3LGLA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k382me2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA01
1YJNT 1OI1A 1WJRA 3PIPA 1N27A 2QQSA 5C0MA 5FRMA 2NLUA 1NPRA 2X4XA 1IZ6A 3L2QA 1VQ9A 3OYMA 2EQKA 4E7IA 2PQWA 1YHQA 3CCRA 3CCLA 3OYAA 2RI5A 4C5IA 2MWPA 1VQMA 4X34A 2OTJT 4II1A 3OYHA 3QJ6A 2E6ZA 5D6WA 2DIQA 1XNIA 3OQ5A 1KQSA 4IUTA 5D6YA 4IURA 5C6SA 3OA6A 4TVRA 1RI0A 2EKOA 1YITA 1VQNT 2E6NA 2R5MA 2JNGA 3DB4A 3E9FA 1UEBA 2F5KA 1Q86U 3ER0A 3C4SA 3CC7T 5FROA 2RJDA 2XK0A 1Q86C 3ME9A 4QQGA 3CCQA 1QVGA 3NTIA 3LGFA 3CCEA 4LD6A 3OYGA 2O4XA 1WJQA 2JVVA 1WJSA 3H8ZA 1VQNA 3G71A 3CEYA 3UWNA 3OYYA 4QQ6A 2RI2A 3CPFA 1Q81U 2RJCA 3MEVA 2JTFA 1QVFS 3OS0A 3CMEA 4BD3A 1K8AC 3I56T 1VQ9T 3OYEA 3OS2A 3EAEA 2X4YA 2R57A 5KCHA 3CC7A 2KVQG 5HY6A 2JUFA 3MP1A 1Q81C 1K73C 1JJ2S 2EQJA 3I55T 1N8RU 4QVZA 4C5EA 4IKFA 3OYJA 5FRNA 3ASKA 3KUFA 5D6XA 1KC8U 3CXCA 2MWOA 2BKDN 1JJ2A 1N8RC 2LRQA 3E9GA 3KBGA 2B8AA 3P8HA 3S3MA 1VQPA 3O8VA 2L3RA 2E5QA 3SD4A 3I56A 3TREA 1YITT 3S3OA 3DLLA 1KC8C 2EQUA 3CCST 4PLLA 3I55A 4FL6A 4A4FA 1KQSS 1WGSA 2R5AA 4B9WA 4E7KA 1YI2A 2X4WA 2HQEA 3FLGA 4BE1A 2LTOA 3Q1JA 3OW2A 3CPWA 3CCQT 3CCET 1Q7YU 2DIGA 2K3YA 1S72T 3G71T 2LCLA 1M90U 2XDPA 3CCJT 1G5VA 3G6EA 3FEOA 3META 3CCSA 1KHCA 3CC2T 3NTHA 3CMET 1QVGS 1X6OA 2M0OA 2FHDA 3H6ZA 4N4HA 4BE2A 4IUVA 5IAYA 4C5GA 5IN1A 1YJWT 4Q5WA 2JZ2A 5DLQE 2X35A 2OTLA 2MI6A 3LGLA 3J81E 3CCMA 1S72A 4PLIA 4UC4A 3LX7A 1VQ5T 3CCJA 3CCUA 1BKBA 5IT9E 3CD6T 1VQLT 2XHCA 4NS5A 3MEUA 3OMGA 3JAME 2K3XA 1VQ8T 3CC2A 1VQPT 2LCCA 2M16A 3QKJA 5J39A 1YBYA 5KCOA 1VQOT 3P8BB 2M1HA 2BIVA 3J80E 2GF7A 1YIJT 4CRIA 1YJWA 4A4GA 3S3NA 1OYXA 2O4XB 3CXCS 3DB3A 2QQRA 2RHYA 3L2VA 3NTKA 3F70A 1YJ9A 2QEXT 1YI2T 2RI3A 3L42A 4ZN1A 2EIFA 3PMTA 5J3BA 2KDSA 1VQ5A 3HKSA 3OY9A 4ZTJA 3CD6A 1VQLA 3MP6A 3MEAA 1K9MU 2LDMA 3OYKA 1VQ8A 1OZ2A 1VQKT 5CIUA 3FC3A 3J7AF 1VQOA 4PL6A 5FLXE 3G4SA 2WACA 3OYFA 3L2UA 4FU6A 1YIJA 3G6ET 4QW2A 3M9QA 5DM7R 3OW2S 3CPWS 3L2RA 4OVAA 2QEXA 1W2BA 3QIIA 3OMCA 2YRVA 3LH0A 2HQXA 1KD1U 2G3RA 3PFSA 3OYBA 4HCZA 1M1KU 4IUQA 2E70A 3A5ZB 4GY5A 2R58A 2OTLT 4A4EA 2RHZA 1VQKA 4ZN3A 2RO0A 4N4IA 3OYCA 3CCMT 1RL2A 2RJEA 1NJIU 2D9TA 4E7HA 1KD1C 3CCUT 2LQ8A 2VYTA 3BDLA 3QBYA 3OYNA 1M1KC 4E7JA 1VQ6A 3CCVT 1VQ4A 3OS1A 1SSFA 5LL6S 1YJNA 2EFIA 3OYIA 1Q7YC 4N4GA 4RG2A 5KE3A 4QQDA 1NJIC 3CMAT 2EQMA 4C5HA 1M90C 2BUDA 3OYDA 4BDZA 2RHUA 4IUPA 1KHIA 1VQ7T 3CC4T 1NZ9A 3PMIA 5KE2A 3OB9A 3MP8A 4ZTFA 3PNWC 2LVMA 1YJ9T 3MO8A 4BACA 3PIOA 1OZ3A 2OTJA 2DO3A 4A4HA 1M1GA 4B9XA 3CCVA 2P0KA 2GFUA 4BDYA 3DLMA 3CMAA 1K8AU 2RHIA 5KH6A 3G4ST 1EIFA 3LLRA 1VQ7A 3MEWA 2RJFA 3S6WA 3CC4A 2L8DA 4YTLA 1MHNA 4L59A 2QA4T 2RHXA 1K73U 2JOYA 2DAQA 3L2WA 1Q82U 4E7LA 1NPPA 1H3ZA 3P8DA 2GFAA 4IUUA 1XTDA 4BE0A 1YHQT 3UT1A 3CCRT 3CCLT 3OYLA 1QVFA 3ZEHA 1Q82C 2CKKA 1W2BS 1VQMT 5A2QE 3LYIA 3GOXA 4Z02A 2IG0A 3FDRA 4EDUA 5J26A 2L89A 1K9MC 1VQ6T 2QA4A 1VQ4T 5M9OA
chains in the Genus database with same CATH superfamily
4PJOG 1WJRA 2B86A 1YJNT 1N27A 3LW5E 2LQWA 4KUIA 3VS1A 4C92A 2GBQA 1SF9A 3OYMA 1VQLQ 3CD6Q 2DXUA 3EHRA 4NOYA 3R6OA 2EQKA 4PNOA 2KEAA 4E7IA 3FB9A 3RBBB 2V26A 3CCRA 3CCLA 1GRIA 2J6OA 3JCMP 3EFOA 1VYVA 1NE8A 4C8QG 1YWPA 5I11A 4QT7A 1BCOA 4NL2A 4CC4B 4XK8E 3A1PA 3AT1B 4II1A 1TTHB 1Y7XA 2XDDA 3LWIA 2L3PA 3OS5A 3GPLA 5D6YA 3WXMB 1KQSA 5C6SA 3H0FA 1IREB 3QWYA 2CT4A 3JRZA 1F1BB 1QCNA 1ZSZB 5GMKj 1UGPB 2L0AA 2Y4YA 4AFUC 2M0YA 3BY7A 1PC0A 5FWCA 2F5KA 4KH1B 1YWOA 2F5TX 2EYQA 4LDVA 3GBQA 3M0TA 5GAN7 1RI9A 2HKQB 2YRCA 1VQ6Q 4M77F 2AT1B 4LDYA 1JO8A 5FROA 4OMMA 2JM8A 2XK0A 4OMOA 1Q86C 3JB9H 1K9MR 3NTIA 1K0XA 4LD6A 3OYGA 5A0GA 2V8IA 1D1BA 4M77D 3CEYA 4QQ6A 2DZCA 5KYYB 2OTLQ 2JXBA 4RTTA 4JZ4A 2KRNA 3CCMQ 5CO7A 1QVFS 2DILA 3CMEA 1LPLA 2E3IA 3I56T 4M78F 3CBMA 4AFZC 4EMKC 2X4YA 3R6NA 1MGQA 1Y07A 5CQXA 1MMAA 3EHQA 3MP1A 1K73C 4PJLA 4HT8A 3EG9A 4OGCA 2RF0A 3QXEB 4M78D 4C5EA 1WNLA 2DMOA 3OW2P 1KQSP 2YDLA 3CC4Q 4HCCA 3H0HA 2O01E 2A7YA 2J6FA 3KUFA 1KC8U 4LDUA 1NJIR 2C06A 1N8RC 1WFWA 1O9SA 1FWZA 3O8VA 2E5QA 4PFZA 3I56A 1WI7A 5IXBA 3S3OA 4OB1B 4IIOA 4R56A 3TVTA 3H9NA 1W1FA 2EQUA 3RKWA 3RESA 5GAN6 4FL6A 2CH4W 5CKFA 4HT9A 1KQSS 4M7DC 3THKA 3M4YA 2JTEA 1LCKA 3CBOA 2PVDB 3UA6A 4FSXA 1BIAA 2EAYA 2O9SA 1IO6A 3QPHA 3EG3A 1VQ9Q 3QJYA 2ZPFB 5DY9A 2ROLA 4KGVB 2RA2A 1Q7YU 2DD4A 5GAN3 2DK3A 2C0TA 4GBQA 1S72T 2RNAA 3G71T 2LCLA 1O75A 2XDPA 1K8AR 1WQWA 2DEUA 4JLIA 2DRMA 1VQMQ 5HK0A 5GAOl 1WYXA 4C92F 1VIEA 3H6ZA 1I4K1 4E47A 5GAOq 2LNHB 4N4HA 3JCMc 2CZ6B 1VQ4Q 2EYWA 1Q82R 1YJWT 2YRDA 3M0QA 4C92D 1ZBXA 2OTLA 4KGXB 1YITQ 3LGLA 3X28B 2QGGA 1RAEB 4LDXA 3J81E 3CCMA 1S72A 4C0DC 3INZA 1NBEB 1N5ZA 3PVQA 1VQ5T 2W0ZA 5CKDA 2KRSA 2EJ9A 3C0CA 4MMLA 3HSBA 4NS5A 4J5YA 1KJWA 1VQPT 2M16A 5J39A 1RLQC 2M1HA 3IQLA 2ZPIB 3NFCA 9ATCB 4F7UE 2JTMA 1YJWA 3S3NA 1OYXA 3VUBA 5EC7A 2HZYA 2M9UA 2DERA 2DYIA 2RQWA 4RCCA 2SRCA 1YI2T 1AWOA 5KYUB 3L42A 2KGTA 2D8JA 1B34B 1IHVA 1VQ5A 2V8JA 2MAMA 3MEAA 1PKSA 3OYKA 3M55A 2ZGWA 1OZ2A 2QI2A 5CIUA 4BI3A 4PL6A 4F7UB 3OYFA 3L2UA 2K7AA 3G6ET 4L5GA 3M9QA 8ATCB 1I81A 1V76A 1HXDA 2F2XA 1AEYA 1W2BA 1FX7A 3QIIA 1Q86R 3QZ5B 2DLPA 3LH0A 2DTOA 1IRXA 1UGQB 3OYBA 2E3HA 2E70A 3A5ZB 2R58A 4KUDK 2V1QA 2EVRA 3TSWA 2Y4XA 1X27A 1RL2A 4LUEA 2RJEA 2VGMA 4J8OA 4AT1B 2LQ8A 3X20B 1H92A 1M1KC 2VGNA 1VQ4A 3M5AA 5LL6S 2HL3A 3VS2A 3MHXA 4A53A 1PG5B 2E5KA 2PVGB 1I0CA 5KE3A 4XTXA 3A8OB 2EQMA 4C5HA 2BUDA 1M90C 4FT4A 3RERA 1QP3A 2IPOB 4CC7A 2CYZB 2QK0A 1SPKA 3EFRA 4Y92A 3GIBA 2L3QA 1D1CA 4M75A 5D7UA 5GAN5 1N8RR 2MK5A 1PHTA 3PIOA 4HVWA 1OZ3A 2DXBA 5CQYA 3RNJA 3QUIA 1GCQC 2DEQA 2VKNA 2YSQA 3VRYA 2CP0A 4BDYA 3DLMA 3G4ST 1U3OA 3MEWA 3CCQQ 2L8DA 2KSSA 4ELZC 1ABOA 1T3SA 5DLOA 4PJOA 1I1JA 1E6HA 4E7LA 2DFUA 2DKGA 2X9HA 1W6XA 2GCXA 5GAMg 4EMKB 2QG9B 3HL8A 2J05A 4DQ2A 3UT1A 3D7SB 1GFDA 3GP8A 4J83A 1W2BS 3OBYA 5CAIA 1ZHIA 4C8QA 1IHWA 2IG0A 1HK9A 2JS0A 1K9MC 3KXTA 3S6WA 5M9OA 1OI1A 3PIPA 5FRMA 1FMKA 3RMQA 2NLUA 3RMSA 2LCSA 1N6AA 3SWNA 3JV3A 3L2QA 1B7TA 2EQIA 2DETA 8AT1B 4Y28E 2C0OA 2FPFA 2A08A 2CUDA 1FMWA 1VQ8Q 4LD9K 1NLOC 2LX7A 2GNCA 2PU9B 3I5RA 1VQOQ 3OYAA 3L2ZA 3EGDB 2COWA 1KIKA 4DA4A 2MWPA 2O88A 1M9SA 4E7ZA 1BB9A 4HCBA 2AHJB 4X34A 3VS5A 5I21A 2FVUA 2QEXQ 3QJ6A 2E6ZA 5D6WA 1XNIA 4KBMB 1G3SA 1X2KA 4IUTA 4XU0A 1SHFA 1JQQA 3VYGA 2YUNA 1RI0A 2EKOA 1N9SA 1J3TA 2E6NA 3JB9F 2R5MA 2XD0A 2YUQA 1JB0E 2JNGA 4M4ZA 2DXTA 1EFNA 1RABB 5CKEA 4D6WA 3GNFB 3E9FA 2HMAA 3UATA 1AOJA 3M0SA 1AWXA 2VWFA 1PNJA 2CS7A 2K5LA 3JB9D 5KYWB 4FW1A 4M7AF 1TUCA 2P0PA 1YJNQ 2YT6A 1G8XA 3CC7T 4DEXA 2HL5C 1N9RA 2KMTA 1PSEA 3E2UA 3ME9A 1I5LA 1UJ0A 1NEBA 4HKEA 4K11A 3CCQA 1C1AA 1OU9A 3CCEA 1Y0MA 2O4XA 1WJSA 2HDAA 4M7AD 3H8ZA 4MZMA 3A8MB 2ESWA 3OYYA 4LE9A 4PJMA 4JJCA 1SEMA 3RIRA 2XG8D 3JCMg 3CPFA 2K3BA 3VS0A 4A4KA 5HKCA 4KH0B 2P0QA 4BD3A 3CCUQ 1RAFB 1K8AC 4RG8A 2HQHA 1UB4A 3EAEA 4JLGA 2RPNA 4RTWA 2HCKA 3RUXA 4J9GA 3CC7A 5I2SA 3QO3A 5HY6A 5L23A 3I55T 4QVZA 4M75F 2DBKA 2KK4A 1NLPC 1M1KR 1VQ7Q 2GGRA 3OYJA 1RAAB 2F69A 1QCOA 1UECA 2H3EB 1Y96B 4RMOA 3NGPA 4M75D 2BKDN 2LRQA 1Z9QA 3E9GA 2B8AA 3H41A 1Y71A 3X24B 3S3MA 2E10A 3SD4A 4ME7A 4OMNA 2XKOC 1OOTA 1KC8C 3M56A 3VS4A 4CI0C 4F7UG 2K57A 4PLLA 3I55A 5EG2A 2LC4A 2AKLA 3VUZA 4PJOF 1C6VX 4B9WA 1R77A 2DL4A 2FRWA 5GANg 1QVPA 2X4WA 3FLGA 4L6V5 3JB9I 3OSVA 2PUOB 3M53A 4M77C 4PJOD 1U8RA 3V7CA 4BY6B 3M0RA 3OW2A 1LOJA 1U1TA 2ZPGB 2ATCB 2K3YA 2X3WD 1R0BG 1YHQQ 1WLPB 4C8QF 2PVOB 2P4RA 3N5BB 3BE3A 3TEEA 1RAGB 4RCBA 4J9IA 1G83A 2DJQA 4D8KA 3META 1I5OB 3E1SA 3NTHA 3CMET 4JRIA 2L5QA 4C8QD 1BK2A 2WSFE 1QWFA 4BE2A 3TCJA 1YCYA 2OJ2A 5IAYA 4J9BA 4M78C 1WHMA 5IN1A 1MV0B 4A63B 2JZ2A 4RKUE 2YHTA 2MI6A 5GAMf 2BE9B 2E41A 2IIMA 4UC4A 2K5FA 3CCUA 1PRMC 2DM1A 3CD6T 1VQLT 3EG2A 4D8DA 2DNUA 2OTJQ 4EPCA 3QKJA 5GMKm 4J7FA 3FIFA 4ATOA 2GF7A 1NM7A 3DB3A 2QQRA 2RHYA 5AYFA 1D0YA 3L2VA 1RLPC 1VQNQ 1G2BA 3F70A 3SEMA 2L3SA 1M3AA 3PMTA 3TSZA 5GAN4 4CC2A 3HKSA 1ZUKA 4ZTJA 3PE0A 3CD6A 1VQLA 3NPFA 1UGSB 2FZKB 4X9CA 2DL8A 1IGQA 1WA7A 3J7AF 3EGXB 2H3JA 6AT1B 4FYWB 2EJGA 2XMFA 2QXFA 3OW2S 4OMFB 3L2RA 4OVAA 4M7AE 1IB8A 1SG5A 2FL7A 4C92C 3ZBDA 4DBHA 3I5SA 2E4HA 1KD1U 1X6BA 2LJ1A 4HCZA 4IUQA 2QQ9A 4GY5A 4A4EA 2OTLT 1ZSZA 1QP2A 2RO0A 5KYXB 3CCMT 1M2VB 4M7DG 4N0AA 2VYTA 3BDLA 3FJPA 3QBYA 3OYNA 1E6GA 3HRTA 4E7JA 4BI8B 1VQ6A 4MMKA 3OS1A 2NYSA 4J9EA 3I9QA 2EFIA 2HD0A 3EG0A 2AIRB 4M7AB 2AK5A 4N4GA 3JCMf 5FU6C 1H8KA 4BDZA 5GAMd 5CK9A 1ZLMA 3RKXA 2A37A 5IH2A 1D0XA 3CC4T 1NZ9A 3RR6A 1MUZA 2EW3A 5KE2A 2JMCA 4JPBW 3QDFA 4JJBA 3AHUA 1QKWA 5KYYA 3MO8A 4BACA 2RN8A 1ABQA 3VS3A 3CCSQ 2OTJA 1PKTA 3HFOA 3UPUA 1M1GA 1ZX6A 2EYZA 1K4US 1D1AA 4B9XA 1KC8R 1M8VA 2YUOA 1MMNA 3M57A 5L8RE 2FB7A 4AG1C 2M02A 1SHGA 1TUGB 2MOXA 4J6XA 2KRMA 2LQKA 1K76A 3CC4A 2Z0WA 3WVEB 1MHNA 5LJ3g 4ELYC 1K73U 1UHFA 3TU4K 3CCJQ 2CDTA 2W10A 2OAUA 3L2WA 1VUBA 2DRKA 1H3ZA 5LJ3h 1UE9A 2JMAA 5IHNA 2YWWA 4RTZA 4IUUA 1XTDA 1D09B 3CC2Q 1BI1A 1VYUA 5GANf 3OYLA 3HRSA 3X26B 2ED1A 2QDYB 2JM9A 4JDSA 4NL3A 2EYYA 4IIMA 1QCFA 1M2OA 3EGUA 1GBQA 1VQMT 3LYIA 2JT4A 4Z88A 2RB6A 4Z02A 2G6FX 2DD5A 2AKKA 2ZCFB 4PK4A 4EDUA 1ZA2B 2CP3A 3OYDA 2HNIA 1WQ7A 1X6GA 3M0PA 1VQ4T 3HP9A 2DPPB 4RTUA 5C0MA 3HPWA 1NPRA 4M77E 1G3TA 2NUZA 1VQ9A 1CKBA 5GAOn 3EG1A 3T9NA 1QKXA 2PQWA 1NG2A 2ECZA 4OB2B 1TSFA 2RD1A 4BY6C 4X9DA 2CT3A 2X4JA 4LUDA 1KSWA 2K2VA 3G4SQ 4DOVA 3C95A 1YIJQ 1VQMA 5GAN8 4AG2C 2HEQA 2GTOA 4ORZA 1UUEA 2YXYA 2VXEA 4XQ3A 1ZUUA 2IVWA 2KR3A 2ZPEB 4M78E 4JRPA 2E64A 4HVVA 3OQ5A 4M77B 4PKCC 2XI9A 2NUPB 5GAN2 1AT1B 3OA6A 1NEGA 2HBPA 5GAOm 4PJJA 1YITA 1M3BA 1QW1A 4GLKA 2I2LA 5HCKA 4RUGA 2HBWA 1VQKQ 4JZ3A 2XIDA 3HFNA 1TWBA 3GF5A 1MMGA 1GL5A 1MMDA 3ER0A 3C4SA 2E1HA 2CZ1B 2RQUA 1OEBA 4Z8AA 4M78B 2QASA 2CZ7B 4FSSA 2FPDA 3U23A 1AZGB 3CXCP 2K2MA 1JJ2P 2O2OA 4AFQC 4QQGA 2VV5A 1EX4A 4J9FA 1QVGA 3MCAB 3LGFA 2JVVA 3UWNA 2CUBA 2XICA 2DJZA 2VC8A 5KYUA 4JJDA 4V2SA 1Q81U 1JXOA 1RUWA 2RJCA 1B34A 2E12A 5GANd 1B3QA 3OYEA 3OS2A 2LNVA 3ULRB 1ARKA 3CCVQ 5KCHA 2SEMA 1GCPA 2KVQG 2FZCB 4WTOB 4KGZB 2KNBB 4BUGA 2EQJA 4E6RA 4EMGA 3CMAQ 1JJ2S 1U1SA 4JRQA 4F7UA 2BE7D 3JCMW 4IKFA 1D3BB 1QLYA 3CPWP 1GXIE 5GAMh 4J6YA 1YCSB 4RTXA 5CCAA 2KY9A 5D6XA 2WSEE 2KYBA 1YJ9Q 4C92E 4HVUA 1XOVA 3WVDB 5LJ3e 2DZ9A 3P8HA 3VU3C 1P92A 2L3RA 1T0JA 1TOVA 2JS2A 2DBMA 2OX7A 3DLLA 2JN0A 3E19A 3REAB 4PFOA 5GJWB 1K0SA 1M27C 4J9CA 3GLXA 4A4FA 5IHIA 1WGSA 2R5AA 4QVCA 4E7KA 1QVGP 2J6KA 3QDRB 4FIBA 4DEYA 4ZGDB 2QA4Q 2CGHA 1WXBA 2EJFA 4C92B 4ZGJB 2LTOA 1BBZA 2YLBA 4M7AC 3MPUB 1WX6A 2QQAA 2MPXC 3CCQT 3CCET 4J6WA 3KFVA 1M90U 3CCRQ 3EFOB 3CCLQ 2FO0A 1G5VA 1UGRB 2FYKA 1FMVA 5LJ5g 4LDWA 1KHCA 4FYYB 1QVGS 1KK7A 2EBPA 2PUKB 5LJ3f 4E2FB 2BTTA 1WZOA 3VYHB 1PM3A 1YN8A 5LJ5h 2WSCE 4IUVA 5CKHA 5FU6B 3UDCA 3HHTB 3O5ZA 4B6MA 2X35A 3G1JA 1VIFA 2H8HA 2HKNA 2PTKA 1PWTA 1UFFA 2CSQA 4M75C 3BW1A 1RAHB 4EIKA 2DL3A 3SFMA 5IT9E 4XAXB 1FXXA 4F17A 3MEUA 4F16A 4MZTA 3JAME 2K3XA 1VQ8T 2LP5A 4EMKA 1VQOT 2MMPA 3JCMh 1ZQ1A 1LJOA 2E65A 4OP0A 2BIVA 4CRIA 4A4GA 1TU0B 3HRUA 4VUBA 2VXFA 2DVEA 4LN2A 1ACMB 3TQ7P 1YJ9A 2QEXT 4ZN1A 2KDSA 1W4SA 1ZBJA 4PJOC 1BIBA 1G3WA 2JW4A 3OY9A 1BYMA 3CMEQ 3MP6A 4MDWA 2LDMA 1K9MU 1VQ8A 3QYGB 1A0NB 1VQOA 2LZ6B 1SRLA 1W70A 5FLXE 3EG9B 2WACA 3JCMb 4C0ZA 4QW2A 3EGDA 5GAMe 2DYBA 2D6FA 1XQHA 4M7DA 4QKUA 2A28A 2ENMA 4HCKA 4XTUA 1M30A 5DM7R 4C0GA 1MNEA 2A36A 2EGEA 2K6DA 1WHJA 2QEXA 3M59A 3OMCA 5I22A 1SRMA 3SWNC 2DTIA 7AT1B 2EKHA 1PCXA 2PNIA 2G3RA 3PFSA 3I56Q 4OF1A 1M5Q1 4OMLA 4F7UF 5GANh 2RHZA 3PGGA 4N4IA 1BU1A 2NUTA 3G7ZA 1NJIU 1HSQA 1I07A 2KAFA 4E7HA 3FRNA 1KD1C 1JU5C 3CCUT 1MV3A 2EWNA 5LJ3d 4PJNA 1X75C 1SSFA 5KYWA 1XJWB 1YJNA 3OYIA 3X25B 1Q7YC 1X2QA 4RG2A 2VB6A 4M77G 4QQDA 1WXTA 2RHUA 1VQ7T 4OMPA 1QQJA 2QTXA 2QYZA 4F04B 3MP8A 4XTYA 3EH2A 3PNWC 4ZTFA 4XU2A 1QVFP 1U5SA 4XU3A 1YNZA 2D0QB 4MDXA 1I8FA 1T0HA 2X51A 4A4HA 3JCMX 2LJ0A 5LJ5e 4M78G 3ZL7C 1JXMA 1K8AU 2RHIA 3I35A 2D0NA 3DKMA 1KQ2A 3VS6A 1YP5A 1VQ7A 2RJFA 4MZPA 4YTLA 5CKBA 3QYHB 2ZZDA 2NWMA 2RHXA 1S72Q 3G71Q 1Y96A 3M58A 4P5NA 3URGA 2GQVA 2DAQA 1Q82U 1NPPA 2CP2A 5AT1B 1WXUA 2AZVA 4AMCA 4JJNK 2K4YA 2GFAA 4R55A 3NHNA 1YHQT 4C0FA 3JCMe 3M0UA 4XU1A 3ZEHA 1TH7A 2EPDA 1R0CB 2CKKA 3M4GA 1YJWQ 5LJ3j 2FPEA 2GTJA 3GOXA 3SB2A 1CKAA 3VS7A 3C12A 5J26A 2L89A 1VQ6T 4DBRA 3RKYA 2LT4A 2QQSA 2X4XA 1VQ5Q 1C0MA 1IZ6A 1VA7A 5LJ5f 2KQWA 2KXDA 1V1CA 2RQVA 1PD1A 5GAOr 1VQPQ 1YHQA 2O31A 3UF4A 1OPKA 2RI5A 1JEGA 4XTVA 4C5IA 2FZGB 1OULA 3V7RA 4FW2A 3VKIA 2RQRA 2OTJT 2A0FB 3MJXA 2DTHA 3EFSA 5GMKh 1WHGA 2F1LA 2DA9A 3OYHA 1YI2Q 4E7SA 2DIQA 4C92G 4RTVA 4IURA 4FCYA 1M4ZA 3V8KA 4TVRA 1VQNT 5GANe 2RH2A 2COZA 2OAWA 4M75E 4M7DF 1D0ZA 2CREA 3DB4A 1UEBA 1Q86U 4F14A 1T3LA 4ZNXA 3G6EQ 4CC3A 3CBPA 4Z89A 3PTAA 4XTWA 1HD3A 1LNXA 4JS5A 1GCQA 4M7DD 2DVJA 3FJ5A 2QAZA 1RAIB 1ZSGA 2RJDA 2YUPA 1DJ7B 4OMQA 2P84A 4OB3B 2FEIA 2J7IA 4J9HA 2HAXA 5CR2A 4OGEA 1OU8A 1WJQA 1AZEA 1VQNA 3G71A 1Y57A 4GLMA 2P4TA 4M75B 2KI7A 2RI2A 4OB0B 1SSHA 2LQNA 4PJOE 1MNDA 3BFMA 2ABLA 4J9DA 3MEVA 2JTFA 1WPYA 3SDZA 3M54A 3OS0A 2VUBA 1VQ9T 4FYXB 2K5IA 1K9AA 3CQTA 4LXCA 3ZFJA 2ROTA 3JCMV 2R57A 2KXCA 2Y90A 4ZGEB 1JBMA 1VOMA 2JUFA 1Q81C 2X3XD 1KD1R 2CH4A 3A8LB 1N8RU 3GNGA 3EGXA 4C8QE 1WHLA 5FU7C 1WIEA 3V8JA 4BB7A 2AZSA 2CZ0B 2CP7A 3REBB 3EH1A 1UJYA 1Q7YR 5FRNA 1RADB 3ASKA 2RM4A 5LJ5d 4XTZA 4PJOB 3CXCA 2MWOA 1JJ2A 5HK3A 2LMJA 3KBGA 1OX9A 4DBQA 5GAMj 1VQPA 1OV3A 1ZA1B 3TREA 1H641 1YITT 1EZZB 2KROA 2VASA 2LX9A 2MF2A 1WDXA 2COYA 2RMOA 5KYXA 5A0LA 1ZUYA 3CCST 2RK2A 4C8QB 1PD0A 1M2VA 3V8LA 4HA8A 4DBFA 5KYNA 1TG0A 1YI2A 5GAOp 1UDLA 1SKUB 2J06A 1AHJB 1V29B 3JCMd 2HQEA 1OPLA 4X1VA 3SWNB 4BE1A 4M7AA 2FRYA 1QWEA 4QVDA 3PVLA 2O9VA 2KE9A 1G3YA 4O5VA 3Q1JA 2BZ8A 2LJ3A 3CPWA 2DIGA 1ZSZC 2K79A 3CCJT 2GQIA 3G6EA 2QQBA 3FEOA 4N0AC 3CCSA 1UG1A 1R8OB 5A0DA 1PRLC 5GMKe 3CC2T 3NMZC 3LH5A 3QG1A 1X6OA 2KYMA 1TUDA 2M0OA 2FHDA 1K73R 3V7SA 3JB9J 1QMCA 3OBWA 2DX1A 3A8HB 5GJVB 4C5GA 1Q95G 3L1AA 4Q5WA 2MYSA 5IXFA 3UA7A 5DLQE 1YFNA 2QTVA 1CSKA 3A98A 1JRIA 4PLIA 3VJPA 3LX7A 5LJ5j 5ECAA 2EGCA 3CCJA 1BKBA 1M3CA 2XHCA 4ESRA 2EGAA 1RACB 3OMGA 2V1RA 2KT1A 3CC2A 4KRTA 2LCCA 1H3HA 1PSFA 1GBRA 1YBYA 5KCOA 1AWWA 2YLCA 3P8BB 1W2BP 1AVZC 1OX8A 1KG1A 3JCMQ 3J80E 1YIJT 1M8MA 5FW9A 2ZPHB 2O4XB 3CXCS 5I2MA 4WCIA 3CCEQ 2LT1A 3QHSA 2QGFB 3NTKA 2RK1A 3OSSC 1OQKA 2RI3A 1BI0A 1VYTA 2EIFA 5J3BA 1B07A 4FT2A 4A54A 4RTYA 1LVKA 4FM4B 1NYGA 3H0IA 1VQKT 2DL7A 4FYVB 3FC3A 1IXDA 1WHHA 3CC7Q 1GFCA 4AFSC 3QZ9B 3G4SA 4M7DE 1BI2A 2DF6A 2CSIA 4FU6A 1YIJA 1AD5A 2MIOA 4LNPA 3CPWS 4DOWA 2EYXA 2YRVA 2RQTA 2OI3A 2HQXA 2I0NA 1UTIA 2ZPBB 4M77A 2NUPA 1KQ1A 1M1KU 4JS4A 2ED0A 2KT8A 1VQKA 1X01A 2KBTA 4ZN3A 2PZ1A 1X69A 3OYCA 4JUVA 3JB9G 4J7IA 1HYOA 4M7DB 1Z9ZA 4O6JA 2D9TA 3I55Q 2D8HA 2HSPA 3LWHA 4BI4A 1AWJA 2JJ9A 5GANj 1BCMA 3CCVT 1UHCA 1NYFA 1E7OA 2DL5A 3QWXX 1Q81R 1TXQA 2VVKA 3JSCA 2V8KA 2CP5A 4M78A 1NJIC 2A3LA 2CP6A 3CMAT 4M7AG 2DE0X 2XU8A 4IUPA 1KHIA 3PMIA 4R0KA 2NUTB 1IGUA 2MCNA 4Y91A 1UGVA 1S1NA 3OB9A 2LVMA 1YJ9T 2DXCA 2M51A 3SHWA 2BZYA 2ZAEA 2HSEB 2DO3A 1WHKA 2FG0A 1K1ZA 1U06A 2BZXA 3CCVA 2P0KA 1FYNA 3HTRA 3C94A 2K9GA 2F2WA 3BDUA 4EMHA 2GFUA 4JRKA 3VV0A 2D1XA 3CMAA 5KH6A 1EIFA 5IHKA 3LLRA 3QSUA 3MKDA 4HXJA 4C0DB 4KULA 1D3BA 3VRZA 1M1FA 1X43A 4M75G 5CVIA 3PT9A 4L59A 2QA4T 4KT0E 5GMKl 3RDVA 4PFPA 5GMKi 2JOYA 2F2VA 5FWBA 3P8DA 2L2PA 1TS9A 4BE0A 4ANJA 3A8GB 3CCRT 3CCLT 1QVFA 1Q82C 1HJDA 5FU7B 1KFZA 5A2QE 1BI3A 3FDRA 2XDBA 2C0IA 2QDLA 4WF2A 4C8QC 3JCMJ 1M90R 2QA4A
chains in the Genus database with same CATH topology
3HP9A 4PJOG 1OI1A 1WJRA 1YJNT 2DPPB 3RKYA 2LT4A 1N27A 2QQSA 3LW5E 5C0MA 3HPWA 2NLUA 1NPRA 3RMSA 3RMQA 5FRMA 2X4XA 4KUIA 4M77E 1IZ6A 1N6AA 4C92A 3SWNA 1G3TA 3L2QA 1VQ9A 5LJ5f 5GAOn 3OYMA 2DXUA 4Y28E 2KQWA 3T9NA 4NOYA 3R6OA 2EQKA 4PNOA 4E7IA 2PQWA 4LD9K 5GAOr 1YHQA 4OB2B 4BY6C 2RD1A 3FB9A 2PU9B 4X9DA 2X4JA 3CCRA 3CCLA 3OYAA 2K2VA 3JCMP 2RI5A 3L2ZA 1NE8A 4C8QG 4XTVA 4C5IA 4DOVA 4DA4A 3C95A 2MWPA 1M9SA 3V7RA 3VKIA 1VQMA 4HCBA 4NL2A 2AHJB 5GAN8 4X34A 2OTJT 1NJIC 4XK8E 5GMKh 2DTHA 3EFSA 4II1A 2VXEA 4XQ3A 5I21A 2IVWA 2FVUA 3OYHA 3QJ6A 2E6ZA 1Y7XA 2ZPEB 5D6WA 2DIQA 4M78E 2E64A 4C92G 2XDDA 3LWIA 4JRPA 3OS5A 1XNIA 4KBMB 1G3SA 3GPLA 3OQ5A 4IUTA 4M77B 2XI9A 4PKCC 4XU0A 5D6YA 4IURA 3WXMB 5C6SA 1M4ZA 1IREB 3VYGA 3V8KA 3OA6A 2QA4A 4TVRA 1RI0A 2EKOA 2HBPA 5GAOm 1N9SA 3JRZA 1YITA 1VQNT 2E6NA 1QW1A 5GANe 2RH2A 4GLKA 2R5MA 5GMKj 3JB9F 1UGPB 2XD0A 2I2LA 2Y4YA 1JB0E 2JNGA 4M75E 2DXTA 3BY7A 4M7DF 5CKEA 4D6WA 2XIDA 3DB4A 3E9FA 1UEBA 3GNFB 2F5KA 3HFNA 3GF5A 1Q86U 2EYQA 2F5TX 4PJOA 4LDVA 3ER0A 2CS7A 2K5LA 5GAN7 3JB9D 3CBPA 3C4SA 2E1HA 3PTAA 4XTWA 1LNXA 2CZ1B 4JS5A 4M77F 4M7AF 2P0PA 4M7DD 4LDYA 3CC7T 5FROA 2RJDA 1N9RA 2KMTA 4M78B 1DJ7B 2XK0A 2CZ7B 1PSEA 3ME9A 1Q86C 1I5LA 4OB3B 1KQSA 4HKEA 4QQGA 3CCQA 2VV5A 3JB9H 2HAXA 1QVGA 5CR2A 4OGEA 3MCAB 3LGFA 3NTIA 3CCEA 4LD6A 3OYGA 2O4XA 1WJQA 2JVVA 1WJSA 5A0GA 2V8IA 4M77D 4M7AD 3H8ZA 4MZMA 1VQNA 3A8MB 3CEYA 3UWNA 3OYYA 4QQ6A 2XICA 3G71A 4M75B 2P4TA 2DZCA 2RI2A 2DJZA 4OB0B 3RIRA 2VC8A 2XG8D 4PJOE 3JCMg 3BFMA 3CPFA 5CO7A 4V2SA 1Q81U 2RJCA 3MEVA 2JTFA 1WPYA 3SDZA 3M54A 4A4KA 5HKCA 3OS0A 1B34A 2VUBA 1QVFS 2P0QA 4BD3A 2E12A 3CMEA 1K8AC 5GANd 3OYEA 3I56T 4M78F 4RG8A 2K5IA 1VQ9T 3OS2A 1UB4A 2LNVA 3ZFJA 3CBMA 3EAEA 4JLGA 4EMKC 2X4YA 3JCMV 2R57A 3RUXA 5KCHA 1MGQA 1Y07A 2Y90A 5CQXA 5I2SA 3CC7A 2KVQG 4ZGEB 1JBMA 3QO3A 5HY6A 2JUFA 3MP1A 1Q81C 4BUGA 3A8LB 2EQJA 4EMGA 3I55T 3GNGA 1K73C 1N8RU 4QVZA 1U1SA 4M75F 2KK4A 4C8QE 4OGCA 4F7UA 4JRQA 4HT8A 3QXEB 4M78D 5FU7C 3V8JA 4C5EA 3JCMW 4BB7A 1WNLA 4IKFA 1D3BB 2CZ0B 1GXIE 5GAMh 3OYJA 4J6YA 4HCCA 2F69A 2O01E 5CCAA 5FRNA 2A7YA 2KY9A 3ASKA 3KUFA 2WSEE 2RM4A 5D6XA 4LDUA 1KC8U 1Y96B 4XTZA 5LJ5d 4RMOA 4PJOB 2C06A 4C92E 3CXCA 2MWOA 4M75D 2BKDN 1XOVA 1JJ2A 3WVDB 2LRQA 5HK3A 1N8RC 3E9GA 1O9SA 2DZ9A 3KBGA 2B8AA 3P8HA 5LJ3e 3VU3C 1Y71A 3X24B 3S3MA 2E10A 1FWZA 5GAMj 1P92A 3O8VA 2E5QA 2L3RA 1VQPA 3SD4A 3I56A 4ME7A 3TREA 1H641 1YITT 3S3OA 4OB1B 2XKOC 3DLLA 4R56A 1KC8C 3M56A 2JN0A 3E19A 4CI0C 2LX9A 2MF2A 4F7UG 2K57A 2EQUA 3RKWA 5A0LA 4PLLA 3CCST 2RK2A 3RESA 4C8QB 3I55A 5EG2A 5GAN6 2LC4A 4FL6A 3GLXA 4A4FA 5CKFA 4HT9A 3V8LA 1KQSS 4HA8A 3VUZA 4M7DC 1WGSA 2R5AA 3M4YA 4PJOF 4QVCA 4B9WA 4E7KA 1YI2A 3QDRB 4FIBA 5GAOp 4ZGDB 3CBOA 5GANg 1AHJB 1QVPA 2CGHA 1V29B 2X4WA 3JCMd 2HQEA 2PVDB 3FLGA 4L6V5 3JB9I 2EJFA 4C92B 4FSXA 3SWNB 4ZGJB 1BIAA 2EAYA 3OSVA 4BE1A 2LTOA 4M7AA 2YLBA 4QVDA 3QPHA 2PUOB 3M53A 4M77C 1G3YA 4M7AC 3QJYA 4PJOD 4O5VA 3Q1JA 2QQAA 3V7CA 2ZPFB 4BY6B 3CPWA 3OW2A 5DY9A 1U8RA 3CCQT 2RA2A 1LOJA 3CCET 1U1TA 4J6WA 1Q7YU 2DD4A 2DIGA 5GAN3 2DK3A 2ZPGB 2K3YA 1S72T 4C8QF 3G71T 2PVOB 2LCLA 1M90U 1O75A 3N5BB 2XDPA 3TEEA 3CCJT 4RCBA 1G5VA 3G6EA 1WQWA 1UGRB 2QQBA 2FYKA 3FEOA 3META 4N0AC 5LJ5g 4JLIA 3CCSA 4LDWA 1R8OB 5A0DA 1KHCA 5HK0A 3E1SA 5GAOl 3NTHA 5GMKe 3CC2T 3CMET 4C92F 3QG1A 4JRIA 1QVGS 1X6OA 2L5QA 1VIEA 4C8QD 2PUKB 2M0OA 2FHDA 3H6ZA 1I4K1 4YTLA 5LJ3f 3V7SA 2WSFE 4E47A 5GAOq 3JCMc 4N4HA 4BE2A 3TCJA 2CZ6B 1YCYA 3VYHB 3OBWA 5LJ5h 2WSCE 4IUVA 5CKHA 5FU6B 3A8HB 5IAYA 4M78C 3UDCA 3HHTB 4C5GA 3L1AA 1M90C 5IN1A 1YJWT 4Q5WA 2JZ2A 4RKUE 2YHTA 5DLQE 2X35A 4C92D 1ZBXA 1VIFA 2OTLA 2MI6A 3LGLA 5GAMf 3X28B 2E41A 4LDXA 3J81E 1JRIA 3CCMA 4M75C 1S72A 4PLIA 4UC4A 4C0DC 3VJPA 3BW1A 3LX7A 3INZA 5LJ5j 2K5FA 1VQ5T 3CCJA 3CCUA 5CKDA 1BKBA 3SFMA 2EJ9A 5IT9E 4XAXB 1VQLT 3CD6T 2XHCA 4MMLA 3HSBA 4NS5A 1FXXA 3MEUA 4J5YA 4MZTA 3OMGA 3JAME 2K3XA 1VQ8T 3CC2A 1VQPT 4EPCA 2LCCA 2M16A 1PSFA 1JJ2S 3QKJA 4EMKA 5J39A 1YBYA 5GMKm 4J7FA 5KCOA 3FIFA 2YLCA 1VQOT 2M1HA 2MMPA 3P8BB 3JCMh 1ZQ1A 1LJOA 2E65A 2ZPIB 4OP0A 4ATOA 1KG1A 3JCMQ 2BIVA 3NFCA 3J80E 2GF7A 4F7UE 3CMAT 1YIJT 2JTMA 4CRIA 2ZPHB 4A4GA 1YJWA 3S3NA 1OYXA 2O4XB 3VUBA 3CXCS 3HRUA 3DB3A 5I2MA 4VUBA 2QQRA 2LT1A 2M9UA 2RHYA 2VXFA 5AYFA 2DVEA 3QHSA 3L2VA 3NTKA 2RK1A 3OSSC 3F70A 4RCCA 1YJ9A 2RI3A 2QEXT 1YI2T 1BI0A 3L42A 4ZN1A 2EIFA 3PMTA 5J3BA 2KDSA 1W4SA 4PJOC 5GAN4 4FT2A 1BIBA 1G3WA 1B34B 1VQ5A 2V8JA 3HKSA 4A54A 3OY9A 4ZTJA 3CD6A 1VQLA 1BYMA 3MP6A 2MAMA 3MEAA 4MDWA 1UGSB 2LDMA 1K9MU 4FM4B 3OYKA 3M55A 1VQ8A 2ZGWA 1OZ2A 1VQKT 3QYGB 4X9CA 2QI2A 5CIUA 3FC3A 3J7AF 4BI3A 1VQOA 4PL6A 3QZ9B 5FLXE 3G4SA 4M7DE 2WACA 4F7UB 2H3JA 1BI2A 3JCMb 3OYFA 4FU6A 3L2UA 4C0ZA 4QW2A 3G6ET 1YIJA 1WQ7A 4L5GA 5GAMe 2D6FA 3PIPA 1XQHA 4M7DA 3M9QA 2EJGA 1I81A 2QXFA 5DM7R 4XTUA 3OW2S 3CPWS 4C0GA 4OMFB 3L2RA 1HXDA 4OVAA 4DOWA 2QEXA 4M7AE 1W2BA 1FX7A 3M59A 3QIIA 3OMCA 3QZ5B 2YRVA 2FL7A 4C92C 3ZBDA 3LH0A 3SWNC 2DTIA 2HQXA 2DTOA 1KD1U 2ZPBB 4M77A 2G3RA 1UGQB 3PFSA 3OYBA 4HCZA 1KQ1A 4IUQA 2E70A 2QQ9A 1M5Q1 3A5ZB 4OF1A 4GY5A 4JS4A 2R58A 4A4EA 4F7UF 5GANh 2OTLT 4KUDK 2RHZA 1VQKA 1QP2A 1X01A 3PGGA 4N4IA 2RO0A 4ZN3A 3OYCA 4JUVA 3JB9G 1M1KU 4J7IA 3CCMT 2Y4XA 1RL2A 2RJEA 3G7ZA 2VGMA 4O6JA 1NJIU 4M7DB 2KAFA 2D9TA 4E7HA 3FRNA 1KD1C 4M7DG 3CCUT 4J8OA 4N0AA 2EWNA 3LWHA 5LJ3d 2LQ8A 2VYTA 4BI4A 3X20B 3BDLA 1X75C 3FJPA 3QBYA 3OYNA 1M1KC 3HRTA 4E7JA 4BI8B 1VQ6A 2VGNA 5GANj 4MMKA 3CCVT 3OS1A 1SSFA 3M5AA 5LL6S 1VQ4A 1YJNA 2EFIA 2HD0A 3MHXA 4A53A 3OYIA 3X25B 1Q7YC 2PVGB 4M7AB 4N4GA 4RG2A 3JCMf 5KE3A 4M77G 3JSCA 2V8KA 2EQMA 3A8OB 2BUDA 2A3LA 4M78A 4FT4A 4QQDA 4XTXA 5FU6C 4C5HA 4BDZA 5GAMd 2RHUA 5CK9A 3RKXA 2XU8A 3RERA 4IUPA 1KHIA 1QP3A 1VQ4T 1VQ7T 2CYZB 3CC4T 1NZ9A 3PMIA 5KE2A 3EFRA 4Y91A 3GIBA 2QTXA 3OB9A 3AHUA 3MP8A 4XTYA 4M75A 3PNWC 2LVMA 4ZTFA 4XU2A 1YJ9T 5GAN5 2DXCA 4XU3A 3MO8A 4BACA 3PIOA 2D0QB 4MDXA 1OZ3A 1I8FA 2DXBA 2OTJA 2DO3A 3HFOA 5CQYA 3UPUA 4A4HA 1M1GA 3JB9J 3QUIA 2DEQA 4B9XA 3JCMX 3CCVA 2P0KA 1M8VA 5LJ5e 3C94A 4M78G 3BDUA 3M57A 5L8RE 4EMHA 2FB7A 2GFUA 4JRKA 4BDYA 3VV0A 3DLMA 3CMAA 2RHIA 1K8AU 5KH6A 3G4ST 1EIFA 3DKMA 1KQ2A 4J6XA 3LLRA 3QSUA 2LQKA 1VQ7A 4C0DB 3MEWA 2RJFA 4KULA 3CC4A 2L8DA 1D3BA 2KSSA 1M1FA 4M75G 4MZPA 5CKBA 3PT9A 2ZZDA 3QYHB 1MHNA 4L59A 5CVIA 3WVEB 5LJ3g 2QA4T 4ELZC 2RHXA 4ELYC 4KT0E 5GMKl 1K73U 3TU4K 5DLOA 1Y96A 3M58A 4P5NA 3URGA 5GMKi 2GQVA 2OAUA 2JOYA 2DAQA 3L2WA 4E7LA 1VUBA 1NPPA 2DKGA 1Q82U 1H3ZA 5LJ3h 3P8DA 5GAN2 4JJNK 2GCXA 2K4YA 2GFAA 4IUUA 1XTDA 4EMKB 5GAMg 3HL8A 4R55A 4BE0A 1YHQT 1BI1A 4DQ2A 3A8GB 4C0FA 3JCMe 4M7AG 5GANf 3UT1A 3CCRT 3CCLT 3OYLA 3GP8A 3HRSA 3X26B 1QVFA 4XU1A 3ZEHA 2QDYB 4JDSA 4NL3A 4J83A 1TH7A 1Q82C 2CKKA 5FU7B 1W2BS 3M4GA 3OBYA 5LJ3j 1VQMT 5CAIA 5A2QE 3LYIA 1ZHIA 3GOXA 4C8QA 2RB6A 4Z02A 3SB2A 2IG0A 1BI3A 2DD5A 3FDRA 2ZCFB 4WF2A 2XDBA 4EDUA 3C12A 4C8QC 3JCMJ 5J26A 1HK9A 2L89A 1K9MC 1VQ6T 3OYDA 2HNIA 3KXTA 3S6WA 5M9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN T;  1OI1 A;  1WJR A;  3PIP A;  1N27 A;  2QQS A;  5C0M A;  5FRM A;  2NLU A;  1NPR A;  2X4X A;  1IZ6 A;  3L2Q A;  1VQ9 A;  3OYM A;  2EQK A;  4E7I A;  2PQW A;  1YHQ A;  3CCR A;  3CCL A;  3OYA A;  2RI5 A;  4C5I A;  2MWP A;  1VQM A;  4X34 A;  2OTJ T;  4II1 A;  3OYH A;  3QJ6 A;  2E6Z A;  5D6W A;  2DIQ A;  1XNI A;  3OQ5 A;  1KQS A;  4IUT A;  5D6Y A;  4IUR A;  5C6S A;  3OA6 A;  4TVR A;  1RI0 A;  2EKO A;  1YIT A;  1VQN T;  2E6N A;  2R5M A;  2JNG A;  3DB4 A;  3E9F A;  1UEB A;  2F5K A;  1Q86 U;  3ER0 A;  3C4S A;  3CC7 T;  5FRO A;  2RJD A;  2XK0 A;  1Q86 C;  3ME9 A;  4QQG A;  3CCQ A;  1QVG A;  3NTI A;  3LGF A;  3CCE A;  4LD6 A;  3OYG A;  2O4X A;  1WJQ A;  2JVV A;  1WJS A;  3H8Z A;  1VQN A;  3G71 A;  3CEY A;  3UWN A;  3OYY A;  4QQ6 A;  2RI2 A;  3CPF A;  1Q81 U;  2RJC A;  3MEV A;  2JTF A;  1QVF S;  3OS0 A;  3CME A;  4BD3 A;  1K8A C;  3I56 T;  1VQ9 T;  3OYE A;  3OS2 A;  3EAE A;  2X4Y A;  2R57 A;  5KCH A;  3CC7 A;  2KVQ G;  5HY6 A;  2JUF A;  3MP1 A;  1Q81 C;  1K73 C;  1JJ2 S;  2EQJ A;  3I55 T;  1N8R U;  4QVZ A;  4C5E A;  4IKF A;  3OYJ A;  5FRN A;  3ASK A;  3KUF A;  5D6X A;  1KC8 U;  3CXC A;  2MWO A;  2BKD N;  1JJ2 A;  1N8R C;  2LRQ A;  3E9G A;  3KBG A;  2B8A A;  3P8H A;  3S3M A;  1VQP A;  3O8V A;  2L3R A;  2E5Q A;  3SD4 A;  3I56 A;  3TRE A;  1YIT T;  3S3O A;  3DLL A;  1KC8 C;  2EQU A;  3CCS T;  4PLL A;  3I55 A;  4FL6 A;  4A4F A;  1KQS S;  1WGS A;  2R5A A;  4B9W A;  4E7K A;  1YI2 A;  2X4W A;  2HQE A;  3FLG A;  4BE1 A;  2LTO A;  3Q1J A;  3OW2 A;  3CPW A;  3CCQ T;  3CCE T;  1Q7Y U;  2DIG A;  2K3Y A;  1S72 T;  3G71 T;  2LCL A;  1M90 U;  2XDP A;  3CCJ T;  1G5V A;  3G6E A;  3FEO A;  3MET A;  3CCS A;  1KHC A;  3CC2 T;  3NTH A;  3CME T;  1QVG S;  1X6O A;  2M0O A;  2FHD A;  3H6Z A;  4N4H A;  4BE2 A;  4IUV A;  5IAY A;  4C5G A;  5IN1 A;  1YJW T;  4Q5W A;  2JZ2 A;  5DLQ E;  2X35 A;  2OTL A;  2MI6 A;  3LGL A;  3J81 E;  3CCM A;  1S72 A;  4PLI A;  4UC4 A;  3LX7 A;  1VQ5 T;  3CCJ A;  3CCU A;  1BKB A;  5IT9 E;  3CD6 T;  1VQL T;  2XHC A;  4NS5 A;  3MEU A;  3OMG A;  3JAM E;  2K3X A;  1VQ8 T;  3CC2 A;  1VQP T;  2LCC A;  2M16 A;  3QKJ A;  5J39 A;  1YBY A;  5KCO A;  1VQO T;  3P8B B;  2M1H A;  2BIV A;  3J80 E;  2GF7 A;  1YIJ T;  4CRI A;  1YJW A;  4A4G A;  3S3N A;  1OYX A;  2O4X B;  3CXC S;  3DB3 A;  2QQR A;  2RHY A;  3L2V A;  3NTK A;  3F70 A;  1YJ9 A;  2QEX T;  1YI2 T;  2RI3 A;  3L42 A;  4ZN1 A;  2EIF A;  3PMT A;  5J3B A;  2KDS A;  1VQ5 A;  3HKS A;  3OY9 A;  4ZTJ A;  3CD6 A;  1VQL A;  3MP6 A;  3MEA A;  1K9M U;  2LDM A;  3OYK A;  1VQ8 A;  1OZ2 A;  1VQK T;  5CIU A;  3FC3 A;  3J7A F;  1VQO A;  4PL6 A;  5FLX E;  3G4S A;  2WAC A;  3OYF A;  3L2U A;  4FU6 A;  1YIJ A;  3G6E T;  4QW2 A;  3M9Q A;  5DM7 R;  3OW2 S;  3CPW S;  3L2R A;  4OVA A;  2QEX A;  1W2B A;  3QII A;  3OMC A;  2YRV A;  3LH0 A;  2HQX A;  1KD1 U;  2G3R A;  3PFS A;  3OYB A;  4HCZ A;  1M1K U;  4IUQ A;  2E70 A;  3A5Z B;  4GY5 A;  2R58 A;  2OTL T;  4A4E A;  2RHZ A;  1VQK A;  4ZN3 A;  2RO0 A;  4N4I A;  3OYC A;  3CCM T;  1RL2 A;  2RJE A;  1NJI U;  2D9T A;  4E7H A;  1KD1 C;  3CCU T;  2LQ8 A;  2VYT A;  3BDL A;  3QBY A;  3OYN A;  1M1K C;  4E7J A;  1VQ6 A;  3CCV T;  1VQ4 A;  3OS1 A;  1SSF A;  5LL6 S;  1YJN A;  2EFI A;  3OYI A;  1Q7Y C;  4N4G A;  4RG2 A;  5KE3 A;  4QQD A;  1NJI C;  3CMA T;  2EQM A;  4C5H A;  1M90 C;  2BUD A;  3OYD A;  4BDZ A;  2RHU A;  4IUP A;  1KHI A;  1VQ7 T;  3CC4 T;  1NZ9 A;  3PMI A;  5KE2 A;  3OB9 A;  3MP8 A;  4ZTF A;  3PNW C;  2LVM A;  1YJ9 T;  3MO8 A;  4BAC A;  3PIO A;  1OZ3 A;  2OTJ A;  2DO3 A;  4A4H A;  1M1G A;  4B9X A;  3CCV A;  2P0K A;  2GFU A;  4BDY A;  3DLM A;  3CMA A;  1K8A U;  2RHI A;  5KH6 A;  3G4S T;  1EIF A;  3LLR A;  1VQ7 A;  3MEW A;  2RJF A;  3S6W A;  3CC4 A;  2L8D A;  4YTL A;  1MHN A;  4L59 A;  2QA4 T;  2RHX A;  1K73 U;  2JOY A;  2DAQ A;  3L2W A;  1Q82 U;  4E7L A;  1NPP A;  1H3Z A;  3P8D A;  2GFA A;  4IUU A;  1XTD A;  4BE0 A;  1YHQ T;  3UT1 A;  3CCR T;  3CCL T;  3OYL A;  1QVF A;  3ZEH A;  1Q82 C;  2CKK A;  1W2B S;  1VQM T;  5A2Q E;  3LYI A;  3GOX A;  4Z02 A;  2IG0 A;  3FDR A;  4EDU A;  5J26 A;  2L89 A;  1K9M C;  1VQ6 T;  2QA4 A;  1VQ4 T;  5M9O A; 
#chains in the Genus database with same CATH topology
 4PJO G;  1WJR A;  2B86 A;  1YJN T;  1N27 A;  3LW5 E;  2LQW A;  4KUI A;  3VS1 A;  4C92 A;  2GBQ A;  1SF9 A;  3OYM A;  1VQL Q;  3CD6 Q;  2DXU A;  3EHR A;  4NOY A;  3R6O A;  2EQK A;  4PNO A;  2KEA A;  4E7I A;  3FB9 A;  3RBB B;  2V26 A;  3CCR A;  3CCL A;  1GRI A;  2J6O A;  3JCM P;  3EFO A;  1VYV A;  1NE8 A;  4C8Q G;  1YWP A;  5I11 A;  4QT7 A;  1BCO A;  4NL2 A;  4CC4 B;  4XK8 E;  3A1P A;  3AT1 B;  4II1 A;  1TTH B;  1Y7X A;  2XDD A;  3LWI A;  2L3P A;  3OS5 A;  3GPL A;  5D6Y A;  3WXM B;  1KQS A;  5C6S A;  3H0F A;  1IRE B;  3QWY A;  2CT4 A;  3JRZ A;  1F1B B;  1QCN A;  1ZSZ B;  5GMK j;  1UGP B;  2L0A A;  2Y4Y A;  4AFU C;  2M0Y A;  3BY7 A;  1PC0 A;  5FWC A;  2F5K A;  4KH1 B;  1YWO A;  2F5T X;  2EYQ A;  4LDV A;  3GBQ A;  3M0T A;  5GAN 7;  1RI9 A;  2HKQ B;  2YRC A;  1VQ6 Q;  4M77 F;  2AT1 B;  4LDY A;  1JO8 A;  5FRO A;  4OMM A;  2JM8 A;  2XK0 A;  4OMO A;  1Q86 C;  3JB9 H;  1K9M R;  3NTI A;  1K0X A;  4LD6 A;  3OYG A;  5A0G A;  2V8I A;  1D1B A;  4M77 D;  3CEY A;  4QQ6 A;  2DZC A;  5KYY B;  2OTL Q;  2JXB A;  4RTT A;  4JZ4 A;  2KRN A;  3CCM Q;  5CO7 A;  1QVF S;  2DIL A;  3CME A;  1LPL A;  2E3I A;  3I56 T;  4M78 F;  3CBM A;  4AFZ C;  4EMK C;  2X4Y A;  3R6N A;  1MGQ A;  1Y07 A;  5CQX A;  1MMA A;  3EHQ A;  3MP1 A;  1K73 C;  4PJL A;  4HT8 A;  3EG9 A;  4OGC A;  2RF0 A;  3QXE B;  4M78 D;  4C5E A;  1WNL A;  2DMO A;  3OW2 P;  1KQS P;  2YDL A;  3CC4 Q;  4HCC A;  3H0H A;  2O01 E;  2A7Y A;  2J6F A;  3KUF A;  1KC8 U;  4LDU A;  1NJI R;  2C06 A;  1N8R C;  1WFW A;  1O9S A;  1FWZ A;  3O8V A;  2E5Q A;  4PFZ A;  3I56 A;  1WI7 A;  5IXB A;  3S3O A;  4OB1 B;  4IIO A;  4R56 A;  3TVT A;  3H9N A;  1W1F A;  2EQU A;  3RKW A;  3RES A;  5GAN 6;  4FL6 A;  2CH4 W;  5CKF A;  4HT9 A;  1KQS S;  4M7D C;  3THK A;  3M4Y A;  2JTE A;  1LCK A;  3CBO A;  2PVD B;  3UA6 A;  4FSX A;  1BIA A;  2EAY A;  2O9S A;  1IO6 A;  3QPH A;  3EG3 A;  1VQ9 Q;  3QJY A;  2ZPF B;  5DY9 A;  2ROL A;  4KGV B;  2RA2 A;  1Q7Y U;  2DD4 A;  5GAN 3;  2DK3 A;  2C0T A;  4GBQ A;  1S72 T;  2RNA A;  3G71 T;  2LCL A;  1O75 A;  2XDP A;  1K8A R;  1WQW A;  2DEU A;  4JLI A;  2DRM A;  1VQM Q;  5HK0 A;  5GAO l;  1WYX A;  4C92 F;  1VIE A;  3H6Z A;  1I4K 1;  4E47 A;  5GAO q;  2LNH B;  4N4H A;  3JCM c;  2CZ6 B;  1VQ4 Q;  2EYW A;  1Q82 R;  1YJW T;  2YRD A;  3M0Q A;  4C92 D;  1ZBX A;  2OTL A;  4KGX B;  1YIT Q;  3LGL A;  3X28 B;  2QGG A;  1RAE B;  4LDX A;  3J81 E;  3CCM A;  1S72 A;  4C0D C;  3INZ A;  1NBE B;  1N5Z A;  3PVQ A;  1VQ5 T;  2W0Z A;  5CKD A;  2KRS A;  2EJ9 A;  3C0C A;  4MML A;  3HSB A;  4NS5 A;  4J5Y A;  1KJW A;  1VQP T;  2M16 A;  5J39 A;  1RLQ C;  2M1H A;  3IQL A;  2ZPI B;  3NFC A;  9ATC B;  4F7U E;  2JTM A;  1YJW A;  3S3N A;  1OYX A;  3VUB A;  5EC7 A;  2HZY A;  2M9U A;  2DER A;  2DYI A;  2RQW A;  4RCC A;  2SRC A;  1YI2 T;  1AWO A;  5KYU B;  3L42 A;  2KGT A;  2D8J A;  1B34 B;  1IHV A;  1VQ5 A;  2V8J A;  2MAM A;  3MEA A;  1PKS A;  3OYK A;  3M55 A;  2ZGW A;  1OZ2 A;  2QI2 A;  5CIU A;  4BI3 A;  4PL6 A;  4F7U B;  3OYF A;  3L2U A;  2K7A A;  3G6E T;  4L5G A;  3M9Q A;  8ATC B;  1I81 A;  1V76 A;  1HXD A;  2F2X A;  1AEY A;  1W2B A;  1FX7 A;  3QII A;  1Q86 R;  3QZ5 B;  2DLP A;  3LH0 A;  2DTO A;  1IRX A;  1UGQ B;  3OYB A;  2E3H A;  2E70 A;  3A5Z B;  2R58 A;  4KUD K;  2V1Q A;  2EVR A;  3TSW A;  2Y4X A;  1X27 A;  1RL2 A;  4LUE A;  2RJE A;  2VGM A;  4J8O A;  4AT1 B;  2LQ8 A;  3X20 B;  1H92 A;  1M1K C;  2VGN A;  1VQ4 A;  3M5A A;  5LL6 S;  2HL3 A;  3VS2 A;  3MHX A;  4A53 A;  1PG5 B;  2E5K A;  2PVG B;  1I0C A;  5KE3 A;  4XTX A;  3A8O B;  2EQM A;  4C5H A;  2BUD A;  1M90 C;  4FT4 A;  3RER A;  1QP3 A;  2IPO B;  4CC7 A;  2CYZ B;  2QK0 A;  1SPK A;  3EFR A;  4Y92 A;  3GIB A;  2L3Q A;  1D1C A;  4M75 A;  5D7U A;  5GAN 5;  1N8R R;  2MK5 A;  1PHT A;  3PIO A;  4HVW A;  1OZ3 A;  2DXB A;  5CQY A;  3RNJ A;  3QUI A;  1GCQ C;  2DEQ A;  2VKN A;  2YSQ A;  3VRY A;  2CP0 A;  4BDY A;  3DLM A;  3G4S T;  1U3O A;  3MEW A;  3CCQ Q;  2L8D A;  2KSS A;  4ELZ C;  1ABO A;  1T3S A;  5DLO A;  4PJO A;  1I1J A;  1E6H A;  4E7L A;  2DFU A;  2DKG A;  2X9H A;  1W6X A;  2GCX A;  5GAM g;  4EMK B;  2QG9 B;  3HL8 A;  2J05 A;  4DQ2 A;  3UT1 A;  3D7S B;  1GFD A;  3GP8 A;  4J83 A;  1W2B S;  3OBY A;  5CAI A;  1ZHI A;  4C8Q A;  1IHW A;  2IG0 A;  1HK9 A;  2JS0 A;  1K9M C;  3KXT A;  3S6W A;  5M9O A;  1OI1 A;  3PIP A;  5FRM A;  1FMK A;  3RMQ A;  2NLU A;  3RMS A;  2LCS A;  1N6A A;  3SWN A;  3JV3 A;  3L2Q A;  1B7T A;  2EQI A;  2DET A;  8AT1 B;  4Y28 E;  2C0O A;  2FPF A;  2A08 A;  2CUD A;  1FMW A;  1VQ8 Q;  4LD9 K;  1NLO C;  2LX7 A;  2GNC A;  2PU9 B;  3I5R A;  1VQO Q;  3OYA A;  3L2Z A;  3EGD B;  2COW A;  1KIK A;  4DA4 A;  2MWP A;  2O88 A;  1M9S A;  4E7Z A;  1BB9 A;  4HCB A;  2AHJ B;  4X34 A;  3VS5 A;  5I21 A;  2FVU A;  2QEX Q;  3QJ6 A;  2E6Z A;  5D6W A;  1XNI A;  4KBM B;  1G3S A;  1X2K A;  4IUT A;  4XU0 A;  1SHF A;  1JQQ A;  3VYG A;  2YUN A;  1RI0 A;  2EKO A;  1N9S A;  1J3T A;  2E6N A;  3JB9 F;  2R5M A;  2XD0 A;  2YUQ A;  1JB0 E;  2JNG A;  4M4Z A;  2DXT A;  1EFN A;  1RAB B;  5CKE A;  4D6W A;  3GNF B;  3E9F A;  2HMA A;  3UAT A;  1AOJ A;  3M0S A;  1AWX A;  2VWF A;  1PNJ A;  2CS7 A;  2K5L A;  3JB9 D;  5KYW B;  4FW1 A;  4M7A F;  1TUC A;  2P0P A;  1YJN Q;  2YT6 A;  1G8X A;  3CC7 T;  4DEX A;  2HL5 C;  1N9R A;  2KMT A;  1PSE A;  3E2U A;  3ME9 A;  1I5L A;  1UJ0 A;  1NEB A;  4HKE A;  4K11 A;  3CCQ A;  1C1A A;  1OU9 A;  3CCE A;  1Y0M A;  2O4X A;  1WJS A;  2HDA A;  4M7A D;  3H8Z A;  4MZM A;  3A8M B;  2ESW A;  3OYY A;  4LE9 A;  4PJM A;  4JJC A;  1SEM A;  3RIR A;  2XG8 D;  3JCM g;  3CPF A;  2K3B A;  3VS0 A;  4A4K A;  5HKC A;  4KH0 B;  2P0Q A;  4BD3 A;  3CCU Q;  1RAF B;  1K8A C;  4RG8 A;  2HQH A;  1UB4 A;  3EAE A;  4JLG A;  2RPN A;  4RTW A;  2HCK A;  3RUX A;  4J9G A;  3CC7 A;  5I2S A;  3QO3 A;  5HY6 A;  5L23 A;  3I55 T;  4QVZ A;  4M75 F;  2DBK A;  2KK4 A;  1NLP C;  1M1K R;  1VQ7 Q;  2GGR A;  3OYJ A;  1RAA B;  2F69 A;  1QCO A;  1UEC A;  2H3E B;  1Y96 B;  4RMO A;  3NGP A;  4M75 D;  2BKD N;  2LRQ A;  1Z9Q A;  3E9G A;  2B8A A;  3H41 A;  1Y71 A;  3X24 B;  3S3M A;  2E10 A;  3SD4 A;  4ME7 A;  4OMN A;  2XKO C;  1OOT A;  1KC8 C;  3M56 A;  3VS4 A;  4CI0 C;  4F7U G;  2K57 A;  4PLL A;  3I55 A;  5EG2 A;  2LC4 A;  2AKL A;  3VUZ A;  4PJO F;  1C6V X;  4B9W A;  1R77 A;  2DL4 A;  2FRW A;  5GAN g;  1QVP A;  2X4W A;  3FLG A;  4L6V 5;  3JB9 I;  3OSV A;  2PUO B;  3M53 A;  4M77 C;  4PJO D;  1U8R A;  3V7C A;  4BY6 B;  3M0R A;  3OW2 A;  1LOJ A;  1U1T A;  2ZPG B;  2ATC B;  2K3Y A;  2X3W D;  1R0B G;  1YHQ Q;  1WLP B;  4C8Q F;  2PVO B;  2P4R A;  3N5B B;  3BE3 A;  3TEE A;  1RAG B;  4RCB A;  4J9I A;  1G83 A;  2DJQ A;  4D8K A;  3MET A;  1I5O B;  3E1S A;  3NTH A;  3CME T;  4JRI A;  2L5Q A;  4C8Q D;  1BK2 A;  2WSF E;  1QWF A;  4BE2 A;  3TCJ A;  1YCY A;  2OJ2 A;  5IAY A;  4J9B A;  4M78 C;  1WHM A;  5IN1 A;  1MV0 B;  4A63 B;  2JZ2 A;  4RKU E;  2YHT A;  2MI6 A;  5GAM f;  2BE9 B;  2E41 A;  2IIM A;  4UC4 A;  2K5F A;  3CCU A;  1PRM C;  2DM1 A;  3CD6 T;  1VQL T;  3EG2 A;  4D8D A;  2DNU A;  2OTJ Q;  4EPC A;  3QKJ A;  5GMK m;  4J7F A;  3FIF A;  4ATO A;  2GF7 A;  1NM7 A;  3DB3 A;  2QQR A;  2RHY A;  5AYF A;  1D0Y A;  3L2V A;  1RLP C;  1VQN Q;  1G2B A;  3F70 A;  3SEM A;  2L3S A;  1M3A A;  3PMT A;  3TSZ A;  5GAN 4;  4CC2 A;  3HKS A;  1ZUK A;  4ZTJ A;  3PE0 A;  3CD6 A;  1VQL A;  3NPF A;  1UGS B;  2FZK B;  4X9C A;  2DL8 A;  1IGQ A;  1WA7 A;  3J7A F;  3EGX B;  2H3J A;  6AT1 B;  4FYW B;  2EJG A;  2XMF A;  2QXF A;  3OW2 S;  4OMF B;  3L2R A;  4OVA A;  4M7A E;  1IB8 A;  1SG5 A;  2FL7 A;  4C92 C;  3ZBD A;  4DBH A;  3I5S A;  2E4H A;  1KD1 U;  1X6B A;  2LJ1 A;  4HCZ A;  4IUQ A;  2QQ9 A;  4GY5 A;  4A4E A;  2OTL T;  1ZSZ A;  1QP2 A;  2RO0 A;  5KYX B;  3CCM T;  1M2V B;  4M7D G;  4N0A A;  2VYT A;  3BDL A;  3FJP A;  3QBY A;  3OYN A;  1E6G A;  3HRT A;  4E7J A;  4BI8 B;  1VQ6 A;  4MMK A;  3OS1 A;  2NYS A;  4J9E A;  3I9Q A;  2EFI A;  2HD0 A;  3EG0 A;  2AIR B;  4M7A B;  2AK5 A;  4N4G A;  3JCM f;  5FU6 C;  1H8K A;  4BDZ A;  5GAM d;  5CK9 A;  1ZLM A;  3RKX A;  2A37 A;  5IH2 A;  1D0X A;  3CC4 T;  1NZ9 A;  3RR6 A;  1MUZ A;  2EW3 A;  5KE2 A;  2JMC A;  4JPB W;  3QDF A;  4JJB A;  3AHU A;  1QKW A;  5KYY A;  3MO8 A;  4BAC A;  2RN8 A;  1ABQ A;  3VS3 A;  3CCS Q;  2OTJ A;  1PKT A;  3HFO A;  3UPU A;  1M1G A;  1ZX6 A;  2EYZ A;  1K4U S;  1D1A A;  4B9X A;  1KC8 R;  1M8V A;  2YUO A;  1MMN A;  3M57 A;  5L8R E;  2FB7 A;  4AG1 C;  2M02 A;  1SHG A;  1TUG B;  2MOX A;  4J6X A;  2KRM A;  2LQK A;  1K76 A;  3CC4 A;  2Z0W A;  3WVE B;  1MHN A;  5LJ3 g;  4ELY C;  1K73 U;  1UHF A;  3TU4 K;  3CCJ Q;  2CDT A;  2W10 A;  2OAU A;  3L2W A;  1VUB A;  2DRK A;  1H3Z A;  5LJ3 h;  1UE9 A;  2JMA A;  5IHN A;  2YWW A;  4RTZ A;  4IUU A;  1XTD A;  1D09 B;  3CC2 Q;  1BI1 A;  1VYU A;  5GAN f;  3OYL A;  3HRS A;  3X26 B;  2ED1 A;  2QDY B;  2JM9 A;  4JDS A;  4NL3 A;  2EYY A;  4IIM A;  1QCF A;  1M2O A;  3EGU A;  1GBQ A;  1VQM T;  3LYI A;  2JT4 A;  4Z88 A;  2RB6 A;  4Z02 A;  2G6F X;  2DD5 A;  2AKK A;  2ZCF B;  4PK4 A;  4EDU A;  1ZA2 B;  2CP3 A;  3OYD A;  2HNI A;  1WQ7 A;  1X6G A;  3M0P A;  1VQ4 T;  3HP9 A;  2DPP B;  4RTU A;  5C0M A;  3HPW A;  1NPR A;  4M77 E;  1G3T A;  2NUZ A;  1VQ9 A;  1CKB A;  5GAO n;  3EG1 A;  3T9N A;  1QKX A;  2PQW A;  1NG2 A;  2ECZ A;  4OB2 B;  1TSF A;  2RD1 A;  4BY6 C;  4X9D A;  2CT3 A;  2X4J A;  4LUD A;  1KSW A;  2K2V A;  3G4S Q;  4DOV A;  3C95 A;  1YIJ Q;  1VQM A;  5GAN 8;  4AG2 C;  2HEQ A;  2GTO A;  4ORZ A;  1UUE A;  2YXY A;  2VXE A;  4XQ3 A;  1ZUU A;  2IVW A;  2KR3 A;  2ZPE B;  4M78 E;  4JRP A;  2E64 A;  4HVV A;  3OQ5 A;  4M77 B;  4PKC C;  2XI9 A;  2NUP B;  5GAN 2;  1AT1 B;  3OA6 A;  1NEG A;  2HBP A;  5GAO m;  4PJJ A;  1YIT A;  1M3B A;  1QW1 A;  4GLK A;  2I2L A;  5HCK A;  4RUG A;  2HBW A;  1VQK Q;  4JZ3 A;  2XID A;  3HFN A;  1TWB A;  3GF5 A;  1MMG A;  1GL5 A;  1MMD A;  3ER0 A;  3C4S A;  2E1H A;  2CZ1 B;  2RQU A;  1OEB A;  4Z8A A;  4M78 B;  2QAS A;  2CZ7 B;  4FSS A;  2FPD A;  3U23 A;  1AZG B;  3CXC P;  2K2M A;  1JJ2 P;  2O2O A;  4AFQ C;  4QQG A;  2VV5 A;  1EX4 A;  4J9F A;  1QVG A;  3MCA B;  3LGF A;  2JVV A;  3UWN A;  2CUB A;  2XIC A;  2DJZ A;  2VC8 A;  5KYU A;  4JJD A;  4V2S A;  1Q81 U;  1JXO A;  1RUW A;  2RJC A;  1B34 A;  2E12 A;  5GAN d;  1B3Q A;  3OYE A;  3OS2 A;  2LNV A;  3ULR B;  1ARK A;  3CCV Q;  5KCH A;  2SEM A;  1GCP A;  2KVQ G;  2FZC B;  4WTO B;  4KGZ B;  2KNB B;  4BUG A;  2EQJ A;  4E6R A;  4EMG A;  3CMA Q;  1JJ2 S;  1U1S A;  4JRQ A;  4F7U A;  2BE7 D;  3JCM W;  4IKF A;  1D3B B;  1QLY A;  3CPW P;  1GXI E;  5GAM h;  4J6Y A;  1YCS B;  4RTX A;  5CCA A;  2KY9 A;  5D6X A;  2WSE E;  2KYB A;  1YJ9 Q;  4C92 E;  4HVU A;  1XOV A;  3WVD B;  5LJ3 e;  2DZ9 A;  3P8H A;  3VU3 C;  1P92 A;  2L3R A;  1T0J A;  1TOV A;  2JS2 A;  2DBM A;  2OX7 A;  3DLL A;  2JN0 A;  3E19 A;  3REA B;  4PFO A;  5GJW B;  1K0S A;  1M27 C;  4J9C A;  3GLX A;  4A4F A;  5IHI A;  1WGS A;  2R5A A;  4QVC A;  4E7K A;  1QVG P;  2J6K A;  3QDR B;  4FIB A;  4DEY A;  4ZGD B;  2QA4 Q;  2CGH A;  1WXB A;  2EJF A;  4C92 B;  4ZGJ B;  2LTO A;  1BBZ A;  2YLB A;  4M7A C;  3MPU B;  1WX6 A;  2QQA A;  2MPX C;  3CCQ T;  3CCE T;  4J6W A;  3KFV A;  1M90 U;  3CCR Q;  3EFO B;  3CCL Q;  2FO0 A;  1G5V A;  1UGR B;  2FYK A;  1FMV A;  5LJ5 g;  4LDW A;  1KHC A;  4FYY B;  1QVG S;  1KK7 A;  2EBP A;  2PUK B;  5LJ3 f;  4E2F B;  2BTT A;  1WZO A;  3VYH B;  1PM3 A;  1YN8 A;  5LJ5 h;  2WSC E;  4IUV A;  5CKH A;  5FU6 B;  3UDC A;  3HHT B;  3O5Z A;  4B6M A;  2X35 A;  3G1J A;  1VIF A;  2H8H A;  2HKN A;  2PTK A;  1PWT A;  1UFF A;  2CSQ A;  4M75 C;  3BW1 A;  1RAH B;  4EIK A;  2DL3 A;  3SFM A;  5IT9 E;  4XAX B;  1FXX A;  4F17 A;  3MEU A;  4F16 A;  4MZT A;  3JAM E;  2K3X A;  1VQ8 T;  2LP5 A;  4EMK A;  1VQO T;  2MMP A;  3JCM h;  1ZQ1 A;  1LJO A;  2E65 A;  4OP0 A;  2BIV A;  4CRI A;  4A4G A;  1TU0 B;  3HRU A;  4VUB A;  2VXF A;  2DVE A;  4LN2 A;  1ACM B;  3TQ7 P;  1YJ9 A;  2QEX T;  4ZN1 A;  2KDS A;  1W4S A;  1ZBJ A;  4PJO C;  1BIB A;  1G3W A;  2JW4 A;  3OY9 A;  1BYM A;  3CME Q;  3MP6 A;  4MDW A;  2LDM A;  1K9M U;  1VQ8 A;  3QYG B;  1A0N B;  1VQO A;  2LZ6 B;  1SRL A;  1W70 A;  5FLX E;  3EG9 B;  2WAC A;  3JCM b;  4C0Z A;  4QW2 A;  3EGD A;  5GAM e;  2DYB A;  2D6F A;  1XQH A;  4M7D A;  4QKU A;  2A28 A;  2ENM A;  4HCK A;  4XTU A;  1M30 A;  5DM7 R;  4C0G A;  1MNE A;  2A36 A;  2EGE A;  2K6D A;  1WHJ A;  2QEX A;  3M59 A;  3OMC A;  5I22 A;  1SRM A;  3SWN C;  2DTI A;  7AT1 B;  2EKH A;  1PCX A;  2PNI A;  2G3R A;  3PFS A;  3I56 Q;  4OF1 A;  1M5Q 1;  4OML A;  4F7U F;  5GAN h;  2RHZ A;  3PGG A;  4N4I A;  1BU1 A;  2NUT A;  3G7Z A;  1NJI U;  1HSQ A;  1I07 A;  2KAF A;  4E7H A;  3FRN A;  1KD1 C;  1JU5 C;  3CCU T;  1MV3 A;  2EWN A;  5LJ3 d;  4PJN A;  1X75 C;  1SSF A;  5KYW A;  1XJW B;  1YJN A;  3OYI A;  3X25 B;  1Q7Y C;  1X2Q A;  4RG2 A;  2VB6 A;  4M77 G;  4QQD A;  1WXT A;  2RHU A;  1VQ7 T;  4OMP A;  1QQJ A;  2QTX A;  2QYZ A;  4F04 B;  3MP8 A;  4XTY A;  3EH2 A;  3PNW C;  4ZTF A;  4XU2 A;  1QVF P;  1U5S A;  4XU3 A;  1YNZ A;  2D0Q B;  4MDX A;  1I8F A;  1T0H A;  2X51 A;  4A4H A;  3JCM X;  2LJ0 A;  5LJ5 e;  4M78 G;  3ZL7 C;  1JXM A;  1K8A U;  2RHI A;  3I35 A;  2D0N A;  3DKM A;  1KQ2 A;  3VS6 A;  1YP5 A;  1VQ7 A;  2RJF A;  4MZP A;  4YTL A;  5CKB A;  3QYH B;  2ZZD A;  2NWM A;  2RHX A;  1S72 Q;  3G71 Q;  1Y96 A;  3M58 A;  4P5N A;  3URG A;  2GQV A;  2DAQ A;  1Q82 U;  1NPP A;  2CP2 A;  5AT1 B;  1WXU A;  2AZV A;  4AMC A;  4JJN K;  2K4Y A;  2GFA A;  4R55 A;  3NHN A;  1YHQ T;  4C0F A;  3JCM e;  3M0U A;  4XU1 A;  3ZEH A;  1TH7 A;  2EPD A;  1R0C B;  2CKK A;  3M4G A;  1YJW Q;  5LJ3 j;  2FPE A;  2GTJ A;  3GOX A;  3SB2 A;  1CKA A;  3VS7 A;  3C12 A;  5J26 A;  2L89 A;  1VQ6 T;  4DBR A;  3RKY A;  2LT4 A;  2QQS A;  2X4X A;  1VQ5 Q;  1C0M A;  1IZ6 A;  1VA7 A;  5LJ5 f;  2KQW A;  2KXD A;  1V1C A;  2RQV A;  1PD1 A;  5GAO r;  1VQP Q;  1YHQ A;  2O31 A;  3UF4 A;  1OPK A;  2RI5 A;  1JEG A;  4XTV A;  4C5I A;  2FZG B;  1OUL A;  3V7R A;  4FW2 A;  3VKI A;  2RQR A;  2OTJ T;  2A0F B;  3MJX A;  2DTH A;  3EFS A;  5GMK h;  1WHG A;  2F1L A;  2DA9 A;  3OYH A;  1YI2 Q;  4E7S A;  2DIQ A;  4C92 G;  4RTV A;  4IUR A;  4FCY A;  1M4Z A;  3V8K A;  4TVR A;  1VQN T;  5GAN e;  2RH2 A;  2COZ A;  2OAW A;  4M75 E;  4M7D F;  1D0Z A;  2CRE A;  3DB4 A;  1UEB A;  1Q86 U;  4F14 A;  1T3L A;  4ZNX A;  3G6E Q;  4CC3 A;  3CBP A;  4Z89 A;  3PTA A;  4XTW A;  1HD3 A;  1LNX A;  4JS5 A;  1GCQ A;  4M7D D;  2DVJ A;  3FJ5 A;  2QAZ A;  1RAI B;  1ZSG A;  2RJD A;  2YUP A;  1DJ7 B;  4OMQ A;  2P84 A;  4OB3 B;  2FEI A;  2J7I A;  4J9H A;  2HAX A;  5CR2 A;  4OGE A;  1OU8 A;  1WJQ A;  1AZE A;  1VQN A;  3G71 A;  1Y57 A;  4GLM A;  2P4T A;  4M75 B;  2KI7 A;  2RI2 A;  4OB0 B;  1SSH A;  2LQN A;  4PJO E;  1MND A;  3BFM A;  2ABL A;  4J9D A;  3MEV A;  2JTF A;  1WPY A;  3SDZ A;  3M54 A;  3OS0 A;  2VUB A;  1VQ9 T;  4FYX B;  2K5I A;  1K9A A;  3CQT A;  4LXC A;  3ZFJ A;  2ROT A;  3JCM V;  2R57 A;  2KXC A;  2Y90 A;  4ZGE B;  1JBM A;  1VOM A;  2JUF A;  1Q81 C;  2X3X D;  1KD1 R;  2CH4 A;  3A8L B;  1N8R U;  3GNG A;  3EGX A;  4C8Q E;  1WHL A;  5FU7 C;  1WIE A;  3V8J A;  4BB7 A;  2AZS A;  2CZ0 B;  2CP7 A;  3REB B;  3EH1 A;  1UJY A;  1Q7Y R;  5FRN A;  1RAD B;  3ASK A;  2RM4 A;  5LJ5 d;  4XTZ A;  4PJO B;  3CXC A;  2MWO A;  1JJ2 A;  5HK3 A;  2LMJ A;  3KBG A;  1OX9 A;  4DBQ A;  5GAM j;  1VQP A;  1OV3 A;  1ZA1 B;  3TRE A;  1H64 1;  1YIT T;  1EZZ B;  2KRO A;  2VAS A;  2LX9 A;  2MF2 A;  1WDX A;  2COY A;  2RMO A;  5KYX A;  5A0L A;  1ZUY A;  3CCS T;  2RK2 A;  4C8Q B;  1PD0 A;  1M2V A;  3V8L A;  4HA8 A;  4DBF A;  5KYN A;  1TG0 A;  1YI2 A;  5GAO p;  1UDL A;  1SKU B;  2J06 A;  1AHJ B;  1V29 B;  3JCM d;  2HQE A;  1OPL A;  4X1V A;  3SWN B;  4BE1 A;  4M7A A;  2FRY A;  1QWE A;  4QVD A;  3PVL A;  2O9V A;  2KE9 A;  1G3Y A;  4O5V A;  3Q1J A;  2BZ8 A;  2LJ3 A;  3CPW A;  2DIG A;  1ZSZ C;  2K79 A;  3CCJ T;  2GQI A;  3G6E A;  2QQB A;  3FEO A;  4N0A C;  3CCS A;  1UG1 A;  1R8O B;  5A0D A;  1PRL C;  5GMK e;  3CC2 T;  3NMZ C;  3LH5 A;  3QG1 A;  1X6O A;  2KYM A;  1TUD A;  2M0O A;  2FHD A;  1K73 R;  3V7S A;  3JB9 J;  1QMC A;  3OBW A;  2DX1 A;  3A8H B;  5GJV B;  4C5G A;  1Q95 G;  3L1A A;  4Q5W A;  2MYS A;  5IXF A;  3UA7 A;  5DLQ E;  1YFN A;  2QTV A;  1CSK A;  3A98 A;  1JRI A;  4PLI A;  3VJP A;  3LX7 A;  5LJ5 j;  5ECA A;  2EGC A;  3CCJ A;  1BKB A;  1M3C A;  2XHC A;  4ESR A;  2EGA A;  1RAC B;  3OMG A;  2V1R A;  2KT1 A;  3CC2 A;  4KRT A;  2LCC A;  1H3H A;  1PSF A;  1GBR A;  1YBY A;  5KCO A;  1AWW A;  2YLC A;  3P8B B;  1W2B P;  1AVZ C;  1OX8 A;  1KG1 A;  3JCM Q;  3J80 E;  1YIJ T;  1M8M A;  5FW9 A;  2ZPH B;  2O4X B;  3CXC S;  5I2M A;  4WCI A;  3CCE Q;  2LT1 A;  3QHS A;  2QGF B;  3NTK A;  2RK1 A;  3OSS C;  1OQK A;  2RI3 A;  1BI0 A;  1VYT A;  2EIF A;  5J3B A;  1B07 A;  4FT2 A;  4A54 A;  4RTY A;  1LVK A;  4FM4 B;  1NYG A;  3H0I A;  1VQK T;  2DL7 A;  4FYV B;  3FC3 A;  1IXD A;  1WHH A;  3CC7 Q;  1GFC A;  4AFS C;  3QZ9 B;  3G4S A;  4M7D E;  1BI2 A;  2DF6 A;  2CSI A;  4FU6 A;  1YIJ A;  1AD5 A;  2MIO A;  4LNP A;  3CPW S;  4DOW A;  2EYX A;  2YRV A;  2RQT A;  2OI3 A;  2HQX A;  2I0N A;  1UTI A;  2ZPB B;  4M77 A;  2NUP A;  1KQ1 A;  1M1K U;  4JS4 A;  2ED0 A;  2KT8 A;  1VQK A;  1X01 A;  2KBT A;  4ZN3 A;  2PZ1 A;  1X69 A;  3OYC A;  4JUV A;  3JB9 G;  4J7I A;  1HYO A;  4M7D B;  1Z9Z A;  4O6J A;  2D9T A;  3I55 Q;  2D8H A;  2HSP A;  3LWH A;  4BI4 A;  1AWJ A;  2JJ9 A;  5GAN j;  1BCM A;  3CCV T;  1UHC A;  1NYF A;  1E7O A;  2DL5 A;  3QWX X;  1Q81 R;  1TXQ A;  2VVK A;  3JSC A;  2V8K A;  2CP5 A;  4M78 A;  1NJI C;  2A3L A;  2CP6 A;  3CMA T;  4M7A G;  2DE0 X;  2XU8 A;  4IUP A;  1KHI A;  3PMI A;  4R0K A;  2NUT B;  1IGU A;  2MCN A;  4Y91 A;  1UGV A;  1S1N A;  3OB9 A;  2LVM A;  1YJ9 T;  2DXC A;  2M51 A;  3SHW A;  2BZY A;  2ZAE A;  2HSE B;  2DO3 A;  1WHK A;  2FG0 A;  1K1Z A;  1U06 A;  2BZX A;  3CCV A;  2P0K A;  1FYN A;  3HTR A;  3C94 A;  2K9G A;  2F2W A;  3BDU A;  4EMH A;  2GFU A;  4JRK A;  3VV0 A;  2D1X A;  3CMA A;  5KH6 A;  1EIF A;  5IHK A;  3LLR A;  3QSU A;  3MKD A;  4HXJ A;  4C0D B;  4KUL A;  1D3B A;  3VRZ A;  1M1F A;  1X43 A;  4M75 G;  5CVI A;  3PT9 A;  4L59 A;  2QA4 T;  4KT0 E;  5GMK l;  3RDV A;  4PFP A;  5GMK i;  2JOY A;  2F2V A;  5FWB A;  3P8D A;  2L2P A;  1TS9 A;  4BE0 A;  4ANJ A;  3A8G B;  3CCR T;  3CCL T;  1QVF A;  1Q82 C;  1HJD A;  5FU7 B;  1KFZ A;  5A2Q E;  1BI3 A;  3FDR A;  2XDB A;  2C0I A;  2QDL A;  4WF2 A;  4C8Q C;  3JCM J;  1M90 R;  2QA4 A; 
#chains in the Genus database with same CATH homology
 3HP9 A;  4PJO G;  1OI1 A;  1WJR A;  1YJN T;  2DPP B;  3RKY A;  2LT4 A;  1N27 A;  2QQS A;  3LW5 E;  5C0M A;  3HPW A;  2NLU A;  1NPR A;  3RMS A;  3RMQ A;  5FRM A;  2X4X A;  4KUI A;  4M77 E;  1IZ6 A;  1N6A A;  4C92 A;  3SWN A;  1G3T A;  3L2Q A;  1VQ9 A;  5LJ5 f;  5GAO n;  3OYM A;  2DXU A;  4Y28 E;  2KQW A;  3T9N A;  4NOY A;  3R6O A;  2EQK A;  4PNO A;  4E7I A;  2PQW A;  4LD9 K;  5GAO r;  1YHQ A;  4OB2 B;  4BY6 C;  2RD1 A;  3FB9 A;  2PU9 B;  4X9D A;  2X4J A;  3CCR A;  3CCL A;  3OYA A;  2K2V A;  3JCM P;  2RI5 A;  3L2Z A;  1NE8 A;  4C8Q G;  4XTV A;  4C5I A;  4DOV A;  4DA4 A;  3C95 A;  2MWP A;  1M9S A;  3V7R A;  3VKI A;  1VQM A;  4HCB A;  4NL2 A;  2AHJ B;  5GAN 8;  4X34 A;  2OTJ T;  1NJI C;  4XK8 E;  5GMK h;  2DTH A;  3EFS A;  4II1 A;  2VXE A;  4XQ3 A;  5I21 A;  2IVW A;  2FVU A;  3OYH A;  3QJ6 A;  2E6Z A;  1Y7X A;  2ZPE B;  5D6W A;  2DIQ A;  4M78 E;  2E64 A;  4C92 G;  2XDD A;  3LWI A;  4JRP A;  3OS5 A;  1XNI A;  4KBM B;  1G3S A;  3GPL A;  3OQ5 A;  4IUT A;  4M77 B;  2XI9 A;  4PKC C;  4XU0 A;  5D6Y A;  4IUR A;  3WXM B;  5C6S A;  1M4Z A;  1IRE B;  3VYG A;  3V8K A;  3OA6 A;  2QA4 A;  4TVR A;  1RI0 A;  2EKO A;  2HBP A;  5GAO m;  1N9S A;  3JRZ A;  1YIT A;  1VQN T;  2E6N A;  1QW1 A;  5GAN e;  2RH2 A;  4GLK A;  2R5M A;  5GMK j;  3JB9 F;  1UGP B;  2XD0 A;  2I2L A;  2Y4Y A;  1JB0 E;  2JNG A;  4M75 E;  2DXT A;  3BY7 A;  4M7D F;  5CKE A;  4D6W A;  2XID A;  3DB4 A;  3E9F A;  1UEB A;  3GNF B;  2F5K A;  3HFN A;  3GF5 A;  1Q86 U;  2EYQ A;  2F5T X;  4PJO A;  4LDV A;  3ER0 A;  2CS7 A;  2K5L A;  5GAN 7;  3JB9 D;  3CBP A;  3C4S A;  2E1H A;  3PTA A;  4XTW A;  1LNX A;  2CZ1 B;  4JS5 A;  4M77 F;  4M7A F;  2P0P A;  4M7D D;  4LDY A;  3CC7 T;  5FRO A;  2RJD A;  1N9R A;  2KMT A;  4M78 B;  1DJ7 B;  2XK0 A;  2CZ7 B;  1PSE A;  3ME9 A;  1Q86 C;  1I5L A;  4OB3 B;  1KQS A;  4HKE A;  4QQG A;  3CCQ A;  2VV5 A;  3JB9 H;  2HAX A;  1QVG A;  5CR2 A;  4OGE A;  3MCA B;  3LGF A;  3NTI A;  3CCE A;  4LD6 A;  3OYG A;  2O4X A;  1WJQ A;  2JVV A;  1WJS A;  5A0G A;  2V8I A;  4M77 D;  4M7A D;  3H8Z A;  4MZM A;  1VQN A;  3A8M B;  3CEY A;  3UWN A;  3OYY A;  4QQ6 A;  2XIC A;  3G71 A;  4M75 B;  2P4T A;  2DZC A;  2RI2 A;  2DJZ A;  4OB0 B;  3RIR A;  2VC8 A;  2XG8 D;  4PJO E;  3JCM g;  3BFM A;  3CPF A;  5CO7 A;  4V2S A;  1Q81 U;  2RJC A;  3MEV A;  2JTF A;  1WPY A;  3SDZ A;  3M54 A;  4A4K A;  5HKC A;  3OS0 A;  1B34 A;  2VUB A;  1QVF S;  2P0Q A;  4BD3 A;  2E12 A;  3CME A;  1K8A C;  5GAN d;  3OYE A;  3I56 T;  4M78 F;  4RG8 A;  2K5I A;  1VQ9 T;  3OS2 A;  1UB4 A;  2LNV A;  3ZFJ A;  3CBM A;  3EAE A;  4JLG A;  4EMK C;  2X4Y A;  3JCM V;  2R57 A;  3RUX A;  5KCH A;  1MGQ A;  1Y07 A;  2Y90 A;  5CQX A;  5I2S A;  3CC7 A;  2KVQ G;  4ZGE B;  1JBM A;  3QO3 A;  5HY6 A;  2JUF A;  3MP1 A;  1Q81 C;  4BUG A;  3A8L B;  2EQJ A;  4EMG A;  3I55 T;  3GNG A;  1K73 C;  1N8R U;  4QVZ A;  1U1S A;  4M75 F;  2KK4 A;  4C8Q E;  4OGC A;  4F7U A;  4JRQ A;  4HT8 A;  3QXE B;  4M78 D;  5FU7 C;  3V8J A;  4C5E A;  3JCM W;  4BB7 A;  1WNL A;  4IKF A;  1D3B B;  2CZ0 B;  1GXI E;  5GAM h;  3OYJ A;  4J6Y A;  4HCC A;  2F69 A;  2O01 E;  5CCA A;  5FRN A;  2A7Y A;  2KY9 A;  3ASK A;  3KUF A;  2WSE E;  2RM4 A;  5D6X A;  4LDU A;  1KC8 U;  1Y96 B;  4XTZ A;  5LJ5 d;  4RMO A;  4PJO B;  2C06 A;  4C92 E;  3CXC A;  2MWO A;  4M75 D;  2BKD N;  1XOV A;  1JJ2 A;  3WVD B;  2LRQ A;  5HK3 A;  1N8R C;  3E9G A;  1O9S A;  2DZ9 A;  3KBG A;  2B8A A;  3P8H A;  5LJ3 e;  3VU3 C;  1Y71 A;  3X24 B;  3S3M A;  2E10 A;  1FWZ A;  5GAM j;  1P92 A;  3O8V A;  2E5Q A;  2L3R A;  1VQP A;  3SD4 A;  3I56 A;  4ME7 A;  3TRE A;  1H64 1;  1YIT T;  3S3O A;  4OB1 B;  2XKO C;  3DLL A;  4R56 A;  1KC8 C;  3M56 A;  2JN0 A;  3E19 A;  4CI0 C;  2LX9 A;  2MF2 A;  4F7U G;  2K57 A;  2EQU A;  3RKW A;  5A0L A;  4PLL A;  3CCS T;  2RK2 A;  3RES A;  4C8Q B;  3I55 A;  5EG2 A;  5GAN 6;  2LC4 A;  4FL6 A;  3GLX A;  4A4F A;  5CKF A;  4HT9 A;  3V8L A;  1KQS S;  4HA8 A;  3VUZ A;  4M7D C;  1WGS A;  2R5A A;  3M4Y A;  4PJO F;  4QVC A;  4B9W A;  4E7K A;  1YI2 A;  3QDR B;  4FIB A;  5GAO p;  4ZGD B;  3CBO A;  5GAN g;  1AHJ B;  1QVP A;  2CGH A;  1V29 B;  2X4W A;  3JCM d;  2HQE A;  2PVD B;  3FLG A;  4L6V 5;  3JB9 I;  2EJF A;  4C92 B;  4FSX A;  3SWN B;  4ZGJ B;  1BIA A;  2EAY A;  3OSV A;  4BE1 A;  2LTO A;  4M7A A;  2YLB A;  4QVD A;  3QPH A;  2PUO B;  3M53 A;  4M77 C;  1G3Y A;  4M7A C;  3QJY A;  4PJO D;  4O5V A;  3Q1J A;  2QQA A;  3V7C A;  2ZPF B;  4BY6 B;  3CPW A;  3OW2 A;  5DY9 A;  1U8R A;  3CCQ T;  2RA2 A;  1LOJ A;  3CCE T;  1U1T A;  4J6W A;  1Q7Y U;  2DD4 A;  2DIG A;  5GAN 3;  2DK3 A;  2ZPG B;  2K3Y A;  1S72 T;  4C8Q F;  3G71 T;  2PVO B;  2LCL A;  1M90 U;  1O75 A;  3N5B B;  2XDP A;  3TEE A;  3CCJ T;  4RCB A;  1G5V A;  3G6E A;  1WQW A;  1UGR B;  2QQB A;  2FYK A;  3FEO A;  3MET A;  4N0A C;  5LJ5 g;  4JLI A;  3CCS A;  4LDW A;  1R8O B;  5A0D A;  1KHC A;  5HK0 A;  3E1S A;  5GAO l;  3NTH A;  5GMK e;  3CC2 T;  3CME T;  4C92 F;  3QG1 A;  4JRI A;  1QVG S;  1X6O A;  2L5Q A;  1VIE A;  4C8Q D;  2PUK B;  2M0O A;  2FHD A;  3H6Z A;  1I4K 1;  4YTL A;  5LJ3 f;  3V7S A;  2WSF E;  4E47 A;  5GAO q;  3JCM c;  4N4H A;  4BE2 A;  3TCJ A;  2CZ6 B;  1YCY A;  3VYH B;  3OBW A;  5LJ5 h;  2WSC E;  4IUV A;  5CKH A;  5FU6 B;  3A8H B;  5IAY A;  4M78 C;  3UDC A;  3HHT B;  4C5G A;  3L1A A;  1M90 C;  5IN1 A;  1YJW T;  4Q5W A;  2JZ2 A;  4RKU E;  2YHT A;  5DLQ E;  2X35 A;  4C92 D;  1ZBX A;  1VIF A;  2OTL A;  2MI6 A;  3LGL A;  5GAM f;  3X28 B;  2E41 A;  4LDX A;  3J81 E;  1JRI A;  3CCM A;  4M75 C;  1S72 A;  4PLI A;  4UC4 A;  4C0D C;  3VJP A;  3BW1 A;  3LX7 A;  3INZ A;  5LJ5 j;  2K5F A;  1VQ5 T;  3CCJ A;  3CCU A;  5CKD A;  1BKB A;  3SFM A;  2EJ9 A;  5IT9 E;  4XAX B;  1VQL T;  3CD6 T;  2XHC A;  4MML A;  3HSB A;  4NS5 A;  1FXX A;  3MEU A;  4J5Y A;  4MZT A;  3OMG A;  3JAM E;  2K3X A;  1VQ8 T;  3CC2 A;  1VQP T;  4EPC A;  2LCC A;  2M16 A;  1PSF A;  1JJ2 S;  3QKJ A;  4EMK A;  5J39 A;  1YBY A;  5GMK m;  4J7F A;  5KCO A;  3FIF A;  2YLC A;  1VQO T;  2M1H A;  2MMP A;  3P8B B;  3JCM h;  1ZQ1 A;  1LJO A;  2E65 A;  2ZPI B;  4OP0 A;  4ATO A;  1KG1 A;  3JCM Q;  2BIV A;  3NFC A;  3J80 E;  2GF7 A;  4F7U E;  3CMA T;  1YIJ T;  2JTM A;  4CRI A;  2ZPH B;  4A4G A;  1YJW A;  3S3N A;  1OYX A;  2O4X B;  3VUB A;  3CXC S;  3HRU A;  3DB3 A;  5I2M A;  4VUB A;  2QQR A;  2LT1 A;  2M9U A;  2RHY A;  2VXF A;  5AYF A;  2DVE A;  3QHS A;  3L2V A;  3NTK A;  2RK1 A;  3OSS C;  3F70 A;  4RCC A;  1YJ9 A;  2RI3 A;  2QEX T;  1YI2 T;  1BI0 A;  3L42 A;  4ZN1 A;  2EIF A;  3PMT A;  5J3B A;  2KDS A;  1W4S A;  4PJO C;  5GAN 4;  4FT2 A;  1BIB A;  1G3W A;  1B34 B;  1VQ5 A;  2V8J A;  3HKS A;  4A54 A;  3OY9 A;  4ZTJ A;  3CD6 A;  1VQL A;  1BYM A;  3MP6 A;  2MAM A;  3MEA A;  4MDW A;  1UGS B;  2LDM A;  1K9M U;  4FM4 B;  3OYK A;  3M55 A;  1VQ8 A;  2ZGW A;  1OZ2 A;  1VQK T;  3QYG B;  4X9C A;  2QI2 A;  5CIU A;  3FC3 A;  3J7A F;  4BI3 A;  1VQO A;  4PL6 A;  3QZ9 B;  5FLX E;  3G4S A;  4M7D E;  2WAC A;  4F7U B;  2H3J A;  1BI2 A;  3JCM b;  3OYF A;  4FU6 A;  3L2U A;  4C0Z A;  4QW2 A;  3G6E T;  1YIJ A;  1WQ7 A;  4L5G A;  5GAM e;  2D6F A;  3PIP A;  1XQH A;  4M7D A;  3M9Q A;  2EJG A;  1I81 A;  2QXF A;  5DM7 R;  4XTU A;  3OW2 S;  3CPW S;  4C0G A;  4OMF B;  3L2R A;  1HXD A;  4OVA A;  4DOW A;  2QEX A;  4M7A E;  1W2B A;  1FX7 A;  3M59 A;  3QII A;  3OMC A;  3QZ5 B;  2YRV A;  2FL7 A;  4C92 C;  3ZBD A;  3LH0 A;  3SWN C;  2DTI A;  2HQX A;  2DTO A;  1KD1 U;  2ZPB B;  4M77 A;  2G3R A;  1UGQ B;  3PFS A;  3OYB A;  4HCZ A;  1KQ1 A;  4IUQ A;  2E70 A;  2QQ9 A;  1M5Q 1;  3A5Z B;  4OF1 A;  4GY5 A;  4JS4 A;  2R58 A;  4A4E A;  4F7U F;  5GAN h;  2OTL T;  4KUD K;  2RHZ A;  1VQK A;  1QP2 A;  1X01 A;  3PGG A;  4N4I A;  2RO0 A;  4ZN3 A;  3OYC A;  4JUV A;  3JB9 G;  1M1K U;  4J7I A;  3CCM T;  2Y4X A;  1RL2 A;  2RJE A;  3G7Z A;  2VGM A;  4O6J A;  1NJI U;  4M7D B;  2KAF A;  2D9T A;  4E7H A;  3FRN A;  1KD1 C;  4M7D G;  3CCU T;  4J8O A;  4N0A A;  2EWN A;  3LWH A;  5LJ3 d;  2LQ8 A;  2VYT A;  4BI4 A;  3X20 B;  3BDL A;  1X75 C;  3FJP A;  3QBY A;  3OYN A;  1M1K C;  3HRT A;  4E7J A;  4BI8 B;  1VQ6 A;  2VGN A;  5GAN j;  4MMK A;  3CCV T;  3OS1 A;  1SSF A;  3M5A A;  5LL6 S;  1VQ4 A;  1YJN A;  2EFI A;  2HD0 A;  3MHX A;  4A53 A;  3OYI A;  3X25 B;  1Q7Y C;  2PVG B;  4M7A B;  4N4G A;  4RG2 A;  3JCM f;  5KE3 A;  4M77 G;  3JSC A;  2V8K A;  2EQM A;  3A8O B;  2BUD A;  2A3L A;  4M78 A;  4FT4 A;  4QQD A;  4XTX A;  5FU6 C;  4C5H A;  4BDZ A;  5GAM d;  2RHU A;  5CK9 A;  3RKX A;  2XU8 A;  3RER A;  4IUP A;  1KHI A;  1QP3 A;  1VQ4 T;  1VQ7 T;  2CYZ B;  3CC4 T;  1NZ9 A;  3PMI A;  5KE2 A;  3EFR A;  4Y91 A;  3GIB A;  2QTX A;  3OB9 A;  3AHU A;  3MP8 A;  4XTY A;  4M75 A;  3PNW C;  2LVM A;  4ZTF A;  4XU2 A;  1YJ9 T;  5GAN 5;  2DXC A;  4XU3 A;  3MO8 A;  4BAC A;  3PIO A;  2D0Q B;  4MDX A;  1OZ3 A;  1I8F A;  2DXB A;  2OTJ A;  2DO3 A;  3HFO A;  5CQY A;  3UPU A;  4A4H A;  1M1G A;  3JB9 J;  3QUI A;  2DEQ A;  4B9X A;  3JCM X;  3CCV A;  2P0K A;  1M8V A;  5LJ5 e;  3C94 A;  4M78 G;  3BDU A;  3M57 A;  5L8R E;  4EMH A;  2FB7 A;  2GFU A;  4JRK A;  4BDY A;  3VV0 A;  3DLM A;  3CMA A;  2RHI A;  1K8A U;  5KH6 A;  3G4S T;  1EIF A;  3DKM A;  1KQ2 A;  4J6X A;  3LLR A;  3QSU A;  2LQK A;  1VQ7 A;  4C0D B;  3MEW A;  2RJF A;  4KUL A;  3CC4 A;  2L8D A;  1D3B A;  2KSS A;  1M1F A;  4M75 G;  4MZP A;  5CKB A;  3PT9 A;  2ZZD A;  3QYH B;  1MHN A;  4L59 A;  5CVI A;  3WVE B;  5LJ3 g;  2QA4 T;  4ELZ C;  2RHX A;  4ELY C;  4KT0 E;  5GMK l;  1K73 U;  3TU4 K;  5DLO A;  1Y96 A;  3M58 A;  4P5N A;  3URG A;  5GMK i;  2GQV A;  2OAU A;  2JOY A;  2DAQ A;  3L2W A;  4E7L A;  1VUB A;  1NPP A;  2DKG A;  1Q82 U;  1H3Z A;  5LJ3 h;  3P8D A;  5GAN 2;  4JJN K;  2GCX A;  2K4Y A;  2GFA A;  4IUU A;  1XTD A;  4EMK B;  5GAM g;  3HL8 A;  4R55 A;  4BE0 A;  1YHQ T;  1BI1 A;  4DQ2 A;  3A8G B;  4C0F A;  3JCM e;  4M7A G;  5GAN f;  3UT1 A;  3CCR T;  3CCL T;  3OYL A;  3GP8 A;  3HRS A;  3X26 B;  1QVF A;  4XU1 A;  3ZEH A;  2QDY B;  4JDS A;  4NL3 A;  4J83 A;  1TH7 A;  1Q82 C;  2CKK A;  5FU7 B;  1W2B S;  3M4G A;  3OBY A;  5LJ3 j;  1VQM T;  5CAI A;  5A2Q E;  3LYI A;  1ZHI A;  3GOX A;  4C8Q A;  2RB6 A;  4Z02 A;  3SB2 A;  2IG0 A;  1BI3 A;  2DD5 A;  3FDR A;  2ZCF B;  4WF2 A;  2XDB A;  4EDU A;  3C12 A;  4C8Q C;  3JCM J;  5J26 A;  1HK9 A;  2L89 A;  1K9M C;  1VQ6 T;  3OYD A;  2HNI A;  3KXT A;  3S6W A;  5M9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...