 4BACA 2DIGA 3RERA 2KSSA 1X75C 4F7UF 4RG8A 4LD6A 1YITT 1QVFS 1WQWA 2ZPEB 4HT8A 3FJPA 3M53A 3LLRA 2QQSA 5CQYA 1N27A 4PKCC 3RIRA 1VQ5T 1WGSA 3M4GA 5GAN2 4OMFB 4OP0A 2MAMA 3QG1A 3WVDB 4LDVA 2EKOA 4C92A 3CMAA 1K8AC 1G3SA 4FL6A 3QSUA 3JB9H 3C12A 2KY9A 3DLMA 4Y91A 1X01A 1VQOA 3DB4A 2HQEA 3QJ6A 5HK0A 3CC4T 1VQ5A 3QO3A 4BUGA 1YIJT 3HP9A 3A5ZB 3BDUA 2E70A 4JUVA 3HFNA 1MHNA 2EQJA 2VV5A 2B8AA 1YITA 1VQLA 3GNFB 5J3BA 1QW1A 2LVMA 4M7AA 1JJ2S 1AHJB 3E9GA 2EJGA 3MEVA 1JB0E 1W4SA 4BY6C 3X28B 2YHTA 3L42A 2QEXT 3SD4A 2OTJA 1M1GA 5KH6A 1P92A 2RK2A 3QXEB 4QQGA 2XU8A 3FB9A 4MZMA 4A4EA 1VQ8T 1YHQA 1G3YA 2MWPA 3MCAB 4M77D 4M7DD 5LJ5f 3G6EA 3RKWA 1KD1U 2R5MA 2V8IA 4XTYA 3MP6A 1BIAA 3QKJA 4MZPA 3CC4A 1D3BB 2L8DA 3JCMc 1KD1C 5CK9A 1WJSA 1Q82U 3OSSC 4MMLA 4EMKC 3L2WA 4L6V5 4FT2A 3OYYA 2X35A 5IN1A 3HSBA 2WSEE 3G7ZA 2K5FA 3ER0A 3META 3CC2T 1NE8A 1I4K1 3OY9A 2HD0A 5FU7C 1VQNA 3CMEA 2MWOA 2XHCA 3H8ZA 3OYEA 5GAN6 1QVFA 3S3OA 5A2QE 4JDSA 3CXCS 2DD4A 4M78A 1OZ3A 2BKDN 4XAXB 3QPHA 4IUTA 4LDUA 4N4GA 4D6WA 4RKUE 2FYKA 5GAN3 3J81E 1Y07A 1KC8C 1VQ6A 3UWNA 3CD6T 2RHZA 2RJDA 5A0DA 5CR2A 3BY7A 1Y96B 1N9RA 3T9NA 4RCBA 3P8HA 3L1AA 1OI1A 4M78C 5GAOp 3L2ZA 2QQAA 1X6OA 3QYHB 4C5EA 1WJRA 2MI6A 3RKXA 2JVVA 3QZ5B 4C0DB 2CZ7B 3HPWA 1S72A 1XNIA 2PVOB 4RCCA 4C8QD 4E7KA 2KK4A 4C92F 2IG0A 3CCET 4JS4A 1WQ7A 1V29B 3PMTA 1O75A 1WPYA 3X20B 4A4FA 4EMHA 2WSCE 3OMGA 5LJ5h 3G4SA 1K73U 2M16A 3E19A 1BYMA 2FHDA 1OZ2A 3OYFA 3DB3A 3P8BB 3JB9J 3OS5A 3QJYA 2XIDA 5KCOA 5GAMh 4BE1A 5LL6S 4ELYC 5M9OA 2XICA 5HKCA 2KDSA 1JBMA 1FXXA 1HXDA 2LT1A 3M55A 1VQMA 2M9UA 2EQKA 2XDPA 5I2SA 2XI9A 2R58A 3M56A 4J6WA 1UGQB 3G71T 3CCSA 4ME7A 2D6FA 4M77B 5GANf 1BI2A 5GAOl 1NPRA 4TVRA 4X9DA 1U8RA 4J7FA 3LX7A 1YI2A 3ZEHA 2QQRA 3CXCA 3MEUA 1YJ9T 5FRMA 2LTOA 2HNIA 2ZGWA 2DXTA 5GANg 4C0ZA 5I21A 3EAEA 2GF7A 1SSFA 3S3MA 3OYDA 2ZZDA 2P4TA 2LT4A 2ZCFB 5CKDA 4BDZA 3JB9I 4EDUA 1I81A 1UB4A 4X9CA 2F69A 3OYCA 5C6SA 1YJ9A 4J7IA 3CBMA 2OTLT 3C95A 1ZBXA 4ZGJB 5LJ5j 2XG8D 4OB3B 3JCMh 3NTHA 4M7AD 4Y28E 1M90C 5GMKe 1PSFA 5KCHA 3OYGA 2K5IA 2X4WA 4BE0A 2RB6A 2MMPA 1O9SA 4C0FA 2QTXA 2JTFA 2RK1A 3GP8A 3J7AF 3DKMA 2E10A 3OS0A 5HK3A 1I5LA 4F7UB 2PVDB 3CCQT 2ZPFB 1VIFA 4IUVA 1I8FA 4OF1A 4Q5WA 5DY9A 1VUBA 1VQNT 4FU6A 5D6WA 2KMTA 3V8KA 4ZN1A 3M57A 4OGCA 1KQ1A 2DXCA 4FT4A 4QQ6A 2VC8A 5A0LA 5CCAA 1K9MC 4O6JA 3JCMJ 1VQ7T 4LDWA 2FB7A 1N9SA 4WF2A 4C8QG 2O4XB 2GFAA 5GANd 3NTIA 3OB9A 3ASKA 4XTXA 2RH2A 4XU3A 1NZ9A 4M7AF 2X4YA 4EMKA 2RO0A 1VQ4A 4C92C 4BI8B 3RMSA 2PUOB 3BW1A 4M78E 4QVZA 3JCMV 4IURA 4NL2A 5GAMd 1ZHIA 3JCMP 2E1HA 2JOYA 2RHYA 3JRZA 2WSFE 4X34A 2E5QA 4LD9K 1VQOT 1NPPA 1M4ZA 1N6AA 3INZA 4M75D 5LJ3j 3CCQA 4HA8A 3V7RA 3JCMf 1B34A 1WJQA 3V7CA 4E47A 3PGGA 3O8VA 3OS2A 1OYXA 4KBMB 2O4XA 4N4HA 1FX7A 2Y4YA 3KBGA 2DZCA 4M78F 4M77G 4R56A 4PJOG 4V2SA 2LQ8A 2QXFA 3URGA 5LJ3g 1U1SA 4HKEA 2DK3A 4C92G 2DXBA 2I2LA 1Q81C 2MF2A 4J5YA 2RI2A 5GAOm 4JRQA 4F7UA 2A7YA 3A8OB 2EAYA 2PVGB 2JZ2A 3OMCA 4PJOF 3PIPA 2EQMA 1Q82C 4R55A 1UGRB 4J6XA 5GAMj 2BIVA 2PQWA 1BKBA 4C5IA 2EFIA 4O5VA 5EG2A 4IUUA 3N5BB 2AHJB 2CGHA 2FL7A 2LC4A 3QUIA 5LJ3f 3ME9A 5CKHA 5LJ5g 3LWIA 3SDZA 1KQSA 2JNGA 3NFCA 1Q7YC 2DTOA 5A0GA 3VYHB 1QP3A 2E12A 2L5QA 2XDBA 3M54A 4N0AA 4XTZA 2RI5A 3OQ5A 2JN0A 3L2RA 4QQDA 3VU3C 4BI3A 4ZGDB 1QVGS 1VQLT 1M1KU 4BDYA 1KHIA 5D6YA 1XOVA 4C92E 5CIUA 5FU6B 3CC7A 3MHXA 3RKYA 4C8QF 3TCJA 3GOXA 1QVPA 4A53A 4M75A 4PLLA 1N8RU 3I56A 3PNWC 1NJIU 3SFMA 2LQKA 3MP8A 2VXFA 2CKKA 4JLGA 2KVQG 4QVCA 3OYJA 2DPPB 4II1A 4F7UG 5GMKl 4KUDK 3CD6A 2E6ZA 3LH0A 1Y71A 5FU6C 4QW2A 3OSVA 3I55T 4C8QB 1Q86U 2K2VA 1G3WA 1UGSB 2DJZA 4MMKA 4N0AC 2K3XA 5GAN8 3CPFA 2DXUA 3EFRA 3KXTA 3VYGA 2K57A 4A54A 3G6ET 1YJWT 2JTMA 1BI0A 3HFOA 3S3NA 2WACA 1VQ4T 4L5GA 2F5TX 3A8MB 3UPUA 2D0QB 2GCXA 5CKBA 5AYFA 4BY6B 5GMKm 4M75B 3L2UA 1Q81U 1VQ9A 4M7AE 1ZQ1A 3E1SA 3HRTA 4NS5A 3PTAA 2QA4A 1KQ2A 3JB9G 5J26A 4IUPA 2HBPA 3X24B 3I56T 3QBYA 3CCJT 3PT9A 3I55A 2OAUA 2PU9B 4NL3A 4DOWA 4OVAA 2LX9A 2R5AA 1M9SA 1H641 3UDCA 3WVEB 3HRSA 2DKGA 4GY5A 5DM7R 4ELZC 3LWHA 1VQMT 1G5VA 1WNLA 4BI4A 1KQSS 2CZ1B 4C92B 5HY6A 1M1FA 4C8QA 4M77F 1M8VA 2CS7A 3HHTB 4DQ2A 1RL2A 3QHSA 3JCMX 3CCJA 1G3TA 1UEBA 4E7IA 2LCCA 4OB1B 4RMOA 4J6YA 3CCST 1K73C 2YLBA 3JB9F 3CBOA 1YIJA 2E6NA 5CVIA 1QVGA 4IKFA 5IT9E 5FRNA 4PJOD 4CI0C 4ZTFA 3M59A 4PLIA 3CEYA 1BIBA 3M4YA 5GAN5 3RUXA 2P0KA 5CO7A 4YTLA 4M7AC 3QZ9B 2ZPBB 1EIFA 2E64A 3P8DA 3L2VA 2RJEA 2HAXA 3CCRA 2C06A 2IVWA 4M78D 2RHUA 2CZ6B 4M77E 3DLLA 3VV0A 4DA4A 2XK0A 4A4KA 2O01E 2R57A 3OYHA 4BE2A 4E7HA 4JJNK 4PJOA 4M75F 1DJ7B 2FVUA 4HCZA 2EWNA 4QVDA 1Q86C 2D9TA 4NOYA 2K3YA 5GANj 3FRNA 4J8OA 5GAN4 4BD3A 2E65A 3J80E 2QI2A 1YBYA 5DLQE 3HL8A 4M75C 3VUZA 4C5HA 3G71A 3CMET 3SB2A 3GPLA 1VQKA 5J39A 4M7DA 2LCLA 4PL6A 3OYAA 1M1KC 3V8JA 1RI0A 2VGMA 3JB9D 2PUKB 5FROA 2HQXA 3FC3A 4C8QC 4E7JA 2DIQA 4OB0B 2F5KA 3QIIA 3C4SA 3M5AA 4FIBA 4JLIA 2L89A 5LJ3d 3OW2A 4E7LA 3CCLA 3CCEA 3M58A 1KHCA 4LDYA 1B34B 4M75G 4M7DC 4BB7A 3CPWA 2NLUA 3VKIA 4EMGA 2GQVA 4M77A 5GAMe 1UGPB 1LOJA 2QQBA 2RHIA 4ZTJA 5GMKh 3G4ST 5CQXA 1JRIA 5L8RE 5GAMg 4EMKB 1NJIC 3TREA 1MGQA 3CCUA 3F70A 4C92D 3FEOA 2Y4XA 3HKSA 2EJFA 5GMKj 3OYMA 1YJNA 5IAYA 3FDRA 3OS1A 3M9QA 3JCMW 2JUFA 3NTKA 4M77C 2CYZB 3CC2A 1KG1A 1YJWA 1BI3A 3OA6A 3R6OA 4A4HA 4KT0E 2OTLA 5GAMf 1H3ZA 4B9XA 3V7SA 5CKEA 1D3BA 3TU4K 1K8AU 4PJOB 1QP2A 4JRIA 2EQUA 4IUQA 5GANh 3H6ZA 1YJNT 2DAQA 3RESA 5CAIA 3CMAT 2DTIA 1HK9A 1VQ7A 3BFMA 2YRVA 2G3RA 5GAOn 2XKOC 3OYKA 3ZFJA 1R8OB 2YLCA 3GIBA 2RJFA 2EIFA 3VUBA 2QA4T 1Y7XA 3AHUA 1W2BS 2VXEA 2RD1A 2VYTA 4EPCA 1YHQT 5I2MA 1S72T 3PIOA 4PNOA 2E41A 1Y96A 2ZPGB 4XTVA 3CBPA 2EJ9A 2RHXA 1IREB 4FM4B 4XK8E 2BUDA 2K5LA 4KULA 2QQ9A 3JAME 1YI2T 4MDWA 3QYGB 2DD5A 4MDXA 2ZPHB 1BI1A 3LW5E 3OW2S 4PJOC 4M7DE 4ZGEB 3GF5A 3RMQA 3BDLA 4P5NA 5LJ3e 1K9MU 5GAN7 1U1TA 3OYNA 3CCLT 3CPWS 4M7DG 4C0DC 4JRKA 2QEXA 2OTJT 4JS5A 4A4GA 5GAOq 2P0PA 5GANe 5GAOr 4B9WA 3MP1A 1KC8U 5LJ5e 2LDMA 3GLXA 1FWZA 2K4YA 3JCMe 2X4XA 3LGLA 2QDYB 2Y90A 4N4IA 4PJOE 1XQHA 3GNGA 4XU0A 3S6WA 4OGEA 4OB2B 3VJPA 4GLKA 3JCMg 5GMKi 3OBYA 3CCUT 3JSCA 1M90U 1PSEA 3ZBDA 2EYQA 3LGFA 3QDRB 2ZPIB 2P0QA 3FLGA 2LNVA 4M7AG 5DLOA 3OBWA 1XTDA 4UC4A 3EFSA 3CCRT 1IZ6A 1VQPA 5LJ5d 2LRQA 4HCCA 2CZ0B 4M78G 2VGNA 2VUBA 2M1HA 1YCYA 4L59A 3L2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM A;  2L3R A;  5KE3 A;  1VQ8 A;  1VQ6 T;  3Q1J A;  3PMI A;  1W2B A;  5FLX E;  1N8R C;  3MO8 A;  3CC7 T;  1JJ2 A;  3UT1 A;  2DO3 A;  2M0O A;  3CCV T;  1VQP T;  2RJC A;  3PFS A;  5D6X A;  3LYI A;  3OYI A;  3CCM T;  4ZN3 A;  4RG2 A;  4Z02 A;  1VQK T;  2RI3 A;  1Q7Y U;  3MEW A;  3CCV A;  1VQP A;  5KE2 A;  5C0M A;  3MEA A;  3OYL A;  4CRI A;  3E9F A;  1VQ9 T;  2GFU A;  3OYB A;  3KUF A;  4C5G A;  4BAC A;  2DIG A;  4LD6 A;  1YIT T;  1QVF S;  3LLR A;  1VQ5 T;  2QQS A;  1N27 A;  1WGS A;  3CMA A;  2EKO A;  1K8A C;  4FL6 A;  3DLM A;  1VQO A;  3DB4 A;  2HQE A;  3QJ6 A;  3CC4 T;  1VQ5 A;  1YIJ T;  3A5Z B;  2E70 A;  1MHN A;  2EQJ A;  1YIT A;  1VQL A;  2B8A A;  5J3B A;  2LVM A;  1JJ2 S;  3E9G A;  3MEV A;  2QEX T;  2OTJ A;  3L42 A;  3SD4 A;  1M1G A;  5KH6 A;  4QQG A;  4A4E A;  1VQ8 T;  1YHQ A;  2MWP A;  3G6E A;  1KD1 U;  2R5M A;  3MP6 A;  3QKJ A;  3CC4 A;  2L8D A;  1KD1 C;  1WJS A;  1Q82 U;  3OYY A;  2X35 A;  5IN1 A;  3MET A;  3ER0 A;  3CC2 T;  3OY9 A;  1VQN A;  3CME A;  2MWO A;  2XHC A;  3H8Z A;  3OYE A;  1QVF A;  3S3O A;  5A2Q E;  3CXC S;  1OZ3 A;  2BKD N;  4IUT A;  4N4G A;  3J81 E;  1VQ6 A;  1KC8 C;  3CD6 T;  3UWN A;  2RHZ A;  2RJD A;  3P8H A;  1OI1 A;  1X6O A;  4C5E A;  2MI6 A;  1WJR A;  2JVV A;  1S72 A;  1XNI A;  3CCE T;  4E7K A;  2IG0 A;  3PMT A;  3G4S A;  4A4F A;  1K73 U;  3OMG A;  2M16 A;  2FHD A;  1OZ2 A;  3OYF A;  3DB3 A;  3P8B B;  5KCO A;  4BE1 A;  5LL6 S;  5M9O A;  2KDS A;  1VQM A;  2EQK A;  2XDP A;  2R58 A;  3G71 T;  3CCS A;  1NPR A;  4TVR A;  3LX7 A;  1YI2 A;  3ZEH A;  3CXC A;  1YJ9 T;  2QQR A;  3MEU A;  2LTO A;  3EAE A;  2GF7 A;  1SSF A;  3S3M A;  3OYD A;  4BDZ A;  4EDU A;  1YJ9 A;  3OYC A;  5C6S A;  2OTL T;  3NTH A;  1M90 C;  5KCH A;  3OYG A;  2X4W A;  4BE0 A;  2JTF A;  3J7A F;  3OS0 A;  3CCQ T;  4IUV A;  4Q5W A;  1VQN T;  4FU6 A;  5D6W A;  4ZN1 A;  5FRM A;  1K9M C;  1VQ7 T;  4QQ6 A;  2O4X B;  2GFA A;  3NTI A;  3OB9 A;  3ASK A;  1NZ9 A;  2X4Y A;  2RO0 A;  1VQ4 A;  4QVZ A;  4IUR A;  2RHY A;  2JOY A;  4X34 A;  2E5Q A;  1VQO T;  1NPP A;  3CCQ A;  1WJQ A;  3OS2 A;  3O8V A;  1OYX A;  2O4X A;  4N4H A;  3KBG A;  2LQ8 A;  1Q81 C;  2RI2 A;  3PIP A;  2JZ2 A;  3OMC A;  1Q82 C;  2EQM A;  2BIV A;  2PQW A;  1BKB A;  4C5I A;  2EFI A;  4IUU A;  3ME9 A;  1KQS A;  2JNG A;  1Q7Y C;  2RI5 A;  3OQ5 A;  3L2R A;  4QQD A;  1QVG S;  1VQL T;  1M1K U;  4BDY A;  1KHI A;  5D6Y A;  5CIU A;  3CC7 A;  3GOX A;  1N8R U;  4PLL A;  3I56 A;  1NJI U;  3PNW C;  3MP8 A;  3OYJ A;  3L2W A;  2CKK A;  2KVQ G;  3CD6 A;  4II1 A;  2E6Z A;  3LH0 A;  4QW2 A;  3I55 T;  1Q86 U;  2K3X A;  3CPF A;  3G6E T;  1YJW T;  3S3N A;  2WAC A;  1VQ4 T;  1Q81 U;  3L2U A;  1VQ9 A;  4NS5 A;  2QA4 A;  5J26 A;  4IUP A;  3I56 T;  3QBY A;  3CCJ T;  3I55 A;  4OVA A;  2R5A A;  5DM7 R;  1VQM T;  4GY5 A;  1G5V A;  1KQS S;  5HY6 A;  1RL2 A;  3CCJ A;  4E7I A;  1UEB A;  2LCC A;  3CCS T;  1K73 C;  1YIJ A;  2E6N A;  1QVG A;  4IKF A;  5IT9 E;  5FRN A;  4ZTF A;  4PLI A;  3CEY A;  2P0K A;  4YTL A;  1EIF A;  3P8D A;  3L2V A;  2RJE A;  3CCR A;  2RHU A;  3DLL A;  2XK0 A;  2R57 A;  3OYH A;  4BE2 A;  4E7H A;  4HCZ A;  1Q86 C;  2D9T A;  2K3Y A;  4BD3 A;  3J80 E;  1YBY A;  5DLQ E;  4C5H A;  3G71 A;  3CME T;  1VQK A;  5J39 A;  2LCL A;  4PL6 A;  1M1K C;  3OYA A;  1RI0 A;  5FRO A;  3FC3 A;  2HQX A;  4E7J A;  2DIQ A;  2F5K A;  3OW2 A;  3C4S A;  3QII A;  2L89 A;  4E7L A;  3CCL A;  3CCE A;  1KHC A;  3CPW A;  2NLU A;  2RHI A;  4ZTJ A;  3G4S T;  1NJI C;  3TRE A;  3CCU A;  3F70 A;  3FEO A;  3HKS A;  3OYM A;  1YJN A;  5IAY A;  3FDR A;  3OS1 A;  3M9Q A;  2JUF A;  3NTK A;  3CC2 A;  1YJW A;  3OA6 A;  4A4H A;  2OTL A;  1H3Z A;  4B9X A;  1K8A U;  2EQU A;  4IUQ A;  3H6Z A;  1YJN T;  3CMA T;  2DAQ A;  1VQ7 A;  2YRV A;  2G3R A;  3OYK A;  2RJF A;  2EIF A;  2QA4 T;  1W2B S;  2VYT A;  1YHQ T;  1S72 T;  3PIO A;  2RHX A;  3JAM E;  1YI2 T;  2BUD A;  3OW2 S;  3BDL A;  1K9M U;  3CCL T;  3OYN A;  3CPW S;  2QEX A;  2OTJ T;  4A4G A;  4B9W A;  1KC8 U;  3MP1 A;  2LDM A;  3LGL A;  2X4X A;  4N4I A;  3S6W A;  3CCU T;  1M90 U;  3LGF A;  3FLG A;  1XTD A;  4UC4 A;  3CCR T;  1IZ6 A;  2LRQ A;  2M1H A;  4L59 A;  3L2Q A; 
#chains in the Genus database with same CATH topology
 3UF4 A;  1JO8 A;  2X4J A;  3OW2 P;  1VQ8 A;  3Q1J A;  3PMI A;  1YCS B;  4C8Q E;  4HT9 A;  1N8R C;  1YI2 Q;  2XDD A;  3D7S B;  2DO3 A;  1OUL A;  2DZ9 A;  2ED0 A;  4XTU A;  2KAF A;  5D6X A;  3LYI A;  3OYI A;  2I0N A;  4LN2 A;  1ZUU A;  4RG2 A;  4AFZ C;  3V8L A;  4ATO A;  1VYV A;  4XQ3 A;  2H3J A;  2K2M A;  3JCM b;  2DVE A;  2H8H A;  3CCV A;  4HCB A;  2RN8 A;  2K79 A;  4LDX A;  3VS6 A;  2RQR A;  2J05 A;  2ECZ A;  3A8L B;  4F04 B;  4BAC A;  1X75 C;  4F7U F;  4LD6 A;  1QVF S;  1GFC A;  4JJC A;  3M53 A;  2QQS A;  5GJV B;  1WI7 A;  2RNA A;  1K8A C;  1G3S A;  3JB9 H;  3C12 A;  2KY9 A;  1BCM A;  1X01 A;  1E6H A;  1VQ5 A;  3HP9 A;  2E70 A;  2OI3 A;  2EYY A;  2B8A A;  5J3B A;  1JB0 E;  2J06 A;  2X9H A;  2YHT A;  3SHW A;  2RK2 A;  3FB9 A;  2DLP A;  4M7D D;  2DE0 X;  3RKW A;  1D3B B;  2L8D A;  3ZL7 C;  1WJS A;  4FT2 A;  4F17 A;  3MET A;  3CC2 T;  2FPF A;  3G1J A;  1NE8 A;  4AFQ C;  1AZG B;  1W70 A;  2HD0 A;  2HSE B;  3OYE A;  1G83 A;  4E7Z A;  1BB9 A;  3CXC S;  2DD4 A;  2BKD N;  3QPH A;  4RKU E;  1KC8 C;  1K8A R;  5CR2 A;  2O88 A;  2RF0 A;  1Y96 B;  1N9R A;  1VQP Q;  4RCB A;  3L1A A;  1OI1 A;  3L2Z A;  1X6O A;  3QYH B;  1R77 A;  1WJR A;  3G4S Q;  2JVV A;  3QZ5 B;  2PVO B;  4RCC A;  4C8Q D;  3CCE T;  2ABL A;  4JS4 A;  2OAW A;  3PMT A;  1O75 A;  5LJ5 h;  4A4F A;  3G4S A;  1ABQ A;  3DB3 A;  4J9C A;  4ELY C;  4RTU A;  1M2V A;  3NGP A;  3QWY A;  2PZ1 A;  2EQK A;  5I2S A;  1JU5 C;  3G71 T;  2D6F A;  1SKU B;  4ME7 A;  4M77 B;  1BI2 A;  1S72 Q;  2EBP A;  1M27 C;  3TSW A;  3SEM A;  1U8R A;  3TSZ A;  3LX7 A;  2FRW A;  3CXC A;  2LTO A;  2L0A A;  3TVT A;  4C0Z A;  2COW A;  1QMC A;  5ECA A;  1HD3 A;  3OYD A;  3VS1 A;  2CH4 A;  2LT4 A;  2ZCF B;  5CKD A;  4BDZ A;  4EDU A;  2F69 A;  3I35 A;  4J7I A;  1EX4 A;  3M0Q A;  1TU0 B;  3NTH A;  1M90 C;  2YSQ A;  3RNJ A;  5GMK e;  1M30 A;  4AG1 C;  4BE0 A;  1UJY A;  2MMP A;  4FYY B;  2QTX A;  1X6B A;  3GP8 A;  5HK3 A;  1I5L A;  4F7U B;  1ARK A;  5DY9 A;  1PM3 A;  3CMA Q;  4FT4 A;  4QQ6 A;  5CCA A;  1UG1 A;  2GFA A;  2LP5 A;  1B07 A;  3RR6 A;  1RI9 A;  4ZNX A;  1MNE A;  2X4Y A;  4BI8 B;  3EG9 B;  3RMS A;  3BW1 A;  3JCM V;  3JCM P;  2RHY A;  2JOY A;  2J6K A;  2E5Q A;  1NPP A;  1MMN A;  1OYX A;  1UJ0 A;  4X1V A;  2Y4Y A;  3KBG A;  4M78 F;  2KT8 A;  4PJO G;  3UA7 A;  4V2S A;  1VYU A;  3I5R A;  2L3P A;  4ANJ A;  2RI2 A;  2JZ2 A;  2J6F A;  2PQW A;  1BKB A;  2QK0 A;  2A0F B;  1SEM A;  2EFI A;  3CPW P;  1LPL A;  3ME9 A;  5LJ5 g;  1KQS A;  2ED1 A;  2JNG A;  1YJ9 Q;  5A0G A;  1QP3 A;  5KYU A;  3M54 A;  3OQ5 A;  3L2R A;  4BI3 A;  4ZGD B;  2L3S A;  4C92 E;  5D6Y A;  1XOV A;  5CIU A;  1ZSZ B;  1KQS P;  2DL8 A;  4PLL A;  1AWO A;  3OYJ A;  3GIB A;  2KVQ G;  4AMC A;  5FU6 C;  4C8Q B;  1Q86 U;  1G3W A;  1UGS B;  4N0A C;  2E4H A;  5GAN 8;  3CPF A;  2K57 A;  4A54 A;  3G6E T;  3M0T A;  1BI0 A;  3HFO A;  1PWT A;  2F5T X;  1Q86 R;  5CKB A;  4M75 B;  1VQ9 A;  4NS5 A;  3PTA A;  2QA4 A;  4RTV A;  3JB9 G;  2HBP A;  1OPK A;  3CCJ T;  3I55 A;  1SPK A;  2OAU A;  2PU9 B;  4NL3 A;  1VQ6 Q;  2LX9 A;  3UDC A;  1RLP C;  1G5V A;  1KSW A;  1WNL A;  5HY6 A;  1M1F A;  2CS7 A;  1G8X A;  3JCM X;  1G3T A;  1UEB A;  4JJB A;  4J6Y A;  3CCS T;  2DRK A;  1QVF P;  1QVG A;  4IKF A;  4ZTF A;  3M59 A;  3CEY A;  3RUX A;  2Z0W A;  2OJ2 A;  1JQQ A;  3CCR A;  2IVW A;  1C0M A;  2LJ3 A;  3VV0 A;  2XK0 A;  4A4K A;  2AK5 A;  4BE2 A;  4E7H A;  3REB B;  2FZG B;  1N8R R;  3FRN A;  4J8O A;  5IXF A;  2E65 A;  2HSP A;  1YBY A;  4PFO A;  3HL8 A;  4M75 C;  1RAG B;  4PL6 A;  1RI0 A;  3U23 A;  2PUK B;  5FRO A;  2HQX A;  4D8K A;  1WHG A;  2CSI A;  4HVU A;  3CCE A;  3M58 A;  1KHC A;  1SG5 A;  2DYB A;  5KYX A;  2NLU A;  3VKI A;  2GQV A;  5GAM e;  3H0F A;  1UGP B;  3M0P A;  2QQB A;  3G4S T;  5FWB A;  2MOX A;  1VQ8 Q;  1MGQ A;  3CCU A;  4Y92 A;  1VQ4 Q;  2EJF A;  3M9Q A;  4PFP A;  2E5K A;  3NTK A;  2CYZ B;  3CCU Q;  2OTL A;  1H3Z A;  1ZUY A;  5CKE A;  1D3B A;  4PJO B;  1QP2 A;  4LNP A;  2HEQ A;  4FYV B;  4K11 A;  3H6Z A;  1YJN T;  1YWO A;  3MKD A;  1PCX A;  2DNU A;  1NLP C;  1WYX A;  2RJF A;  2EIF A;  1W2B S;  2RD1 A;  1S72 T;  1QLY A;  1Y96 A;  1PKS A;  1RAF B;  1I0C A;  2K5L A;  2HDA A;  2QQ9 A;  4MDW A;  3QYG B;  4MDX A;  1BI1 A;  1FMK A;  4M7D E;  2FZK B;  3GF5 A;  4P5N A;  1K9M U;  1GCQ C;  1RAE B;  1U1T A;  2CP6 A;  5GAN 7;  1OPL A;  2KXD A;  2QEX A;  2OTJ T;  4JS5 A;  4A4G A;  5GAO r;  3MP1 A;  4J9G A;  1WZO A;  1KC8 U;  2LDM A;  1FWZ A;  2K4Y A;  2QDY B;  1TUD A;  2DRM A;  3LH5 A;  3VJP A;  4GLK A;  3JSC A;  1PSE A;  2OX7 A;  3LGF A;  2LNV A;  5DLO A;  3OBW A;  3EFS A;  3CCR T;  5LJ5 d;  1PC0 A;  1WHJ A;  1ZA2 B;  1VIE A;  4WCI A;  5LJ3 h;  1H3H A;  1VQ6 T;  3C94 A;  4KUI A;  4XU1 A;  3A8H B;  3SWN C;  1TOV A;  5CKF A;  1YIJ Q;  1IB8 A;  1M5Q 1;  2M0O A;  3CCV T;  2EYW A;  2NUP B;  2AT1 B;  2A3L A;  1B7T A;  4J9D A;  4XU2 A;  3CCM T;  1TH7 A;  4ZN3 A;  3CQT A;  2RM4 A;  4Z02 A;  4AG2 C;  1Q7Y U;  3QWX X;  4VUB A;  1VQP A;  2D8J A;  4JRP A;  3JCM d;  3KFV A;  5C0M A;  4M78 B;  3WXM B;  1X27 A;  2O31 A;  3OYL A;  1Z9Z A;  3X25 B;  1ZUK A;  4C5G A;  3RER A;  1YIT T;  4HT8 A;  2IPO B;  1VQ5 T;  1JXM A;  1WGS A;  3M4G A;  4FYW B;  5GAN 2;  2MAM A;  2X3W D;  3WVD B;  4LDV A;  3CMA A;  4AFS C;  3DLM A;  1M90 R;  2JJ9 A;  2CP3 A;  3DB4 A;  2HQE A;  1LCK A;  3QJ6 A;  5HK0 A;  3CC4 T;  3QO3 A;  4BUG A;  3BDU A;  4JUV A;  2JTE A;  3O5Z A;  2KR3 A;  4M7A A;  1JJ2 S;  1AHJ B;  3E9G A;  2EJG A;  1OOT A;  4BY6 C;  3VRY A;  2ZAE A;  3EGU A;  3SD4 A;  2K6D A;  5KH6 A;  1P92 A;  4QQG A;  2XU8 A;  1VQ8 T;  1G3Y A;  3EG9 A;  5LJ5 f;  1U3O A;  3G6E A;  1KD1 U;  2EVR A;  4XTY A;  1BIA A;  1B3Q A;  1QCF A;  4MZP A;  1GFD A;  3JCM c;  4LXC A;  3OSS C;  4EMK C;  3EFO B;  3OYY A;  1WHH A;  3ER0 A;  1WDX A;  1I07 A;  1VQN A;  2XHC A;  3H8Z A;  4AT1 B;  3S3O A;  5A2Q E;  1PRL C;  4M78 A;  4D6W A;  3J81 E;  5GAN 3;  3CD6 T;  3UWN A;  2RHZ A;  1ACM B;  4FW2 A;  5AT1 B;  1C6V X;  3P8H A;  3PVQ A;  4M78 C;  5GAO p;  2DVJ A;  3RKX A;  4IIO A;  2RMO A;  2KK4 A;  1D1C A;  5KYY A;  3X20 B;  4EMH A;  1OZ2 A;  2EYX A;  3NMZ C;  2ROT A;  3A98 A;  2J7I A;  2P4R A;  3EGD A;  2HMA A;  5M9O A;  1K0S A;  2KDS A;  1TS9 A;  1JBM A;  2HBW A;  1FXX A;  2LT1 A;  2F1L A;  3M55 A;  5GJW B;  1RAB B;  2R58 A;  2QA4 Q;  1UGQ B;  5GAN f;  2AKL A;  1XJW B;  1UHC A;  4Z89 A;  4CC7 A;  3H9N A;  4J7F A;  2KRN A;  1SF9 A;  3ZEH A;  2O9V A;  2DER A;  5GAN g;  3EAE A;  2GF7 A;  2PTK A;  1SSF A;  3CCL Q;  3S3M A;  4FSS A;  4JZ3 A;  3JB9 I;  4J9I A;  5C6S A;  1WX6 A;  3CBM A;  2OTL T;  3C95 A;  1AWX A;  4OB3 B;  4M7A D;  2NUT A;  2RQW A;  1PSF A;  1WHK A;  2JTF A;  1FMW A;  2CRE A;  3J7A F;  2E10 A;  1WLP B;  1MMA A;  4IUV A;  1I8F A;  2GTO A;  3IQL A;  1K9A A;  2LJ1 A;  5D6W A;  5FRM A;  1KQ1 A;  2JT4 A;  1YP5 A;  5KYW B;  1VQ7 T;  4O6J A;  3JCM J;  4LDW A;  1TUC A;  4WF2 A;  3HTR A;  2O4X B;  2QDL A;  2AIR B;  2CUD A;  3ASK A;  4PK4 A;  2M02 A;  2FZC B;  2YDL A;  1NZ9 A;  1WXU A;  2KRO A;  3CCE Q;  4NL2 A;  2HCK A;  2B86 A;  3MJX A;  4IUR A;  1SSH A;  3JRZ A;  1I5O B;  4X34 A;  1M4Z A;  3V7R A;  1IHV A;  4E47 A;  2V1Q A;  3O8V A;  4KBM B;  2DA9 A;  2YUO A;  1KC8 R;  4F14 A;  4M77 G;  3VS2 A;  4R56 A;  2LQ8 A;  1VQ9 Q;  4HKE A;  2DK3 A;  4C92 G;  2MF2 A;  2A7Y A;  2EAY A;  3PIP A;  4PJO F;  2LJ0 A;  4R55 A;  1UGR B;  4J6X A;  3EHR A;  5GAM j;  1Q7Y C;  4RUG A;  2XDB A;  4N0A A;  1E6G A;  6AT1 B;  3VU3 C;  1QVG S;  4OMP A;  1M1K U;  5FWC A;  3CC7 A;  3MHX A;  4J9B A;  1PG5 B;  3GOX A;  3I56 A;  2DL3 A;  4LUD A;  1NJI U;  4QVC A;  2LQK A;  3MP8 A;  1BYM A;  2CKK A;  4F7U G;  5GMK l;  3PVL A;  1UFF A;  1Y71 A;  3H41 A;  2K2V A;  2DXU A;  3VYG A;  1YJW T;  2JTM A;  1WXB A;  1T3L A;  3M0R A;  4L5G A;  3UPU A;  2GCX A;  4BY6 B;  1Q81 U;  4M7A E;  1KQ2 A;  3E2U A;  1QQJ A;  5J26 A;  4ESR A;  1M8M A;  2QG9 B;  2YUP A;  3I56 T;  3QBY A;  1V1C A;  5IHN A;  1YIT Q;  4J9H A;  2DL7 A;  1H64 1;  3WVE B;  4GY5 A;  2DKG A;  5DM7 R;  1FMV A;  2PNI A;  3LWH A;  2L2P A;  2CZ1 B;  5IH2 A;  2XMF A;  4M77 F;  4DQ2 A;  3QHS A;  1ABO A;  4E7I A;  2KI7 A;  1KJW A;  3JB9 F;  2NUP A;  1YIJ A;  4DBR A;  5IT9 E;  5FRN A;  2D8H A;  4CI0 C;  2VAS A;  4PLI A;  1K9M R;  3M4Y A;  5CO7 A;  4M7A C;  3P8D A;  1EIF A;  2E64 A;  3L2V A;  1TG0 A;  2KXC A;  2RJE A;  4M78 D;  2LZ6 B;  3DLL A;  4RTT A;  3EGD B;  2YRD A;  2R57 A;  4EIK A;  4PJO A;  4HCZ A;  2D9T A;  5GAN j;  2DYI A;  1VQ5 Q;  4BD3 A;  1IGU A;  3J80 E;  5DLQ E;  4C5H A;  3CME T;  3GPL A;  1ZLM A;  1M1K C;  1Q81 R;  5LJ3 d;  3C4S A;  4BB7 A;  4M4Z A;  2VKN A;  4QT7 A;  2EKH A;  1JRI A;  3RDV A;  4Z8A A;  2Y4X A;  1YJN A;  5IHK A;  4M77 C;  1KG1 A;  2LMJ A;  1BI3 A;  3OA6 A;  3R6O A;  4KT0 E;  2JMC A;  3V7S A;  1K8A U;  1K4U S;  4JRI A;  2E3I A;  4A63 B;  2DAQ A;  3RES A;  5CAI A;  2YRV A;  5GAO n;  2YLC A;  3AHU A;  3VUB A;  2VXE A;  4EPC A;  1CKA A;  2E41 A;  2ZPG B;  3CBP A;  1YFN A;  4FM4 B;  3I5S A;  2EJ9 A;  1IRE B;  1QWF A;  2BUD A;  2GBQ A;  3JAM E;  1YI2 T;  2DD5 A;  1UDL A;  2QTV A;  5LJ3 e;  3CCL T;  1TUG B;  3OYN A;  2YRC A;  3CCM Q;  1Z9Q A;  5GAN e;  2QYZ A;  4B9W A;  1X2K A;  7AT1 B;  3GLX A;  3JCM e;  2X4X A;  3LGL A;  4PJO E;  1HYO A;  1ZX6 A;  4OB2 B;  5GMK i;  3OBY A;  4GBQ A;  2EYQ A;  2BE9 B;  3FLG A;  2DF6 A;  1EFN A;  2K7A A;  2LRQ A;  2CP7 A;  2M1H A;  1YCY A;  4ORZ A;  4JPB W;  5KE3 A;  1IRX A;  1VA7 A;  2VWF A;  2DL5 A;  3HRU A;  1VQL Q;  4M7D B;  1IO6 A;  2RA2 A;  3MO8 A;  4MZT A;  1K0X A;  2V8J A;  4PJJ A;  4DBH A;  2CUB A;  1VQP T;  2RJC A;  2CH4 W;  2KRS A;  4M75 E;  4E6R A;  1OEB A;  1VQK T;  1OU9 A;  1TTH B;  2RI3 A;  4FSX A;  4M7D F;  1LJO A;  1OV3 A;  4J9E A;  4C0G A;  1QVG P;  3SWN A;  1LNX A;  2KQW A;  2V8K A;  2KGT A;  5FU7 B;  3JCM Q;  1VQ9 T;  1BK2 A;  2GFU A;  3OYB A;  1NYF A;  3KUF A;  2BE7 D;  1TWB A;  4RG8 A;  4E2F B;  3PE0 A;  2ZPE B;  3UAT A;  5CQY A;  4PKC C;  3RIR A;  2A37 A;  1K1Z A;  2YUQ A;  4OMF B;  2EKO A;  4FL6 A;  1A0N B;  2DEU A;  1KK7 A;  2NUZ A;  1MHN A;  2EQJ A;  2VV5 A;  2M51 A;  1VQL A;  2OTJ Q;  1QW1 A;  1T0J A;  3ULR B;  3MEV A;  3L42 A;  1M1G A;  3QXE B;  4A4E A;  2QAZ A;  4MZM A;  1YHQ A;  4M77 D;  2MWP A;  3MCA B;  2FRY A;  2ENM A;  5KYY B;  3M0U A;  1TXQ A;  2EGE A;  3H0I A;  1KD1 C;  3G6E Q;  4MML A;  4L6V 5;  2VB6 A;  3HSB A;  2X35 A;  5IN1 A;  2WSE E;  2K5F A;  5KYW A;  1I4K 1;  5FU7 C;  2IIM A;  2MWO A;  1GL5 A;  8AT1 B;  4JDS A;  2ESW A;  1JEG A;  1OZ3 A;  1VQN Q;  1Y07 A;  1GBQ A;  2FEI A;  1YHQ Q;  1D09 B;  3REA B;  5A0D A;  3T9N A;  2JS0 A;  1D1A A;  2M0Y A;  2QQA A;  2F2W A;  1Q82 R;  3CCS Q;  4C0D B;  2CZ7 B;  3HPW A;  1XNI A;  1ZA1 B;  2IG0 A;  1WQ7 A;  1V29 B;  2EW3 A;  1WPY A;  1K73 U;  2DMO A;  2M16 A;  3E19 A;  3VS0 A;  2FHD A;  3OYF A;  3P8B B;  3R6N A;  3JB9 J;  3QJY A;  2XID A;  1M3C A;  5GAM h;  4BE1 A;  5LL6 S;  3EH2 A;  2XIC A;  5HKC A;  1HXD A;  1WXT A;  2MCN A;  3VS7 A;  3EH1 A;  1UGV A;  2M9U A;  3M0S A;  2XI9 A;  3M56 A;  4J6W A;  3CCS A;  3RBB B;  1NPR A;  3VS5 A;  4X9D A;  3CME Q;  2LNH B;  4PJL A;  2HNI A;  2ZGW A;  2DXT A;  2CT4 A;  1GRI A;  1W1F A;  1YJ9 A;  4X9C A;  4JJD A;  4ZGJ B;  2KBT A;  3JCM h;  2CDT A;  2LCS A;  2JMA A;  5KCH A;  3OYG A;  2K5I A;  2C0I A;  3MPU B;  1RAA B;  1V76 A;  3FJ5 A;  2RK1 A;  3DKM A;  1AWW A;  1Y57 A;  2ZPF B;  1K73 R;  1RAD B;  1VIF A;  1W6X A;  4Q5W A;  1SHG A;  1K9M C;  2DXC A;  5A0L A;  2VC8 A;  3EFO A;  1N9S A;  2CT3 A;  2JXB A;  1M2O A;  4C8Q G;  5GAN d;  1ZSZ A;  4XTX A;  2RH2 A;  2GGR A;  4XU3 A;  5I22 A;  2W0Z A;  4M7A F;  2RPN A;  1C1A A;  2RO0 A;  2CP2 A;  1VQ4 A;  4C92 C;  2PUO B;  3H0H A;  4M78 E;  5GAM d;  1ZHI A;  2E1H A;  1D0Z A;  4LD9 K;  2YXY A;  3INZ A;  5LJ3 j;  1UHF A;  1YNZ A;  4HA8 A;  3JCM f;  3V7C A;  1WJQ A;  2O4X A;  5HCK A;  4PFZ A;  1FX7 A;  2SEM A;  2QEX Q;  3EHQ A;  2QXF A;  1M1K R;  5LJ3 g;  2DXB A;  2I2L A;  1Q81 C;  4J5Y A;  4Z88 A;  5GAO m;  2E3H A;  3EGX B;  3A8O B;  2HQH A;  2PVG B;  1UTI A;  2MYS A;  3OMC A;  2EQM A;  1HSQ A;  4C5I A;  4OML A;  5EG2 A;  1AWJ A;  1NG2 A;  2AHJ B;  2LC4 A;  3QUI A;  5LJ3 f;  5CKH A;  4OMO A;  3CCR Q;  3SDZ A;  2BZX A;  2LX7 A;  4OMN A;  1R0B G;  3VYH B;  2E12 A;  2L5Q A;  1VOM A;  2V1R A;  1NLO C;  2JN0 A;  4QQD A;  1HJD A;  3UA6 A;  2KEA A;  4BDY A;  1MUZ A;  2DJQ A;  2G6F X;  3RKY A;  1QVP A;  2O2O A;  4A53 A;  1N8R U;  1GBR A;  3PNW C;  3SFM A;  3L2W A;  3VRZ A;  2DPP B;  2E6Z A;  3NPF A;  2BTT A;  4QW2 A;  1QKX A;  1ZBJ A;  3OSV A;  3I55 T;  2DJZ A;  4MMK A;  2FG0 A;  2K3X A;  3EFR A;  2BZY A;  2YWW A;  3S3N A;  4J9F A;  4QKU A;  2A08 A;  2D0Q B;  5AYF A;  3L2U A;  1ZQ1 A;  3HRT A;  1SRL A;  4OMQ A;  1GCP A;  1YJN Q;  3I9Q A;  5FW9 A;  3HRS A;  4ELZ C;  4BI4 A;  1H92 A;  1RL2 A;  4DBQ A;  4OB1 B;  2YLB A;  1I1J A;  2EGA A;  5CVI A;  4PJO D;  2FPE A;  1X2Q A;  5GAN 5;  2P0K A;  1VQK Q;  1KFZ A;  4YTL A;  3QZ9 B;  2ZPB B;  2JS2 A;  2COY A;  2C06 A;  2RHU A;  2X3X D;  2O01 E;  4JJN K;  3EG2 A;  4M75 F;  1DJ7 B;  2FVU A;  4QVD A;  1OU8 A;  1Q86 C;  4NOY A;  3G71 Q;  2QI2 A;  3TQ7 P;  2D1X A;  2KT1 A;  2V26 A;  1VQK A;  4M7D A;  3V8J A;  2VGM A;  4E7J A;  4C8Q C;  2DIQ A;  2F5K A;  3M5A A;  2L89 A;  4E7L A;  3CCL A;  1IGQ A;  4LDY A;  1B34 B;  1WIE A;  4M75 G;  4M7D C;  3CPW A;  4EMG A;  2FO0 A;  4M77 A;  1J3T A;  1LOJ A;  1YWP A;  2RHI A;  5L8R E;  5GAM g;  4EMK B;  1NJI C;  2GQI A;  3FEO A;  3OYM A;  3FDR A;  3OS1 A;  2QGG A;  3CCQ Q;  3TU4 K;  2EGC A;  5D7U A;  2EQU A;  5GAN h;  3CCJ Q;  1QKW A;  3CMA T;  1VQ7 A;  3BFM A;  3ZFJ A;  1R8O B;  1AOJ A;  2QA4 T;  2VYT A;  3GBQ A;  1YHQ T;  1W2B P;  4XTV A;  4XK8 E;  4CC2 A;  4PJO C;  2ZPH B;  3OW2 S;  2HKQ B;  3RMQ A;  3BDL A;  4HVV A;  4C0D C;  4JRK A;  1X69 A;  2VVK A;  4PJN A;  2P0P A;  1NJI R;  1M3A A;  2KYM A;  2Y90 A;  4N4I A;  1XQH A;  3GNG A;  4XU0 A;  3S6W A;  4OGE A;  1AVZ C;  2DBM A;  3JCM g;  2DIL A;  3VS3 A;  1M90 U;  1JJ2 P;  2RQT A;  1AT1 B;  4LE9 A;  2QAS A;  1IZ6 A;  5I11 A;  4HCC A;  4GLM A;  4M78 G;  2VGN A;  2CP0 A;  1D0X A;  2VUB A;  2DFU A;  3L2Q A;  3CCM A;  1AEY A;  1MMD A;  2L3R A;  2XD0 A;  2HL5 C;  1F1B B;  3A8G B;  1W2B A;  5FLX E;  1U5S A;  1UEC A;  4F7U E;  2DTH A;  3CC7 T;  1JJ2 A;  3UT1 A;  2A36 A;  1KIK A;  2DEQ A;  2BZ8 A;  3PFS A;  1RAC B;  1GXI E;  3X26 B;  3JV3 A;  4M7A B;  4DOV A;  4J83 A;  4XTW A;  4PJM A;  1NEB A;  2MIO A;  3MEW A;  3TEE A;  5KE2 A;  1NEG A;  3MEA A;  3SWN B;  4CRI A;  3E9F A;  3FIF A;  2GNC A;  1ZSG A;  2DIG A;  2KSS A;  4R0K A;  1WQW A;  3FJP A;  1K76 A;  1NBE B;  3LLR A;  1N27 A;  4IIM A;  2MK5 A;  4CC3 A;  3C0C A;  4OP0 A;  3QG1 A;  4C92 A;  3QSU A;  1R0C B;  3CD6 Q;  3CXC P;  4Y91 A;  1VQO A;  4B6M A;  4JZ4 A;  1S1N A;  1YIJ T;  2DET A;  3A5Z B;  1IHW A;  3HFN A;  1YIT A;  1VQO Q;  3GNF B;  2LVM A;  2RQV A;  1W4S A;  1CKB A;  1U06 A;  3X28 B;  2QEX T;  2OTJ A;  1RLQ C;  3EG3 A;  2R5M A;  2V8I A;  3I55 Q;  2OTL Q;  3MP6 A;  3QKJ A;  3CC4 A;  1D1B A;  5CK9 A;  1Q82 U;  2RQU A;  5IXB A;  3G7Z A;  5L23 A;  3OY9 A;  4DBF A;  4HVW A;  2P84 A;  3CME A;  5GAN 6;  1QVF A;  5KYN A;  4XAX B;  4IUT A;  4LDU A;  4N4G A;  2FYK A;  1T3S A;  1VQ6 A;  1MV3 A;  2ROL A;  4DEY A;  3EG1 A;  2FPD A;  2RJD A;  3BY7 A;  4WTO B;  3CCV Q;  3CC4 Q;  4C5E A;  2MI6 A;  2AZS A;  1S72 A;  4E7K A;  4C92 F;  8ATC B;  2WSC E;  3OMG A;  1OX8 A;  1T0H A;  3OS5 A;  5KCO A;  1VQM A;  4F16 A;  1D0Y A;  2XDP A;  4FCY A;  2L3Q A;  1PHT A;  1E7O A;  1VQM Q;  5GAO l;  1Y0M A;  4TVR A;  2AZV A;  1QCN A;  1YI2 A;  2QQR A;  1YJ9 T;  3MEU A;  2JM8 A;  5I21 A;  1BCO A;  2ZZD A;  2P4T A;  3VS4 A;  1I81 A;  1UB4 A;  3OYC A;  1ZBX A;  5LJ5 j;  2XG8 D;  2ATC B;  3EG0 A;  4Y28 E;  2NUT B;  2X4W A;  1JXO A;  2RB6 A;  1O9S A;  4C0F A;  1IXD A;  4RTX A;  1BBZ A;  3OS0 A;  1TSF A;  3CCQ T;  2PVD B;  4OF1 A;  1VUB A;  1VQN T;  4FU6 A;  4OMM A;  2KMT A;  3V8K A;  4ZN1 A;  3M57 A;  4OGC A;  1Q7Y R;  2FB7 A;  1Q95 G;  1PRM C;  1SHF A;  3NTI A;  1AZE A;  3OB9 A;  2C0T A;  2AKK A;  2EYZ A;  1KD1 R;  4KH1 B;  4EMK A;  1PD0 A;  4QVZ A;  2COZ A;  2K3B A;  2WSF E;  1VQO T;  4M75 D;  1N6A A;  3CCQ A;  9ATC B;  2K9G A;  1B34 A;  3OS2 A;  3PGG A;  4N4H A;  2DZC A;  2F2X A;  4RTW A;  3URG A;  1U1S A;  1OQK A;  4D8D A;  4FYX B;  2YUN A;  4JRQ A;  4F7U A;  1Q82 C;  2BIV A;  4KH0 B;  4O5V A;  4IUU A;  3N5B B;  2CGH A;  2FL7 A;  3LWI A;  1VQ7 Q;  3NFC A;  2DTO A;  3BE3 A;  4XTZ A;  2RI5 A;  1H8K A;  4KGV B;  2KRM A;  1VQL T;  1KHI A;  2KE9 A;  5FU6 B;  4C8Q F;  3TCJ A;  1UUE A;  1QWE A;  4M75 A;  1QCO A;  1WHM A;  2VXF A;  4JLG A;  4KUD K;  4II1 A;  3CD6 A;  3LH0 A;  1NM7 A;  1N5Z A;  2KNB B;  3KXT A;  4FW1 A;  2HL3 A;  2MPX C;  2DX1 A;  2A28 A;  2WAC A;  1VQ4 T;  3A8M B;  2DBK A;  5GMK m;  1RUW A;  1MMG A;  3E1S A;  1X6G A;  4IUP A;  2HZY A;  3X24 B;  1AD5 A;  3PT9 A;  4DOW A;  4OVA A;  2R5A A;  4E7S A;  1M9S A;  1VQM T;  5KYU B;  1KQS S;  4RTY A;  4C92 B;  4HXJ A;  2JM9 A;  4C8Q A;  1M8V A;  3HHT B;  3CCJ A;  2LCC A;  4RMO A;  1UE9 A;  1K73 C;  1MV0 B;  2QGF B;  3CBO A;  1FYN A;  2E6N A;  4KGX B;  1BIB A;  3A1P A;  1PNJ A;  2NWM A;  1RAH B;  1PKT A;  1SRM A;  1WHL A;  2HAX A;  2CZ6 B;  4M77 E;  1GCQ A;  1VYT A;  4LUE A;  4DA4 A;  3OYH A;  3QDF A;  2EWN A;  2K3Y A;  2GTJ A;  3AT1 B;  2H3E B;  1WA7 A;  5GAN 4;  3EGX A;  3I56 Q;  3VUZ A;  2YT6 A;  3G71 A;  4CC4 B;  3SB2 A;  5J39 A;  2LCL A;  1LVK A;  3OYA A;  3JB9 D;  5IHI A;  3FC3 A;  4OB0 B;  4FIB A;  3QII A;  4JLI A;  3OW2 A;  5EC7 A;  5KYX B;  1M3B A;  4RTZ A;  1BU1 A;  1ZSZ C;  1EZZ B;  2EPD A;  1X43 A;  1NYG A;  3NHN A;  2J6O A;  2NYS A;  4KGZ B;  4ZTJ A;  5GMK h;  2O9S A;  5CQX A;  3TRE A;  1YJW Q;  2C0O A;  3F70 A;  4C92 D;  3HKS A;  5GMK j;  1YN8 A;  5IAY A;  3JCM W;  2JUF A;  1PD1 A;  3CC2 A;  1YJW A;  4A4H A;  5GAM f;  4B9X A;  1RAI B;  3CC2 Q;  4IUQ A;  2KYB A;  2DTI A;  1HK9 A;  2G3R A;  2XKO C;  4KRT A;  3OYK A;  2W10 A;  1CSK A;  1Y7X A;  1MND A;  3THK A;  5I2M A;  2CP5 A;  4AFU C;  3PIO A;  4PNO A;  4DEX A;  2D0N A;  2RHX A;  4KUL A;  3CC7 Q;  2EQI A;  2CSQ A;  3LW5 E;  4ZGE B;  3CPW S;  2SRC A;  4M7D G;  2F2V A;  5GAO q;  2DM1 A;  1WFW A;  2DL4 A;  5LJ5 e;  2HKN A;  2LQW A;  3CCU T;  4HCK A;  1OX9 A;  3ZBD A;  2JW4 A;  3QDR B;  1G2B A;  2ZPI B;  2P0Q A;  2LQN A;  4M7A G;  1XTD A;  4UC4 A;  2CZ0 B;  2X51 A;  1M2V B;  4L59 A; 
#chains in the Genus database with same CATH homology
 3CCM A;  1VIE A;  5LJ3 h;  2X4J A;  2L3R A;  5KE3 A;  1VQ8 A;  1VQ6 T;  3Q1J A;  3C94 A;  2XD0 A;  3HRU A;  3PMI A;  4KUI A;  4C8Q E;  4M7D B;  4XU1 A;  3A8H B;  3A8G B;  1W2B A;  2RA2 A;  3SWN C;  4HT9 A;  5FLX E;  1N8R C;  4F7U E;  3MO8 A;  2DTH A;  4MZT A;  5CKF A;  2XDD A;  3CC7 T;  1JJ2 A;  1M5Q 1;  3UT1 A;  2V8J A;  2DO3 A;  2DZ9 A;  2M0O A;  4XTU A;  2DEQ A;  2KAF A;  2RJC A;  3PFS A;  3CCV T;  1VQP T;  1GXI E;  5D6X A;  3X26 B;  2A3L A;  3LYI A;  4XU2 A;  3OYI A;  4M75 E;  4M7A B;  3CCM T;  1TH7 A;  4ZN3 A;  2RM4 A;  4RG2 A;  4ATO A;  4Z02 A;  4J83 A;  3V8L A;  4XTW A;  4DOV A;  1VQK T;  2RI3 A;  4FSX A;  4XQ3 A;  1LJO A;  2H3J A;  1Q7Y U;  4M7D F;  4VUB A;  3JCM b;  4HCB A;  2DVE A;  3MEW A;  3TEE A;  4C0G A;  3SWN A;  3CCV A;  4JRP A;  5KE2 A;  1LNX A;  2KQW A;  5C0M A;  3JCM d;  4LDX A;  4M78 B;  3MEA A;  3WXM B;  2V8K A;  3SWN B;  3X25 B;  3OYL A;  4CRI A;  3E9F A;  3FIF A;  5FU7 B;  3JCM Q;  1VQ9 T;  2GFU A;  3A8L B;  3OYB A;  3KUF A;  4C5G A;  4BAC A;  2DIG A;  3RER A;  2KSS A;  1X75 C;  4F7U F;  4RG8 A;  4LD6 A;  1YIT T;  1QVF S;  1WQW A;  2ZPE B;  4HT8 A;  3FJP A;  3M53 A;  3LLR A;  2QQS A;  5CQY A;  1N27 A;  4PKC C;  3RIR A;  1VQ5 T;  1WGS A;  3M4G A;  5GAN 2;  4OMF B;  4OP0 A;  2MAM A;  3QG1 A;  3WVD B;  4LDV A;  2EKO A;  4C92 A;  3CMA A;  1K8A C;  1G3S A;  4FL6 A;  3QSU A;  3JB9 H;  3C12 A;  2KY9 A;  3DLM A;  4Y91 A;  1X01 A;  1VQO A;  3DB4 A;  2HQE A;  3QJ6 A;  5HK0 A;  3CC4 T;  1VQ5 A;  3QO3 A;  4BUG A;  1YIJ T;  3HP9 A;  3A5Z B;  3BDU A;  2E70 A;  4JUV A;  3HFN A;  1MHN A;  2EQJ A;  2VV5 A;  2B8A A;  1YIT A;  1VQL A;  3GNF B;  5J3B A;  1QW1 A;  2LVM A;  4M7A A;  1JJ2 S;  1AHJ B;  3E9G A;  2EJG A;  3MEV A;  1JB0 E;  1W4S A;  4BY6 C;  3X28 B;  2YHT A;  3L42 A;  2QEX T;  3SD4 A;  2OTJ A;  1M1G A;  5KH6 A;  1P92 A;  2RK2 A;  3QXE B;  4QQG A;  2XU8 A;  3FB9 A;  4MZM A;  4A4E A;  1VQ8 T;  1YHQ A;  1G3Y A;  2MWP A;  3MCA B;  4M77 D;  4M7D D;  5LJ5 f;  3G6E A;  3RKW A;  1KD1 U;  2R5M A;  2V8I A;  4XTY A;  3MP6 A;  1BIA A;  3QKJ A;  4MZP A;  3CC4 A;  1D3B B;  2L8D A;  3JCM c;  1KD1 C;  5CK9 A;  1WJS A;  1Q82 U;  3OSS C;  4MML A;  4EMK C;  3L2W A;  4L6V 5;  4FT2 A;  3OYY A;  2X35 A;  5IN1 A;  3HSB A;  2WSE E;  3G7Z A;  2K5F A;  3ER0 A;  3MET A;  3CC2 T;  1NE8 A;  1I4K 1;  3OY9 A;  2HD0 A;  5FU7 C;  1VQN A;  3CME A;  2MWO A;  2XHC A;  3H8Z A;  3OYE A;  5GAN 6;  1QVF A;  3S3O A;  5A2Q E;  4JDS A;  3CXC S;  2DD4 A;  4M78 A;  1OZ3 A;  2BKD N;  4XAX B;  3QPH A;  4IUT A;  4LDU A;  4N4G A;  4D6W A;  4RKU E;  2FYK A;  5GAN 3;  3J81 E;  1Y07 A;  1KC8 C;  1VQ6 A;  3UWN A;  3CD6 T;  2RHZ A;  2RJD A;  5A0D A;  5CR2 A;  3BY7 A;  1Y96 B;  1N9R A;  3T9N A;  4RCB A;  3P8H A;  3L1A A;  1OI1 A;  4M78 C;  5GAO p;  3L2Z A;  2QQA A;  1X6O A;  3QYH B;  4C5E A;  1WJR A;  2MI6 A;  3RKX A;  2JVV A;  3QZ5 B;  4C0D B;  2CZ7 B;  3HPW A;  1S72 A;  1XNI A;  2PVO B;  4RCC A;  4C8Q D;  4E7K A;  2KK4 A;  4C92 F;  2IG0 A;  3CCE T;  4JS4 A;  1WQ7 A;  1V29 B;  3PMT A;  1O75 A;  1WPY A;  3X20 B;  4A4F A;  4EMH A;  2WSC E;  3OMG A;  5LJ5 h;  3G4S A;  1K73 U;  2M16 A;  3E19 A;  1BYM A;  2FHD A;  1OZ2 A;  3OYF A;  3DB3 A;  3P8B B;  3JB9 J;  3OS5 A;  3QJY A;  2XID A;  5KCO A;  5GAM h;  4BE1 A;  5LL6 S;  4ELY C;  5M9O A;  2XIC A;  5HKC A;  2KDS A;  1JBM A;  1FXX A;  1HXD A;  2LT1 A;  3M55 A;  1VQM A;  2M9U A;  2EQK A;  2XDP A;  5I2S A;  2XI9 A;  2R58 A;  3M56 A;  4J6W A;  1UGQ B;  3G71 T;  3CCS A;  4ME7 A;  2D6F A;  4M77 B;  5GAN f;  1BI2 A;  5GAO l;  1NPR A;  4TVR A;  4X9D A;  1U8R A;  4J7F A;  3LX7 A;  1YI2 A;  3ZEH A;  2QQR A;  3CXC A;  3MEU A;  1YJ9 T;  5FRM A;  2LTO A;  2HNI A;  2ZGW A;  2DXT A;  5GAN g;  4C0Z A;  5I21 A;  3EAE A;  2GF7 A;  1SSF A;  3S3M A;  3OYD A;  2ZZD A;  2P4T A;  2LT4 A;  2ZCF B;  5CKD A;  4BDZ A;  3JB9 I;  4EDU A;  1I81 A;  1UB4 A;  4X9C A;  2F69 A;  3OYC A;  5C6S A;  1YJ9 A;  4J7I A;  3CBM A;  2OTL T;  3C95 A;  1ZBX A;  4ZGJ B;  5LJ5 j;  2XG8 D;  4OB3 B;  3JCM h;  3NTH A;  4M7A D;  4Y28 E;  1M90 C;  5GMK e;  1PSF A;  5KCH A;  3OYG A;  2K5I A;  2X4W A;  4BE0 A;  2RB6 A;  2MMP A;  1O9S A;  4C0F A;  2QTX A;  2JTF A;  2RK1 A;  3GP8 A;  3J7A F;  3DKM A;  2E10 A;  3OS0 A;  5HK3 A;  1I5L A;  4F7U B;  2PVD B;  3CCQ T;  2ZPF B;  1VIF A;  4IUV A;  1I8F A;  4OF1 A;  4Q5W A;  5DY9 A;  1VUB A;  1VQN T;  4FU6 A;  5D6W A;  2KMT A;  3V8K A;  4ZN1 A;  3M57 A;  4OGC A;  1KQ1 A;  2DXC A;  4FT4 A;  4QQ6 A;  2VC8 A;  5A0L A;  5CCA A;  1K9M C;  4O6J A;  3JCM J;  1VQ7 T;  4LDW A;  2FB7 A;  1N9S A;  4WF2 A;  4C8Q G;  2O4X B;  2GFA A;  5GAN d;  3NTI A;  3OB9 A;  3ASK A;  4XTX A;  2RH2 A;  4XU3 A;  1NZ9 A;  4M7A F;  2X4Y A;  4EMK A;  2RO0 A;  1VQ4 A;  4C92 C;  4BI8 B;  3RMS A;  2PUO B;  3BW1 A;  4M78 E;  4QVZ A;  3JCM V;  4IUR A;  4NL2 A;  5GAM d;  1ZHI A;  3JCM P;  2E1H A;  2JOY A;  2RHY A;  3JRZ A;  2WSF E;  4X34 A;  2E5Q A;  4LD9 K;  1VQO T;  1NPP A;  1M4Z A;  1N6A A;  3INZ A;  4M75 D;  5LJ3 j;  3CCQ A;  4HA8 A;  3V7R A;  3JCM f;  1B34 A;  1WJQ A;  3V7C A;  4E47 A;  3PGG A;  3O8V A;  3OS2 A;  1OYX A;  4KBM B;  2O4X A;  4N4H A;  1FX7 A;  2Y4Y A;  3KBG A;  2DZC A;  4M78 F;  4M77 G;  4R56 A;  4PJO G;  4V2S A;  2LQ8 A;  2QXF A;  3URG A;  5LJ3 g;  1U1S A;  4HKE A;  2DK3 A;  4C92 G;  2DXB A;  2I2L A;  1Q81 C;  2MF2 A;  4J5Y A;  2RI2 A;  5GAO m;  4JRQ A;  4F7U A;  2A7Y A;  3A8O B;  2EAY A;  2PVG B;  2JZ2 A;  3OMC A;  4PJO F;  3PIP A;  2EQM A;  1Q82 C;  4R55 A;  1UGR B;  4J6X A;  5GAM j;  2BIV A;  2PQW A;  1BKB A;  4C5I A;  2EFI A;  4O5V A;  5EG2 A;  4IUU A;  3N5B B;  2AHJ B;  2CGH A;  2FL7 A;  2LC4 A;  3QUI A;  5LJ3 f;  3ME9 A;  5CKH A;  5LJ5 g;  3LWI A;  3SDZ A;  1KQS A;  2JNG A;  3NFC A;  1Q7Y C;  2DTO A;  5A0G A;  3VYH B;  1QP3 A;  2E12 A;  2L5Q A;  2XDB A;  3M54 A;  4N0A A;  4XTZ A;  2RI5 A;  3OQ5 A;  2JN0 A;  3L2R A;  4QQD A;  3VU3 C;  4BI3 A;  4ZGD B;  1QVG S;  1VQL T;  1M1K U;  4BDY A;  1KHI A;  5D6Y A;  1XOV A;  4C92 E;  5CIU A;  5FU6 B;  3CC7 A;  3MHX A;  3RKY A;  4C8Q F;  3TCJ A;  3GOX A;  1QVP A;  4A53 A;  4M75 A;  4PLL A;  1N8R U;  3I56 A;  3PNW C;  1NJI U;  3SFM A;  2LQK A;  3MP8 A;  2VXF A;  2CKK A;  4JLG A;  2KVQ G;  4QVC A;  3OYJ A;  2DPP B;  4II1 A;  4F7U G;  5GMK l;  4KUD K;  3CD6 A;  2E6Z A;  3LH0 A;  1Y71 A;  5FU6 C;  4QW2 A;  3OSV A;  3I55 T;  4C8Q B;  1Q86 U;  2K2V A;  1G3W A;  1UGS B;  2DJZ A;  4MMK A;  4N0A C;  2K3X A;  5GAN 8;  3CPF A;  2DXU A;  3EFR A;  3KXT A;  3VYG A;  2K57 A;  4A54 A;  3G6E T;  1YJW T;  2JTM A;  1BI0 A;  3HFO A;  3S3N A;  2WAC A;  1VQ4 T;  4L5G A;  2F5T X;  3A8M B;  3UPU A;  2D0Q B;  2GCX A;  5CKB A;  5AYF A;  4BY6 B;  5GMK m;  4M75 B;  3L2U A;  1Q81 U;  1VQ9 A;  4M7A E;  1ZQ1 A;  3E1S A;  3HRT A;  4NS5 A;  3PTA A;  2QA4 A;  1KQ2 A;  3JB9 G;  5J26 A;  4IUP A;  2HBP A;  3X24 B;  3I56 T;  3QBY A;  3CCJ T;  3PT9 A;  3I55 A;  2OAU A;  2PU9 B;  4NL3 A;  4DOW A;  4OVA A;  2LX9 A;  2R5A A;  1M9S A;  1H64 1;  3UDC A;  3WVE B;  3HRS A;  2DKG A;  4GY5 A;  5DM7 R;  4ELZ C;  3LWH A;  1VQM T;  1G5V A;  1WNL A;  4BI4 A;  1KQS S;  2CZ1 B;  4C92 B;  5HY6 A;  1M1F A;  4C8Q A;  4M77 F;  1M8V A;  2CS7 A;  3HHT B;  4DQ2 A;  1RL2 A;  3QHS A;  3JCM X;  3CCJ A;  1G3T A;  1UEB A;  4E7I A;  2LCC A;  4OB1 B;  4RMO A;  4J6Y A;  3CCS T;  1K73 C;  2YLB A;  3JB9 F;  3CBO A;  1YIJ A;  2E6N A;  5CVI A;  1QVG A;  4IKF A;  5IT9 E;  5FRN A;  4PJO D;  4CI0 C;  4ZTF A;  3M59 A;  4PLI A;  3CEY A;  1BIB A;  3M4Y A;  5GAN 5;  3RUX A;  2P0K A;  5CO7 A;  4YTL A;  4M7A C;  3QZ9 B;  2ZPB B;  1EIF A;  2E64 A;  3P8D A;  3L2V A;  2RJE A;  2HAX A;  3CCR A;  2C06 A;  2IVW A;  4M78 D;  2RHU A;  2CZ6 B;  4M77 E;  3DLL A;  3VV0 A;  4DA4 A;  2XK0 A;  4A4K A;  2O01 E;  2R57 A;  3OYH A;  4BE2 A;  4E7H A;  4JJN K;  4PJO A;  4M75 F;  1DJ7 B;  2FVU A;  4HCZ A;  2EWN A;  4QVD A;  1Q86 C;  2D9T A;  4NOY A;  2K3Y A;  5GAN j;  3FRN A;  4J8O A;  5GAN 4;  4BD3 A;  2E65 A;  3J80 E;  2QI2 A;  1YBY A;  5DLQ E;  3HL8 A;  4M75 C;  3VUZ A;  4C5H A;  3G71 A;  3CME T;  3SB2 A;  3GPL A;  1VQK A;  5J39 A;  4M7D A;  2LCL A;  4PL6 A;  3OYA A;  1M1K C;  3V8J A;  1RI0 A;  2VGM A;  3JB9 D;  2PUK B;  5FRO A;  2HQX A;  3FC3 A;  4C8Q C;  4E7J A;  2DIQ A;  4OB0 B;  2F5K A;  3QII A;  3C4S A;  3M5A A;  4FIB A;  4JLI A;  2L89 A;  5LJ3 d;  3OW2 A;  4E7L A;  3CCL A;  3CCE A;  3M58 A;  1KHC A;  4LDY A;  1B34 B;  4M75 G;  4M7D C;  4BB7 A;  3CPW A;  2NLU A;  3VKI A;  4EMG A;  2GQV A;  4M77 A;  5GAM e;  1UGP B;  1LOJ A;  2QQB A;  2RHI A;  4ZTJ A;  5GMK h;  3G4S T;  5CQX A;  1JRI A;  5L8R E;  5GAM g;  4EMK B;  1NJI C;  3TRE A;  1MGQ A;  3CCU A;  3F70 A;  4C92 D;  3FEO A;  2Y4X A;  3HKS A;  2EJF A;  5GMK j;  3OYM A;  1YJN A;  5IAY A;  3FDR A;  3OS1 A;  3M9Q A;  3JCM W;  2JUF A;  3NTK A;  4M77 C;  2CYZ B;  3CC2 A;  1KG1 A;  1YJW A;  1BI3 A;  3OA6 A;  3R6O A;  4A4H A;  4KT0 E;  2OTL A;  5GAM f;  1H3Z A;  4B9X A;  3V7S A;  5CKE A;  1D3B A;  3TU4 K;  1K8A U;  4PJO B;  1QP2 A;  4JRI A;  2EQU A;  4IUQ A;  5GAN h;  3H6Z A;  1YJN T;  2DAQ A;  3RES A;  5CAI A;  3CMA T;  2DTI A;  1HK9 A;  1VQ7 A;  3BFM A;  2YRV A;  2G3R A;  5GAO n;  2XKO C;  3OYK A;  3ZFJ A;  1R8O B;  2YLC A;  3GIB A;  2RJF A;  2EIF A;  3VUB A;  2QA4 T;  1Y7X A;  3AHU A;  1W2B S;  2VXE A;  2RD1 A;  2VYT A;  4EPC A;  1YHQ T;  5I2M A;  1S72 T;  3PIO A;  4PNO A;  2E41 A;  1Y96 A;  2ZPG B;  4XTV A;  3CBP A;  2EJ9 A;  2RHX A;  1IRE B;  4FM4 B;  4XK8 E;  2BUD A;  2K5L A;  4KUL A;  2QQ9 A;  3JAM E;  1YI2 T;  4MDW A;  3QYG B;  2DD5 A;  4MDX A;  2ZPH B;  1BI1 A;  3LW5 E;  3OW2 S;  4PJO C;  4M7D E;  4ZGE B;  3GF5 A;  3RMQ A;  3BDL A;  4P5N A;  5LJ3 e;  1K9M U;  5GAN 7;  1U1T A;  3OYN A;  3CCL T;  3CPW S;  4M7D G;  4C0D C;  4JRK A;  2QEX A;  2OTJ T;  4JS5 A;  4A4G A;  5GAO q;  2P0P A;  5GAN e;  5GAO r;  4B9W A;  3MP1 A;  1KC8 U;  5LJ5 e;  2LDM A;  3GLX A;  1FWZ A;  2K4Y A;  3JCM e;  2X4X A;  3LGL A;  2QDY B;  2Y90 A;  4N4I A;  4PJO E;  1XQH A;  3GNG A;  4XU0 A;  3S6W A;  4OGE A;  4OB2 B;  3VJP A;  4GLK A;  3JCM g;  5GMK i;  3OBY A;  3CCU T;  3JSC A;  1M90 U;  1PSE A;  3ZBD A;  2EYQ A;  3LGF A;  3QDR B;  2ZPI B;  2P0Q A;  3FLG A;  2LNV A;  4M7A G;  5DLO A;  3OBW A;  1XTD A;  4UC4 A;  3EFS A;  3CCR T;  1IZ6 A;  1VQP A;  5LJ5 d;  2LRQ A;  4HCC A;  2CZ0 B;  4M78 G;  2VGN A;  2VUB A;  2M1H A;  1YCY A;  4L59 A;  3L2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...