3LGLA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k382me2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA01
3E9GA 2JOYA 2B8AA 4PL6A 2QA4A 3H6ZA 2LRQA 1K9MC 3CCUT 4IUVA 4ZN1A 2RI5A 1K9MU 1VQLA 3CC7T 1YJNT 1NJIC 3QIIA 4E7JA 1N27A 2LVMA 3S3OA 1VQ4A 2EQUA 2BIVA 1G5VA 1VQ8A 4II1A 1WJRA 5A2QE 4ZTJA 4IUTA 2R58A 3OYNA 2FHDA 1NPPA 3LYIA 4BE1A 3CPFA 2QQRA 2JUFA 2XK0A 5CIUA 5C0MA 3ME9A 1XTDA 2RHIA 3OYAA 1VQKT 4FL6A 3L2VA 2JZ2A 2QEXT 4EDUA 4E7IA 3OYCA 4E7LA 2RJFA 3OS0A 1M90C 1VQ6A 2OTJA 4QQ6A 4IUPA 2R5AA 3G6EA 1QVFA 2RO0A 2GFUA 2LCCA 3MO8A 2DIQA 4C5EA 5DLQE 4PLIA 2OTLA 1RL2A 1YIJT 1VQ7A 2K3YA 3CC4T 2RHYA 1JJ2S 3G4SA 5FRNA 1VQPT 1OZ3A 1VQ9A 4A4FA 2L3RA 2KDSA 4OVAA 5DM7R 1M1KU 4A4GA 2EQJA 4RG2A 3CCJT 3CCQA 3ASKA 1YJWA 3CCST 4GY5A 3I55A 3OMCA 1YI2T 3CEYA 1NZ9A 1VQNA 3L42A 1OYXA 4N4GA 3OYKA 3ZEHA 2JTFA 4UC4A 4C5IA 1K73U 3MEVA 2EIFA 1YBYA 3CPWA 5FRMA 3OA6A 2GF7A 4B9WA 4Q5WA 4BE0A 3LH0A 2M16A 1MHNA 4QW2A 3LGFA 1Q81U 2MWOA 4HCZA 2CKKA 4A4HA 1JJ2A 2X35A 2DAQA 3CCMA 1KC8U 1KD1C 3OYDA 3KBGA 5KH6A 4BD3A 2JVVA 2F5KA 4IUUA 3G71A 1RI0A 3P8BB 1YHQT 3DB3A 2HQEA 3FC3A 2EQKA 3I56T 4N4HA 5KE3A 1S72T 1VQ6T 1Q86C 3FDRA 3CC2A 3G4ST 5M9OA 5HY6A 2R5MA 2GFAA 2KVQG 2LDMA 2M1HA 3OW2S 3OYGA 1K73C 2RJDA 3CCQT 2QA4T 2QQSA 3QJ6A 3OS1A 2LCLA 3FEOA 5KE2A 1M1KC 3CD6T 3L2RA 5FROA 3JAME 2O4XA 3QKJA 1M90U 2X4WA 1VQ7T 2OTJT 1KC8C 2DIGA 4L59A 1OI1A 3CXCS 3HKSA 3NTIA 2L8DA 3CMEA 5C6SA 3CCUA 1VQ8T 1QVGA 1NPRA 3CMET 1YI2A 3TREA 2K3XA 1W2BS 1VQNT 3S6WA 3O8VA 3CC7A 2X4YA 1YJ9T 3CCJA 2LQ8A 5KCHA 3CCMT 5J39A 4ZN3A 5J3BA 1YJWT 4ZTFA 3OW2A 3MP8A 4NS5A 4LD6A 3P8HA 3E9FA 3L2QA 1Q81C 3Q1JA 1VQOA 1Q82C 1YJNA 4Z02A 2E70A 1KHCA 4N4IA 1QVFS 1KD1U 1YITT 1VQOT 2L89A 1VQ4T 3OYBA 3S3NA 2RHZA 4C5HA 3QBYA 4IUQA 3PIOA 4IKFA 3PMTA 3OS2A 3CMAA 4BE2A 4B9XA 1XNIA 3OYIA 3A5ZB 3CCRT 1Q86U 2XHCA 1QVGS 3CMAT 2LTOA 2R57A 3F70A 2VYTA 4FU6A 3MP1A 3DLMA 2EKOA 3CCEA 1KQSS 3OYHA 3CCLT 2O4XB 1BKBA 3J80E 5IN1A 1VQ5A 2P0KA 2RJEA 3L2WA 1N8RU 5D6WA 1VQMA 3J7AF 1OZ2A 3L2UA 1KQSA 3CD6A 3OYFA 5KCOA 2EQMA 3OB9A 4BDZA 1WJSA 2BUDA 3MEUA 1WGSA 4BACA 3ER0A 3KUFA 1YJ9A 2MI6A 3OYYA 5IAYA 2E6ZA 2RHXA 3OY9A 1Q82U 2OTLT 3DLLA 3LGLA 3SD4A 2MWPA 3PFSA 2JNGA 4IURA 2YRVA 3H8ZA 3J81E 3LLRA 3UT1A 5D6XA 3FLGA 1VQLT 3GOXA 3CPWS 2NLUA 3LX7A 1K8AU 2IG0A 4E7HA 1H3ZA 3PIPA 5FLXE 3G71T 2BKDN 1S72A 4YTLA 1Q7YC 3CCVT 3PNWC 3OYLA 2G3RA 1X6OA 1Q7YU 2X4XA 3CCVA 3S3MA 1N8RC 2M0OA 1SSFA 3P8DA 2RJCA 1NJIU 4QQGA 4QVZA 2RHUA 3NTKA 3OYJA 3MP6A 2EFIA 3BDLA 3M9QA 1UEBA 1VQ5T 2E5QA 3CCRA 1YHQA 3I56A 3OYMA 4E7KA 1M1GA 5D6YA 2QEXA 1VQ9T 2XDPA 3OQ5A 5LL6S 4TVRA 3CC2T 2RI2A 4C5GA 3PMIA 1YITA 1VQKA 1EIFA 3MEAA 3OYEA 4BDYA 3DB4A 3I55T 3CCLA 4X34A 4PLLA 1K8AC 3OMGA 1VQPA 3MEWA 2RI3A 1W2BA 4QQDA 1VQMT 3META 2WACA 3C4SA 3CC4A 4CRIA 3G6ET 2E6NA 3CCSA 2PQWA 2D9TA 2HQXA 5IT9E 2DO3A 3EAEA 3CCET 1WJQA 4A4EA 3CXCA 3NTHA 5J26A 1IZ6A 1KHIA 1YIJA 3UWNA
chains in the Genus database with same CATH superfamily
1PRLC 2DL3A 4FSSA 4PL6A 4M75B 3H6ZA 1KD1R 3A8GB 4XK8E 5LJ5e 3CCUT 4IUVA 2M9UA 2X51A 1X27A 1Y57A 2O9SA 3G4SQ 1N6AA 2LX9A 2SRCA 2WSFE 1YJNT 1N27A 4V2SA 2O9VA 1JO8A 3CBOA 4L5GA 2JMCA 4RTTA 1VQ4A 4KULA 4II1A 2KBTA 4IIOA 1VQ5Q 2YSQA 1U06A 2RK2A 2R58A 4GBQA 3OYNA 1ZHIA 5CKEA 4BE1A 4R0KA 1UHCA 3V7CA 4MDXA 4X9CA 3R6NA 5ECAA 4OB3B 2JUFA 1S1NA 3FB9A 1TOVA 2KYMA 5C0MA 1MV3A 3NFCA 2DTOA 3ME9A 1D0ZA 1VQKT 1OX8A 4FYXB 3I9QA 4PJOD 2JZ2A 2A37A 3RDVA 2KAFA 3M54A 1WXUA 4E7LA 2VV5A 4XTZA 1SRLA 3CPWP 3JB9G 1YCYA 1M90C 2EYZA 1ZSZC 1Y71A 1WLPB 1ZUKA 4J83A 2R5AA 3G6EA 1NEBA 1T3LA 3CBPA 2LCCA 1O9SA 1AVZC 2K4YA 5DLQE 2KT8A 3NHNA 5KYXB 4FYYB 2KXDA 4J9FA 2D8HA 4HCCA 1VQPT 1OZ3A 2L3RA 4HT8A 2EQJA 5GAMh 3CCJT 3EHQA 2EJFA 2QQAA 3CCQA 4JS5A 1UGSB 1TU0B 2D0QB 4C8QD 2XDBA 2K57A 4A53A 1NLOC 2GTOA 1VQNA 4J6WA 2YUQA 4M77D 4QVCA 1C1AA 3VS4A 1X2KA 4C0GA 1K73U 2EIFA 2JS2A 2HAXA 3TCJA 2C06A 3V7RA 1IGQA 2DRKA 1QP3A 1ZLMA 2DL8A 2M16A 2XD0A 1MHNA 1VIFA 4EMKB 2MWOA 1GRIA 1MNDA 3EG9B 2RF0A 4J9EA 2BE7D 3V8LA 3QHSA 3GLXA 2X3WD 4HT9A 2X35A 2JMAA 1MUZA 4JRPA 1M1KR 1KD1C 2P4TA 4Y91A 2V8JA 1PHTA 3OYDA 4M77G 3M57A 2F5KA 3QDRB 4KGZB 4BI3A 2ATCB 2DL5A 1JRIA 2VASA 3PVQA 1E7OA 4B6MA 2J6KA 3FC3A 5IHIA 3LW5E 2ZPBB 3I56T 4N4HA 4FYVB 1C6VX 4GLKA 4JS4A 1S72T 4K11A 4HCKA 5GAOp 3INZA 4RTXA 4LDXA 2R5MA 1H92A 1Q7YR 2RPNA 1KQSP 4EMHA 4XU2A 2GQIA 1SHFA 2RJDA 3QYHB 2QEXQ 3EG1A 3QJ6A 5GAN3 4X9DA 2LC4A 2FZKB 3OBWA 5GAOq 1K1ZA 3CC4Q 2DD4A 1WHMA 1ZSGA 3JAME 1OPKA 2FPEA 2ZAEA 2E3IA 2NWMA 4DBQA 1KC8C 4PJMA 3CXCS 2EGCA 2EBPA 1VQ8T 2K79A 2ZPFB 2CSIA 2PVDB 3TREA 5EG2A 5IXBA 2NUTB 5AT1B 4DQ2A 2X4YA 3JCMW 2LZ6B 2YUPA 1T0HA 4J9CA 4C8QA 5J3BA 1OX9A 4A54A 4A4KA 3OW2A 3VV0A 3MP8A 4Y28E 2DVJA 5CCAA 1JQQA 1ZSZA 1Q81C 2DMOA 3VUBA 4QKUA 2MAMA 2O31A 1YJNA 4E7ZA 2E70A 2QAZA 2L89A 4ATOA 4HVUA 1K9MR 2A28A 2COWA 3SHWA 4C5HA 2I2LA 3QBYA 1D3BA 5KYWA 5GAMe 1N9RA 2AT1B 2QK0A 4IKFA 5GAOn 1R77A 3CBMA 3CCUQ 1BK2A 3A5ZB 4C8QE 5IHKA 2DK3A 3F70A 2R57A 4F14A 4KGXB 1YJNQ 3JCMJ 2K2MA 2DA9A 2A08A 3CCEA 2HNIA 5LJ5h 2CH4W 1LPLA 4OMFB 1FXXA 4D8KA 4M7AF 3RKYA 1QVPA 1W6XA 2YWWA 2CDTA 3JB9I 1N8RU 2J06A 2XKOC 2AZVA 3J7AF 3RBBB 1IRXA 2GQVA 3OB9A 4D8DA 4M78B 2EW3A 1V1CA 1I07A 5GMKe 2JXBA 3RMSA 4BACA 1UE9A 1ZBJA 3OYYA 4OB2B 5IAYA 2RHXA 2J6OA 2YT6A 4LE9A 3DLLA 2CP5A 2MIOA 2KRSA 3PFSA 4PJOE 4IURA 1G8XA 3H8ZA 3CC2Q 2G6FX 1IREB 1SKUB 2K5LA 1GFCA 2YDLA 1Y7XA 5HK0A 1H3ZA 2LX7A 5FLXE 1ZX6A 3G71T 4AFZC 2BTTA 4AFQC 5GAOm 1LJOA 4LDVA 2MCNA 1AWOA 2BKDN 2CP7A 2E4HA 3QG1A 2KGTA 4JZ4A 1K0SA 1Q7YC 1YN8A 2L3QA 3EH1A 3MPUB 3CCJQ 5LJ3e 1WHJA 3S3MA 1PD0A 2XIDA 1SSFA 2L3SA 1BI1A 3UPUA 2RHUA 1BI0A 1IHVA 3HFOA 4C92E 2EFIA 4JDSA 4M7DA 3BDLA 3M9QA 3CCRA 3PT9A 3EGDB 3HL8A 3M53A 2D6FA 3UA6A 4D6WA 2KK4A 1R8OB 1VQOQ 3CCVQ 3RESA 3H0HA 3VS3A 2VXEA 2JJ9A 2EJ9A 3EG0A 1VQNQ 2JW4A 3AHUA 1YCSB 4OP0A 5FU7C 3CCLA 1GCPA 4X34A 3C95A 1UHFA 4FSXA 5A0DA 2DERA 2PUKB 1RAAB 2M0YA 1W2BA 4XAXB 2E1HA 2DLPA 4PFPA 2WACA 4C8QC 3ULRB 3CC4A 3VS0A 2QG9B 1BU1A 2FG0A 3CCSA 4AG1C 2KYBA 2DBMA 3CCET 5J26A 1TUCA 3VS7A 3E9GA 2YLBA 2AKKA 3EG2A 1K9MC 1U3OA 4FIBA 4ZN1A 4AMCA 4CI0C 1X6GA 1RUWA 1K9MU 4ELZC 2VXFA 2O2OA 2KY9A 4C8QG 4XU3A 2HSPA 2K5IA 2K7AA 1ABQA 1Y0MA 3GIBA 1KIKA 2BIVA 3QO3A 1W4SA 5GAN7 3M5AA 3RR6A 2W0ZA 4ZTJA 2E65A 4M7AE 1M2VA 2HBWA 2FHDA 4E47A 3LYIA 1VQPQ 2ZPGB 2OAUA 3CPFA 3X26B 2ED0A 2HZYA 2XK0A 2EJGA 5HK3A 4LNPA 5GMKh 2DJQA 5KYUA 5KYYA 3L2VA 4RTUA 3HP9A 1YFNA 2H8HA 2VGMA 4O5VA 4C0DB 2E12A 3OYCA 2KMTA 1HXDA 1PKSA 1E6GA 4A63B 4C0ZA 1AZGB 4ELYC 1MNEA 1OPLA 2AIRB 4M78F 4BUGA 4E6RA 3TEEA 1N9SA 4IUPA 2F2WA 2GNCA 1YP5A 1JXOA 1ZA1B 2GFUA 2QGFB 3MO8A 4C5EA 4M75A 1H3HA 1QQJA 4PLIA 2OTLA 2V8IA 2CUBA 1RL2A 4J6XA 5KYWB 5LJ5j 3URGA 1YIJT 4KH0B 1G2BA 2JM8A 2K3YA 1QCFA 1M4ZA 5L8RE 1M1KU 2FVUA 3ASKA 3A98A 1YJWA 3JRZA 4GY5A 3VS2A 2LP5A 4M7AA 4M75D 4LXCA 4DA4A 1B34B 3OMCA 1NZ9A 1M3CA 2RD1A 2VGNA 4JUVA 1O75A 3M4GA 2ZGWA 1T3SA 4J9GA 4M7DC 4M7AD 1OYXA 2LQNA 4N4GA 3OYKA 3QXEB 1KC8R 3T9NA 2E10A 3MEVA 3M0PA 2FEIA 4OF1A 5IHNA 2HL3A 3NPFA 5LJ5f 3EGXA 1PG5B 1VQKQ 2K9GA 2DX1A 3RERA 3I5SA 4PFOA 3G1JA 4M77F 5CQXA 1PKTA 1AOJA 1KQ1A 2CKKA 1JJ2A 3JB9F 8AT1B 2KROA 1ARKA 1YJ9Q 3HHTB 5KH6A 4J9BA 4BD3A 1VQLQ 3G71A 5GAMj 1RI0A 1YHQT 3X20B 2EQKA 3GF5A 1YNZA 5KE3A 5CQYA 4EMKA 4KBMB 4JLIA 4C0FA 2X3XD 4XTYA 5HY6A 2L5QA 3OW2S 3OYGA 2DTHA 3QSUA 3RUXA 2PVGB 2RQWA 3X25B 5KE2A 1WDXA 3VS5A 3L2RA 4C92B 4LDWA 3BDUA 1ZUYA 1M90U 2EKHA 3THKA 2XDDA 4NL2A 4CC4B 2DIGA 4L59A 2C0OA 2MMPA 3JCMf 1PSEA 3D7SB 1M5Q1 2RQUA 4JJBA 4PJNA 3I55Q 4BI4A 5C6SA 3CCUA 1DJ7B 3HPWA 3CMET 2K3XA 2CT3A 1UDLA 4Z89A 1HYOA 9ATCB 5KYXA 3HRUA 4RUGA 3FJ5A 1VQNT 3H0FA 4ZGEB 3CC7A 1UJ0A 2QQBA 2DYIA 3M4YA 1PRMC 2LQ8A 4PJOA 3CCMT 5J39A 4ZN3A 2WSCE 1YJWT 3X24B 2LCSA 4NS5A 1MMAA 4LD6A 3NMZC 1BYMA 2VB6A 4BY6B 4FM4B 2HBPA 1KHCA 2XICA 2I0NA 1FWZA 1QW1A 3VYGA 2W10A 4QVDA 1QVFS 4C8QB 2O88A 5GMKi 1VQ4T 2BZXA 2QASA 1BIBA 4IUQA 1QMCA 3PIOA 2DRMA 3QWXX 1JJ2P 3OS2A 3CMAA 2CT4A 4L6V5 1VQ9Q 1BI3A 2A3LA 4M75G 1MGQA 2XHCA 1QVGS 2P4RA 2VYTA 4M7AC 4FU6A 1S72Q 4OGCA 3H41A 3OYHA 1RAHB 1LOJA 2O4XB 5GMKm 3VJPA 3JCMg 3VS1A 1QKXA 1K9AA 1BKBA 3OBYA 2LNHB 3AT1B 2P0KA 3RNJA 4J6YA 1D3BB 1I5OB 3M0RA 4F16A 2COZA 5I22A 1VQMA 5GAMg 3BE3A 5CR2A 2FPFA 2NUPA 2DE0X 3L2UA 2AKLA 1TXQA 4FT2A 3CD6A 2MOXA 2HCKA 2LJ0A 2EQMA 1QWEA 2BUDA 3LH5A 4ZNXA 4JJDA 2PZ1A 1OULA 4PFZA 1WGSA 2CZ1B 3IQLA 3KUFA 1V76A 4RG8A 3HSBA 2MI6A 1OV3A 2ESWA 3A1PA 2A7YA 1K4US 3L2ZA 3SD4A 2AZSA 2O01E 2NYSA 4EPCA 1VQ6Q 1WPYA 1MMNA 3FLGA 4J9HA 1KJWA 3CCMQ 5GAMd 5LJ3h 2CGHA 3LX7A 5I2MA 4LDYA 2FZCB 3OSVA 1Y96A 4NOYA 3C0CA 4M7DE 1S72A 5EC7A 1X2QA 3TU4K 3CCVT 3OYLA 1X6OA 4Z88A 2X4XA 1N5ZA 2FRWA 2CREA 3EH2A 1PCXA 2M0OA 2CP2A 1NJIU 1H8KA 4JZ3A 1LNXA 4QVZA 4PNOA 2DILA 2OJ2A 3MP6A 3NGPA 3I35A 2J7IA 2YRDA 1M2VB 3I56A 3EG9A 3CXCP 1M1GA 2F2XA 1QVGP 1M3BA 1GCQC 2RI2A 3BY7A 3PMIA 3QWYA 1VIEA 2AK5A 2KXCA 3CCEQ 2DTIA 2RA2A 3QZ9B 3OYEA 4BDYA 1RAIB 1XOVA 1F1BB 5GAOl 2CP6A 4JRKA 5IXFA 2RI3A 4LDUA 1X69A 4F04B 1VQMT 3VU3C 2IVWA 3C4SA 2CP3A 3I56Q 2IPOB 1BB9A 2HQXA 5CKHA 3LWIA 5GANj 4MMKA 3NTHA 1IZ6A 1MV0B 1KHIA 2XI9A 1YIJA 2JOYA 1X6BA 3JCMX 1U8RA 1UGVA 2LJ1A 2PTKA 2FPDA 2QA4A 1D1CA 2LRQA 1I0CA 1UB4A 2MF2A 4C92D 4VUBA 2RI5A 1VYVA 4C92G 1M1FA 4RTWA 2ROLA 1NJIC 2LVMA 2HMAA 1YWPA 3RIRA 3S3OA 2VUBA 5I21A 1FMWA 3HRSA 2EQUA 1G5VA 1VQ8A 4F7UA 3R6OA 3EGDA 1AHJB 2H3EB 1I5LA 2VVKA 3C94A 1VQ8Q 2JTEA 5CO7A 2X9HA 1NPPA 3TSZA 1V29B 5CIUA 3VUZA 4IIMA 2NUTA 3SFMA 1ZQ1A 4M4ZA 3M59A 2RHIA 3SWNB 4AG2C 1WQ7A 2QA4Q 4EDUA 4E7IA 3EGXB 4LD9K 3KFVA 4DBFA 2DM1A 2LJ3A 1G3TA 1U1TA 3VS6A 4RMOA 4ZGDB 4QQ6A 1RLQC 2FO0A 1QWFA 4M7AB 3CD6Q 1JJ2S 5FRNA 4F7UG 2OI3A 1VQ9A 4DOWA 2DEQA 1QP2A 4A4GA 2D8JA 1HSQA 4RG2A 1TUGB 1NEGA 3MHXA 2DF6A 2ZCFB 1RAGB 3E19A 4DBRA 1SHGA 3CCST 3JCMQ 2DETA 4JLGA 2JM9A 3CEYA 4XTVA 3JCMe 4BB7A 4M7AG 3TSWA 3WXMB 5GMKj 3GBQA 3ZEHA 5CK9A 2JT4A 2JTFA 2P0QA 2Y90A 1WA7A 1VOMA 4UC4A 4C5IA 1YBYA 3CPWA 3OA6A 1YHQQ 3H9NA 2GF7A 4Q5WA 4BE0A 4RCCA 4QW2A 3LGFA 3PE0A 1YI2Q 5HCKA 4HCZA 1OU8A 4M7DF 4A4HA 5GAOr 2X4JA 2DYBA 2DAQA 3CCMA 4BY6C 4OMQA 3CCLQ 2KE9A 4JRIA 3P8BB 1UG1A 4ZGJB 4OB1B 1UTIA 2HQEA 2F69A 3ZL7C 2LT1A 2RQRA 2K6DA 2CSQA 4R56A 1YIJQ 2K5FA 1WHGA 1VQ6T 1Q86C 3G6EQ 3CMAQ 3FDRA 3OW2P 3CC2A 5FW9A 2BE9B 1IXDA 2D1XA 5M9OA 1RAEB 1ACMB 2KVQG 3JB9H 3MCAB 5I11A 1R0CB 4Z8AA 3I5RA 2QQSA 1N8RR 3X28B 1WXTA 1M1KC 3MKDA 2V8KA 5FROA 5GAN4 1AZEA 2DD5A 1FX7A 2O4XA 3VYHB 2OTJT 2XU8A 1OI1A 2Y4XA 1T0JA 4ANJA 3EFSA 3HKSA 3M58A 1FMVA 1TTHB 1WYXA 4O6JA 4DOVA 1QVGA 1TH7A 4J7IA 1VYUA 1VQ4Q 4HVVA 2DZCA 4OMMA 1W2BS 3EFOB 1G3YA 1YJ9T 1TS9A 3JV3A 2EPDA 1D09B 2CH4A 2JS0A 4ZTFA 2GGRA 3E9FA 3L2QA 4LN2A 2HD0A 4XU1A 3Q1JA 3A8MB 1VQOA 4Z02A 4N4IA 1SEMA 1K8AR 2DL7A 3OYBA 1D0YA 2E3HA 2EQIA 3DKMA 1SRMA 1I1JA 1NE8A 3BW1A 2RHZA 1B7TA 2P0PA 3JSCA 4FCYA 2PVOB 1IO6A 3PMTA 3JCMd 5CKBA 1B3QA 1OU9A 2VC8A 4BE2A 4B9XA 4Y92A 3OYIA 1OQKA 3HTRA 3WVEB 3ZBDA 3CCRT 2EWNA 4WF2A 2LTOA 5CKDA 3CMAT 3UF4A 3CQTA 1AWJA 3MP1A 3DLMA 4EIKA 2EKOA 1NG2A 3M0UA 4KUIA 4CC7A 2SEMA 2RH2A 1UECA 3J80E 5IN1A 1VQ5A 2RJEA 4WCIA 1A0NB 1K73R 1OZ2A 1Q82R 1M30A 4LUDA 2WSEE 3OYFA 2YLCA 2H3JA 2NUZA 1SSHA 1JU5C 1CKAA 4HCBA 1EX4A 1CKBA 2KSSA 1OEBA 2QI2A 1YJ9A 2DBKA 3VRZA 3OY9A 1M8MA 1QCNA 5HKCA 1M27C 1Q82U 1W1FA 1ZA2B 3M0SA 3LGLA 4F7UB 1UGRB 1I4K1 1RABB 3REBB 1GXIE 4M7DD 1RACB 1AT1B 3J81E 3LLRA 1EZZB 3GOXA 3CC7Q 1PC0A 3CPWS 2EGEA 2L3PA 1K8AU 2QQ9A 5LJ3j 2V26A 1PSFA 1M3AA 3CMEQ 2XG8D 4PKCC 5KYUB 5KYYB 3PNWC 1CSKA 5FU6C 2G3RA 3PGGA 1YWOA 1Q95G 4MZMA 2EYYA 1Q7YU 4JPBW 3SDZA 2M02A 5GAN6 4C92C 2DFUA 1IB8A 1N8RC 1NM7A 3P8DA 1YJWQ 2RJCA 5CAIA 4QQGA 4KRTA 3PTAA 5AYFA 1UEBA 1VQ5T 4MZPA 2DPPB 1YHQA 3KXTA 1VQMQ 1UFFA 3OYMA 4F7UF 2B86A 4E7KA 1VQ9T 2DKGA 3OQ5A 5LL6S 2KEAA 2PUOB 2EVRA 2HEQA 4C5GA 5GAN8 3OSSC 4RCBA 3JCMb 1YITA 2GBQA 4CC2A 1PD1A 2FYKA 1EIFA 1NJIR 3V7SA 4ME7A 1WIEA 2F2VA 2RNAA 1B34A 2HDAA 1BBZA 1G3WA 1K8AC 1HD3A 1VQPA 3UATA 4M75E 8ATCB 2ROTA 4PJOC 1RADB 4OMNA 4XTUA 4M78G 1X01A 4M77C 2E6NA 3EHRA 1C0MA 3N5BB 6AT1B 2PQWA 4RKUE 1BI2A 2F1LA 2DO3A 3EAEA 4PJOF 1WJQA 5D7UA 3CXCA 3U23A 2HL5C 2B8AA 1AD5A 2KI7A 1U5SA 1GBRA 5L23A 4WTOB 1TWBA 4AFUC 1VYTA 1VQLA 2NUPB 3CC7T 2LMJA 3QIIA 4LUEA 1D1BA 4E7JA 3A8LB 2ENMA 2QTVA 1WI7A 1M2OA 2V1RA 5CVIA 3JCMP 1QVFP 3C12A 5IH2A 2MYSA 4JJCA 5DY9A 1UGPB 1WJRA 1KK7A 5A2QE 4IUTA 1TSFA 2CP0A 2YUOA 3M56A 1D1AA 2JN0A 5LJ3f 1JEGA 2C0IA 2EYWA 3UDCA 1BIAA 2QQRA 4PJLA 1G83A 1NLPC 3RKWA 5LJ5d 1ZBXA 2EGAA 7AT1B 1XTDA 2EYXA 3OYAA 2YRCA 3CCSQ 1VA7A 4FL6A 4F7UE 2QEXT 4M78C 3M0QA 4J8OA 1BCOA 2OTLQ 2BZ8A 2RJFA 3OS0A 1AWXA 2KQWA 1VQ6A 1Z9QA 2ZZDA 3GPLA 2OTJA 2ECZA 1QVFA 2RO0A 1JXMA 2DIQA 1RLPC 4C0DC 1U1SA 1EFNA 1WX6A 1VQ7A 3CC4T 2KT1A 2RHYA 3G4SA 2GTJA 1Q86R 4C92F 1NBEB 4A4FA 1E6HA 2KDSA 4HXJA 4OVAA 4BI8B 5DM7R 1GFDA 1IGUA 2HKNA 1NYGA 1JBMA 3H0IA 5CKFA 1WHKA 1HK9A 3VRYA 3I55A 3M55A 4ORZA 1YI2T 3CCRQ 4C92A 2F5TX 3FJPA 5GANh 1B07A 1TUDA 2DNUA 1AEYA 3L42A 2FRYA 1ABOA 1X43A 2L0AA 1XJWB 4AT1B 5FRMA 4F17A 1GCQA 1PWTA 1KG1A 4B9WA 2E41A 3LH0A 5FU7B 4XTWA 1TG0A 5GAMf 5FWBA 1VUBA 1Q81U 1QKWA 3JCMV 2LT4A 3QYGB 2KRNA 2LQWA 1M90R 4QT7A 2RQTA 1KC8U 4J9IA 3KBGA 2VWFA 5GMKl 2JVVA 4IUUA 4M78D 3EG3A 1W70A 2DJZA 3L1AA 2EYQA 5KYNA 2CZ6B 4M77A 3DB3A 1VQ7Q 1IHWA 3RKXA 5LJ5g 2QDYB 2ABLA 4RTVA 2DXBA 3JB9D 4CC3A 3HFNA 2QGGA 4N0AC 1WHHA 3G4ST 2QXFA 1OOTA 2OTJQ 1SF9A 2GFAA 2LDMA 2M1HA 3G7ZA 3SWNC 2RB6A 4RTYA 1KFZA 2HQHA 1K73C 2P84A 3GNFB 3CCQT 1I8FA 2FB7A 2QA4T 4EMGA 4M75F 2LCLA 3FEOA 3OS1A 1WZOA 2ZPEB 5LJ3g 1RAFB 3CD6T 1K0XA 4M78E 2COYA 2K3BA 5GANd 3QKJA 4RTZA 3QDFA 2X4WA 4PJJA 3BFMA 2HSEB 1AWWA 1M9SA 1Y96B 2FZGB 2RMOA 3NTIA 4P5NA 1Z9ZA 2L8DA 3CMEA 2QTXA 4OMOA 2OX7A 4DEYA 2GCXA 2DEUA 2M51A 3RMQA 1RI9A 1NPRA 1JB0E 1YI2A 2CS7A 2PU9B 4DBHA 1X75C 3GNGA 2DL4A 2LNVA 3O8VA 3S6WA 4DEXA 4M78A 3CCJA 2ZPHB 5KCHA 4OMLA 5FWCA 4OMPA 3E1SA 1MMDA 1FYNA 1GBQA 4X1VA 4OB0B 2Y4YA 3P8HA 2E64A 3VKIA 2DVEA 5GANe 3ZFJA 1WFWA 2LQKA 3JCMh 1Q82C 3EGUA 4XQ3A 1WXBA 4J7FA 1KD1U 1YITT 1VQOT 4MMLA 2MK5A 4PJOB 1LVKA 3S3NA 3E2UA 3WVDB 3EFOA 2EAYA 2BZYA 4M77E 2Z0WA 5A0LA 1XNIA 3PVLA 4HVWA 2VKNA 1Q86U 5DLOA 3TVTA 2RM4A 4FT4A 1QCOA 4PJOG 2KR3A 1KQSS 3LWHA 2DXTA 3CCLT 1LCKA 1PNJA 4E7SA 3HRTA 1KQ2A 3CCQQ 4KGVB 1K76A 3L2WA 1D0XA 3SB2A 5D6WA 1R0BG 2OAWA 4NL3A 2DXUA 1KQSA 1NYFA 5KCOA 4XTXA 4MZTA 2XMFA 2DZ9A 4MDWA 2RK1A 4BDZA 1WJSA 1XQHA 2CZ0B 3MEUA 5GJWB 2J6FA 3ER0A 4E2FB 1UJYA 2E6ZA 1H641 2OTLT 4FW1A 4GLMA 1Q81R 3TQ7P 1KSWA 3MJXA 1ZSZB 3QPHA 2C0TA 2MWPA 2JNGA 4M75C 4J5YA 2K2VA 2YRVA 1WQWA 2YUNA 3UT1A 5D6XA 5FU6B 1VQLT 3V8KA 4KT0E 2NLUA 1UUEA 3REAB 4M7DB 2KRMA 2YHTA 4M77B 3JCMc 2IG0A 4E7HA 1G3SA 1SPKA 5I2SA 3PIPA 4N0AA 3A8OB 2E5KA 1QLYA 2CYZB 2A0FB 4ESRA 4YTLA 5GANg 3M0TA 4J9DA 2J05A 4KH1B 3SWNA 2JTMA 2KNBB 2YXYA 1YITQ 4FYWB 5LJ3d 4HA8A 2V1QA 2FL7A 1Y07A 4XU0A 3CCVA 1W2BP 4C8QF 1WNLA 3GP8A 1MMGA 3V8JA 1ZUUA 4M7DG 1GL5A 4JRQA 3NTKA 3QZ5B 4OGEA 3OYJA 3OS5A 4KUDK 2E5QA 3SEMA 2RQVA 1HJDA 5D6YA 2QEXA 2HKQB 3FIFA 2XDPA 4TVRA 2CZ7B 3CC2T 2L2PA 5GAN5 1I81A 5GJVB 4R55A 1M8VA 1BCMA 3FRNA 2DXCA 3QUIA 5A0GA 1FMKA 1VQKA 1UGQB 2MPXC 1P92A 3MEAA 4HKEA 3DB4A 3I55T 4FW2A 3G71Q 4PLLA 2AHJB 2PNIA 5GANf 3A8HB 3QJYA 2D0NA 3OMGA 3MEWA 1WHLA 3O5ZA 2RN8A 3JB9J 4QQDA 2ED1A 2QDLA 3META 4PK4A 1J3TA 1SG5A 4JJNK 4CRIA 3EFRA 1PM3A 2CUDA 3G6ET 2A36A 2D9TA 5GAN2 5IT9E 4A4EA 2QYZA 3UA7A 2ZPIB 4EMKC 1VQ7T 2IIMA 4AFSC 3UWNA
chains in the Genus database with same CATH topology
3E9GA 2JOYA 2B8AA 2YLBA 3JCMX 1U8RA 4PL6A 4M75B 3H6ZA 2QA4A 3A8GB 4XK8E 2LRQA 1UB4A 2MF2A 5LJ5e 1K9MC 4C92D 3CCUT 4IUVA 2M9UA 4FIBA 4VUBA 2RI5A 4ZN1A 4C92G 4CI0C 1M1FA 1N6AA 1K9MU 4ELZC 1VQLA 2LX9A 2VXFA 3CC7T 2WSFE 1YJNT 1NJIC 3QIIA 2KY9A 4E7JA 3A8LB 4C8QG 1N27A 2LVMA 4V2SA 4XU3A 3RIRA 3CBOA 3S3OA 2K5IA 2VUBA 4L5GA 5CVIA 5I21A 3JCMP 1VQ4A 3C12A 3HRSA 3GIBA 2EQUA 2BIVA 3QO3A 1G5VA 1VQ8A 4KULA 4II1A 1W4SA 3R6OA 5DY9A 3M5AA 4F7UA 1UGPB 5GAN7 1AHJB 1WJRA 5A2QE 4ZTJA 4IUTA 1I5LA 2E65A 4M7AE 3M56A 2JN0A 2R58A 2RK2A 3C94A 5LJ3f 5CO7A 3OYNA 2FHDA 1NPPA 1ZHIA 5CKEA 3LYIA 4E47A 4BE1A 2ZPGB 3V7CA 2OAUA 1V29B 4X9CA 3UDCA 3CPFA 3X26B 4MDXA 1BIAA 2QQRA 4OB3B 2JUFA 2XK0A 3FB9A 3RKWA 4EMKC 5LJ5d 2EJGA 5CIUA 3VUZA 5C0MA 5HK3A 3NFCA 3SFMA 2DTOA 3ME9A 1ZBXA 1ZQ1A 5GMKh 3M59A 1XTDA 2RHIA 3OYAA 1VQKT 3SWNB 4FL6A 3L2VA 3HP9A 4F7UE 2JZ2A 2VGMA 1WQ7A 4O5VA 2QEXT 4EDUA 4C0DB 4E7IA 4M78C 2E12A 4J8OA 2KAFA 3M54A 3OYCA 4E7LA 2KMTA 4LD9K 2VV5A 2RJFA 4XTZA 1HXDA 3OS0A 3JB9G 1YCYA 1G3TA 1U1TA 2KQWA 1M90C 1VQ6A 4C0ZA 4ELYC 4RMOA 2ZZDA 3GPLA 2OTJA 4M78F 1Y71A 4BUGA 4ZGDB 3TEEA 1N9SA 4QQ6A 4IUPA 4J83A 2R5AA 3G6EA 1QVFA 2RO0A 3CBPA 2GFUA 2LCCA 1O9SA 3MO8A 2DIQA 4C5EA 4M75A 2K4YA 4PLIA 5DLQE 4C0DC 1U1SA 2OTLA 2V8IA 1RL2A 4J6XA 5LJ5j 3URGA 1YIJT 1VQ7A 2K3YA 3CC4T 4M7AB 2RHYA 1JJ2S 1M4ZA 3G4SA 4HCCA 1VQPT 4F7UG 5FRNA 4C92F 1OZ3A 1VQ9A 4DOWA 2DEQA 4A4FA 1QP2A 2KDSA 2L3RA 4OVAA 5L8RE 4BI8B 5DM7R 4A4GA 1M1KU 2EQJA 4HT8A 4RG2A 5GAMh 3CCJT 3MHXA 2EJFA 2QQAA 2FVUA 2ZCFB 3CCQA 4JS5A 3ASKA 3E19A 1UGSB 3JRZA 1YJWA 2D0QB 3CCST 4GY5A 1JBMA 5CKFA 4M7AA 3JCMQ 4M75D 4JLGA 4DA4A 1HK9A 4C8QD 1B34B 3I55A 2XDBA 2K57A 3M55A 3OMCA 1YI2T 3CEYA 1NZ9A 4XTVA 3JCMe 4A53A 4BB7A 4C92A 2F5TX 2RD1A 3FJPA 4M7AG 5GANh 2VGNA 4JUVA 1O75A 3M4GA 1VQNA 4J6WA 4M77D 2ZGWA 3WXMB 4QVCA 3L42A 4M7DC 5GMKj 4M7AD 1OYXA 4N4GA 3OYKA 3ZEHA 5CK9A 4C0GA 2JTFA 2P0QA 2Y90A 3QXEB 4UC4A 4C5IA 3T9NA 2E10A 1K73U 3MEVA 2EIFA 1YBYA 3CPWA 4OF1A 5FRMA 2HAXA 3TCJA 3OA6A 5LJ5f 2GF7A 1KG1A 2C06A 3V7RA 4B9WA 4Q5WA 4BE0A 2E41A 3LH0A 5FU7B 1QP3A 4XTWA 2M16A 4RCCA 2XD0A 1MHNA 3RERA 5GAMf 4QW2A 3LGFA 1VIFA 1VUBA 4M77F 4EMKB 1Q81U 2MWOA 4HCZA 2LT4A 3JCMV 4M7DF 5CQXA 3V8LA 1KQ1A 3QYGB 2CKKA 3GLXA 3QHSA 4A4HA 5GAOr 2X4JA 1JJ2A 3JB9F 4HT9A 2X35A 2DAQA 3CCMA 4JRPA 4BY6C 3HHTB 1KC8U 1KD1C 2P4TA 3KBGA 2V8JA 4Y91A 5KH6A 4BD3A 5GMKl 3OYDA 4M77G 2JVVA 2F5KA 3M57A 4IUUA 4M78D 2DJZA 3G71A 3L1AA 3QDRB 1RI0A 4JRIA 5GAMj 4BI3A 2EYQA 2CZ6B 3P8BB 1JRIA 4ZGJB 4OB1B 1YHQT 4M77A 3DB3A 2HQEA 2F69A 3RKXA 2LT1A 5LJ5g 3FC3A 2QDYB 3X20B 2EQKA 3GF5A 3LW5E 2DXBA 2ZPBB 4R56A 2K5FA 3I56T 3JB9D 4N4HA 5KE3A 1S72T 4GLKA 4JS4A 5CQYA 4EMKA 1VQ6T 1Q86C 5GAOp 3HFNA 3FDRA 4KBMB 3INZA 4N0AC 4JLIA 4C0FA 3CC2A 4LDXA 3G4ST 2QXFA 4XTYA 2R5MA 5HY6A 5M9OA 2GFAA 2L5QA 2KVQG 2LDMA 2M1HA 3JB9H 3MCAB 3G7ZA 3SWNC 4EMHA 2RB6A 2DTHA 4XU2A 3OYGA 3OW2S 3QSUA 1K73C 2RJDA 3GNFB 3CCQT 1I8FA 2FB7A 2QQSA 3QYHB 3QJ6A 2QA4T 4EMGA 3RUXA 4M75F 2LCLA 3FEOA 3X28B 5GAN3 3OS1A 4X9DA 2LC4A 2PVGB 2ZPEB 3OBWA 3X25B 5KE2A 5LJ3g 5GAOq 1M1KC 3L2RA 3CD6T 2DD4A 2V8KA 5FROA 4M78E 4C92B 5GAN4 2DD5A 4LDWA 3BDUA 1FX7A 2O4XA 3QKJA 5GANd 3JAME 1M90U 3VYHB 2X4WA 3BFMA 2XDDA 1VQ7T 4NL2A 2OTJT 1KC8C 1M9SA 1Y96B 2DIGA 4L59A 2MMPA 3JCMf 1PSEA 2XU8A 1OI1A 1M5Q1 2Y4XA 3CXCS 3EFSA 3HKSA 3NTIA 4P5NA 2L8DA 3CMEA 3M58A 4BI4A 2QTXA 5C6SA 3CCUA 2GCXA 4O6JA 1VQ8T 4DOVA 2ZPFB 1QVGA 3RMQA 1NPRA 1JB0E 1DJ7B 2PVDB 3HPWA 3CMET 1TH7A 2CS7A 1YI2A 4J7IA 3TREA 2PU9B 2K3XA 4M7DA 5EG2A 1X75C 2DZCA 3GNGA 3HRUA 1W2BS 1VQNT 4DQ2A 2LNVA 3O8VA 1G3YA 3S6WA 4ZGEB 3CC7A 2X4YA 4M78A 3JCMW 2QQBA 1YJ9T 3M4YA 3CCJA 2ZPHB 2LQ8A 4PJOA 5KCHA 3CCMT 5J39A 4ZN3A 4C8QA 3E1SA 2WSCE 5J3BA 4A54A 3X24B 4A4KA 3OW2A 4ZTFA 3VV0A 3MP8A 4Y28E 4NS5A 5CCAA 4LD6A 4OB0B 2Y4YA 3P8HA 2E64A 3E9FA 3L2QA 1BYMA 2HD0A 1Q81C 3VKIA 2DVEA 5GANe 3ZFJA 4XU1A 3VUBA 2MAMA 4BY6B 2LQKA 3Q1JA 3A8MB 4FM4B 3JCMh 1VQOA 1Q82C 1YJNA 2HBPA 4Z02A 2E70A 1KHCA 4XQ3A 2XICA 1FWZA 1QW1A 4N4IA 3VYGA 4QVDA 1QVFS 4J7FA 1KD1U 4C8QB 2L89A 3OYBA 5GMKi 1VQ4T 1VQOT 1YITT 4ATOA 4MMLA 4PJOB 3DKMA 1NE8A 3BW1A 2RHZA 3S3NA 3WVDB 4C5HA 2P0PA 2I2LA 3QBYA 1D3BA 2EAYA 1BIBA 3JSCA 4IUQA 5GAMe 3PIOA 1N9RA 2PVOB 4IKFA 3PMTA 3JCMd 5CKBA 5GAOn 3OS2A 3CBMA 2VC8A 4M77E 3CMAA 4BE2A 5A0LA 4L6V5 4B9XA 1XNIA 3OYIA 1BI3A 2A3LA 3A5ZB 4M75G 3WVEB 3ZBDA 3CCRT 4C8QE 5DLOA 1Q86U 2EWNA 1MGQA 2XHCA 2DK3A 2LTOA 3F70A 2R57A 4WF2A 5CKDA 1QVGS 3CMAT 2VYTA 4M7AC 2RM4A 4FU6A 4FT4A 3MP1A 3DLMA 3JCMJ 4OGCA 2EKOA 4PJOG 3CCEA 3LWHA 2DXTA 3OYHA 1KQSS 4KUIA 3CCLT 1LOJA 2HNIA 2O4XB 2RH2A 5GMKm 5LJ5h 3VJPA 3JCMg 4OMFB 1FXXA 3HRTA 1KQ2A 1BKBA 3OBYA 5IN1A 3J80E 1VQ5A 4M7AF 3RKYA 2P0KA 2RJEA 3L2WA 1QVPA 4J6YA 1D3BB 3SB2A 3JB9I 1N8RU 5D6WA 2XKOC 1VQMA 5GAMg 4NL3A 5CR2A 3J7AF 1OZ2A 3L2UA 2DXUA 1KQSA 4FT2A 2WSEE 3CD6A 2GQVA 3OYFA 5KCOA 2YLCA 4XTXA 4MZTA 2EQMA 2DZ9A 3OB9A 4MDWA 2RK1A 4BDZA 1WJSA 2BUDA 4M78B 1XQHA 2CZ0B 2H3JA 5GMKe 3RMSA 3MEUA 1WGSA 4BACA 4HCBA 2CZ1B 3ER0A 3KUFA 4RG8A 2KSSA 2QI2A 3HSBA 1YJ9A 2MI6A 3OYYA 4OB2B 2E6ZA 2RHXA 5IAYA 3OY9A 5HKCA 1Q82U 1H641 2OTLT 2A7YA 3DLLA 3LGLA 3L2ZA 1UGRB 4F7UB 3QPHA 1I4K1 3SD4A 2MWPA 3PFSA 2JNGA 4PJOE 1GXIE 4IURA 4M75C 4J5YA 4M7DD 2K2VA 2YRVA 3H8ZA 2O01E 1WQWA 4EPCA 3J81E 3LLRA 1WPYA 3UT1A 5D6XA 3FLGA 5FU6B 1IREB 3GOXA 3V8KA 1VQLT 4KT0E 4PJOD 5GAMd 3CPWS 2NLUA 5LJ3h 2CGHA 2K5LA 3LX7A 5I2MA 4LDYA 1Y7XA 4M7DB 5HK0A 2YHTA 1K8AU 3OSVA 4M77B 3JCMc 2IG0A 4E7HA 1G3SA 1Y96A 4NOYA 1H3ZA 2QQ9A 5I2SA 3PIPA 5FLXE 4N0AA 3G71T 5LJ3j 5GAOm 1PSFA 1LJOA 3A8OB 4LDVA 2CYZB 2BKDN 4M7DE 3QG1A 4YTLA 5GANg 1S72A 2XG8D 3SWNA 3TU4K 2JTMA 1Q7YC 3CCVT 4PKCC 1YJWT 3PNWC 5FU6C 5LJ3d 2G3RA 3PGGA 4HA8A 3OYLA 4MZMA 1X6OA 2FL7A 2X4XA 1Q7YU 1Y07A 4XU0A 3SDZA 5LJ3e 3CCVA 4C8QF 5GAN6 4C92C 1WNLA 3GP8A 2XIDA 3S3MA 1N8RC 2M0OA 1SSFA 3V8JA 3P8DA 4M7DG 2RJCA 1BI1A 4QQGA 5CAIA 1NJIU 4JRQA 1LNXA 4QVZA 2RHUA 3NTKA 4PNOA 3QZ5B 1BI0A 4OGEA 3UPUA 3PTAA 3OYJA 3HFOA 3MP6A 2EFIA 3OS5A 4JDSA 4C92E 3BDLA 5AYFA 3M9QA 4KUDK 1UEBA 1VQ5T 3AHUA 2E5QA 4MZPA 3CCRA 2DPPB 1YHQA 3I56A 3KXTA 3OYMA 3PT9A 4F7UF 4E7KA 1M1GA 5D6YA 2QEXA 3FIFA 1VQ9T 2DKGA 2XDPA 3OQ5A 4TVRA 5LL6S 2CZ7B 2PUOB 3HL8A 3M53A 3CC2T 2D6FA 5GAN5 4D6WA 1I81A 1R8OB 2KK4A 2RI2A 4C5GA 3BY7A 3PMIA 5GAN8 4R55A 1M8VA 3RESA 3OSSC 3FRNA 2VXEA 1VIEA 2DXCA 4RCBA 2EJ9A 3QUIA 3JCMb 5A0GA 1YITA 2FYKA 1VQKA 1UGQB 1EIFA 2DTIA 1P92A 2RA2A 3V7SA 3QZ9B 3MEAA 4HKEA 4ME7A 3OYEA 4OP0A 4BDYA 1B34A 3DB4A 3I55T 5FU7C 3CCLA 1G3WA 1XOVA 2AHJB 4PLLA 4X34A 3C95A 5GANf 4FSXA 3A8HB 5A0DA 5GAOl 1K8AC 2PUKB 3QJYA 4JRKA 3OMGA 3MEWA 1VQPA 2RI3A 4LDUA 1W2BA 4M75E 4XAXB 2E1HA 3JB9J 4QQDA 4PJOC 1VQMT 3VU3C 3META 2WACA 2IVWA 4XTUA 4C8QC 3C4SA 3CC4A 4JJNK 4CRIA 4M78G 3EFRA 1X01A 4M77C 3G6ET 2E6NA 3CCSA 3N5BB 2PQWA 2D9TA 1BI2A 4RKUE 5GAN2 2HQXA 5CKHA 3LWIA 5GANj 5IT9E 2DO3A 3EAEA 4PJOF 1WJQA 4A4EA 3CCET 4MMKA 3CXCA 3NTHA 5J26A 1IZ6A 2ZPIB 1KHIA 2XI9A 1YIJA 3UWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9G A;  2JOY A;  2B8A A;  4PL6 A;  2QA4 A;  3H6Z A;  2LRQ A;  1K9M C;  3CCU T;  4IUV A;  4ZN1 A;  2RI5 A;  1K9M U;  1VQL A;  3CC7 T;  1YJN T;  1NJI C;  3QII A;  4E7J A;  1N27 A;  2LVM A;  3S3O A;  1VQ4 A;  2EQU A;  2BIV A;  1G5V A;  1VQ8 A;  4II1 A;  1WJR A;  5A2Q E;  4ZTJ A;  4IUT A;  2R58 A;  3OYN A;  2FHD A;  1NPP A;  3LYI A;  4BE1 A;  3CPF A;  2QQR A;  2JUF A;  2XK0 A;  5CIU A;  5C0M A;  3ME9 A;  1XTD A;  2RHI A;  3OYA A;  1VQK T;  4FL6 A;  3L2V A;  2JZ2 A;  2QEX T;  4EDU A;  4E7I A;  3OYC A;  4E7L A;  2RJF A;  3OS0 A;  1M90 C;  1VQ6 A;  2OTJ A;  4QQ6 A;  4IUP A;  2R5A A;  3G6E A;  1QVF A;  2RO0 A;  2GFU A;  2LCC A;  3MO8 A;  2DIQ A;  4C5E A;  5DLQ E;  4PLI A;  2OTL A;  1RL2 A;  1YIJ T;  1VQ7 A;  2K3Y A;  3CC4 T;  2RHY A;  1JJ2 S;  3G4S A;  5FRN A;  1VQP T;  1OZ3 A;  1VQ9 A;  4A4F A;  2L3R A;  2KDS A;  4OVA A;  5DM7 R;  1M1K U;  4A4G A;  2EQJ A;  4RG2 A;  3CCJ T;  3CCQ A;  3ASK A;  1YJW A;  3CCS T;  4GY5 A;  3I55 A;  3OMC A;  1YI2 T;  3CEY A;  1NZ9 A;  1VQN A;  3L42 A;  1OYX A;  4N4G A;  3OYK A;  3ZEH A;  2JTF A;  4UC4 A;  4C5I A;  1K73 U;  3MEV A;  2EIF A;  1YBY A;  3CPW A;  5FRM A;  3OA6 A;  2GF7 A;  4B9W A;  4Q5W A;  4BE0 A;  3LH0 A;  2M16 A;  1MHN A;  4QW2 A;  3LGF A;  1Q81 U;  2MWO A;  4HCZ A;  2CKK A;  4A4H A;  1JJ2 A;  2X35 A;  2DAQ A;  3CCM A;  1KC8 U;  1KD1 C;  3OYD A;  3KBG A;  5KH6 A;  4BD3 A;  2JVV A;  2F5K A;  4IUU A;  3G71 A;  1RI0 A;  3P8B B;  1YHQ T;  3DB3 A;  2HQE A;  3FC3 A;  2EQK A;  3I56 T;  4N4H A;  5KE3 A;  1S72 T;  1VQ6 T;  1Q86 C;  3FDR A;  3CC2 A;  3G4S T;  5M9O A;  5HY6 A;  2R5M A;  2GFA A;  2KVQ G;  2LDM A;  2M1H A;  3OW2 S;  3OYG A;  1K73 C;  2RJD A;  3CCQ T;  2QA4 T;  2QQS A;  3QJ6 A;  3OS1 A;  2LCL A;  3FEO A;  5KE2 A;  1M1K C;  3CD6 T;  3L2R A;  5FRO A;  3JAM E;  2O4X A;  3QKJ A;  1M90 U;  2X4W A;  1VQ7 T;  2OTJ T;  1KC8 C;  2DIG A;  4L59 A;  1OI1 A;  3CXC S;  3HKS A;  3NTI A;  2L8D A;  3CME A;  5C6S A;  3CCU A;  1VQ8 T;  1QVG A;  1NPR A;  3CME T;  1YI2 A;  3TRE A;  2K3X A;  1W2B S;  1VQN T;  3S6W A;  3O8V A;  3CC7 A;  2X4Y A;  1YJ9 T;  3CCJ A;  2LQ8 A;  5KCH A;  3CCM T;  5J39 A;  4ZN3 A;  5J3B A;  1YJW T;  4ZTF A;  3OW2 A;  3MP8 A;  4NS5 A;  4LD6 A;  3P8H A;  3E9F A;  3L2Q A;  1Q81 C;  3Q1J A;  1VQO A;  1Q82 C;  1YJN A;  4Z02 A;  2E70 A;  1KHC A;  4N4I A;  1QVF S;  1KD1 U;  1YIT T;  1VQO T;  2L89 A;  1VQ4 T;  3OYB A;  3S3N A;  2RHZ A;  4C5H A;  3QBY A;  4IUQ A;  3PIO A;  4IKF A;  3PMT A;  3OS2 A;  3CMA A;  4BE2 A;  4B9X A;  1XNI A;  3OYI A;  3A5Z B;  3CCR T;  1Q86 U;  2XHC A;  1QVG S;  3CMA T;  2LTO A;  2R57 A;  3F70 A;  2VYT A;  4FU6 A;  3MP1 A;  3DLM A;  2EKO A;  3CCE A;  1KQS S;  3OYH A;  3CCL T;  2O4X B;  1BKB A;  3J80 E;  5IN1 A;  1VQ5 A;  2P0K A;  2RJE A;  3L2W A;  1N8R U;  5D6W A;  1VQM A;  3J7A F;  1OZ2 A;  3L2U A;  1KQS A;  3CD6 A;  3OYF A;  5KCO A;  2EQM A;  3OB9 A;  4BDZ A;  1WJS A;  2BUD A;  3MEU A;  1WGS A;  4BAC A;  3ER0 A;  3KUF A;  1YJ9 A;  2MI6 A;  3OYY A;  5IAY A;  2E6Z A;  2RHX A;  3OY9 A;  1Q82 U;  2OTL T;  3DLL A;  3LGL A;  3SD4 A;  2MWP A;  3PFS A;  2JNG A;  4IUR A;  2YRV A;  3H8Z A;  3J81 E;  3LLR A;  3UT1 A;  5D6X A;  3FLG A;  1VQL T;  3GOX A;  3CPW S;  2NLU A;  3LX7 A;  1K8A U;  2IG0 A;  4E7H A;  1H3Z A;  3PIP A;  5FLX E;  3G71 T;  2BKD N;  1S72 A;  4YTL A;  1Q7Y C;  3CCV T;  3PNW C;  3OYL A;  2G3R A;  1X6O A;  1Q7Y U;  2X4X A;  3CCV A;  3S3M A;  1N8R C;  2M0O A;  1SSF A;  3P8D A;  2RJC A;  1NJI U;  4QQG A;  4QVZ A;  2RHU A;  3NTK A;  3OYJ A;  3MP6 A;  2EFI A;  3BDL A;  3M9Q A;  1UEB A;  1VQ5 T;  2E5Q A;  3CCR A;  1YHQ A;  3I56 A;  3OYM A;  4E7K A;  1M1G A;  5D6Y A;  2QEX A;  1VQ9 T;  2XDP A;  3OQ5 A;  5LL6 S;  4TVR A;  3CC2 T;  2RI2 A;  4C5G A;  3PMI A;  1YIT A;  1VQK A;  1EIF A;  3MEA A;  3OYE A;  4BDY A;  3DB4 A;  3I55 T;  3CCL A;  4X34 A;  4PLL A;  1K8A C;  3OMG A;  1VQP A;  3MEW A;  2RI3 A;  1W2B A;  4QQD A;  1VQM T;  3MET A;  2WAC A;  3C4S A;  3CC4 A;  4CRI A;  3G6E T;  2E6N A;  3CCS A;  2PQW A;  2D9T A;  2HQX A;  5IT9 E;  2DO3 A;  3EAE A;  3CCE T;  1WJQ A;  4A4E A;  3CXC A;  3NTH A;  5J26 A;  1IZ6 A;  1KHI A;  1YIJ A;  3UWN A; 
#chains in the Genus database with same CATH topology
 1PRL C;  2DL3 A;  4FSS A;  4PL6 A;  4M75 B;  3H6Z A;  1KD1 R;  3A8G B;  4XK8 E;  5LJ5 e;  3CCU T;  4IUV A;  2M9U A;  2X51 A;  1X27 A;  1Y57 A;  2O9S A;  3G4S Q;  1N6A A;  2LX9 A;  2SRC A;  2WSF E;  1YJN T;  1N27 A;  4V2S A;  2O9V A;  1JO8 A;  3CBO A;  4L5G A;  2JMC A;  4RTT A;  1VQ4 A;  4KUL A;  4II1 A;  2KBT A;  4IIO A;  1VQ5 Q;  2YSQ A;  1U06 A;  2RK2 A;  2R58 A;  4GBQ A;  3OYN A;  1ZHI A;  5CKE A;  4BE1 A;  4R0K A;  1UHC A;  3V7C A;  4MDX A;  4X9C A;  3R6N A;  5ECA A;  4OB3 B;  2JUF A;  1S1N A;  3FB9 A;  1TOV A;  2KYM A;  5C0M A;  1MV3 A;  3NFC A;  2DTO A;  3ME9 A;  1D0Z A;  1VQK T;  1OX8 A;  4FYX B;  3I9Q A;  4PJO D;  2JZ2 A;  2A37 A;  3RDV A;  2KAF A;  3M54 A;  1WXU A;  4E7L A;  2VV5 A;  4XTZ A;  1SRL A;  3CPW P;  3JB9 G;  1YCY A;  1M90 C;  2EYZ A;  1ZSZ C;  1Y71 A;  1WLP B;  1ZUK A;  4J83 A;  2R5A A;  3G6E A;  1NEB A;  1T3L A;  3CBP A;  2LCC A;  1O9S A;  1AVZ C;  2K4Y A;  5DLQ E;  2KT8 A;  3NHN A;  5KYX B;  4FYY B;  2KXD A;  4J9F A;  2D8H A;  4HCC A;  1VQP T;  1OZ3 A;  2L3R A;  4HT8 A;  2EQJ A;  5GAM h;  3CCJ T;  3EHQ A;  2EJF A;  2QQA A;  3CCQ A;  4JS5 A;  1UGS B;  1TU0 B;  2D0Q B;  4C8Q D;  2XDB A;  2K57 A;  4A53 A;  1NLO C;  2GTO A;  1VQN A;  4J6W A;  2YUQ A;  4M77 D;  4QVC A;  1C1A A;  3VS4 A;  1X2K A;  4C0G A;  1K73 U;  2EIF A;  2JS2 A;  2HAX A;  3TCJ A;  2C06 A;  3V7R A;  1IGQ A;  2DRK A;  1QP3 A;  1ZLM A;  2DL8 A;  2M16 A;  2XD0 A;  1MHN A;  1VIF A;  4EMK B;  2MWO A;  1GRI A;  1MND A;  3EG9 B;  2RF0 A;  4J9E A;  2BE7 D;  3V8L A;  3QHS A;  3GLX A;  2X3W D;  4HT9 A;  2X35 A;  2JMA A;  1MUZ A;  4JRP A;  1M1K R;  1KD1 C;  2P4T A;  4Y91 A;  2V8J A;  1PHT A;  3OYD A;  4M77 G;  3M57 A;  2F5K A;  3QDR B;  4KGZ B;  4BI3 A;  2ATC B;  2DL5 A;  1JRI A;  2VAS A;  3PVQ A;  1E7O A;  4B6M A;  2J6K A;  3FC3 A;  5IHI A;  3LW5 E;  2ZPB B;  3I56 T;  4N4H A;  4FYV B;  1C6V X;  4GLK A;  4JS4 A;  1S72 T;  4K11 A;  4HCK A;  5GAO p;  3INZ A;  4RTX A;  4LDX A;  2R5M A;  1H92 A;  1Q7Y R;  2RPN A;  1KQS P;  4EMH A;  4XU2 A;  2GQI A;  1SHF A;  2RJD A;  3QYH B;  2QEX Q;  3EG1 A;  3QJ6 A;  5GAN 3;  4X9D A;  2LC4 A;  2FZK B;  3OBW A;  5GAO q;  1K1Z A;  3CC4 Q;  2DD4 A;  1WHM A;  1ZSG A;  3JAM E;  1OPK A;  2FPE A;  2ZAE A;  2E3I A;  2NWM A;  4DBQ A;  1KC8 C;  4PJM A;  3CXC S;  2EGC A;  2EBP A;  1VQ8 T;  2K79 A;  2ZPF B;  2CSI A;  2PVD B;  3TRE A;  5EG2 A;  5IXB A;  2NUT B;  5AT1 B;  4DQ2 A;  2X4Y A;  3JCM W;  2LZ6 B;  2YUP A;  1T0H A;  4J9C A;  4C8Q A;  5J3B A;  1OX9 A;  4A54 A;  4A4K A;  3OW2 A;  3VV0 A;  3MP8 A;  4Y28 E;  2DVJ A;  5CCA A;  1JQQ A;  1ZSZ A;  1Q81 C;  2DMO A;  3VUB A;  4QKU A;  2MAM A;  2O31 A;  1YJN A;  4E7Z A;  2E70 A;  2QAZ A;  2L89 A;  4ATO A;  4HVU A;  1K9M R;  2A28 A;  2COW A;  3SHW A;  4C5H A;  2I2L A;  3QBY A;  1D3B A;  5KYW A;  5GAM e;  1N9R A;  2AT1 B;  2QK0 A;  4IKF A;  5GAO n;  1R77 A;  3CBM A;  3CCU Q;  1BK2 A;  3A5Z B;  4C8Q E;  5IHK A;  2DK3 A;  3F70 A;  2R57 A;  4F14 A;  4KGX B;  1YJN Q;  3JCM J;  2K2M A;  2DA9 A;  2A08 A;  3CCE A;  2HNI A;  5LJ5 h;  2CH4 W;  1LPL A;  4OMF B;  1FXX A;  4D8K A;  4M7A F;  3RKY A;  1QVP A;  1W6X A;  2YWW A;  2CDT A;  3JB9 I;  1N8R U;  2J06 A;  2XKO C;  2AZV A;  3J7A F;  3RBB B;  1IRX A;  2GQV A;  3OB9 A;  4D8D A;  4M78 B;  2EW3 A;  1V1C A;  1I07 A;  5GMK e;  2JXB A;  3RMS A;  4BAC A;  1UE9 A;  1ZBJ A;  3OYY A;  4OB2 B;  5IAY A;  2RHX A;  2J6O A;  2YT6 A;  4LE9 A;  3DLL A;  2CP5 A;  2MIO A;  2KRS A;  3PFS A;  4PJO E;  4IUR A;  1G8X A;  3H8Z A;  3CC2 Q;  2G6F X;  1IRE B;  1SKU B;  2K5L A;  1GFC A;  2YDL A;  1Y7X A;  5HK0 A;  1H3Z A;  2LX7 A;  5FLX E;  1ZX6 A;  3G71 T;  4AFZ C;  2BTT A;  4AFQ C;  5GAO m;  1LJO A;  4LDV A;  2MCN A;  1AWO A;  2BKD N;  2CP7 A;  2E4H A;  3QG1 A;  2KGT A;  4JZ4 A;  1K0S A;  1Q7Y C;  1YN8 A;  2L3Q A;  3EH1 A;  3MPU B;  3CCJ Q;  5LJ3 e;  1WHJ A;  3S3M A;  1PD0 A;  2XID A;  1SSF A;  2L3S A;  1BI1 A;  3UPU A;  2RHU A;  1BI0 A;  1IHV A;  3HFO A;  4C92 E;  2EFI A;  4JDS A;  4M7D A;  3BDL A;  3M9Q A;  3CCR A;  3PT9 A;  3EGD B;  3HL8 A;  3M53 A;  2D6F A;  3UA6 A;  4D6W A;  2KK4 A;  1R8O B;  1VQO Q;  3CCV Q;  3RES A;  3H0H A;  3VS3 A;  2VXE A;  2JJ9 A;  2EJ9 A;  3EG0 A;  1VQN Q;  2JW4 A;  3AHU A;  1YCS B;  4OP0 A;  5FU7 C;  3CCL A;  1GCP A;  4X34 A;  3C95 A;  1UHF A;  4FSX A;  5A0D A;  2DER A;  2PUK B;  1RAA B;  2M0Y A;  1W2B A;  4XAX B;  2E1H A;  2DLP A;  4PFP A;  2WAC A;  4C8Q C;  3ULR B;  3CC4 A;  3VS0 A;  2QG9 B;  1BU1 A;  2FG0 A;  3CCS A;  4AG1 C;  2KYB A;  2DBM A;  3CCE T;  5J26 A;  1TUC A;  3VS7 A;  3E9G A;  2YLB A;  2AKK A;  3EG2 A;  1K9M C;  1U3O A;  4FIB A;  4ZN1 A;  4AMC A;  4CI0 C;  1X6G A;  1RUW A;  1K9M U;  4ELZ C;  2VXF A;  2O2O A;  2KY9 A;  4C8Q G;  4XU3 A;  2HSP A;  2K5I A;  2K7A A;  1ABQ A;  1Y0M A;  3GIB A;  1KIK A;  2BIV A;  3QO3 A;  1W4S A;  5GAN 7;  3M5A A;  3RR6 A;  2W0Z A;  4ZTJ A;  2E65 A;  4M7A E;  1M2V A;  2HBW A;  2FHD A;  4E47 A;  3LYI A;  1VQP Q;  2ZPG B;  2OAU A;  3CPF A;  3X26 B;  2ED0 A;  2HZY A;  2XK0 A;  2EJG A;  5HK3 A;  4LNP A;  5GMK h;  2DJQ A;  5KYU A;  5KYY A;  3L2V A;  4RTU A;  3HP9 A;  1YFN A;  2H8H A;  2VGM A;  4O5V A;  4C0D B;  2E12 A;  3OYC A;  2KMT A;  1HXD A;  1PKS A;  1E6G A;  4A63 B;  4C0Z A;  1AZG B;  4ELY C;  1MNE A;  1OPL A;  2AIR B;  4M78 F;  4BUG A;  4E6R A;  3TEE A;  1N9S A;  4IUP A;  2F2W A;  2GNC A;  1YP5 A;  1JXO A;  1ZA1 B;  2GFU A;  2QGF B;  3MO8 A;  4C5E A;  4M75 A;  1H3H A;  1QQJ A;  4PLI A;  2OTL A;  2V8I A;  2CUB A;  1RL2 A;  4J6X A;  5KYW B;  5LJ5 j;  3URG A;  1YIJ T;  4KH0 B;  1G2B A;  2JM8 A;  2K3Y A;  1QCF A;  1M4Z A;  5L8R E;  1M1K U;  2FVU A;  3ASK A;  3A98 A;  1YJW A;  3JRZ A;  4GY5 A;  3VS2 A;  2LP5 A;  4M7A A;  4M75 D;  4LXC A;  4DA4 A;  1B34 B;  3OMC A;  1NZ9 A;  1M3C A;  2RD1 A;  2VGN A;  4JUV A;  1O75 A;  3M4G A;  2ZGW A;  1T3S A;  4J9G A;  4M7D C;  4M7A D;  1OYX A;  2LQN A;  4N4G A;  3OYK A;  3QXE B;  1KC8 R;  3T9N A;  2E10 A;  3MEV A;  3M0P A;  2FEI A;  4OF1 A;  5IHN A;  2HL3 A;  3NPF A;  5LJ5 f;  3EGX A;  1PG5 B;  1VQK Q;  2K9G A;  2DX1 A;  3RER A;  3I5S A;  4PFO A;  3G1J A;  4M77 F;  5CQX A;  1PKT A;  1AOJ A;  1KQ1 A;  2CKK A;  1JJ2 A;  3JB9 F;  8AT1 B;  2KRO A;  1ARK A;  1YJ9 Q;  3HHT B;  5KH6 A;  4J9B A;  4BD3 A;  1VQL Q;  3G71 A;  5GAM j;  1RI0 A;  1YHQ T;  3X20 B;  2EQK A;  3GF5 A;  1YNZ A;  5KE3 A;  5CQY A;  4EMK A;  4KBM B;  4JLI A;  4C0F A;  2X3X D;  4XTY A;  5HY6 A;  2L5Q A;  3OW2 S;  3OYG A;  2DTH A;  3QSU A;  3RUX A;  2PVG B;  2RQW A;  3X25 B;  5KE2 A;  1WDX A;  3VS5 A;  3L2R A;  4C92 B;  4LDW A;  3BDU A;  1ZUY A;  1M90 U;  2EKH A;  3THK A;  2XDD A;  4NL2 A;  4CC4 B;  2DIG A;  4L59 A;  2C0O A;  2MMP A;  3JCM f;  1PSE A;  3D7S B;  1M5Q 1;  2RQU A;  4JJB A;  4PJN A;  3I55 Q;  4BI4 A;  5C6S A;  3CCU A;  1DJ7 B;  3HPW A;  3CME T;  2K3X A;  2CT3 A;  1UDL A;  4Z89 A;  1HYO A;  9ATC B;  5KYX A;  3HRU A;  4RUG A;  3FJ5 A;  1VQN T;  3H0F A;  4ZGE B;  3CC7 A;  1UJ0 A;  2QQB A;  2DYI A;  3M4Y A;  1PRM C;  2LQ8 A;  4PJO A;  3CCM T;  5J39 A;  4ZN3 A;  2WSC E;  1YJW T;  3X24 B;  2LCS A;  4NS5 A;  1MMA A;  4LD6 A;  3NMZ C;  1BYM A;  2VB6 A;  4BY6 B;  4FM4 B;  2HBP A;  1KHC A;  2XIC A;  2I0N A;  1FWZ A;  1QW1 A;  3VYG A;  2W10 A;  4QVD A;  1QVF S;  4C8Q B;  2O88 A;  5GMK i;  1VQ4 T;  2BZX A;  2QAS A;  1BIB A;  4IUQ A;  1QMC A;  3PIO A;  2DRM A;  3QWX X;  1JJ2 P;  3OS2 A;  3CMA A;  2CT4 A;  4L6V 5;  1VQ9 Q;  1BI3 A;  2A3L A;  4M75 G;  1MGQ A;  2XHC A;  1QVG S;  2P4R A;  2VYT A;  4M7A C;  4FU6 A;  1S72 Q;  4OGC A;  3H41 A;  3OYH A;  1RAH B;  1LOJ A;  2O4X B;  5GMK m;  3VJP A;  3JCM g;  3VS1 A;  1QKX A;  1K9A A;  1BKB A;  3OBY A;  2LNH B;  3AT1 B;  2P0K A;  3RNJ A;  4J6Y A;  1D3B B;  1I5O B;  3M0R A;  4F16 A;  2COZ A;  5I22 A;  1VQM A;  5GAM g;  3BE3 A;  5CR2 A;  2FPF A;  2NUP A;  2DE0 X;  3L2U A;  2AKL A;  1TXQ A;  4FT2 A;  3CD6 A;  2MOX A;  2HCK A;  2LJ0 A;  2EQM A;  1QWE A;  2BUD A;  3LH5 A;  4ZNX A;  4JJD A;  2PZ1 A;  1OUL A;  4PFZ A;  1WGS A;  2CZ1 B;  3IQL A;  3KUF A;  1V76 A;  4RG8 A;  3HSB A;  2MI6 A;  1OV3 A;  2ESW A;  3A1P A;  2A7Y A;  1K4U S;  3L2Z A;  3SD4 A;  2AZS A;  2O01 E;  2NYS A;  4EPC A;  1VQ6 Q;  1WPY A;  1MMN A;  3FLG A;  4J9H A;  1KJW A;  3CCM Q;  5GAM d;  5LJ3 h;  2CGH A;  3LX7 A;  5I2M A;  4LDY A;  2FZC B;  3OSV A;  1Y96 A;  4NOY A;  3C0C A;  4M7D E;  1S72 A;  5EC7 A;  1X2Q A;  3TU4 K;  3CCV T;  3OYL A;  1X6O A;  4Z88 A;  2X4X A;  1N5Z A;  2FRW A;  2CRE A;  3EH2 A;  1PCX A;  2M0O A;  2CP2 A;  1NJI U;  1H8K A;  4JZ3 A;  1LNX A;  4QVZ A;  4PNO A;  2DIL A;  2OJ2 A;  3MP6 A;  3NGP A;  3I35 A;  2J7I A;  2YRD A;  1M2V B;  3I56 A;  3EG9 A;  3CXC P;  1M1G A;  2F2X A;  1QVG P;  1M3B A;  1GCQ C;  2RI2 A;  3BY7 A;  3PMI A;  3QWY A;  1VIE A;  2AK5 A;  2KXC A;  3CCE Q;  2DTI A;  2RA2 A;  3QZ9 B;  3OYE A;  4BDY A;  1RAI B;  1XOV A;  1F1B B;  5GAO l;  2CP6 A;  4JRK A;  5IXF A;  2RI3 A;  4LDU A;  1X69 A;  4F04 B;  1VQM T;  3VU3 C;  2IVW A;  3C4S A;  2CP3 A;  3I56 Q;  2IPO B;  1BB9 A;  2HQX A;  5CKH A;  3LWI A;  5GAN j;  4MMK A;  3NTH A;  1IZ6 A;  1MV0 B;  1KHI A;  2XI9 A;  1YIJ A;  2JOY A;  1X6B A;  3JCM X;  1U8R A;  1UGV A;  2LJ1 A;  2PTK A;  2FPD A;  2QA4 A;  1D1C A;  2LRQ A;  1I0C A;  1UB4 A;  2MF2 A;  4C92 D;  4VUB A;  2RI5 A;  1VYV A;  4C92 G;  1M1F A;  4RTW A;  2ROL A;  1NJI C;  2LVM A;  2HMA A;  1YWP A;  3RIR A;  3S3O A;  2VUB A;  5I21 A;  1FMW A;  3HRS A;  2EQU A;  1G5V A;  1VQ8 A;  4F7U A;  3R6O A;  3EGD A;  1AHJ B;  2H3E B;  1I5L A;  2VVK A;  3C94 A;  1VQ8 Q;  2JTE A;  5CO7 A;  2X9H A;  1NPP A;  3TSZ A;  1V29 B;  5CIU A;  3VUZ A;  4IIM A;  2NUT A;  3SFM A;  1ZQ1 A;  4M4Z A;  3M59 A;  2RHI A;  3SWN B;  4AG2 C;  1WQ7 A;  2QA4 Q;  4EDU A;  4E7I A;  3EGX B;  4LD9 K;  3KFV A;  4DBF A;  2DM1 A;  2LJ3 A;  1G3T A;  1U1T A;  3VS6 A;  4RMO A;  4ZGD B;  4QQ6 A;  1RLQ C;  2FO0 A;  1QWF A;  4M7A B;  3CD6 Q;  1JJ2 S;  5FRN A;  4F7U G;  2OI3 A;  1VQ9 A;  4DOW A;  2DEQ A;  1QP2 A;  4A4G A;  2D8J A;  1HSQ A;  4RG2 A;  1TUG B;  1NEG A;  3MHX A;  2DF6 A;  2ZCF B;  1RAG B;  3E19 A;  4DBR A;  1SHG A;  3CCS T;  3JCM Q;  2DET A;  4JLG A;  2JM9 A;  3CEY A;  4XTV A;  3JCM e;  4BB7 A;  4M7A G;  3TSW A;  3WXM B;  5GMK j;  3GBQ A;  3ZEH A;  5CK9 A;  2JT4 A;  2JTF A;  2P0Q A;  2Y90 A;  1WA7 A;  1VOM A;  4UC4 A;  4C5I A;  1YBY A;  3CPW A;  3OA6 A;  1YHQ Q;  3H9N A;  2GF7 A;  4Q5W A;  4BE0 A;  4RCC A;  4QW2 A;  3LGF A;  3PE0 A;  1YI2 Q;  5HCK A;  4HCZ A;  1OU8 A;  4M7D F;  4A4H A;  5GAO r;  2X4J A;  2DYB A;  2DAQ A;  3CCM A;  4BY6 C;  4OMQ A;  3CCL Q;  2KE9 A;  4JRI A;  3P8B B;  1UG1 A;  4ZGJ B;  4OB1 B;  1UTI A;  2HQE A;  2F69 A;  3ZL7 C;  2LT1 A;  2RQR A;  2K6D A;  2CSQ A;  4R56 A;  1YIJ Q;  2K5F A;  1WHG A;  1VQ6 T;  1Q86 C;  3G6E Q;  3CMA Q;  3FDR A;  3OW2 P;  3CC2 A;  5FW9 A;  2BE9 B;  1IXD A;  2D1X A;  5M9O A;  1RAE B;  1ACM B;  2KVQ G;  3JB9 H;  3MCA B;  5I11 A;  1R0C B;  4Z8A A;  3I5R A;  2QQS A;  1N8R R;  3X28 B;  1WXT A;  1M1K C;  3MKD A;  2V8K A;  5FRO A;  5GAN 4;  1AZE A;  2DD5 A;  1FX7 A;  2O4X A;  3VYH B;  2OTJ T;  2XU8 A;  1OI1 A;  2Y4X A;  1T0J A;  4ANJ A;  3EFS A;  3HKS A;  3M58 A;  1FMV A;  1TTH B;  1WYX A;  4O6J A;  4DOV A;  1QVG A;  1TH7 A;  4J7I A;  1VYU A;  1VQ4 Q;  4HVV A;  2DZC A;  4OMM A;  1W2B S;  3EFO B;  1G3Y A;  1YJ9 T;  1TS9 A;  3JV3 A;  2EPD A;  1D09 B;  2CH4 A;  2JS0 A;  4ZTF A;  2GGR A;  3E9F A;  3L2Q A;  4LN2 A;  2HD0 A;  4XU1 A;  3Q1J A;  3A8M B;  1VQO A;  4Z02 A;  4N4I A;  1SEM A;  1K8A R;  2DL7 A;  3OYB A;  1D0Y A;  2E3H A;  2EQI A;  3DKM A;  1SRM A;  1I1J A;  1NE8 A;  3BW1 A;  2RHZ A;  1B7T A;  2P0P A;  3JSC A;  4FCY A;  2PVO B;  1IO6 A;  3PMT A;  3JCM d;  5CKB A;  1B3Q A;  1OU9 A;  2VC8 A;  4BE2 A;  4B9X A;  4Y92 A;  3OYI A;  1OQK A;  3HTR A;  3WVE B;  3ZBD A;  3CCR T;  2EWN A;  4WF2 A;  2LTO A;  5CKD A;  3CMA T;  3UF4 A;  3CQT A;  1AWJ A;  3MP1 A;  3DLM A;  4EIK A;  2EKO A;  1NG2 A;  3M0U A;  4KUI A;  4CC7 A;  2SEM A;  2RH2 A;  1UEC A;  3J80 E;  5IN1 A;  1VQ5 A;  2RJE A;  4WCI A;  1A0N B;  1K73 R;  1OZ2 A;  1Q82 R;  1M30 A;  4LUD A;  2WSE E;  3OYF A;  2YLC A;  2H3J A;  2NUZ A;  1SSH A;  1JU5 C;  1CKA A;  4HCB A;  1EX4 A;  1CKB A;  2KSS A;  1OEB A;  2QI2 A;  1YJ9 A;  2DBK A;  3VRZ A;  3OY9 A;  1M8M A;  1QCN A;  5HKC A;  1M27 C;  1Q82 U;  1W1F A;  1ZA2 B;  3M0S A;  3LGL A;  4F7U B;  1UGR B;  1I4K 1;  1RAB B;  3REB B;  1GXI E;  4M7D D;  1RAC B;  1AT1 B;  3J81 E;  3LLR A;  1EZZ B;  3GOX A;  3CC7 Q;  1PC0 A;  3CPW S;  2EGE A;  2L3P A;  1K8A U;  2QQ9 A;  5LJ3 j;  2V26 A;  1PSF A;  1M3A A;  3CME Q;  2XG8 D;  4PKC C;  5KYU B;  5KYY B;  3PNW C;  1CSK A;  5FU6 C;  2G3R A;  3PGG A;  1YWO A;  1Q95 G;  4MZM A;  2EYY A;  1Q7Y U;  4JPB W;  3SDZ A;  2M02 A;  5GAN 6;  4C92 C;  2DFU A;  1IB8 A;  1N8R C;  1NM7 A;  3P8D A;  1YJW Q;  2RJC A;  5CAI A;  4QQG A;  4KRT A;  3PTA A;  5AYF A;  1UEB A;  1VQ5 T;  4MZP A;  2DPP B;  1YHQ A;  3KXT A;  1VQM Q;  1UFF A;  3OYM A;  4F7U F;  2B86 A;  4E7K A;  1VQ9 T;  2DKG A;  3OQ5 A;  5LL6 S;  2KEA A;  2PUO B;  2EVR A;  2HEQ A;  4C5G A;  5GAN 8;  3OSS C;  4RCB A;  3JCM b;  1YIT A;  2GBQ A;  4CC2 A;  1PD1 A;  2FYK A;  1EIF A;  1NJI R;  3V7S A;  4ME7 A;  1WIE A;  2F2V A;  2RNA A;  1B34 A;  2HDA A;  1BBZ A;  1G3W A;  1K8A C;  1HD3 A;  1VQP A;  3UAT A;  4M75 E;  8ATC B;  2ROT A;  4PJO C;  1RAD B;  4OMN A;  4XTU A;  4M78 G;  1X01 A;  4M77 C;  2E6N A;  3EHR A;  1C0M A;  3N5B B;  6AT1 B;  2PQW A;  4RKU E;  1BI2 A;  2F1L A;  2DO3 A;  3EAE A;  4PJO F;  1WJQ A;  5D7U A;  3CXC A;  3U23 A;  2HL5 C;  2B8A A;  1AD5 A;  2KI7 A;  1U5S A;  1GBR A;  5L23 A;  4WTO B;  1TWB A;  4AFU C;  1VYT A;  1VQL A;  2NUP B;  3CC7 T;  2LMJ A;  3QII A;  4LUE A;  1D1B A;  4E7J A;  3A8L B;  2ENM A;  2QTV A;  1WI7 A;  1M2O A;  2V1R A;  5CVI A;  3JCM P;  1QVF P;  3C12 A;  5IH2 A;  2MYS A;  4JJC A;  5DY9 A;  1UGP B;  1WJR A;  1KK7 A;  5A2Q E;  4IUT A;  1TSF A;  2CP0 A;  2YUO A;  3M56 A;  1D1A A;  2JN0 A;  5LJ3 f;  1JEG A;  2C0I A;  2EYW A;  3UDC A;  1BIA A;  2QQR A;  4PJL A;  1G83 A;  1NLP C;  3RKW A;  5LJ5 d;  1ZBX A;  2EGA A;  7AT1 B;  1XTD A;  2EYX A;  3OYA A;  2YRC A;  3CCS Q;  1VA7 A;  4FL6 A;  4F7U E;  2QEX T;  4M78 C;  3M0Q A;  4J8O A;  1BCO A;  2OTL Q;  2BZ8 A;  2RJF A;  3OS0 A;  1AWX A;  2KQW A;  1VQ6 A;  1Z9Q A;  2ZZD A;  3GPL A;  2OTJ A;  2ECZ A;  1QVF A;  2RO0 A;  1JXM A;  2DIQ A;  1RLP C;  4C0D C;  1U1S A;  1EFN A;  1WX6 A;  1VQ7 A;  3CC4 T;  2KT1 A;  2RHY A;  3G4S A;  2GTJ A;  1Q86 R;  4C92 F;  1NBE B;  4A4F A;  1E6H A;  2KDS A;  4HXJ A;  4OVA A;  4BI8 B;  5DM7 R;  1GFD A;  1IGU A;  2HKN A;  1NYG A;  1JBM A;  3H0I A;  5CKF A;  1WHK A;  1HK9 A;  3VRY A;  3I55 A;  3M55 A;  4ORZ A;  1YI2 T;  3CCR Q;  4C92 A;  2F5T X;  3FJP A;  5GAN h;  1B07 A;  1TUD A;  2DNU A;  1AEY A;  3L42 A;  2FRY A;  1ABO A;  1X43 A;  2L0A A;  1XJW B;  4AT1 B;  5FRM A;  4F17 A;  1GCQ A;  1PWT A;  1KG1 A;  4B9W A;  2E41 A;  3LH0 A;  5FU7 B;  4XTW A;  1TG0 A;  5GAM f;  5FWB A;  1VUB A;  1Q81 U;  1QKW A;  3JCM V;  2LT4 A;  3QYG B;  2KRN A;  2LQW A;  1M90 R;  4QT7 A;  2RQT A;  1KC8 U;  4J9I A;  3KBG A;  2VWF A;  5GMK l;  2JVV A;  4IUU A;  4M78 D;  3EG3 A;  1W70 A;  2DJZ A;  3L1A A;  2EYQ A;  5KYN A;  2CZ6 B;  4M77 A;  3DB3 A;  1VQ7 Q;  1IHW A;  3RKX A;  5LJ5 g;  2QDY B;  2ABL A;  4RTV A;  2DXB A;  3JB9 D;  4CC3 A;  3HFN A;  2QGG A;  4N0A C;  1WHH A;  3G4S T;  2QXF A;  1OOT A;  2OTJ Q;  1SF9 A;  2GFA A;  2LDM A;  2M1H A;  3G7Z A;  3SWN C;  2RB6 A;  4RTY A;  1KFZ A;  2HQH A;  1K73 C;  2P84 A;  3GNF B;  3CCQ T;  1I8F A;  2FB7 A;  2QA4 T;  4EMG A;  4M75 F;  2LCL A;  3FEO A;  3OS1 A;  1WZO A;  2ZPE B;  5LJ3 g;  1RAF B;  3CD6 T;  1K0X A;  4M78 E;  2COY A;  2K3B A;  5GAN d;  3QKJ A;  4RTZ A;  3QDF A;  2X4W A;  4PJJ A;  3BFM A;  2HSE B;  1AWW A;  1M9S A;  1Y96 B;  2FZG B;  2RMO A;  3NTI A;  4P5N A;  1Z9Z A;  2L8D A;  3CME A;  2QTX A;  4OMO A;  2OX7 A;  4DEY A;  2GCX A;  2DEU A;  2M51 A;  3RMQ A;  1RI9 A;  1NPR A;  1JB0 E;  1YI2 A;  2CS7 A;  2PU9 B;  4DBH A;  1X75 C;  3GNG A;  2DL4 A;  2LNV A;  3O8V A;  3S6W A;  4DEX A;  4M78 A;  3CCJ A;  2ZPH B;  5KCH A;  4OML A;  5FWC A;  4OMP A;  3E1S A;  1MMD A;  1FYN A;  1GBQ A;  4X1V A;  4OB0 B;  2Y4Y A;  3P8H A;  2E64 A;  3VKI A;  2DVE A;  5GAN e;  3ZFJ A;  1WFW A;  2LQK A;  3JCM h;  1Q82 C;  3EGU A;  4XQ3 A;  1WXB A;  4J7F A;  1KD1 U;  1YIT T;  1VQO T;  4MML A;  2MK5 A;  4PJO B;  1LVK A;  3S3N A;  3E2U A;  3WVD B;  3EFO A;  2EAY A;  2BZY A;  4M77 E;  2Z0W A;  5A0L A;  1XNI A;  3PVL A;  4HVW A;  2VKN A;  1Q86 U;  5DLO A;  3TVT A;  2RM4 A;  4FT4 A;  1QCO A;  4PJO G;  2KR3 A;  1KQS S;  3LWH A;  2DXT A;  3CCL T;  1LCK A;  1PNJ A;  4E7S A;  3HRT A;  1KQ2 A;  3CCQ Q;  4KGV B;  1K76 A;  3L2W A;  1D0X A;  3SB2 A;  5D6W A;  1R0B G;  2OAW A;  4NL3 A;  2DXU A;  1KQS A;  1NYF A;  5KCO A;  4XTX A;  4MZT A;  2XMF A;  2DZ9 A;  4MDW A;  2RK1 A;  4BDZ A;  1WJS A;  1XQH A;  2CZ0 B;  3MEU A;  5GJW B;  2J6F A;  3ER0 A;  4E2F B;  1UJY A;  2E6Z A;  1H64 1;  2OTL T;  4FW1 A;  4GLM A;  1Q81 R;  3TQ7 P;  1KSW A;  3MJX A;  1ZSZ B;  3QPH A;  2C0T A;  2MWP A;  2JNG A;  4M75 C;  4J5Y A;  2K2V A;  2YRV A;  1WQW A;  2YUN A;  3UT1 A;  5D6X A;  5FU6 B;  1VQL T;  3V8K A;  4KT0 E;  2NLU A;  1UUE A;  3REA B;  4M7D B;  2KRM A;  2YHT A;  4M77 B;  3JCM c;  2IG0 A;  4E7H A;  1G3S A;  1SPK A;  5I2S A;  3PIP A;  4N0A A;  3A8O B;  2E5K A;  1QLY A;  2CYZ B;  2A0F B;  4ESR A;  4YTL A;  5GAN g;  3M0T A;  4J9D A;  2J05 A;  4KH1 B;  3SWN A;  2JTM A;  2KNB B;  2YXY A;  1YIT Q;  4FYW B;  5LJ3 d;  4HA8 A;  2V1Q A;  2FL7 A;  1Y07 A;  4XU0 A;  3CCV A;  1W2B P;  4C8Q F;  1WNL A;  3GP8 A;  1MMG A;  3V8J A;  1ZUU A;  4M7D G;  1GL5 A;  4JRQ A;  3NTK A;  3QZ5 B;  4OGE A;  3OYJ A;  3OS5 A;  4KUD K;  2E5Q A;  3SEM A;  2RQV A;  1HJD A;  5D6Y A;  2QEX A;  2HKQ B;  3FIF A;  2XDP A;  4TVR A;  2CZ7 B;  3CC2 T;  2L2P A;  5GAN 5;  1I81 A;  5GJV B;  4R55 A;  1M8V A;  1BCM A;  3FRN A;  2DXC A;  3QUI A;  5A0G A;  1FMK A;  1VQK A;  1UGQ B;  2MPX C;  1P92 A;  3MEA A;  4HKE A;  3DB4 A;  3I55 T;  4FW2 A;  3G71 Q;  4PLL A;  2AHJ B;  2PNI A;  5GAN f;  3A8H B;  3QJY A;  2D0N A;  3OMG A;  3MEW A;  1WHL A;  3O5Z A;  2RN8 A;  3JB9 J;  4QQD A;  2ED1 A;  2QDL A;  3MET A;  4PK4 A;  1J3T A;  1SG5 A;  4JJN K;  4CRI A;  3EFR A;  1PM3 A;  2CUD A;  3G6E T;  2A36 A;  2D9T A;  5GAN 2;  5IT9 E;  4A4E A;  2QYZ A;  3UA7 A;  2ZPI B;  4EMK C;  1VQ7 T;  2IIM A;  4AFS C;  3UWN A; 
#chains in the Genus database with same CATH homology
 3E9G A;  2JOY A;  2B8A A;  2YLB A;  3JCM X;  1U8R A;  4PL6 A;  4M75 B;  3H6Z A;  2QA4 A;  3A8G B;  4XK8 E;  2LRQ A;  1UB4 A;  2MF2 A;  5LJ5 e;  1K9M C;  4C92 D;  3CCU T;  4IUV A;  2M9U A;  4FIB A;  4VUB A;  2RI5 A;  4ZN1 A;  4C92 G;  4CI0 C;  1M1F A;  1N6A A;  1K9M U;  4ELZ C;  1VQL A;  2LX9 A;  2VXF A;  3CC7 T;  2WSF E;  1YJN T;  1NJI C;  3QII A;  2KY9 A;  4E7J A;  3A8L B;  4C8Q G;  1N27 A;  2LVM A;  4V2S A;  4XU3 A;  3RIR A;  3CBO A;  3S3O A;  2K5I A;  2VUB A;  4L5G A;  5CVI A;  5I21 A;  3JCM P;  1VQ4 A;  3C12 A;  3HRS A;  3GIB A;  2EQU A;  2BIV A;  3QO3 A;  1G5V A;  1VQ8 A;  4KUL A;  4II1 A;  1W4S A;  3R6O A;  5DY9 A;  3M5A A;  4F7U A;  1UGP B;  5GAN 7;  1AHJ B;  1WJR A;  5A2Q E;  4ZTJ A;  4IUT A;  1I5L A;  2E65 A;  4M7A E;  3M56 A;  2JN0 A;  2R58 A;  2RK2 A;  3C94 A;  5LJ3 f;  5CO7 A;  3OYN A;  2FHD A;  1NPP A;  1ZHI A;  5CKE A;  3LYI A;  4E47 A;  4BE1 A;  2ZPG B;  3V7C A;  2OAU A;  1V29 B;  4X9C A;  3UDC A;  3CPF A;  3X26 B;  4MDX A;  1BIA A;  2QQR A;  4OB3 B;  2JUF A;  2XK0 A;  3FB9 A;  3RKW A;  4EMK C;  5LJ5 d;  2EJG A;  5CIU A;  3VUZ A;  5C0M A;  5HK3 A;  3NFC A;  3SFM A;  2DTO A;  3ME9 A;  1ZBX A;  1ZQ1 A;  5GMK h;  3M59 A;  1XTD A;  2RHI A;  3OYA A;  1VQK T;  3SWN B;  4FL6 A;  3L2V A;  3HP9 A;  4F7U E;  2JZ2 A;  2VGM A;  1WQ7 A;  4O5V A;  2QEX T;  4EDU A;  4C0D B;  4E7I A;  4M78 C;  2E12 A;  4J8O A;  2KAF A;  3M54 A;  3OYC A;  4E7L A;  2KMT A;  4LD9 K;  2VV5 A;  2RJF A;  4XTZ A;  1HXD A;  3OS0 A;  3JB9 G;  1YCY A;  1G3T A;  1U1T A;  2KQW A;  1M90 C;  1VQ6 A;  4C0Z A;  4ELY C;  4RMO A;  2ZZD A;  3GPL A;  2OTJ A;  4M78 F;  1Y71 A;  4BUG A;  4ZGD B;  3TEE A;  1N9S A;  4QQ6 A;  4IUP A;  4J83 A;  2R5A A;  3G6E A;  1QVF A;  2RO0 A;  3CBP A;  2GFU A;  2LCC A;  1O9S A;  3MO8 A;  2DIQ A;  4C5E A;  4M75 A;  2K4Y A;  4PLI A;  5DLQ E;  4C0D C;  1U1S A;  2OTL A;  2V8I A;  1RL2 A;  4J6X A;  5LJ5 j;  3URG A;  1YIJ T;  1VQ7 A;  2K3Y A;  3CC4 T;  4M7A B;  2RHY A;  1JJ2 S;  1M4Z A;  3G4S A;  4HCC A;  1VQP T;  4F7U G;  5FRN A;  4C92 F;  1OZ3 A;  1VQ9 A;  4DOW A;  2DEQ A;  4A4F A;  1QP2 A;  2KDS A;  2L3R A;  4OVA A;  5L8R E;  4BI8 B;  5DM7 R;  4A4G A;  1M1K U;  2EQJ A;  4HT8 A;  4RG2 A;  5GAM h;  3CCJ T;  3MHX A;  2EJF A;  2QQA A;  2FVU A;  2ZCF B;  3CCQ A;  4JS5 A;  3ASK A;  3E19 A;  1UGS B;  3JRZ A;  1YJW A;  2D0Q B;  3CCS T;  4GY5 A;  1JBM A;  5CKF A;  4M7A A;  3JCM Q;  4M75 D;  4JLG A;  4DA4 A;  1HK9 A;  4C8Q D;  1B34 B;  3I55 A;  2XDB A;  2K57 A;  3M55 A;  3OMC A;  1YI2 T;  3CEY A;  1NZ9 A;  4XTV A;  3JCM e;  4A53 A;  4BB7 A;  4C92 A;  2F5T X;  2RD1 A;  3FJP A;  4M7A G;  5GAN h;  2VGN A;  4JUV A;  1O75 A;  3M4G A;  1VQN A;  4J6W A;  4M77 D;  2ZGW A;  3WXM B;  4QVC A;  3L42 A;  4M7D C;  5GMK j;  4M7A D;  1OYX A;  4N4G A;  3OYK A;  3ZEH A;  5CK9 A;  4C0G A;  2JTF A;  2P0Q A;  2Y90 A;  3QXE B;  4UC4 A;  4C5I A;  3T9N A;  2E10 A;  1K73 U;  3MEV A;  2EIF A;  1YBY A;  3CPW A;  4OF1 A;  5FRM A;  2HAX A;  3TCJ A;  3OA6 A;  5LJ5 f;  2GF7 A;  1KG1 A;  2C06 A;  3V7R A;  4B9W A;  4Q5W A;  4BE0 A;  2E41 A;  3LH0 A;  5FU7 B;  1QP3 A;  4XTW A;  2M16 A;  4RCC A;  2XD0 A;  1MHN A;  3RER A;  5GAM f;  4QW2 A;  3LGF A;  1VIF A;  1VUB A;  4M77 F;  4EMK B;  1Q81 U;  2MWO A;  4HCZ A;  2LT4 A;  3JCM V;  4M7D F;  5CQX A;  3V8L A;  1KQ1 A;  3QYG B;  2CKK A;  3GLX A;  3QHS A;  4A4H A;  5GAO r;  2X4J A;  1JJ2 A;  3JB9 F;  4HT9 A;  2X35 A;  2DAQ A;  3CCM A;  4JRP A;  4BY6 C;  3HHT B;  1KC8 U;  1KD1 C;  2P4T A;  3KBG A;  2V8J A;  4Y91 A;  5KH6 A;  4BD3 A;  5GMK l;  3OYD A;  4M77 G;  2JVV A;  2F5K A;  3M57 A;  4IUU A;  4M78 D;  2DJZ A;  3G71 A;  3L1A A;  3QDR B;  1RI0 A;  4JRI A;  5GAM j;  4BI3 A;  2EYQ A;  2CZ6 B;  3P8B B;  1JRI A;  4ZGJ B;  4OB1 B;  1YHQ T;  4M77 A;  3DB3 A;  2HQE A;  2F69 A;  3RKX A;  2LT1 A;  5LJ5 g;  3FC3 A;  2QDY B;  3X20 B;  2EQK A;  3GF5 A;  3LW5 E;  2DXB A;  2ZPB B;  4R56 A;  2K5F A;  3I56 T;  3JB9 D;  4N4H A;  5KE3 A;  1S72 T;  4GLK A;  4JS4 A;  5CQY A;  4EMK A;  1VQ6 T;  1Q86 C;  5GAO p;  3HFN A;  3FDR A;  4KBM B;  3INZ A;  4N0A C;  4JLI A;  4C0F A;  3CC2 A;  4LDX A;  3G4S T;  2QXF A;  4XTY A;  2R5M A;  5HY6 A;  5M9O A;  2GFA A;  2L5Q A;  2KVQ G;  2LDM A;  2M1H A;  3JB9 H;  3MCA B;  3G7Z A;  3SWN C;  4EMH A;  2RB6 A;  2DTH A;  4XU2 A;  3OYG A;  3OW2 S;  3QSU A;  1K73 C;  2RJD A;  3GNF B;  3CCQ T;  1I8F A;  2FB7 A;  2QQS A;  3QYH B;  3QJ6 A;  2QA4 T;  4EMG A;  3RUX A;  4M75 F;  2LCL A;  3FEO A;  3X28 B;  5GAN 3;  3OS1 A;  4X9D A;  2LC4 A;  2PVG B;  2ZPE B;  3OBW A;  3X25 B;  5KE2 A;  5LJ3 g;  5GAO q;  1M1K C;  3L2R A;  3CD6 T;  2DD4 A;  2V8K A;  5FRO A;  4M78 E;  4C92 B;  5GAN 4;  2DD5 A;  4LDW A;  3BDU A;  1FX7 A;  2O4X A;  3QKJ A;  5GAN d;  3JAM E;  1M90 U;  3VYH B;  2X4W A;  3BFM A;  2XDD A;  1VQ7 T;  4NL2 A;  2OTJ T;  1KC8 C;  1M9S A;  1Y96 B;  2DIG A;  4L59 A;  2MMP A;  3JCM f;  1PSE A;  2XU8 A;  1OI1 A;  1M5Q 1;  2Y4X A;  3CXC S;  3EFS A;  3HKS A;  3NTI A;  4P5N A;  2L8D A;  3CME A;  3M58 A;  4BI4 A;  2QTX A;  5C6S A;  3CCU A;  2GCX A;  4O6J A;  1VQ8 T;  4DOV A;  2ZPF B;  1QVG A;  3RMQ A;  1NPR A;  1JB0 E;  1DJ7 B;  2PVD B;  3HPW A;  3CME T;  1TH7 A;  2CS7 A;  1YI2 A;  4J7I A;  3TRE A;  2PU9 B;  2K3X A;  4M7D A;  5EG2 A;  1X75 C;  2DZC A;  3GNG A;  3HRU A;  1W2B S;  1VQN T;  4DQ2 A;  2LNV A;  3O8V A;  1G3Y A;  3S6W A;  4ZGE B;  3CC7 A;  2X4Y A;  4M78 A;  3JCM W;  2QQB A;  1YJ9 T;  3M4Y A;  3CCJ A;  2ZPH B;  2LQ8 A;  4PJO A;  5KCH A;  3CCM T;  5J39 A;  4ZN3 A;  4C8Q A;  3E1S A;  2WSC E;  5J3B A;  4A54 A;  3X24 B;  4A4K A;  3OW2 A;  4ZTF A;  3VV0 A;  3MP8 A;  4Y28 E;  4NS5 A;  5CCA A;  4LD6 A;  4OB0 B;  2Y4Y A;  3P8H A;  2E64 A;  3E9F A;  3L2Q A;  1BYM A;  2HD0 A;  1Q81 C;  3VKI A;  2DVE A;  5GAN e;  3ZFJ A;  4XU1 A;  3VUB A;  2MAM A;  4BY6 B;  2LQK A;  3Q1J A;  3A8M B;  4FM4 B;  3JCM h;  1VQO A;  1Q82 C;  1YJN A;  2HBP A;  4Z02 A;  2E70 A;  1KHC A;  4XQ3 A;  2XIC A;  1FWZ A;  1QW1 A;  4N4I A;  3VYG A;  4QVD A;  1QVF S;  4J7F A;  1KD1 U;  4C8Q B;  2L89 A;  3OYB A;  5GMK i;  1VQ4 T;  1VQO T;  1YIT T;  4ATO A;  4MML A;  4PJO B;  3DKM A;  1NE8 A;  3BW1 A;  2RHZ A;  3S3N A;  3WVD B;  4C5H A;  2P0P A;  2I2L A;  3QBY A;  1D3B A;  2EAY A;  1BIB A;  3JSC A;  4IUQ A;  5GAM e;  3PIO A;  1N9R A;  2PVO B;  4IKF A;  3PMT A;  3JCM d;  5CKB A;  5GAO n;  3OS2 A;  3CBM A;  2VC8 A;  4M77 E;  3CMA A;  4BE2 A;  5A0L A;  4L6V 5;  4B9X A;  1XNI A;  3OYI A;  1BI3 A;  2A3L A;  3A5Z B;  4M75 G;  3WVE B;  3ZBD A;  3CCR T;  4C8Q E;  5DLO A;  1Q86 U;  2EWN A;  1MGQ A;  2XHC A;  2DK3 A;  2LTO A;  3F70 A;  2R57 A;  4WF2 A;  5CKD A;  1QVG S;  3CMA T;  2VYT A;  4M7A C;  2RM4 A;  4FU6 A;  4FT4 A;  3MP1 A;  3DLM A;  3JCM J;  4OGC A;  2EKO A;  4PJO G;  3CCE A;  3LWH A;  2DXT A;  3OYH A;  1KQS S;  4KUI A;  3CCL T;  1LOJ A;  2HNI A;  2O4X B;  2RH2 A;  5GMK m;  5LJ5 h;  3VJP A;  3JCM g;  4OMF B;  1FXX A;  3HRT A;  1KQ2 A;  1BKB A;  3OBY A;  5IN1 A;  3J80 E;  1VQ5 A;  4M7A F;  3RKY A;  2P0K A;  2RJE A;  3L2W A;  1QVP A;  4J6Y A;  1D3B B;  3SB2 A;  3JB9 I;  1N8R U;  5D6W A;  2XKO C;  1VQM A;  5GAM g;  4NL3 A;  5CR2 A;  3J7A F;  1OZ2 A;  3L2U A;  2DXU A;  1KQS A;  4FT2 A;  2WSE E;  3CD6 A;  2GQV A;  3OYF A;  5KCO A;  2YLC A;  4XTX A;  4MZT A;  2EQM A;  2DZ9 A;  3OB9 A;  4MDW A;  2RK1 A;  4BDZ A;  1WJS A;  2BUD A;  4M78 B;  1XQH A;  2CZ0 B;  2H3J A;  5GMK e;  3RMS A;  3MEU A;  1WGS A;  4BAC A;  4HCB A;  2CZ1 B;  3ER0 A;  3KUF A;  4RG8 A;  2KSS A;  2QI2 A;  3HSB A;  1YJ9 A;  2MI6 A;  3OYY A;  4OB2 B;  2E6Z A;  2RHX A;  5IAY A;  3OY9 A;  5HKC A;  1Q82 U;  1H64 1;  2OTL T;  2A7Y A;  3DLL A;  3LGL A;  3L2Z A;  1UGR B;  4F7U B;  3QPH A;  1I4K 1;  3SD4 A;  2MWP A;  3PFS A;  2JNG A;  4PJO E;  1GXI E;  4IUR A;  4M75 C;  4J5Y A;  4M7D D;  2K2V A;  2YRV A;  3H8Z A;  2O01 E;  1WQW A;  4EPC A;  3J81 E;  3LLR A;  1WPY A;  3UT1 A;  5D6X A;  3FLG A;  5FU6 B;  1IRE B;  3GOX A;  3V8K A;  1VQL T;  4KT0 E;  4PJO D;  5GAM d;  3CPW S;  2NLU A;  5LJ3 h;  2CGH A;  2K5L A;  3LX7 A;  5I2M A;  4LDY A;  1Y7X A;  4M7D B;  5HK0 A;  2YHT A;  1K8A U;  3OSV A;  4M77 B;  3JCM c;  2IG0 A;  4E7H A;  1G3S A;  1Y96 A;  4NOY A;  1H3Z A;  2QQ9 A;  5I2S A;  3PIP A;  5FLX E;  4N0A A;  3G71 T;  5LJ3 j;  5GAO m;  1PSF A;  1LJO A;  3A8O B;  4LDV A;  2CYZ B;  2BKD N;  4M7D E;  3QG1 A;  4YTL A;  5GAN g;  1S72 A;  2XG8 D;  3SWN A;  3TU4 K;  2JTM A;  1Q7Y C;  3CCV T;  4PKC C;  1YJW T;  3PNW C;  5FU6 C;  5LJ3 d;  2G3R A;  3PGG A;  4HA8 A;  3OYL A;  4MZM A;  1X6O A;  2FL7 A;  2X4X A;  1Q7Y U;  1Y07 A;  4XU0 A;  3SDZ A;  5LJ3 e;  3CCV A;  4C8Q F;  5GAN 6;  4C92 C;  1WNL A;  3GP8 A;  2XID A;  3S3M A;  1N8R C;  2M0O A;  1SSF A;  3V8J A;  3P8D A;  4M7D G;  2RJC A;  1BI1 A;  4QQG A;  5CAI A;  1NJI U;  4JRQ A;  1LNX A;  4QVZ A;  2RHU A;  3NTK A;  4PNO A;  3QZ5 B;  1BI0 A;  4OGE A;  3UPU A;  3PTA A;  3OYJ A;  3HFO A;  3MP6 A;  2EFI A;  3OS5 A;  4JDS A;  4C92 E;  3BDL A;  5AYF A;  3M9Q A;  4KUD K;  1UEB A;  1VQ5 T;  3AHU A;  2E5Q A;  4MZP A;  3CCR A;  2DPP B;  1YHQ A;  3I56 A;  3KXT A;  3OYM A;  3PT9 A;  4F7U F;  4E7K A;  1M1G A;  5D6Y A;  2QEX A;  3FIF A;  1VQ9 T;  2DKG A;  2XDP A;  3OQ5 A;  4TVR A;  5LL6 S;  2CZ7 B;  2PUO B;  3HL8 A;  3M53 A;  3CC2 T;  2D6F A;  5GAN 5;  4D6W A;  1I81 A;  1R8O B;  2KK4 A;  2RI2 A;  4C5G A;  3BY7 A;  3PMI A;  5GAN 8;  4R55 A;  1M8V A;  3RES A;  3OSS C;  3FRN A;  2VXE A;  1VIE A;  2DXC A;  4RCB A;  2EJ9 A;  3QUI A;  3JCM b;  5A0G A;  1YIT A;  2FYK A;  1VQK A;  1UGQ B;  1EIF A;  2DTI A;  1P92 A;  2RA2 A;  3V7S A;  3QZ9 B;  3MEA A;  4HKE A;  4ME7 A;  3OYE A;  4OP0 A;  4BDY A;  1B34 A;  3DB4 A;  3I55 T;  5FU7 C;  3CCL A;  1G3W A;  1XOV A;  2AHJ B;  4PLL A;  4X34 A;  3C95 A;  5GAN f;  4FSX A;  3A8H B;  5A0D A;  5GAO l;  1K8A C;  2PUK B;  3QJY A;  4JRK A;  3OMG A;  3MEW A;  1VQP A;  2RI3 A;  4LDU A;  1W2B A;  4M75 E;  4XAX B;  2E1H A;  3JB9 J;  4QQD A;  4PJO C;  1VQM T;  3VU3 C;  3MET A;  2WAC A;  2IVW A;  4XTU A;  4C8Q C;  3C4S A;  3CC4 A;  4JJN K;  4CRI A;  4M78 G;  3EFR A;  1X01 A;  4M77 C;  3G6E T;  2E6N A;  3CCS A;  3N5B B;  2PQW A;  2D9T A;  1BI2 A;  4RKU E;  5GAN 2;  2HQX A;  5CKH A;  3LWI A;  5GAN j;  5IT9 E;  2DO3 A;  3EAE A;  4PJO F;  1WJQ A;  4A4E A;  3CCE T;  4MMK A;  3CXC A;  3NTH A;  5J26 A;  1IZ6 A;  2ZPI B;  1KHI A;  2XI9 A;  1YIJ A;  3UWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...