3LGLA

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k382me2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lglA01
3G4ST 3OYHA 3CPWA 2WACA 1YI2T 1VQPT 2NLUA 1Q82C 2LTOA 2XK0A 2R5AA 1IZ6A 1WJRA 3I55A 3MO8A 1Q7YC 1YHQA 1VQNT 2QQSA 3OYGA 4N4HA 3CMET 1YJWT 2L89A 3CCMA 2JVVA 3CPFA 1VQ8A 5M9OA 3OYMA 2RI5A 3G4SA 2QA4T 4E7LA 5C6SA 1Q86C 4CRIA 1VQPA 1YI2A 2RHIA 2L8DA 2RI2A 3S6WA 1OZ3A 3C4SA 2GF7A 2M16A 3QJ6A 3EAEA 2XHCA 1M1GA 3CCQT 1VQNA 3CMEA 1YJWA 2K3YA 1K9MU 3QBYA 4QQ6A 4IURA 4QVZA 1BKBA 1K8AC 3CCLT 3UWNA 2QA4A 1Q82U 1SSFA 2DO3A 3CC2T 3CCRT 3CEYA 3OS1A 3LGLA 3J81E 3FDRA 3LGFA 3GOXA 3PFSA 2RHZA 4PLLA 4YTLA 2KVQG 3QKJA 3CCQA 3H8ZA 5IT9E 3CCST 1VQMT 1VQ7T 4EDUA 5KE3A 3CXCS 4E7KA 4IUPA 4E7IA 2RHUA 4ZN3A 3CCLA 4BD3A 3S3MA 3OYKA 3E9GA 2X4YA 1NPPA 1YJNT 3CC2A 3CCRA 4PLIA 4A4FA 1WJQA 2RJEA 3P8HA 5D6XA 2FHDA 3FEOA 3MEVA 1VQ6T 2EQJA 3CCSA 1VQMA 3CCJA 3META 4OVAA 1VQ7A 3OYEA 2JOYA 1N8RU 2X35A 4BE2A 1K8AU 4HCZA 5KCOA 3OYJA 3ZEHA 3MEWA 3L2QA 5LL6S 1NJIC 1K9MC 4IUQA 1S72A 1YJNA 1XNIA 4C5GA 3CD6T 4N4GA 2EIFA 2RJCA 3G6ET 4ZN1A 3OW2A 3P8DA 3CMAT 1VQ6A 1N27A 2O4XA 5IN1A 3OYBA 4IUVA 3SD4A 1KHCA 2HQEA 3OQ5A 1VQ9T 5IAYA 1EIFA 3OMGA 4B9WA 3OYAA 1NPRA 3BDLA 4N4IA 5C0MA 3CCVT 3NTKA 2O4XB 2IG0A 4II1A 3L42A 1KD1C 4QQGA 3OY9A 5FROA 2OTJT 2BIVA 3CD6A 3S3NA 3DB3A 2GFAA 3G6EA 1M90U 4A4GA 3OYYA 1YIJT 1QVFS 5D6WA 4ZTJA 3CMAA 2BUDA 4PL6A 1KQSS 1VQ9A 2RI3A 1RL2A 4ZTFA 2R58A 5DM7R 3CC4T 2E5QA 1NJIU 3CCVA 1YJ9T 2RJDA 1VQ4T 3PMTA 3L2WA 1N8RC 3H6ZA 4C5EA 5KH6A 2K3XA 3OS0A 4A4EA 2OTJA 2JUFA 3L2VA 4BACA 4QW2A 1YIJA 4E7HA 3MP1A 1VQOT 2JTFA 2LQ8A 4TVRA 5A2QE 3DB4A 3QIIA 5HY6A 3F70A 3CCJT 3CC4A 2E6NA 1QVGS 1KD1U 5KE2A 1YJ9A 2R5MA 5FRMA 5D6YA 3KUFA 1VQ4A 3OYIA 2OTLT 5CIUA 4RG2A 1S72T 3FLGA 3PNWC 1UEBA 2RHYA 4Z02A 3ASKA 3JAME 3CC7T 3LYIA 4Q5WA 4BDZA 1VQOA 3CPWS 4C5IA 3PIOA 1M90C 2MWOA 3A5ZB 4LD6A 2QEXT 2DIQA 3OYCA 3MEUA 2G3RA 2P0KA 3PIPA 3E9FA 1OZ2A 2LDMA 5J3BA 2OTLA 3FC3A 4FU6A 3J7AF 2M1HA 2MI6A 3LH0A 1QVGA 1VQLT 3CXCA 3CC7A 2EQKA 1WJSA 4UC4A 2QEXA 4B9XA 1JJ2S 5J26A 5J39A 3P8BB 1MHNA 4E7JA 3HKSA 3S3OA 3MP8A 3DLMA 3OYNA 3ME9A 2RJFA 2RHXA 1VQLA 3I56T 2E70A 1VQKT 1KHIA 1W2BS 2B8AA 3UT1A 1M1KU 3ER0A 3MEAA 1VQ5T 2EKOA 3CCET 2JNGA 2BKDN 1Q81U 3DLLA 1RI0A 1YITT 1KC8C 2X4WA 1JJ2A 2R57A 3G71T 2LCCA 3L2UA 2D9TA 3CCUT 1K73C 3NTHA 5FLXE 2HQXA 3I56A 3KBGA 1VQKA 3OA6A 4FL6A 2JZ2A 3LX7A 2EFIA 1VQ5A 1WGSA 3OMCA 3CCEA 2LCLA 5FRNA 3OYFA 1G5VA 3Q1JA 1QVFA 4IKFA 3MP6A 3L2RA 3OB9A 3OYLA 1H3ZA 1X6OA 1W2BA 1OI1A 2LVMA 1YITA 2L3RA 1YBYA 4IUTA 3G71A 1KQSA 3OS2A 1NZ9A 1Q7YU 2X4XA 3CCUA 4BE0A 1XTDA 3LLRA 2XDPA 2VYTA 1OYXA 4GY5A 4QQDA 4L59A 3PMIA 3OW2S 2DAQA 1Q86U 3O8VA 5KCHA 2QQRA 3TREA 2M0OA 1KC8U 4BDYA 2CKKA 1M1KC 4BE1A 2DIGA 5DLQE 1K73U 2RO0A 2GFUA 1Q81C 2MWPA 2E6ZA 3M9QA 4A4HA 2YRVA 2KDSA 4IUUA 4NS5A 2LRQA 4X34A 2EQMA 3NTIA 3I55T 1YHQT 3J80E 2F5KA 4C5HA 3CCMT 3OYDA 2PQWA 1VQ8T 2EQUA
chains in the Genus database with same CATH superfamily
1MUZA 5CKEA 1EZZB 1FMWA 2EGAA 2WACA 1QP2A 2NLUA 3CPWA 1HXDA 3RR6A 5GMKj 2GNCA 2HKQB 1Y57A 3I55A 1YHQA 2RD1A 1WXTA 5L8RE 3CMET 3HSBA 3WVDB 5KYXA 3A1PA 3HRUA 4J7FA 2G6FX 2F2VA 1VQ8A 1I0CA 3CCEQ 4PJOC 2QA4T 3EG0A 3CQTA 2DEQA 4XTVA 4E7LA 2BZ8A 1VQPA 2RHIA 3S6WA 5KYXB 3MCAB 1OZ3A 4OB0B 2M16A 4C8QG 4DQ2A 4XTUA 5CR2A 3EAEA 2ZZDA 3JCMh 3QBYA 1C6VX 1NLOC 4M7DF 5EC7A 3FJPA 1M2OA 1M27C 5CVIA 5EG2A 4IURA 4FYXB 5CQXA 1FMKA 1AWOA 3H9NA 4HA8A 1Q82U 2O01E 3CCRT 2IVWA 2B86A 3FDRA 1S1NA 1ZUYA 4M78E 2EGCA 2KVQG 3QKJA 1GL5A 3G7ZA 1EX4A 3EG1A 3H8ZA 2JM9A 3EG3A 3CCST 2KAFA 2JM8A 1VQ7T 2JMAA 5KE3A 4E7KA 3JCMJ 2BZYA 2AKKA 2MYSA 2JTMA 1TOVA 3CCLA 1O9SA 4K11A 1K4US 2PUOB 1NLPC 4PLIA 2EYQA 4R55A 2LT1A 4J9BA 1RLPC 3URGA 1TXQA 2ROLA 2EPDA 1QCFA 3MJXA 2FHDA 1GXIE 2M51A 3CCJA 2YHTA 4ESRA 3OYEA 4MZTA 1N8RU 2X35A 1YN8A 1ZA1B 1I81A 1I07A 3ZEHA 5GAOn 2KYMA 1OQKA 2EJ9A 1NJIC 4KH1B 1YJNA 1D1CA 1XNIA 2KSSA 2EIFA 2RJCA 3M55A 1QW1A 3G6ET 5LJ5f 3TSWA 2LJ0A 4ZN1A 3IQLA 5GJVB 2DNUA 3PTAA 3CBMA 1R77A 2QK0A 3A8OB 4M75E 1JBMA 3OQ5A 1VQ9T 5IAYA 1EIFA 3OMGA 1IB8A 2QASA 4JRIA 4B9WA 4OGEA 3H0HA 4N4IA 4XAXB 1VYVA 3I9QA 5FWBA 5C0MA 1QWEA 4KUIA 5KYNA 4II1A 4DBQA 1KD1C 4M7DD 2XDBA 3X24B 5FROA 1OOTA 4N0AC 2XIDA 1PKTA 4M7AE 2HDAA 5I21A 4M78C 4C92F 4A4GA 1RABB 1QVFS 5GAN2 1K8AR 4ZTJA 1VUBA 3M53A 4Y91A 4F14A 2DXCA 2E5KA 2YLCA 2RI3A 1NBEB 1YNZA 1H92A 4M77A 1AHJB 2YUPA 2R58A 4ZTFA 3CC4T 1YP5A 4LDXA 4L6V5 3U23A 4J9IA 4A63B 4F7UA 2RJDA 3MPUB 1VQ4T 1N8RC 5A0DA 4M77B 2QTXA 4OMPA 2RMOA 1AWWA 3INZA 1UFFA 3L2VA 2MCNA 4F7UB 3CCRQ 2O9SA 4E7HA 3MP1A 2EYWA 4B6MA 1QVGP 4FM4B 2J6OA 1B7TA 2PNIA 2C0OA 4CC2A 1TWBA 3V7SA 3CCSQ 4HCBA 2L3QA 3AT1B 4BY6C 2X4JA 1TG0A 3CPWP 2KT8A 5LJ5d 2RHYA 1BIAA 1OU8A 4Z89A 2EGEA 2KBTA 4M75C 1KG1A 1AZGB 1UECA 4DA4A 2DJZA 2F2XA 4LDVA 4ZGDB 3JCMQ 2QYZA 2HD0A 1JO8A 3M0QA 3OS5A 3TSZA 2D8JA 2H3EB 2DMOA 4WF2A 4FYYB 2KMTA 1UG1A 3WVEB 5GMKm 1OZ2A 4M7AC 2YWWA 4OP0A 4FU6A 1Y7XA 3GPLA 1JB0E 2GQIA 3SWNC 2CP3A 2M1HA 1YCSB 3G6EQ 1GCQA 2COZA 4CC7A 4C92D 4ZGJB 4OMMA 1PD0A 2HBWA 2O88A 1JJ2S 3P8BB 3G1JA 1RAHB 4E7JA 3HKSA 3S3OA 1VQ9Q 4KULA 4F17A 3MP8A 1IHWA 2K5LA 3TQ7P 1YJWQ 3OYNA 4HT8A 1IRXA 4DEYA 2RJFA 2COWA 4M7DG 3EG9A 4HCKA 2K3BA 2QXFA 1MV0B 4Z88A 1M30A 1W1FA 4BI3A 1VOMA 1FYNA 1G3TA 3V7CA 3M54A 3I56T 2E70A 3EG9B 1KHIA 2KGTA 4MMKA 2RF0A 3MEAA 1VQ5T 2EKOA 1H641 2VWFA 2YUOA 1D3BA 3CC4Q 1SG5A 1UUEA 3FIFA 1UJYA 3DLLA 4C8QE 1VQ4Q 1BB9A 1UE9A 4GBQA 2X4WA 3G71T 1W6XA 3RBBB 3L2UA 1M5Q1 2D9TA 3NTHA 2EYZA 2P4TA 2HQXA 4JLGA 3TU4K 3VUZA 4FL6A 4XU0A 3LX7A 3HHTB 2EYXA 5FRNA 2E3IA 1G5VA 2DKGA 5GAN4 1QVFA 3L2RA 1M90R 1VYTA 1W2BA 6AT1B 3RDVA 1YITA 3OS2A 3JCMW 1Q7YU 4Y92A 3LWHA 4L5GA 2X51A 2VUBA 3VYHB 5GMKi 5HKCA 3X28B 2DAQA 1WNLA 1X27A 2EJFA 3O8VA 5KCHA 1Q86U 3E2UA 4HVUA 3QPHA 1X01A 1KC8U 4RTZA 1PC0A 5L23A 4C0GA 4FYVB 4OGCA 2K2MA 2JXBA 2ZCFB 2DXUA 2LMJA 1M4ZA 3EFSA 1I8FA 2MWPA 2E6ZA 3M9QA 4DBRA 5CKBA 5I22A 2VXEA 2KDSA 3CD6Q 2LRQA 4KRTA 4JS5A 1BYMA 2EQMA 3I55T 2VC8A 1YHQT 2AT1B 1ZHIA 3QO3A 1OV3A 2YSQA 4C0ZA 1VQ8T 2LNHB 3PE0A 4MMLA 4C8QC 3VKIA 4JLIA 2CZ7B 2X3WD 3M5AA 5CCAA 3CCVQ 5FU6C 2DLPA 4IIMA 1VQPT 1LJOA 3EHQA 1N5ZA 2P4RA 2R5AA 4J8OA 1IZ6A 3I5SA 5DLOA 5IH2A 4N0AA 3VRZA 4F7UF 1WX6A 3MO8A 1YIJQ 1Q7YC 4RKUE 4JJCA 2ENMA 2QQSA 3OYGA 5CAIA 2FRYA 2VGNA 1K73R 1HD3A 3CPFA 1XQHA 4CC3A 2KRMA 3OYMA 1MNDA 3T9NA 2L3SA 2K6DA 3G4SA 3QG1A 1MNEA 2K79A 5GAMe 1E6HA 4LUEA 5LJ3f 1Q86C 2GCXA 1YI2A 1G2BA 2GF7A 1RAFB 1JXOA 1QP3A 4NOYA 3TCJA 1GBRA 1QCNA 1U1SA 4FW2A 1VQNA 2RA2A 1IXDA 1VIFA 3PGGA 4AG1C 3N5BB 2KT1A 1T3LA 2P0PA 1Y07A 1Z9ZA 1F1BB 4QVZA 1BKBA 1K8AC 3CCLT 1V76A 1SSFA 2DO3A 4C92B 2HNIA 5ECAA 5D7UA 3OS1A 3LGLA 1UB4A 4IIOA 3PFSA 4PLLA 4MDXA 2OTLQ 5GAOm 3CCQA 4JRPA 3EH2A 1ZSGA 4J9GA 2C0IA 2DXBA 2DYBA 4LUDA 5IXFA 2DFUA 3NGPA 3L1AA 3M0RA 2XKOC 4J83A 4IUPA 4M75A 1D0YA 5HCKA 2QTVA 3MHXA 2VB6A 2KY9A 2DF6A 1YJNT 1M3AA 3AHUA 1FWZA 1PG5B 2NUTB 2RJEA 2L3PA 1GFDA 1A0NB 2QQBA 4FYWB 2EQJA 1UGQB 3META 4M77D 1WQWA 4JS4A 2D1XA 2JOYA 1YHQQ 4BE2A 3JB9F 3A8GB 4RTTA 1YCYA 3X25B 7AT1B 5LL6S 1QKWA 1VQ8Q 1NM7A 1PCXA 1S72A 5LJ3d 2CP2A 4A4KA 3EGXA 2DVJA 3L2ZA 4N4GA 1TUDA 1VYUA 4RG8A 5GMKe 4EMKA 3P8DA 5GAN7 1VQ6A 2IIMA 2EKHA 1WHMA 3OYBA 1BI0A 3C0CA 4IUVA 3SD4A 3EGXB 2MPXC 1KHCA 2HQEA 2F2WA 4PJLA 1OU9A 2PVOB 4EMKB 1VQKQ 3OYAA 2XICA 4M7DE 1RI9A 4KGVB 1NPRA 1IREB 3NTKA 1I5OB 2IG0A 3JCMb 4XTXA 1G3SA 2CDTA 1QVFP 4OB3B 2X3XD 1ZSZC 2DBKA 3UF4A 1RADB 3DB3A 1LVKA 2RQUA 1M90U 2KR3A 2QGGA 3CMAA 2E3HA 2DE0X 1XOVA 1KQSS 2MIOA 1WXBA 1EFNA 1K76A 2JS0A 1RL2A 1YWPA 1K0XA 1NJIU 1G8XA 3UDCA 4NL3A 3L2WA 3H6ZA 2K3XA 3JRZA 2V26A 1QQJA 4XTZA 4A4EA 3CCLQ 3X26B 2OTJA 1U1TA 4KUDK 2F5TX 3QXEB 3OBWA 3RMQA 5I2SA 5GANd 1N9SA 1UHFA 2GBQA 3HFNA 1TUCA 3SFMA 5HY6A 2E6NA 4C0DB 4AFSC 1Q95G 5KE2A 1KD1U 1YJ9A 5FRMA 3M0UA 1AOJA 5D6YA 4XK8E 2LC4A 8AT1B 2EJGA 3OYIA 5LJ5g 3JB9D 2NUZA 3PVLA 3GBQA 1HK9A 2M9UA 4PK4A 1QLYA 4JZ3A 2PUKB 4Z02A 4AG2C 3ASKA 5KYYA 1K9MR 1KK7A 1SHGA 3PVQA 5GAOr 4AFZC 1M8VA 3PIOA 4M77G 1M90C 4GLMA 3HRTA 3A5ZB 4LD6A 2DIQA 3OYCA 4M7DC 3QJYA 1WXUA 4PFOA 3SHWA 2ZPBB 4F7UG 5KYYB 5LJ3h 1IHVA 5GAMh 1TSFA 1ZBJA 4ELYC 2SEMA 4HT9A 2FZGB 5J3BA 4JPBW 2A08A 2LT4A 2DXTA 3QSUA 2MI6A 4PNOA 1JJ2P 2NUPA 2DYIA 1H8KA 2DZ9A 2EQKA 1PRMC 2FYKA 1VA7A 1WJSA 4AFUC 1MV3A 4XQ3A 4LE9A 1NEGA 3VS7A 3ZBDA 3QWXX 2HKNA 2NYSA 4OMLA 2NUPB 1PNJA 2CZ0B 5FU6B 3CMEQ 2QG9B 2ZPGB 1JU5C 3QYHB 2CH4A 5LJ5j 5KYWA 1SRMA 2QA4Q 2FO0A 2CUDA 2YUQA 2KI7A 2JN0A 1M1FA 4F04B 1W2BS 4R0KA 2CS7A 3M56A 1WDXA 5FU7C 2C0TA 2JNGA 2PU9B 2BKDN 3NMZC 2CGHA 2Z0WA 2WSEE 4E7ZA 2E64A 2LQKA 1YITT 5GANh 1KSWA 2FRWA 3CBOA 1AD5A 1K73C 1OPLA 1RAGB 3KBGA 4M75F 3SDZA 2JZ2A 4HCCA 1WI7A 2EFIA 3EGUA 1MMNA 3OMCA 2LCLA 2AZSA 2V8IA 1VIEA 1VQ7Q 2O2OA 4IKFA 3MP6A 3HPWA 1H3ZA 3JB9G 4DBFA 4IUTA 1KQSA 4WCIA 1AWJA 1X75C 1NZ9A 2MK5A 3VS3A 1BBZA 3V7RA 3CCUA 1OULA 1GBQA 3PT9A 1IO6A 1XTDA 2XDPA 1AEYA 4X9DA 1Q81R 4GY5A 2VXFA 1TU0B 3PMIA 3OW2S 4R56A 3A8MB 2DILA 3TREA 1LPLA 3GIBA 3RKXA 4BE1A 4JJBA 4XTYA 5I11A 3KFVA 2EBPA 2CSIA 1X69A 2KK4A 1GRIA 4A4HA 3TEEA 4X34A 4RTXA 2D0QB 2RB6A 1Y0MA 3LH5A 4AFQC 1WIEA 4GLKA 4EMGA 4C5HA 3RESA 4VUBA 4RTUA 1TTHB 2F69A 3G4ST 2ED1A 9ATCB 1YI2T 3JCMV 3VS4A 1QVPA 1D09B 3JCMX 2KXDA 3C94A 1HSQA 1ZSZA 4PJOA 4Y28E 4E7SA 2FL7A 2MOXA 1VQNT 3FB9A 4N4HA 4M75D 3CCMA 4BUGA 1K9AA 2JVVA 4O5VA 4PJOB 5M9OA 1ABQA 2RI5A 1R0BG 4KH0B 4CRIA 2RI2A 1TS9A 2V8KA 2ZPHB 2Y4XA 3JCMc 4QVDA 2DM1A 3OSSC 1D3BB 2FVUA 3WXMB 3VUBA 4DOWA 2FZKB 2DX1A 1M1GA 3CCQT 1D0ZA 4PKCC 2E12A 2K5IA 1YJWA 2E10A 2GTJA 2K3YA 1K9MU 3THKA 4DOVA 2YRCA 2OJ2A 1PKSA 4QQ6A 4FW1A 1ACMB 3JCMg 2JMCA 3UWNA 5CK9A 1M3BA 1C1AA 3REBB 1Z9QA 2XD0A 4FIBA 1T3SA 2FPEA 2COYA 2RN8A 2RPNA 2QDLA 3E1SA 3J81E 2W10A 3R6OA 3LGFA 3GOXA 2DJQA 1MMAA 2LNVA 3GLXA 2YDLA 1UDLA 3CXCS 3QHSA 3V8KA 1TH7A 4E7IA 1I4K1 3JB9I 2RHUA 4C8QF 4BD3A 1BI3A 3OYKA 3RERA 2OI3A 1D0XA 1NPPA 3CC2A 4RTYA 4A4FA 2FPFA 4M77E 2YT6A 3P8HA 5D6XA 2I2LA 2HZYA 5GAOp 3MEVA 4KGZB 1VQ6T 3HP9A 4F7UE 4Z8AA 1VQMA 4C92G 4ORZA 1Q82R 2QQ9A 2C06A 1UHCA 1K8AU 4NL2A 1XJWB 3JCMe 2L2PA 2AKLA 3JB9H 5KCOA 2A36A 1ZA2B 2A3LA 4ATOA 1K9MC 3EH1A 2HEQA 4C5GA 3G4SQ 2E1HA 2J6KA 1YI2Q 4J6YA 1FX7A 3OW2A 1JRIA 4ZGEB 3CMAT 3VRYA 5GAN8 1N27A 2O4XA 5IN1A 4AT1B 3C95A 4QVCA 4OMOA 2CP5A 1M3CA 3I56Q 3RIRA 1VQNQ 4M78A 1AVZC 3BDLA 4RCBA 3UATA 2O4XB 1VQ5Q 2E41A 4HXJA 1HYOA 4QQGA 2VVKA 4M78B 3R6NA 2OTJT 1U06A 5FWCA 3CD6A 2HMAA 1DJ7B 1KQSP 5GAMf 1N8RR 2DD4A 3OYYA 2LZ6B 4LDWA 5D6WA 3BW1A 3FRNA 2X9HA 5FU7B 3G71Q 2K7AA 1RAAB 3CCQQ 5DM7R 3H0IA 2DTHA 1U8RA 2AHJB 2CZ6B 3CCVA 1ZLMA 1FMVA 4E47A 1YJ9T 5LJ3j 3PMTA 3EFOA 1X6GA 2FB7A 5I2MA 3NHNA 2E65A 2HL3A 2JUFA 4M77C 1M2VA 4QW2A 1YIJA 1U3OA 3EFOB 1MMDA 2AZVA 4LNPA 1NYGA 1CKAA 1LOJA 2DPPB 2JTFA 3BFMA 3V8LA 4TVRA 2CT4A 3QIIA 1M2VB 3F70A 3CCJT 4RTWA 2KXCA 4A54A 1UGVA 3M0SA 2R5MA 4BY6B 3JSCA 2PZ1A 2KRNA 2L0AA 2RK2A 4OB1B 3OBYA 1ZUUA 3TVTA 4RG2A 1RAIB 3PNWC 3EGDA 2FZCB 3VS2A 1UEBA 1JXMA 4M75B 2DL7A 1UTIA 4ZNXA 4Q5WA 1VQOA 4M7AA 5GANf 1VQ6Q 1YFNA 1RUWA 3EGDB 3MEUA 2G3RA 3VV0A 1BIBA 3SWNA 1LCKA 1WFWA 4J7IA 4J9DA 3PIPA 3I55Q 2JJ9A 1SKUB 2LX7A 2FG0A 4M7AB 1RLQC 2EWNA 1KIKA 5GAN3 2W0ZA 4FSXA 3EFRA 2P0QA 5GAN5 1WHGA 3EHRA 4PJOF 2CUBA 2HBPA 3SWNB 4D8KA 2OTLA 3J7AF 3UPUA 3LH0A 5GAMd 1QVGA 1X6BA 5GJWB 3CXCA 3CC7A 1VQPQ 1MMGA 3RKYA 1ZX6A 5KYUA 1B34A 1RACB 5CQYA 1C0MA 1E6GA 2XDDA 3CMAQ 1G3YA 2QEXA 3LWIA 4XU1A 4B9XA 1MHNA 3QUIA 2DETA 3DLMA 5KYUB 1B34B 5GAOq 2DK3A 1GCQC 1U5SA 2NWMA 3ME9A 1Y71A 3M59A 1WHLA 2RHXA 3UA7A 1W2BP 2OTJQ 4LD9K 1VQLA 1PWTA 1PSEA 5CO7A 4PJJA 2B8AA 4E2FB 1I5LA 5HK0A 1X2KA 2EAYA 4M4ZA 2J7IA 1NE8A 4KBMB 1YJ9Q 5GMKl 2GQVA 1RI0A 4OMNA 2LCCA 3VS1A 2RH2A 4JJDA 2HAXA 2ATCB 3RUXA 2SRCA 3CCUT 3MKDA 3A98A 3HFOA 5FLXE 1VQKA 3OA6A 2ECZA 4JUVA 4QT7A 2K57A 2IPOB 1SF9A 1WGSA 3CCEA 1AT1B 1OX9A 1MGQA 3M0TA 3CCJQ 3H41A 1WHHA 3Q1JA 2LP5A 2DEUA 2DBMA 3OB9A 4PFZA 1J3TA 2V1RA 1OI1A 4MZPA 2LVMA 2L3RA 4O6JA 2WSFE 1YJNQ 1QCOA 4BE0A 4PJOD 1PRLC 2WSCE 2Y4YA 3OW2P 2VYTA 2KNBB 1OYXA 2QDYB 2JS2A 3JB9J 4OB2B 2K9GA 4P5NA 1SHFA 2DD5A 2QQRA 2M0OA 1ZBXA 4BDYA 2CKKA 2DIGA 2Y90A 2FPDA 1D1AA 5DLQE 3X20B 1K73U 2QQAA 2AK5A 3BY7A 1CKBA 4M78F 4C92E 4IUUA 5DY9A 2ZAEA 4J9FA 4C8QA 2YLBA 4JDSA 2VGMA 4DBHA 2QI2A 4HKEA 3QDRB 3CCMT 5AT1B 4C8QB 1WPYA 2RQRA 4PJMA 2MAMA 1Q7YR 4E6RA 1PSFA 1RAEB 3HRSA 3H0FA 2I0NA 3UA6A 5LJ5e 1K0SA 3OYHA 2LQNA 2KRSA 5FW9A 1Q82C 2LTOA 2XK0A 2H8HA 1Q86R 1WJRA 1KC8R 5KYWB 1YJWT 2L89A 2DZCA 1QKXA 4D6WA 3QZ9B 2J05A 1NG2A 3RNJA 5C6SA 3GNGA 2L8DA 4MDWA 1BK2A 3C4SA 3VS6A 4DEXA 2DRMA 2DTIA 4OMFB 1T0JA 5IHIA 4D8DA 3QJ6A 4J5YA 3CCUQ 2XHCA 3LW5E 3ZFJA 2HCKA 3VS0A 3CMEA 2D6FA 2PVGB 2DL4A 4J6XA 4EPCA 2RQVA 8ATCB 2CREA 1HJDA 1G3WA 2ZGWA 1NYFA 2V1QA 2QA4A 5IXBA 1AWXA 3A8LB 2L5QA 3CC2T 3CEYA 1N9RA 1WQ7A 3VU3C 4M7AF 5GMKh 4C92C 4XU2A 5IHNA 2RHZA 4PJOG 1M1KR 4YTLA 2JW4A 2BZXA 3CXCP 3V8JA 1P92A 5IT9E 1VQMT 4JZ4A 1ABOA 4M78D 3DKMA 2YUNA 2CSQA 1LNXA 4EDUA 4A53A 2CH4W 5CKFA 1GCPA 3RMSA 4ZN3A 3BDUA 3S3MA 3E9GA 2X4YA 3CCRA 3VJPA 2ZPFB 4LDUA 1NEBA 1WJQA 2KE9A 1BU1A 2KYBA 2LCSA 1PHTA 1X2QA 3FEOA 3O5ZA 1QWFA 2CZ1B 4OF1A 3SB2A 1OX8A 1UGPB 2HL5C 3CCSA 4OVAA 1VQ7A 3M0PA 1FXXA 1KJWA 4J9HA 1AZEA 4HCZA 3OYJA 2LX9A 3CCMQ 3MEWA 3L2QA 5HK3A 4IUQA 2CT3A 2CYZB 2OAWA 4LXCA 3EG2A 3CD6T 1D1BA 3NFCA 3E19A 1V29B 2CP7A 2DA9A 2RQWA 1WA7A 1X43A 1SPKA 2BE7D 5GAOl 2YRDA 4MZMA 1JEGA 1JQQA 4KGXB 2DRKA 4EMKC 3CCVT 3GP8A 2HQHA 2A37A 4LDYA 2HSPA 1ZSZB 2P84A 1TUGB 1SSHA 3L42A 4X9CA 3OY9A 2RM4A 1W4SA 2BIVA 3S3NA 4KT0E 4RMOA 2GFAA 3G6EA 1IGUA 1E7OA 1YIJT 1YITQ 3VS5A 1I1JA 2DL5A 4M7AD 2BUDA 4PL6A 1VQ9A 2QGFB 4ANJA 2ABLA 3CBPA 3QDFA 1CSKA 2FEIA 2E5QA 1OPKA 1G83A 2ROTA 2PVDB 3GF5A 4WTOB 1PM3A 4C5EA 5KH6A 3OS0A 3M58A 3NPFA 2M02A 4BACA 3CC2Q 2KEAA 2DL8A 1B07A 3RKWA 2D0NA 1OEBA 2OX7A 1VQOT 1IGQA 1SRLA 2MMPA 2LQ8A 2MF2A 5A2QE 3DB4A 4M78G 1QMCA 1VQMQ 3CC4A 1QVGS 2DERA 4RUGA 2XG8D 5LJ5h 4C0DC 3KUFA 1VQ4A 2QAZA 3REAB 2AIRB 2OAUA 2VKNA 5AYFA 2OTLT 4M7DA 5CIUA 1UGRB 1S72T 1KQ1A 3FLGA 2CP0A 4J6WA 4EMHA 3A8HB 1NJIR 3JAME 3CC7T 2K5FA 3LYIA 3ZL7C 1W70A 4OMQA 4BDZA 3CPWS 4C5IA 4M7DB 3QYGB 1WYXA 2MWOA 2QEXT 1KQ2A 2P0KA 2K4YA 3BE3A 3E9FA 4J9CA 4PFPA 2GTOA 5LJ3g 3JCMf 2D8HA 2LDMA 5GAMg 2BE9B 3FC3A 4V2SA 2J6FA 2XMFA 1ZQ1A 5GAN6 2HSEB 1VQLT 5CKHA 2ESWA 3M4GA 4F16A 1KD1R 1H3HA 1UJ0A 4UC4A 2BTTA 1WHKA 5J26A 5J39A 2DL3A 2XU8A 5CKDA 4M75G 2ED0A 4ELZC 2A28A 1ARKA 4FT4A 3OSVA 3KXTA 2V8JA 4BI4A 4HVWA 4M77F 1WHJA 2DTOA 1Y96A 2YXYA 4ME7A 4RCCA 4XU3A 4AMCA 4BI8B 4M7AG 4CC4B 2EVRA 1VQKT 1R0CB 4BB7A 2RK1A 2A7YA 4JJNK 1BCOA 2O9VA 2KQWA 1K1ZA 2M0YA 3UT1A 4CI0C 4PJNA 1M1KU 3ER0A 1Y96B 3C12A 3CCET 5LJ3e 1T0HA 4EIKA 4FSSA 4FCYA 1Q81U 5GAMj 2CP6A 1KC8C 2R57A 1JJ2A 2F1LA 2KROA 3HTRA 5A0GA 2GGRA 4C8QD 2E4HA 5GANg 2JT4A 2XI9A 2A0FB 3I56A 1M9SA 1WLPB 3HL8A 1R8OB 2LJ1A 2K2VA 2LQWA 4C92A 1YWOA 1VQOQ 1VQ5A 1N6AA 4JRQA 3OYFA 2O31A 5A0LA 4FT2A 3M57A 1ZUKA 3JCMd 3OYLA 1X6OA 1O75A 2EW3A 1B3QA 3GNFB 4PJOE 1V1CA 1YBYA 2H3JA 3G71A 3D7SB 3FJ5A 3M4YA 2X4XA 3QWYA 1S72Q 5IHKA 4RTVA 3LLRA 2DVEA 1UGSB 1KFZA 2RNAA 2RQTA 3CC7Q 4QQDA 1BI1A 3JCMP 1BCMA 4JRKA 4L59A 3VYGA 3JV3A 2QEXQ 2NUTA 4J9EA 3ULRB 1M1KC 2VASA 1M8MA 2VV5A 2LJ3A 3QZ5B 1WZOA 2RO0A 2GFUA 1SEMA 4X1VA 5GANe 1Q81C 2EYYA 4C0FA 3SEMA 2YRVA 1BI2A 5GANj 4NS5A 2ZPEB 3I35A 1VQLQ 4XTWA 1PD1A 3NTIA 1GFCA 2PTKA 2ZPIB 3J80E 2F5KA 3I5RA 3OYDA 2PQWA 4HVVA 2J06A 2JTEA 2EQUA 2EQIA 4QKUA 4LN2A
chains in the Genus database with same CATH topology
3M5AA 5LJ5e 5CKEA 3G4ST 3OYHA 5CCAA 5FU6C 3CPWA 2WACA 1QP2A 2NLUA 1YI2T 1VQPT 3JCMV 1HXDA 1LJOA 1QVPA 3JCMX 5GMKj 1Q82C 2LTOA 2XK0A 2R5AA 3C94A 1IZ6A 4J8OA 5DLOA 4PJOA 1WJRA 4Y28E 4N0AA 4F7UF 2FL7A 3MO8A 3I55A 1Q7YC 1YHQA 1VQNT 2RD1A 4RKUE 5L8RE 2QQSA 3OYGA 5CAIA 3FB9A 4N4HA 2L89A 3CMET 1YJWT 3HSBA 2VGNA 3WVDB 4M75D 3CCMA 4BUGA 2JVVA 3CPFA 1XQHA 4O5VA 4J7FA 3HRUA 2DZCA 4PJOB 4D6WA 1VQ8A 5M9OA 3QZ9B 3OYMA 3T9NA 4PJOC 2RI5A 3G4SA 3QG1A 2QA4T 5GAMe 2DEQA 4XTVA 4E7LA 5LJ3f 5C6SA 1Q86C 2GCXA 2RI2A 2RHIA 3GNGA 2L8DA 4MDWA 3MCAB 1OZ3A 3S6WA 2V8KA 1VQPA 2ZPHB 2Y4XA 3JCMc 4OB0B 3C4SA 4QVDA 2GF7A 2M16A 3OSSC 2DTIA 1D3BB 4OMFB 4C8QG 4DQ2A 4XTUA 2FVUA 3QJ6A 3WXMB 5CR2A 3VUBA 3EAEA 1QP3A 4J5YA 4NOYA 3TCJA 4DOWA 2ZZDA 2XHCA 1M1GA 3LW5E 3CCQT 1U1SA 4PKCC 3ZFJA 1VQNA 2E12A 2K5IA 1VIFA 3CMEA 1YJWA 3PGGA 2E10A 2K3YA 3JCMh 1K9MU 4DOVA 3QBYA 3N5BB 2P0PA 4M7DF 1Y07A 2D6FA 2PVGB 3FJPA 4QQ6A 4J6XA 4EPCA 5CVIA 5EG2A 4IURA 3JCMg 5CQXA 4QVZA 1BKBA 1K8AC 3CCLT 1G3WA 3UWNA 2ZGWA 5CK9A 2QA4A 4HA8A 1Q82U 2O01E 2XD0A 4FIBA 1SSFA 2DO3A 4C92B 2HNIA 3A8LB 2L5QA 3CC2T 3CCRT 2IVWA 3CEYA 1N9RA 1WQ7A 3VU3C 4M7AF 5GMKh 3OS1A 3LGLA 3J81E 1UB4A 3E1SA 3FDRA 4C92C 4XU2A 3R6OA 3LGFA 3GOXA 3PFSA 2RHZA 4PJOG 4PLLA 4M78E 4YTLA 4MDXA 2KVQG 3QKJA 5GAOm 3V8JA 3CCQA 4JRPA 3G7ZA 2LNVA 1P92A 3H8ZA 3GLXA 5IT9E 3CCST 2DXBA 2KAFA 1VQMT 1GXIE 4M78D 3DKMA 1VQ7T 1LNXA 4EDUA 3L1AA 4A53A 5KE3A 2XKOC 5CKFA 3CXCS 4J83A 4E7KA 3JCMJ 4IUPA 3QHSA 4M75A 3V8KA 1TH7A 4E7IA 3RMSA 1I4K1 3JB9I 2RHUA 4C8QF 4ZN3A 2JTMA 3BDUA 3CCLA 4BD3A 1O9SA 3MHXA 3S3MA 1BI3A 3OYKA 3E9GA 2KY9A 3RERA 2X4YA 1NPPA 1YJNT 2PUOB 3CC2A 3CCRA 4PLIA 2EYQA 3VJPA 3AHUA 2ZPFB 1FWZA 4R55A 4A4FA 2LT1A 4LDUA 1WJQA 2RJEA 3URGA 4M77E 3P8HA 5D6XA 2I2LA 2FHDA 3FEOA 2CZ1B 3MEVA 4OF1A 3HP9A 3SB2A 1UGPB 5GAOp 1VQ6T 2QQBA 2EQJA 1UGQB 4F7UE 3CCSA 3CCJA 1VQMA 3META 4M77D 4OVAA 1WQWA 2YHTA 4C92G 1VQ7A 4JS4A 3OYEA 4MZTA 2JOYA 2X35A 1N8RU 2QQ9A 2C06A 4BE2A 1K8AU 1FXXA 4NL2A 3JCMe 3JB9H 3JB9F 1I81A 4HCZA 3A8GB 5KCOA 3OYJA 2LX9A 1YCYA 3ZEHA 3X25B 3MEWA 2A3LA 5GAOn 3L2QA 5LL6S 5HK3A 4ATOA 2EJ9A 1NJIC 4IUQA 1K9MC 2CYZB 1S72A 1YJNA 5LJ3d 1XNIA 2KSSA 4C5GA 4A4KA 3CD6T 4N4GA 3L2ZA 2EIFA 2RJCA 3M55A 1QW1A 2E1HA 4RG8A 5GMKe 3G6ET 5LJ5f 3NFCA 4EMKA 4J6YA 1FX7A 4ZN1A 1JRIA 3OW2A 3E19A 1V29B 4ZGEB 3P8DA 5GAN7 3CMAT 1VQ6A 5GAN8 1N27A 2O4XA 3CBMA 5IN1A 3PTAA 3OYBA 1BI0A 4IUVA 3SD4A 5GAOl 4MZMA 3A8OB 3C95A 1KHCA 4M75E 1JBMA 2HQEA 3OQ5A 4QVCA 1VQ9T 5IAYA 1EIFA 2PVOB 3OMGA 3RIRA 4EMKB 4M78A 4JRIA 4B9WA 3OYAA 2XICA 4M7DE 4OGEA 1NPRA 3BDLA 4N4IA 4RCBA 1IREB 4XAXB 3NTKA 4EMKC 2O4XB 5C0MA 2IG0A 4LDYA 3JCMb 3GP8A 4KUIA 4II1A 4XTXA 1G3SA 2E41A 4OB3B 3L42A 4HCBA 1KD1C 4M7DD 2XDBA 4QQGA 4X9CA 3X24B 3OY9A 4M78B 5FROA 2RM4A 1W4SA 2BIVA 4N0AC 2OTJT 3CD6A 2XIDA 4KT0E 4RMOA 4JLIA 2GFAA 3DB3A 3S3NA 4M7AE 3G6EA 5I21A 4M78C 1DJ7B 4C92F 1M90U 5GAMf 4A4GA 2DD4A 3OYYA 1YIJT 1QVFS 5GAN2 4LDWA 5D6WA 3BW1A 3FRNA 4ZTJA 3CMAA 1VUBA 5FU7B 4M7AD 3M53A 4Y91A 2DXCA 2BUDA 2YLCA 1XOVA 4PL6A 1KQSS 1VQ9A 2RI3A 3CBPA 1RL2A 4M77A 1AHJB 4ZTFA 2R58A 5DM7R 3CC4T 2DTHA 1U8RA 4LDXA 2AHJB 2E5QA 4L6V5 1NJIU 2CZ6B 3CCVA 4E47A 1YJ9T 5LJ3j 4F7UA 2PVDB 2RJDA 3GF5A 3PMTA 1VQ4T 3UDCA 3CCVT 4NL3A 2FB7A 3L2WA 1N8RC 5I2MA 3H6ZA 5A0DA 4C5EA 5KH6A 2K3XA 3JRZA 4M77B 2E65A 3OS0A 4XTZA 4A4EA 2OTJA 2QTXA 3X26B 3M58A 2JUFA 4M77C 3INZA 3L2VA 1U1TA 4BACA 4KUDK 2F5TX 4F7UB 4QW2A 4E7HA 1YIJA 3QXEB 3MP1A 3OBWA 3RKWA 3RMQA 5I2SA 5GANd 1LOJA 1N9SA 4FM4B 1VQOT 2DPPB 2JTFA 3BFMA 2MMPA 3HFNA 2LQ8A 2MF2A 4TVRA 3V8LA 5A2QE 3DB4A 3QIIA 4M78G 3SFMA 5HY6A 3F70A 3V7SA 3CCJT 3CC4A 2E6NA 4C0DB 1QVGS 4A54A 5KE2A 1KD1U 2R5MA 2XG8D 4BY6B 5LJ5h 1YJ9A 5D6YA 4C0DC 3JSCA 3KUFA 4XK8E 5FRMA 2LC4A 1VQ4A 2EJGA 2OAUA 2RK2A 4OB1B 4BY6C 3OBYA 3OYIA 2X4JA 5LJ5g 5AYFA 3JB9D 2OTLT 4M7DA 1HK9A 5CIUA 4RG2A 1UGRB 1S72T 1KQ1A 3FLGA 2M9UA 4J6WA 3PNWC 4EMHA 5LJ5d 1UEBA 2RHYA 1BIAA 2PUKB 3A8HB 4M75B 4Z02A 3ASKA 3JAME 3CC7T 2K5FA 3LYIA 4M75C 1KG1A 4Q5WA 4BDZA 5GAOr 1VQOA 3CPWS 4DA4A 4C5IA 4M7DB 4M7AA 2DJZA 1M8VA 3QYGB 5GANf 4M77G 3PIOA 1M90C 3HRTA 2MWOA 3A5ZB 4LDVA 2DIQA 4LD6A 3OYCA 2QEXT 1YI2A 4ZGDB 3JCMQ 1KQ2A 3MEUA 2G3RA 3VV0A 4M7DC 2P0KA 1BIBA 2HD0A 2K4YA 3QJYA 3SWNA 4J7IA 3OS5A 2ZPBB 4F7UG 3PIPA 5LJ3h 3E9FA 4WF2A 5GAMh 4M7AB 2EWNA 2KMTA 3WVEB 4ELYC 5GMKm 5LJ3g 4HT9A 3JCMf 5GAN3 1OZ2A 4FSXA 2LDMA 2P0QA 3EFRA 5J3BA 5GAMg 5GAN5 4M7AC 4PJOF 2HBPA 3SWNB 2OTLA 4OP0A 3FC3A 4V2SA 2LT4A 4FU6A 1Y7XA 2DXTA 3GPLA 1JB0E 3J7AF 3QSUA 3UPUA 3SWNC 2M1HA 2MI6A 3LH0A 1ZQ1A 4PNOA 5GAMd 1QVGA 5GAN6 1VQLT 3CXCA 5CKHA 3CC7A 3RKYA 3M4GA 2DZ9A 1B34A 5CQYA 2EQKA 2FYKA 4C92D 1WJSA 4UC4A 4ZGJB 2XDDA 4XQ3A 1G3YA 2QEXA 3LWIA 3ZBDA 4XU1A 4B9XA 1JJ2S 5J26A 5J39A 3P8BB 1MHNA 2XU8A 3QUIA 4E7JA 3HKSA 3S3OA 4KULA 5CKDA 3MP8A 3DLMA 2CZ0B 2K5LA 4M75G 1B34B 5FU6B 5GAOq 4ELZC 2DK3A 3OYNA 2ZPGB 4HT8A 3ME9A 4FT4A 3QYHB 2RJFA 1Y71A 3M59A 3OSVA 5LJ5j 3KXTA 4M7DG 2V8JA 2RHXA 4BI4A 4M77F 2QXFA 2DTOA 4BI3A 4LD9K 1Y96A 1VQLA 1PSEA 4ME7A 1G3TA 4RCCA 4XU3A 3V7CA 4BI8B 3M54A 3I56T 4M7AG 2E70A 2JN0A 5CO7A 1KHIA 1VQKT 4BB7A 2RK1A 1M1FA 2A7YA 4JJNK 2B8AA 1W2BS 2CS7A 3M56A 2KQWA 3UT1A 4CI0C 4MMKA 1M1KU 1I5LA 3ER0A 5FU7C 3MEAA 1Y96B 3C12A 1VQ5T 5HK0A 2EKOA 1H641 1D3BA 2JNGA 2PU9B 3CCET 2EAYA 2BKDN 5LJ3e 2CGHA 3FIFA 1NE8A 1Q81U 4KBMB 3DLLA 2WSEE 4C8QE 5GMKl 5GAMj 2GQVA 1RI0A 2E64A 2LQKA 1YITT 2X4WA 1KC8C 2R57A 1JJ2A 5GANh 2LCCA 3G71T 2RH2A 2HAXA 3RUXA 3CBOA 5A0GA 1M5Q1 2D9TA 4C8QD 3L2UA 3CCUT 1K73C 3NTHA 5GANg 3HFOA 2P4TA 2XI9A 2HQXA 5FLXE 3I56A 1M9SA 3KBGA 4JLGA 1VQKA 3HL8A 4M75F 3OA6A 3TU4K 3VUZA 4FL6A 1R8OB 4XU0A 3SDZA 2JZ2A 4HCCA 2K2VA 4JUVA 4C92A 3LX7A 2K57A 3HHTB 2EFIA 1VQ5A 1N6AA 1WGSA 3OMCA 3CCEA 2LCLA 4JRQA 5FRNA 1MGQA 2V8IA 1VIEA 3OYFA 1G5VA 2DKGA 3Q1JA 5GAN4 4IKFA 1QVFA 3MP6A 3L2RA 3HPWA 5A0LA 3OB9A 3M57A 4FT2A 3JCMd 3OYLA 1X6OA 1W2BA 1H3ZA 3JB9G 1O75A 1OI1A 3GNFB 4MZPA 4PJOE 2LVMA 1YITA 2L3RA 1YBYA 2H3JA 4IUTA 4O6JA 3G71A 1KQSA 1X75C 1NZ9A 3OS2A 3JCMW 1Q7YU 3LWHA 2WSFE 3M4YA 2X4XA 3V7RA 3CCUA 4L5GA 4PJOD 3PT9A 4BE0A 1XTDA 2WSCE 2Y4YA 3LLRA 2XDPA 2VUBA 2VYTA 2DVEA 1OYXA 2QDYB 4X9DA 3VYHB 1UGSB 5GMKi 3JB9J 4GY5A 5HKCA 4QQDA 1BI1A 2VXFA 4OB2B 3JCMP 4JRKA 4L59A 3VYGA 3PMIA 4P5NA 3X28B 2DAQA 4R56A 3OW2S 1WNLA 2DD5A 2EJFA 3O8VA 5KCHA 1Q86U 3A8MB 2QQRA 2M0OA 3TREA 3QPHA 1X01A 1KC8U 1ZBXA 4BDYA 3GIBA 3RKXA 2CKKA 4BE1A 1M1KC 2DIGA 2Y90A 2VV5A 4XTYA 4C0GA 4OGCA 5DLQE 3X20B 3QZ5B 1K73U 2RO0A 2QQAA 2ZCFB 2DXUA 2GFUA 1M4ZA 3EFSA 1I8FA 5GANe 1Q81C 2KK4A 2MWPA 4C0FA 2E6ZA 3M9QA 3BY7A 4A4HA 2YRVA 5CKBA 1BI2A 2VXEA 4M78F 4C92E 5GANj 2KDSA 4IUUA 2ZPEB 4NS5A 5DY9A 4C8QA 2LRQA 2YLBA 3TEEA 4JDSA 2VGMA 4JS5A 4XTWA 2EQMA 4X34A 1BYMA 3NTIA 3I55T 2QI2A 2VC8A 4HKEA 1YHQT 2D0QB 2RB6A 2ZPIB 3QDRB 4GLKA 2F5KA 4EMGA 3J80E 1ZHIA 4C5HA 3RESA 3OYDA 3CCMT 2PQWA 3QO3A 4C8QB 1WPYA 2MAMA 4C0ZA 4VUBA 1VQ8T 1PSFA 4CRIA 4MMLA 4C8QC 3HRSA 3VKIA 2EQUA 2F69A 2CZ7B 2RA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S T;  3OYH A;  3CPW A;  2WAC A;  1YI2 T;  1VQP T;  2NLU A;  1Q82 C;  2LTO A;  2XK0 A;  2R5A A;  1IZ6 A;  1WJR A;  3I55 A;  3MO8 A;  1Q7Y C;  1YHQ A;  1VQN T;  2QQS A;  3OYG A;  4N4H A;  3CME T;  1YJW T;  2L89 A;  3CCM A;  2JVV A;  3CPF A;  1VQ8 A;  5M9O A;  3OYM A;  2RI5 A;  3G4S A;  2QA4 T;  4E7L A;  5C6S A;  1Q86 C;  4CRI A;  1VQP A;  1YI2 A;  2RHI A;  2L8D A;  2RI2 A;  3S6W A;  1OZ3 A;  3C4S A;  2GF7 A;  2M16 A;  3QJ6 A;  3EAE A;  2XHC A;  1M1G A;  3CCQ T;  1VQN A;  3CME A;  1YJW A;  2K3Y A;  1K9M U;  3QBY A;  4QQ6 A;  4IUR A;  4QVZ A;  1BKB A;  1K8A C;  3CCL T;  3UWN A;  2QA4 A;  1Q82 U;  1SSF A;  2DO3 A;  3CC2 T;  3CCR T;  3CEY A;  3OS1 A;  3LGL A;  3J81 E;  3FDR A;  3LGF A;  3GOX A;  3PFS A;  2RHZ A;  4PLL A;  4YTL A;  2KVQ G;  3QKJ A;  3CCQ A;  3H8Z A;  5IT9 E;  3CCS T;  1VQM T;  1VQ7 T;  4EDU A;  5KE3 A;  3CXC S;  4E7K A;  4IUP A;  4E7I A;  2RHU A;  4ZN3 A;  3CCL A;  4BD3 A;  3S3M A;  3OYK A;  3E9G A;  2X4Y A;  1NPP A;  1YJN T;  3CC2 A;  3CCR A;  4PLI A;  4A4F A;  1WJQ A;  2RJE A;  3P8H A;  5D6X A;  2FHD A;  3FEO A;  3MEV A;  1VQ6 T;  2EQJ A;  3CCS A;  1VQM A;  3CCJ A;  3MET A;  4OVA A;  1VQ7 A;  3OYE A;  2JOY A;  1N8R U;  2X35 A;  4BE2 A;  1K8A U;  4HCZ A;  5KCO A;  3OYJ A;  3ZEH A;  3MEW A;  3L2Q A;  5LL6 S;  1NJI C;  1K9M C;  4IUQ A;  1S72 A;  1YJN A;  1XNI A;  4C5G A;  3CD6 T;  4N4G A;  2EIF A;  2RJC A;  3G6E T;  4ZN1 A;  3OW2 A;  3P8D A;  3CMA T;  1VQ6 A;  1N27 A;  2O4X A;  5IN1 A;  3OYB A;  4IUV A;  3SD4 A;  1KHC A;  2HQE A;  3OQ5 A;  1VQ9 T;  5IAY A;  1EIF A;  3OMG A;  4B9W A;  3OYA A;  1NPR A;  3BDL A;  4N4I A;  5C0M A;  3CCV T;  3NTK A;  2O4X B;  2IG0 A;  4II1 A;  3L42 A;  1KD1 C;  4QQG A;  3OY9 A;  5FRO A;  2OTJ T;  2BIV A;  3CD6 A;  3S3N A;  3DB3 A;  2GFA A;  3G6E A;  1M90 U;  4A4G A;  3OYY A;  1YIJ T;  1QVF S;  5D6W A;  4ZTJ A;  3CMA A;  2BUD A;  4PL6 A;  1KQS S;  1VQ9 A;  2RI3 A;  1RL2 A;  4ZTF A;  2R58 A;  5DM7 R;  3CC4 T;  2E5Q A;  1NJI U;  3CCV A;  1YJ9 T;  2RJD A;  1VQ4 T;  3PMT A;  3L2W A;  1N8R C;  3H6Z A;  4C5E A;  5KH6 A;  2K3X A;  3OS0 A;  4A4E A;  2OTJ A;  2JUF A;  3L2V A;  4BAC A;  4QW2 A;  1YIJ A;  4E7H A;  3MP1 A;  1VQO T;  2JTF A;  2LQ8 A;  4TVR A;  5A2Q E;  3DB4 A;  3QII A;  5HY6 A;  3F70 A;  3CCJ T;  3CC4 A;  2E6N A;  1QVG S;  1KD1 U;  5KE2 A;  1YJ9 A;  2R5M A;  5FRM A;  5D6Y A;  3KUF A;  1VQ4 A;  3OYI A;  2OTL T;  5CIU A;  4RG2 A;  1S72 T;  3FLG A;  3PNW C;  1UEB A;  2RHY A;  4Z02 A;  3ASK A;  3JAM E;  3CC7 T;  3LYI A;  4Q5W A;  4BDZ A;  1VQO A;  3CPW S;  4C5I A;  3PIO A;  1M90 C;  2MWO A;  3A5Z B;  4LD6 A;  2QEX T;  2DIQ A;  3OYC A;  3MEU A;  2G3R A;  2P0K A;  3PIP A;  3E9F A;  1OZ2 A;  2LDM A;  5J3B A;  2OTL A;  3FC3 A;  4FU6 A;  3J7A F;  2M1H A;  2MI6 A;  3LH0 A;  1QVG A;  1VQL T;  3CXC A;  3CC7 A;  2EQK A;  1WJS A;  4UC4 A;  2QEX A;  4B9X A;  1JJ2 S;  5J26 A;  5J39 A;  3P8B B;  1MHN A;  4E7J A;  3HKS A;  3S3O A;  3MP8 A;  3DLM A;  3OYN A;  3ME9 A;  2RJF A;  2RHX A;  1VQL A;  3I56 T;  2E70 A;  1VQK T;  1KHI A;  1W2B S;  2B8A A;  3UT1 A;  1M1K U;  3ER0 A;  3MEA A;  1VQ5 T;  2EKO A;  3CCE T;  2JNG A;  2BKD N;  1Q81 U;  3DLL A;  1RI0 A;  1YIT T;  1KC8 C;  2X4W A;  1JJ2 A;  2R57 A;  3G71 T;  2LCC A;  3L2U A;  2D9T A;  3CCU T;  1K73 C;  3NTH A;  5FLX E;  2HQX A;  3I56 A;  3KBG A;  1VQK A;  3OA6 A;  4FL6 A;  2JZ2 A;  3LX7 A;  2EFI A;  1VQ5 A;  1WGS A;  3OMC A;  3CCE A;  2LCL A;  5FRN A;  3OYF A;  1G5V A;  3Q1J A;  1QVF A;  4IKF A;  3MP6 A;  3L2R A;  3OB9 A;  3OYL A;  1H3Z A;  1X6O A;  1W2B A;  1OI1 A;  2LVM A;  1YIT A;  2L3R A;  1YBY A;  4IUT A;  3G71 A;  1KQS A;  3OS2 A;  1NZ9 A;  1Q7Y U;  2X4X A;  3CCU A;  4BE0 A;  1XTD A;  3LLR A;  2XDP A;  2VYT A;  1OYX A;  4GY5 A;  4QQD A;  4L59 A;  3PMI A;  3OW2 S;  2DAQ A;  1Q86 U;  3O8V A;  5KCH A;  2QQR A;  3TRE A;  2M0O A;  1KC8 U;  4BDY A;  2CKK A;  1M1K C;  4BE1 A;  2DIG A;  5DLQ E;  1K73 U;  2RO0 A;  2GFU A;  1Q81 C;  2MWP A;  2E6Z A;  3M9Q A;  4A4H A;  2YRV A;  2KDS A;  4IUU A;  4NS5 A;  2LRQ A;  4X34 A;  2EQM A;  3NTI A;  3I55 T;  1YHQ T;  3J80 E;  2F5K A;  4C5H A;  3CCM T;  3OYD A;  2PQW A;  1VQ8 T;  2EQU A; 
#chains in the Genus database with same CATH topology
 1MUZ A;  5CKE A;  1EZZ B;  1FMW A;  2EGA A;  2WAC A;  1QP2 A;  2NLU A;  3CPW A;  1HXD A;  3RR6 A;  5GMK j;  2GNC A;  2HKQ B;  1Y57 A;  3I55 A;  1YHQ A;  2RD1 A;  1WXT A;  5L8R E;  3CME T;  3HSB A;  3WVD B;  5KYX A;  3A1P A;  3HRU A;  4J7F A;  2G6F X;  2F2V A;  1VQ8 A;  1I0C A;  3CCE Q;  4PJO C;  2QA4 T;  3EG0 A;  3CQT A;  2DEQ A;  4XTV A;  4E7L A;  2BZ8 A;  1VQP A;  2RHI A;  3S6W A;  5KYX B;  3MCA B;  1OZ3 A;  4OB0 B;  2M16 A;  4C8Q G;  4DQ2 A;  4XTU A;  5CR2 A;  3EAE A;  2ZZD A;  3JCM h;  3QBY A;  1C6V X;  1NLO C;  4M7D F;  5EC7 A;  3FJP A;  1M2O A;  1M27 C;  5CVI A;  5EG2 A;  4IUR A;  4FYX B;  5CQX A;  1FMK A;  1AWO A;  3H9N A;  4HA8 A;  1Q82 U;  2O01 E;  3CCR T;  2IVW A;  2B86 A;  3FDR A;  1S1N A;  1ZUY A;  4M78 E;  2EGC A;  2KVQ G;  3QKJ A;  1GL5 A;  3G7Z A;  1EX4 A;  3EG1 A;  3H8Z A;  2JM9 A;  3EG3 A;  3CCS T;  2KAF A;  2JM8 A;  1VQ7 T;  2JMA A;  5KE3 A;  4E7K A;  3JCM J;  2BZY A;  2AKK A;  2MYS A;  2JTM A;  1TOV A;  3CCL A;  1O9S A;  4K11 A;  1K4U S;  2PUO B;  1NLP C;  4PLI A;  2EYQ A;  4R55 A;  2LT1 A;  4J9B A;  1RLP C;  3URG A;  1TXQ A;  2ROL A;  2EPD A;  1QCF A;  3MJX A;  2FHD A;  1GXI E;  2M51 A;  3CCJ A;  2YHT A;  4ESR A;  3OYE A;  4MZT A;  1N8R U;  2X35 A;  1YN8 A;  1ZA1 B;  1I81 A;  1I07 A;  3ZEH A;  5GAO n;  2KYM A;  1OQK A;  2EJ9 A;  1NJI C;  4KH1 B;  1YJN A;  1D1C A;  1XNI A;  2KSS A;  2EIF A;  2RJC A;  3M55 A;  1QW1 A;  3G6E T;  5LJ5 f;  3TSW A;  2LJ0 A;  4ZN1 A;  3IQL A;  5GJV B;  2DNU A;  3PTA A;  3CBM A;  1R77 A;  2QK0 A;  3A8O B;  4M75 E;  1JBM A;  3OQ5 A;  1VQ9 T;  5IAY A;  1EIF A;  3OMG A;  1IB8 A;  2QAS A;  4JRI A;  4B9W A;  4OGE A;  3H0H A;  4N4I A;  4XAX B;  1VYV A;  3I9Q A;  5FWB A;  5C0M A;  1QWE A;  4KUI A;  5KYN A;  4II1 A;  4DBQ A;  1KD1 C;  4M7D D;  2XDB A;  3X24 B;  5FRO A;  1OOT A;  4N0A C;  2XID A;  1PKT A;  4M7A E;  2HDA A;  5I21 A;  4M78 C;  4C92 F;  4A4G A;  1RAB B;  1QVF S;  5GAN 2;  1K8A R;  4ZTJ A;  1VUB A;  3M53 A;  4Y91 A;  4F14 A;  2DXC A;  2E5K A;  2YLC A;  2RI3 A;  1NBE B;  1YNZ A;  1H92 A;  4M77 A;  1AHJ B;  2YUP A;  2R58 A;  4ZTF A;  3CC4 T;  1YP5 A;  4LDX A;  4L6V 5;  3U23 A;  4J9I A;  4A63 B;  4F7U A;  2RJD A;  3MPU B;  1VQ4 T;  1N8R C;  5A0D A;  4M77 B;  2QTX A;  4OMP A;  2RMO A;  1AWW A;  3INZ A;  1UFF A;  3L2V A;  2MCN A;  4F7U B;  3CCR Q;  2O9S A;  4E7H A;  3MP1 A;  2EYW A;  4B6M A;  1QVG P;  4FM4 B;  2J6O A;  1B7T A;  2PNI A;  2C0O A;  4CC2 A;  1TWB A;  3V7S A;  3CCS Q;  4HCB A;  2L3Q A;  3AT1 B;  4BY6 C;  2X4J A;  1TG0 A;  3CPW P;  2KT8 A;  5LJ5 d;  2RHY A;  1BIA A;  1OU8 A;  4Z89 A;  2EGE A;  2KBT A;  4M75 C;  1KG1 A;  1AZG B;  1UEC A;  4DA4 A;  2DJZ A;  2F2X A;  4LDV A;  4ZGD B;  3JCM Q;  2QYZ A;  2HD0 A;  1JO8 A;  3M0Q A;  3OS5 A;  3TSZ A;  2D8J A;  2H3E B;  2DMO A;  4WF2 A;  4FYY B;  2KMT A;  1UG1 A;  3WVE B;  5GMK m;  1OZ2 A;  4M7A C;  2YWW A;  4OP0 A;  4FU6 A;  1Y7X A;  3GPL A;  1JB0 E;  2GQI A;  3SWN C;  2CP3 A;  2M1H A;  1YCS B;  3G6E Q;  1GCQ A;  2COZ A;  4CC7 A;  4C92 D;  4ZGJ B;  4OMM A;  1PD0 A;  2HBW A;  2O88 A;  1JJ2 S;  3P8B B;  3G1J A;  1RAH B;  4E7J A;  3HKS A;  3S3O A;  1VQ9 Q;  4KUL A;  4F17 A;  3MP8 A;  1IHW A;  2K5L A;  3TQ7 P;  1YJW Q;  3OYN A;  4HT8 A;  1IRX A;  4DEY A;  2RJF A;  2COW A;  4M7D G;  3EG9 A;  4HCK A;  2K3B A;  2QXF A;  1MV0 B;  4Z88 A;  1M30 A;  1W1F A;  4BI3 A;  1VOM A;  1FYN A;  1G3T A;  3V7C A;  3M54 A;  3I56 T;  2E70 A;  3EG9 B;  1KHI A;  2KGT A;  4MMK A;  2RF0 A;  3MEA A;  1VQ5 T;  2EKO A;  1H64 1;  2VWF A;  2YUO A;  1D3B A;  3CC4 Q;  1SG5 A;  1UUE A;  3FIF A;  1UJY A;  3DLL A;  4C8Q E;  1VQ4 Q;  1BB9 A;  1UE9 A;  4GBQ A;  2X4W A;  3G71 T;  1W6X A;  3RBB B;  3L2U A;  1M5Q 1;  2D9T A;  3NTH A;  2EYZ A;  2P4T A;  2HQX A;  4JLG A;  3TU4 K;  3VUZ A;  4FL6 A;  4XU0 A;  3LX7 A;  3HHT B;  2EYX A;  5FRN A;  2E3I A;  1G5V A;  2DKG A;  5GAN 4;  1QVF A;  3L2R A;  1M90 R;  1VYT A;  1W2B A;  6AT1 B;  3RDV A;  1YIT A;  3OS2 A;  3JCM W;  1Q7Y U;  4Y92 A;  3LWH A;  4L5G A;  2X51 A;  2VUB A;  3VYH B;  5GMK i;  5HKC A;  3X28 B;  2DAQ A;  1WNL A;  1X27 A;  2EJF A;  3O8V A;  5KCH A;  1Q86 U;  3E2U A;  4HVU A;  3QPH A;  1X01 A;  1KC8 U;  4RTZ A;  1PC0 A;  5L23 A;  4C0G A;  4FYV B;  4OGC A;  2K2M A;  2JXB A;  2ZCF B;  2DXU A;  2LMJ A;  1M4Z A;  3EFS A;  1I8F A;  2MWP A;  2E6Z A;  3M9Q A;  4DBR A;  5CKB A;  5I22 A;  2VXE A;  2KDS A;  3CD6 Q;  2LRQ A;  4KRT A;  4JS5 A;  1BYM A;  2EQM A;  3I55 T;  2VC8 A;  1YHQ T;  2AT1 B;  1ZHI A;  3QO3 A;  1OV3 A;  2YSQ A;  4C0Z A;  1VQ8 T;  2LNH B;  3PE0 A;  4MML A;  4C8Q C;  3VKI A;  4JLI A;  2CZ7 B;  2X3W D;  3M5A A;  5CCA A;  3CCV Q;  5FU6 C;  2DLP A;  4IIM A;  1VQP T;  1LJO A;  3EHQ A;  1N5Z A;  2P4R A;  2R5A A;  4J8O A;  1IZ6 A;  3I5S A;  5DLO A;  5IH2 A;  4N0A A;  3VRZ A;  4F7U F;  1WX6 A;  3MO8 A;  1YIJ Q;  1Q7Y C;  4RKU E;  4JJC A;  2ENM A;  2QQS A;  3OYG A;  5CAI A;  2FRY A;  2VGN A;  1K73 R;  1HD3 A;  3CPF A;  1XQH A;  4CC3 A;  2KRM A;  3OYM A;  1MND A;  3T9N A;  2L3S A;  2K6D A;  3G4S A;  3QG1 A;  1MNE A;  2K79 A;  5GAM e;  1E6H A;  4LUE A;  5LJ3 f;  1Q86 C;  2GCX A;  1YI2 A;  1G2B A;  2GF7 A;  1RAF B;  1JXO A;  1QP3 A;  4NOY A;  3TCJ A;  1GBR A;  1QCN A;  1U1S A;  4FW2 A;  1VQN A;  2RA2 A;  1IXD A;  1VIF A;  3PGG A;  4AG1 C;  3N5B B;  2KT1 A;  1T3L A;  2P0P A;  1Y07 A;  1Z9Z A;  1F1B B;  4QVZ A;  1BKB A;  1K8A C;  3CCL T;  1V76 A;  1SSF A;  2DO3 A;  4C92 B;  2HNI A;  5ECA A;  5D7U A;  3OS1 A;  3LGL A;  1UB4 A;  4IIO A;  3PFS A;  4PLL A;  4MDX A;  2OTL Q;  5GAO m;  3CCQ A;  4JRP A;  3EH2 A;  1ZSG A;  4J9G A;  2C0I A;  2DXB A;  2DYB A;  4LUD A;  5IXF A;  2DFU A;  3NGP A;  3L1A A;  3M0R A;  2XKO C;  4J83 A;  4IUP A;  4M75 A;  1D0Y A;  5HCK A;  2QTV A;  3MHX A;  2VB6 A;  2KY9 A;  2DF6 A;  1YJN T;  1M3A A;  3AHU A;  1FWZ A;  1PG5 B;  2NUT B;  2RJE A;  2L3P A;  1GFD A;  1A0N B;  2QQB A;  4FYW B;  2EQJ A;  1UGQ B;  3MET A;  4M77 D;  1WQW A;  4JS4 A;  2D1X A;  2JOY A;  1YHQ Q;  4BE2 A;  3JB9 F;  3A8G B;  4RTT A;  1YCY A;  3X25 B;  7AT1 B;  5LL6 S;  1QKW A;  1VQ8 Q;  1NM7 A;  1PCX A;  1S72 A;  5LJ3 d;  2CP2 A;  4A4K A;  3EGX A;  2DVJ A;  3L2Z A;  4N4G A;  1TUD A;  1VYU A;  4RG8 A;  5GMK e;  4EMK A;  3P8D A;  5GAN 7;  1VQ6 A;  2IIM A;  2EKH A;  1WHM A;  3OYB A;  1BI0 A;  3C0C A;  4IUV A;  3SD4 A;  3EGX B;  2MPX C;  1KHC A;  2HQE A;  2F2W A;  4PJL A;  1OU9 A;  2PVO B;  4EMK B;  1VQK Q;  3OYA A;  2XIC A;  4M7D E;  1RI9 A;  4KGV B;  1NPR A;  1IRE B;  3NTK A;  1I5O B;  2IG0 A;  3JCM b;  4XTX A;  1G3S A;  2CDT A;  1QVF P;  4OB3 B;  2X3X D;  1ZSZ C;  2DBK A;  3UF4 A;  1RAD B;  3DB3 A;  1LVK A;  2RQU A;  1M90 U;  2KR3 A;  2QGG A;  3CMA A;  2E3H A;  2DE0 X;  1XOV A;  1KQS S;  2MIO A;  1WXB A;  1EFN A;  1K76 A;  2JS0 A;  1RL2 A;  1YWP A;  1K0X A;  1NJI U;  1G8X A;  3UDC A;  4NL3 A;  3L2W A;  3H6Z A;  2K3X A;  3JRZ A;  2V26 A;  1QQJ A;  4XTZ A;  4A4E A;  3CCL Q;  3X26 B;  2OTJ A;  1U1T A;  4KUD K;  2F5T X;  3QXE B;  3OBW A;  3RMQ A;  5I2S A;  5GAN d;  1N9S A;  1UHF A;  2GBQ A;  3HFN A;  1TUC A;  3SFM A;  5HY6 A;  2E6N A;  4C0D B;  4AFS C;  1Q95 G;  5KE2 A;  1KD1 U;  1YJ9 A;  5FRM A;  3M0U A;  1AOJ A;  5D6Y A;  4XK8 E;  2LC4 A;  8AT1 B;  2EJG A;  3OYI A;  5LJ5 g;  3JB9 D;  2NUZ A;  3PVL A;  3GBQ A;  1HK9 A;  2M9U A;  4PK4 A;  1QLY A;  4JZ3 A;  2PUK B;  4Z02 A;  4AG2 C;  3ASK A;  5KYY A;  1K9M R;  1KK7 A;  1SHG A;  3PVQ A;  5GAO r;  4AFZ C;  1M8V A;  3PIO A;  4M77 G;  1M90 C;  4GLM A;  3HRT A;  3A5Z B;  4LD6 A;  2DIQ A;  3OYC A;  4M7D C;  3QJY A;  1WXU A;  4PFO A;  3SHW A;  2ZPB B;  4F7U G;  5KYY B;  5LJ3 h;  1IHV A;  5GAM h;  1TSF A;  1ZBJ A;  4ELY C;  2SEM A;  4HT9 A;  2FZG B;  5J3B A;  4JPB W;  2A08 A;  2LT4 A;  2DXT A;  3QSU A;  2MI6 A;  4PNO A;  1JJ2 P;  2NUP A;  2DYI A;  1H8K A;  2DZ9 A;  2EQK A;  1PRM C;  2FYK A;  1VA7 A;  1WJS A;  4AFU C;  1MV3 A;  4XQ3 A;  4LE9 A;  1NEG A;  3VS7 A;  3ZBD A;  3QWX X;  2HKN A;  2NYS A;  4OML A;  2NUP B;  1PNJ A;  2CZ0 B;  5FU6 B;  3CME Q;  2QG9 B;  2ZPG B;  1JU5 C;  3QYH B;  2CH4 A;  5LJ5 j;  5KYW A;  1SRM A;  2QA4 Q;  2FO0 A;  2CUD A;  2YUQ A;  2KI7 A;  2JN0 A;  1M1F A;  4F04 B;  1W2B S;  4R0K A;  2CS7 A;  3M56 A;  1WDX A;  5FU7 C;  2C0T A;  2JNG A;  2PU9 B;  2BKD N;  3NMZ C;  2CGH A;  2Z0W A;  2WSE E;  4E7Z A;  2E64 A;  2LQK A;  1YIT T;  5GAN h;  1KSW A;  2FRW A;  3CBO A;  1AD5 A;  1K73 C;  1OPL A;  1RAG B;  3KBG A;  4M75 F;  3SDZ A;  2JZ2 A;  4HCC A;  1WI7 A;  2EFI A;  3EGU A;  1MMN A;  3OMC A;  2LCL A;  2AZS A;  2V8I A;  1VIE A;  1VQ7 Q;  2O2O A;  4IKF A;  3MP6 A;  3HPW A;  1H3Z A;  3JB9 G;  4DBF A;  4IUT A;  1KQS A;  4WCI A;  1AWJ A;  1X75 C;  1NZ9 A;  2MK5 A;  3VS3 A;  1BBZ A;  3V7R A;  3CCU A;  1OUL A;  1GBQ A;  3PT9 A;  1IO6 A;  1XTD A;  2XDP A;  1AEY A;  4X9D A;  1Q81 R;  4GY5 A;  2VXF A;  1TU0 B;  3PMI A;  3OW2 S;  4R56 A;  3A8M B;  2DIL A;  3TRE A;  1LPL A;  3GIB A;  3RKX A;  4BE1 A;  4JJB A;  4XTY A;  5I11 A;  3KFV A;  2EBP A;  2CSI A;  1X69 A;  2KK4 A;  1GRI A;  4A4H A;  3TEE A;  4X34 A;  4RTX A;  2D0Q B;  2RB6 A;  1Y0M A;  3LH5 A;  4AFQ C;  1WIE A;  4GLK A;  4EMG A;  4C5H A;  3RES A;  4VUB A;  4RTU A;  1TTH B;  2F69 A;  3G4S T;  2ED1 A;  9ATC B;  1YI2 T;  3JCM V;  3VS4 A;  1QVP A;  1D09 B;  3JCM X;  2KXD A;  3C94 A;  1HSQ A;  1ZSZ A;  4PJO A;  4Y28 E;  4E7S A;  2FL7 A;  2MOX A;  1VQN T;  3FB9 A;  4N4H A;  4M75 D;  3CCM A;  4BUG A;  1K9A A;  2JVV A;  4O5V A;  4PJO B;  5M9O A;  1ABQ A;  2RI5 A;  1R0B G;  4KH0 B;  4CRI A;  2RI2 A;  1TS9 A;  2V8K A;  2ZPH B;  2Y4X A;  3JCM c;  4QVD A;  2DM1 A;  3OSS C;  1D3B B;  2FVU A;  3WXM B;  3VUB A;  4DOW A;  2FZK B;  2DX1 A;  1M1G A;  3CCQ T;  1D0Z A;  4PKC C;  2E12 A;  2K5I A;  1YJW A;  2E10 A;  2GTJ A;  2K3Y A;  1K9M U;  3THK A;  4DOV A;  2YRC A;  2OJ2 A;  1PKS A;  4QQ6 A;  4FW1 A;  1ACM B;  3JCM g;  2JMC A;  3UWN A;  5CK9 A;  1M3B A;  1C1A A;  3REB B;  1Z9Q A;  2XD0 A;  4FIB A;  1T3S A;  2FPE A;  2COY A;  2RN8 A;  2RPN A;  2QDL A;  3E1S A;  3J81 E;  2W10 A;  3R6O A;  3LGF A;  3GOX A;  2DJQ A;  1MMA A;  2LNV A;  3GLX A;  2YDL A;  1UDL A;  3CXC S;  3QHS A;  3V8K A;  1TH7 A;  4E7I A;  1I4K 1;  3JB9 I;  2RHU A;  4C8Q F;  4BD3 A;  1BI3 A;  3OYK A;  3RER A;  2OI3 A;  1D0X A;  1NPP A;  3CC2 A;  4RTY A;  4A4F A;  2FPF A;  4M77 E;  2YT6 A;  3P8H A;  5D6X A;  2I2L A;  2HZY A;  5GAO p;  3MEV A;  4KGZ B;  1VQ6 T;  3HP9 A;  4F7U E;  4Z8A A;  1VQM A;  4C92 G;  4ORZ A;  1Q82 R;  2QQ9 A;  2C06 A;  1UHC A;  1K8A U;  4NL2 A;  1XJW B;  3JCM e;  2L2P A;  2AKL A;  3JB9 H;  5KCO A;  2A36 A;  1ZA2 B;  2A3L A;  4ATO A;  1K9M C;  3EH1 A;  2HEQ A;  4C5G A;  3G4S Q;  2E1H A;  2J6K A;  1YI2 Q;  4J6Y A;  1FX7 A;  3OW2 A;  1JRI A;  4ZGE B;  3CMA T;  3VRY A;  5GAN 8;  1N27 A;  2O4X A;  5IN1 A;  4AT1 B;  3C95 A;  4QVC A;  4OMO A;  2CP5 A;  1M3C A;  3I56 Q;  3RIR A;  1VQN Q;  4M78 A;  1AVZ C;  3BDL A;  4RCB A;  3UAT A;  2O4X B;  1VQ5 Q;  2E41 A;  4HXJ A;  1HYO A;  4QQG A;  2VVK A;  4M78 B;  3R6N A;  2OTJ T;  1U06 A;  5FWC A;  3CD6 A;  2HMA A;  1DJ7 B;  1KQS P;  5GAM f;  1N8R R;  2DD4 A;  3OYY A;  2LZ6 B;  4LDW A;  5D6W A;  3BW1 A;  3FRN A;  2X9H A;  5FU7 B;  3G71 Q;  2K7A A;  1RAA B;  3CCQ Q;  5DM7 R;  3H0I A;  2DTH A;  1U8R A;  2AHJ B;  2CZ6 B;  3CCV A;  1ZLM A;  1FMV A;  4E47 A;  1YJ9 T;  5LJ3 j;  3PMT A;  3EFO A;  1X6G A;  2FB7 A;  5I2M A;  3NHN A;  2E65 A;  2HL3 A;  2JUF A;  4M77 C;  1M2V A;  4QW2 A;  1YIJ A;  1U3O A;  3EFO B;  1MMD A;  2AZV A;  4LNP A;  1NYG A;  1CKA A;  1LOJ A;  2DPP B;  2JTF A;  3BFM A;  3V8L A;  4TVR A;  2CT4 A;  3QII A;  1M2V B;  3F70 A;  3CCJ T;  4RTW A;  2KXC A;  4A54 A;  1UGV A;  3M0S A;  2R5M A;  4BY6 B;  3JSC A;  2PZ1 A;  2KRN A;  2L0A A;  2RK2 A;  4OB1 B;  3OBY A;  1ZUU A;  3TVT A;  4RG2 A;  1RAI B;  3PNW C;  3EGD A;  2FZC B;  3VS2 A;  1UEB A;  1JXM A;  4M75 B;  2DL7 A;  1UTI A;  4ZNX A;  4Q5W A;  1VQO A;  4M7A A;  5GAN f;  1VQ6 Q;  1YFN A;  1RUW A;  3EGD B;  3MEU A;  2G3R A;  3VV0 A;  1BIB A;  3SWN A;  1LCK A;  1WFW A;  4J7I A;  4J9D A;  3PIP A;  3I55 Q;  2JJ9 A;  1SKU B;  2LX7 A;  2FG0 A;  4M7A B;  1RLQ C;  2EWN A;  1KIK A;  5GAN 3;  2W0Z A;  4FSX A;  3EFR A;  2P0Q A;  5GAN 5;  1WHG A;  3EHR A;  4PJO F;  2CUB A;  2HBP A;  3SWN B;  4D8K A;  2OTL A;  3J7A F;  3UPU A;  3LH0 A;  5GAM d;  1QVG A;  1X6B A;  5GJW B;  3CXC A;  3CC7 A;  1VQP Q;  1MMG A;  3RKY A;  1ZX6 A;  5KYU A;  1B34 A;  1RAC B;  5CQY A;  1C0M A;  1E6G A;  2XDD A;  3CMA Q;  1G3Y A;  2QEX A;  3LWI A;  4XU1 A;  4B9X A;  1MHN A;  3QUI A;  2DET A;  3DLM A;  5KYU B;  1B34 B;  5GAO q;  2DK3 A;  1GCQ C;  1U5S A;  2NWM A;  3ME9 A;  1Y71 A;  3M59 A;  1WHL A;  2RHX A;  3UA7 A;  1W2B P;  2OTJ Q;  4LD9 K;  1VQL A;  1PWT A;  1PSE A;  5CO7 A;  4PJJ A;  2B8A A;  4E2F B;  1I5L A;  5HK0 A;  1X2K A;  2EAY A;  4M4Z A;  2J7I A;  1NE8 A;  4KBM B;  1YJ9 Q;  5GMK l;  2GQV A;  1RI0 A;  4OMN A;  2LCC A;  3VS1 A;  2RH2 A;  4JJD A;  2HAX A;  2ATC B;  3RUX A;  2SRC A;  3CCU T;  3MKD A;  3A98 A;  3HFO A;  5FLX E;  1VQK A;  3OA6 A;  2ECZ A;  4JUV A;  4QT7 A;  2K57 A;  2IPO B;  1SF9 A;  1WGS A;  3CCE A;  1AT1 B;  1OX9 A;  1MGQ A;  3M0T A;  3CCJ Q;  3H41 A;  1WHH A;  3Q1J A;  2LP5 A;  2DEU A;  2DBM A;  3OB9 A;  4PFZ A;  1J3T A;  2V1R A;  1OI1 A;  4MZP A;  2LVM A;  2L3R A;  4O6J A;  2WSF E;  1YJN Q;  1QCO A;  4BE0 A;  4PJO D;  1PRL C;  2WSC E;  2Y4Y A;  3OW2 P;  2VYT A;  2KNB B;  1OYX A;  2QDY B;  2JS2 A;  3JB9 J;  4OB2 B;  2K9G A;  4P5N A;  1SHF A;  2DD5 A;  2QQR A;  2M0O A;  1ZBX A;  4BDY A;  2CKK A;  2DIG A;  2Y90 A;  2FPD A;  1D1A A;  5DLQ E;  3X20 B;  1K73 U;  2QQA A;  2AK5 A;  3BY7 A;  1CKB A;  4M78 F;  4C92 E;  4IUU A;  5DY9 A;  2ZAE A;  4J9F A;  4C8Q A;  2YLB A;  4JDS A;  2VGM A;  4DBH A;  2QI2 A;  4HKE A;  3QDR B;  3CCM T;  5AT1 B;  4C8Q B;  1WPY A;  2RQR A;  4PJM A;  2MAM A;  1Q7Y R;  4E6R A;  1PSF A;  1RAE B;  3HRS A;  3H0F A;  2I0N A;  3UA6 A;  5LJ5 e;  1K0S A;  3OYH A;  2LQN A;  2KRS A;  5FW9 A;  1Q82 C;  2LTO A;  2XK0 A;  2H8H A;  1Q86 R;  1WJR A;  1KC8 R;  5KYW B;  1YJW T;  2L89 A;  2DZC A;  1QKX A;  4D6W A;  3QZ9 B;  2J05 A;  1NG2 A;  3RNJ A;  5C6S A;  3GNG A;  2L8D A;  4MDW A;  1BK2 A;  3C4S A;  3VS6 A;  4DEX A;  2DRM A;  2DTI A;  4OMF B;  1T0J A;  5IHI A;  4D8D A;  3QJ6 A;  4J5Y A;  3CCU Q;  2XHC A;  3LW5 E;  3ZFJ A;  2HCK A;  3VS0 A;  3CME A;  2D6F A;  2PVG B;  2DL4 A;  4J6X A;  4EPC A;  2RQV A;  8ATC B;  2CRE A;  1HJD A;  1G3W A;  2ZGW A;  1NYF A;  2V1Q A;  2QA4 A;  5IXB A;  1AWX A;  3A8L B;  2L5Q A;  3CC2 T;  3CEY A;  1N9R A;  1WQ7 A;  3VU3 C;  4M7A F;  5GMK h;  4C92 C;  4XU2 A;  5IHN A;  2RHZ A;  4PJO G;  1M1K R;  4YTL A;  2JW4 A;  2BZX A;  3CXC P;  3V8J A;  1P92 A;  5IT9 E;  1VQM T;  4JZ4 A;  1ABO A;  4M78 D;  3DKM A;  2YUN A;  2CSQ A;  1LNX A;  4EDU A;  4A53 A;  2CH4 W;  5CKF A;  1GCP A;  3RMS A;  4ZN3 A;  3BDU A;  3S3M A;  3E9G A;  2X4Y A;  3CCR A;  3VJP A;  2ZPF B;  4LDU A;  1NEB A;  1WJQ A;  2KE9 A;  1BU1 A;  2KYB A;  2LCS A;  1PHT A;  1X2Q A;  3FEO A;  3O5Z A;  1QWF A;  2CZ1 B;  4OF1 A;  3SB2 A;  1OX8 A;  1UGP B;  2HL5 C;  3CCS A;  4OVA A;  1VQ7 A;  3M0P A;  1FXX A;  1KJW A;  4J9H A;  1AZE A;  4HCZ A;  3OYJ A;  2LX9 A;  3CCM Q;  3MEW A;  3L2Q A;  5HK3 A;  4IUQ A;  2CT3 A;  2CYZ B;  2OAW A;  4LXC A;  3EG2 A;  3CD6 T;  1D1B A;  3NFC A;  3E19 A;  1V29 B;  2CP7 A;  2DA9 A;  2RQW A;  1WA7 A;  1X43 A;  1SPK A;  2BE7 D;  5GAO l;  2YRD A;  4MZM A;  1JEG A;  1JQQ A;  4KGX B;  2DRK A;  4EMK C;  3CCV T;  3GP8 A;  2HQH A;  2A37 A;  4LDY A;  2HSP A;  1ZSZ B;  2P84 A;  1TUG B;  1SSH A;  3L42 A;  4X9C A;  3OY9 A;  2RM4 A;  1W4S A;  2BIV A;  3S3N A;  4KT0 E;  4RMO A;  2GFA A;  3G6E A;  1IGU A;  1E7O A;  1YIJ T;  1YIT Q;  3VS5 A;  1I1J A;  2DL5 A;  4M7A D;  2BUD A;  4PL6 A;  1VQ9 A;  2QGF B;  4ANJ A;  2ABL A;  3CBP A;  3QDF A;  1CSK A;  2FEI A;  2E5Q A;  1OPK A;  1G83 A;  2ROT A;  2PVD B;  3GF5 A;  4WTO B;  1PM3 A;  4C5E A;  5KH6 A;  3OS0 A;  3M58 A;  3NPF A;  2M02 A;  4BAC A;  3CC2 Q;  2KEA A;  2DL8 A;  1B07 A;  3RKW A;  2D0N A;  1OEB A;  2OX7 A;  1VQO T;  1IGQ A;  1SRL A;  2MMP A;  2LQ8 A;  2MF2 A;  5A2Q E;  3DB4 A;  4M78 G;  1QMC A;  1VQM Q;  3CC4 A;  1QVG S;  2DER A;  4RUG A;  2XG8 D;  5LJ5 h;  4C0D C;  3KUF A;  1VQ4 A;  2QAZ A;  3REA B;  2AIR B;  2OAU A;  2VKN A;  5AYF A;  2OTL T;  4M7D A;  5CIU A;  1UGR B;  1S72 T;  1KQ1 A;  3FLG A;  2CP0 A;  4J6W A;  4EMH A;  3A8H B;  1NJI R;  3JAM E;  3CC7 T;  2K5F A;  3LYI A;  3ZL7 C;  1W70 A;  4OMQ A;  4BDZ A;  3CPW S;  4C5I A;  4M7D B;  3QYG B;  1WYX A;  2MWO A;  2QEX T;  1KQ2 A;  2P0K A;  2K4Y A;  3BE3 A;  3E9F A;  4J9C A;  4PFP A;  2GTO A;  5LJ3 g;  3JCM f;  2D8H A;  2LDM A;  5GAM g;  2BE9 B;  3FC3 A;  4V2S A;  2J6F A;  2XMF A;  1ZQ1 A;  5GAN 6;  2HSE B;  1VQL T;  5CKH A;  2ESW A;  3M4G A;  4F16 A;  1KD1 R;  1H3H A;  1UJ0 A;  4UC4 A;  2BTT A;  1WHK A;  5J26 A;  5J39 A;  2DL3 A;  2XU8 A;  5CKD A;  4M75 G;  2ED0 A;  4ELZ C;  2A28 A;  1ARK A;  4FT4 A;  3OSV A;  3KXT A;  2V8J A;  4BI4 A;  4HVW A;  4M77 F;  1WHJ A;  2DTO A;  1Y96 A;  2YXY A;  4ME7 A;  4RCC A;  4XU3 A;  4AMC A;  4BI8 B;  4M7A G;  4CC4 B;  2EVR A;  1VQK T;  1R0C B;  4BB7 A;  2RK1 A;  2A7Y A;  4JJN K;  1BCO A;  2O9V A;  2KQW A;  1K1Z A;  2M0Y A;  3UT1 A;  4CI0 C;  4PJN A;  1M1K U;  3ER0 A;  1Y96 B;  3C12 A;  3CCE T;  5LJ3 e;  1T0H A;  4EIK A;  4FSS A;  4FCY A;  1Q81 U;  5GAM j;  2CP6 A;  1KC8 C;  2R57 A;  1JJ2 A;  2F1L A;  2KRO A;  3HTR A;  5A0G A;  2GGR A;  4C8Q D;  2E4H A;  5GAN g;  2JT4 A;  2XI9 A;  2A0F B;  3I56 A;  1M9S A;  1WLP B;  3HL8 A;  1R8O B;  2LJ1 A;  2K2V A;  2LQW A;  4C92 A;  1YWO A;  1VQO Q;  1VQ5 A;  1N6A A;  4JRQ A;  3OYF A;  2O31 A;  5A0L A;  4FT2 A;  3M57 A;  1ZUK A;  3JCM d;  3OYL A;  1X6O A;  1O75 A;  2EW3 A;  1B3Q A;  3GNF B;  4PJO E;  1V1C A;  1YBY A;  2H3J A;  3G71 A;  3D7S B;  3FJ5 A;  3M4Y A;  2X4X A;  3QWY A;  1S72 Q;  5IHK A;  4RTV A;  3LLR A;  2DVE A;  1UGS B;  1KFZ A;  2RNA A;  2RQT A;  3CC7 Q;  4QQD A;  1BI1 A;  3JCM P;  1BCM A;  4JRK A;  4L59 A;  3VYG A;  3JV3 A;  2QEX Q;  2NUT A;  4J9E A;  3ULR B;  1M1K C;  2VAS A;  1M8M A;  2VV5 A;  2LJ3 A;  3QZ5 B;  1WZO A;  2RO0 A;  2GFU A;  1SEM A;  4X1V A;  5GAN e;  1Q81 C;  2EYY A;  4C0F A;  3SEM A;  2YRV A;  1BI2 A;  5GAN j;  4NS5 A;  2ZPE B;  3I35 A;  1VQL Q;  4XTW A;  1PD1 A;  3NTI A;  1GFC A;  2PTK A;  2ZPI B;  3J80 E;  2F5K A;  3I5R A;  3OYD A;  2PQW A;  4HVV A;  2J06 A;  2JTE A;  2EQU A;  2EQI A;  4QKU A;  4LN2 A; 
#chains in the Genus database with same CATH homology
 3M5A A;  5LJ5 e;  5CKE A;  3G4S T;  3OYH A;  5CCA A;  5FU6 C;  3CPW A;  2WAC A;  1QP2 A;  2NLU A;  1YI2 T;  1VQP T;  3JCM V;  1HXD A;  1LJO A;  1QVP A;  3JCM X;  5GMK j;  1Q82 C;  2LTO A;  2XK0 A;  2R5A A;  3C94 A;  1IZ6 A;  4J8O A;  5DLO A;  4PJO A;  1WJR A;  4Y28 E;  4N0A A;  4F7U F;  2FL7 A;  3MO8 A;  3I55 A;  1Q7Y C;  1YHQ A;  1VQN T;  2RD1 A;  4RKU E;  5L8R E;  2QQS A;  3OYG A;  5CAI A;  3FB9 A;  4N4H A;  2L89 A;  3CME T;  1YJW T;  3HSB A;  2VGN A;  3WVD B;  4M75 D;  3CCM A;  4BUG A;  2JVV A;  3CPF A;  1XQH A;  4O5V A;  4J7F A;  3HRU A;  2DZC A;  4PJO B;  4D6W A;  1VQ8 A;  5M9O A;  3QZ9 B;  3OYM A;  3T9N A;  4PJO C;  2RI5 A;  3G4S A;  3QG1 A;  2QA4 T;  5GAM e;  2DEQ A;  4XTV A;  4E7L A;  5LJ3 f;  5C6S A;  1Q86 C;  2GCX A;  2RI2 A;  2RHI A;  3GNG A;  2L8D A;  4MDW A;  3MCA B;  1OZ3 A;  3S6W A;  2V8K A;  1VQP A;  2ZPH B;  2Y4X A;  3JCM c;  4OB0 B;  3C4S A;  4QVD A;  2GF7 A;  2M16 A;  3OSS C;  2DTI A;  1D3B B;  4OMF B;  4C8Q G;  4DQ2 A;  4XTU A;  2FVU A;  3QJ6 A;  3WXM B;  5CR2 A;  3VUB A;  3EAE A;  1QP3 A;  4J5Y A;  4NOY A;  3TCJ A;  4DOW A;  2ZZD A;  2XHC A;  1M1G A;  3LW5 E;  3CCQ T;  1U1S A;  4PKC C;  3ZFJ A;  1VQN A;  2E12 A;  2K5I A;  1VIF A;  3CME A;  1YJW A;  3PGG A;  2E10 A;  2K3Y A;  3JCM h;  1K9M U;  4DOV A;  3QBY A;  3N5B B;  2P0P A;  4M7D F;  1Y07 A;  2D6F A;  2PVG B;  3FJP A;  4QQ6 A;  4J6X A;  4EPC A;  5CVI A;  5EG2 A;  4IUR A;  3JCM g;  5CQX A;  4QVZ A;  1BKB A;  1K8A C;  3CCL T;  1G3W A;  3UWN A;  2ZGW A;  5CK9 A;  2QA4 A;  4HA8 A;  1Q82 U;  2O01 E;  2XD0 A;  4FIB A;  1SSF A;  2DO3 A;  4C92 B;  2HNI A;  3A8L B;  2L5Q A;  3CC2 T;  3CCR T;  2IVW A;  3CEY A;  1N9R A;  1WQ7 A;  3VU3 C;  4M7A F;  5GMK h;  3OS1 A;  3LGL A;  3J81 E;  1UB4 A;  3E1S A;  3FDR A;  4C92 C;  4XU2 A;  3R6O A;  3LGF A;  3GOX A;  3PFS A;  2RHZ A;  4PJO G;  4PLL A;  4M78 E;  4YTL A;  4MDX A;  2KVQ G;  3QKJ A;  5GAO m;  3V8J A;  3CCQ A;  4JRP A;  3G7Z A;  2LNV A;  1P92 A;  3H8Z A;  3GLX A;  5IT9 E;  3CCS T;  2DXB A;  2KAF A;  1VQM T;  1GXI E;  4M78 D;  3DKM A;  1VQ7 T;  1LNX A;  4EDU A;  3L1A A;  4A53 A;  5KE3 A;  2XKO C;  5CKF A;  3CXC S;  4J83 A;  4E7K A;  3JCM J;  4IUP A;  3QHS A;  4M75 A;  3V8K A;  1TH7 A;  4E7I A;  3RMS A;  1I4K 1;  3JB9 I;  2RHU A;  4C8Q F;  4ZN3 A;  2JTM A;  3BDU A;  3CCL A;  4BD3 A;  1O9S A;  3MHX A;  3S3M A;  1BI3 A;  3OYK A;  3E9G A;  2KY9 A;  3RER A;  2X4Y A;  1NPP A;  1YJN T;  2PUO B;  3CC2 A;  3CCR A;  4PLI A;  2EYQ A;  3VJP A;  3AHU A;  2ZPF B;  1FWZ A;  4R55 A;  4A4F A;  2LT1 A;  4LDU A;  1WJQ A;  2RJE A;  3URG A;  4M77 E;  3P8H A;  5D6X A;  2I2L A;  2FHD A;  3FEO A;  2CZ1 B;  3MEV A;  4OF1 A;  3HP9 A;  3SB2 A;  1UGP B;  5GAO p;  1VQ6 T;  2QQB A;  2EQJ A;  1UGQ B;  4F7U E;  3CCS A;  3CCJ A;  1VQM A;  3MET A;  4M77 D;  4OVA A;  1WQW A;  2YHT A;  4C92 G;  1VQ7 A;  4JS4 A;  3OYE A;  4MZT A;  2JOY A;  2X35 A;  1N8R U;  2QQ9 A;  2C06 A;  4BE2 A;  1K8A U;  1FXX A;  4NL2 A;  3JCM e;  3JB9 H;  3JB9 F;  1I81 A;  4HCZ A;  3A8G B;  5KCO A;  3OYJ A;  2LX9 A;  1YCY A;  3ZEH A;  3X25 B;  3MEW A;  2A3L A;  5GAO n;  3L2Q A;  5LL6 S;  5HK3 A;  4ATO A;  2EJ9 A;  1NJI C;  4IUQ A;  1K9M C;  2CYZ B;  1S72 A;  1YJN A;  5LJ3 d;  1XNI A;  2KSS A;  4C5G A;  4A4K A;  3CD6 T;  4N4G A;  3L2Z A;  2EIF A;  2RJC A;  3M55 A;  1QW1 A;  2E1H A;  4RG8 A;  5GMK e;  3G6E T;  5LJ5 f;  3NFC A;  4EMK A;  4J6Y A;  1FX7 A;  4ZN1 A;  1JRI A;  3OW2 A;  3E19 A;  1V29 B;  4ZGE B;  3P8D A;  5GAN 7;  3CMA T;  1VQ6 A;  5GAN 8;  1N27 A;  2O4X A;  3CBM A;  5IN1 A;  3PTA A;  3OYB A;  1BI0 A;  4IUV A;  3SD4 A;  5GAO l;  4MZM A;  3A8O B;  3C95 A;  1KHC A;  4M75 E;  1JBM A;  2HQE A;  3OQ5 A;  4QVC A;  1VQ9 T;  5IAY A;  1EIF A;  2PVO B;  3OMG A;  3RIR A;  4EMK B;  4M78 A;  4JRI A;  4B9W A;  3OYA A;  2XIC A;  4M7D E;  4OGE A;  1NPR A;  3BDL A;  4N4I A;  4RCB A;  1IRE B;  4XAX B;  3NTK A;  4EMK C;  2O4X B;  5C0M A;  2IG0 A;  4LDY A;  3JCM b;  3GP8 A;  4KUI A;  4II1 A;  4XTX A;  1G3S A;  2E41 A;  4OB3 B;  3L42 A;  4HCB A;  1KD1 C;  4M7D D;  2XDB A;  4QQG A;  4X9C A;  3X24 B;  3OY9 A;  4M78 B;  5FRO A;  2RM4 A;  1W4S A;  2BIV A;  4N0A C;  2OTJ T;  3CD6 A;  2XID A;  4KT0 E;  4RMO A;  4JLI A;  2GFA A;  3DB3 A;  3S3N A;  4M7A E;  3G6E A;  5I21 A;  4M78 C;  1DJ7 B;  4C92 F;  1M90 U;  5GAM f;  4A4G A;  2DD4 A;  3OYY A;  1YIJ T;  1QVF S;  5GAN 2;  4LDW A;  5D6W A;  3BW1 A;  3FRN A;  4ZTJ A;  3CMA A;  1VUB A;  5FU7 B;  4M7A D;  3M53 A;  4Y91 A;  2DXC A;  2BUD A;  2YLC A;  1XOV A;  4PL6 A;  1KQS S;  1VQ9 A;  2RI3 A;  3CBP A;  1RL2 A;  4M77 A;  1AHJ B;  4ZTF A;  2R58 A;  5DM7 R;  3CC4 T;  2DTH A;  1U8R A;  4LDX A;  2AHJ B;  2E5Q A;  4L6V 5;  1NJI U;  2CZ6 B;  3CCV A;  4E47 A;  1YJ9 T;  5LJ3 j;  4F7U A;  2PVD B;  2RJD A;  3GF5 A;  3PMT A;  1VQ4 T;  3UDC A;  3CCV T;  4NL3 A;  2FB7 A;  3L2W A;  1N8R C;  5I2M A;  3H6Z A;  5A0D A;  4C5E A;  5KH6 A;  2K3X A;  3JRZ A;  4M77 B;  2E65 A;  3OS0 A;  4XTZ A;  4A4E A;  2OTJ A;  2QTX A;  3X26 B;  3M58 A;  2JUF A;  4M77 C;  3INZ A;  3L2V A;  1U1T A;  4BAC A;  4KUD K;  2F5T X;  4F7U B;  4QW2 A;  4E7H A;  1YIJ A;  3QXE B;  3MP1 A;  3OBW A;  3RKW A;  3RMQ A;  5I2S A;  5GAN d;  1LOJ A;  1N9S A;  4FM4 B;  1VQO T;  2DPP B;  2JTF A;  3BFM A;  2MMP A;  3HFN A;  2LQ8 A;  2MF2 A;  4TVR A;  3V8L A;  5A2Q E;  3DB4 A;  3QII A;  4M78 G;  3SFM A;  5HY6 A;  3F70 A;  3V7S A;  3CCJ T;  3CC4 A;  2E6N A;  4C0D B;  1QVG S;  4A54 A;  5KE2 A;  1KD1 U;  2R5M A;  2XG8 D;  4BY6 B;  5LJ5 h;  1YJ9 A;  5D6Y A;  4C0D C;  3JSC A;  3KUF A;  4XK8 E;  5FRM A;  2LC4 A;  1VQ4 A;  2EJG A;  2OAU A;  2RK2 A;  4OB1 B;  4BY6 C;  3OBY A;  3OYI A;  2X4J A;  5LJ5 g;  5AYF A;  3JB9 D;  2OTL T;  4M7D A;  1HK9 A;  5CIU A;  4RG2 A;  1UGR B;  1S72 T;  1KQ1 A;  3FLG A;  2M9U A;  4J6W A;  3PNW C;  4EMH A;  5LJ5 d;  1UEB A;  2RHY A;  1BIA A;  2PUK B;  3A8H B;  4M75 B;  4Z02 A;  3ASK A;  3JAM E;  3CC7 T;  2K5F A;  3LYI A;  4M75 C;  1KG1 A;  4Q5W A;  4BDZ A;  5GAO r;  1VQO A;  3CPW S;  4DA4 A;  4C5I A;  4M7D B;  4M7A A;  2DJZ A;  1M8V A;  3QYG B;  5GAN f;  4M77 G;  3PIO A;  1M90 C;  3HRT A;  2MWO A;  3A5Z B;  4LDV A;  2DIQ A;  4LD6 A;  3OYC A;  2QEX T;  1YI2 A;  4ZGD B;  3JCM Q;  1KQ2 A;  3MEU A;  2G3R A;  3VV0 A;  4M7D C;  2P0K A;  1BIB A;  2HD0 A;  2K4Y A;  3QJY A;  3SWN A;  4J7I A;  3OS5 A;  2ZPB B;  4F7U G;  3PIP A;  5LJ3 h;  3E9F A;  4WF2 A;  5GAM h;  4M7A B;  2EWN A;  2KMT A;  3WVE B;  4ELY C;  5GMK m;  5LJ3 g;  4HT9 A;  3JCM f;  5GAN 3;  1OZ2 A;  4FSX A;  2LDM A;  2P0Q A;  3EFR A;  5J3B A;  5GAM g;  5GAN 5;  4M7A C;  4PJO F;  2HBP A;  3SWN B;  2OTL A;  4OP0 A;  3FC3 A;  4V2S A;  2LT4 A;  4FU6 A;  1Y7X A;  2DXT A;  3GPL A;  1JB0 E;  3J7A F;  3QSU A;  3UPU A;  3SWN C;  2M1H A;  2MI6 A;  3LH0 A;  1ZQ1 A;  4PNO A;  5GAM d;  1QVG A;  5GAN 6;  1VQL T;  3CXC A;  5CKH A;  3CC7 A;  3RKY A;  3M4G A;  2DZ9 A;  1B34 A;  5CQY A;  2EQK A;  2FYK A;  4C92 D;  1WJS A;  4UC4 A;  4ZGJ B;  2XDD A;  4XQ3 A;  1G3Y A;  2QEX A;  3LWI A;  3ZBD A;  4XU1 A;  4B9X A;  1JJ2 S;  5J26 A;  5J39 A;  3P8B B;  1MHN A;  2XU8 A;  3QUI A;  4E7J A;  3HKS A;  3S3O A;  4KUL A;  5CKD A;  3MP8 A;  3DLM A;  2CZ0 B;  2K5L A;  4M75 G;  1B34 B;  5FU6 B;  5GAO q;  4ELZ C;  2DK3 A;  3OYN A;  2ZPG B;  4HT8 A;  3ME9 A;  4FT4 A;  3QYH B;  2RJF A;  1Y71 A;  3M59 A;  3OSV A;  5LJ5 j;  3KXT A;  4M7D G;  2V8J A;  2RHX A;  4BI4 A;  4M77 F;  2QXF A;  2DTO A;  4BI3 A;  4LD9 K;  1Y96 A;  1VQL A;  1PSE A;  4ME7 A;  1G3T A;  4RCC A;  4XU3 A;  3V7C A;  4BI8 B;  3M54 A;  3I56 T;  4M7A G;  2E70 A;  2JN0 A;  5CO7 A;  1KHI A;  1VQK T;  4BB7 A;  2RK1 A;  1M1F A;  2A7Y A;  4JJN K;  2B8A A;  1W2B S;  2CS7 A;  3M56 A;  2KQW A;  3UT1 A;  4CI0 C;  4MMK A;  1M1K U;  1I5L A;  3ER0 A;  5FU7 C;  3MEA A;  1Y96 B;  3C12 A;  1VQ5 T;  5HK0 A;  2EKO A;  1H64 1;  1D3B A;  2JNG A;  2PU9 B;  3CCE T;  2EAY A;  2BKD N;  5LJ3 e;  2CGH A;  3FIF A;  1NE8 A;  1Q81 U;  4KBM B;  3DLL A;  2WSE E;  4C8Q E;  5GMK l;  5GAM j;  2GQV A;  1RI0 A;  2E64 A;  2LQK A;  1YIT T;  2X4W A;  1KC8 C;  2R57 A;  1JJ2 A;  5GAN h;  2LCC A;  3G71 T;  2RH2 A;  2HAX A;  3RUX A;  3CBO A;  5A0G A;  1M5Q 1;  2D9T A;  4C8Q D;  3L2U A;  3CCU T;  1K73 C;  3NTH A;  5GAN g;  3HFO A;  2P4T A;  2XI9 A;  2HQX A;  5FLX E;  3I56 A;  1M9S A;  3KBG A;  4JLG A;  1VQK A;  3HL8 A;  4M75 F;  3OA6 A;  3TU4 K;  3VUZ A;  4FL6 A;  1R8O B;  4XU0 A;  3SDZ A;  2JZ2 A;  4HCC A;  2K2V A;  4JUV A;  4C92 A;  3LX7 A;  2K57 A;  3HHT B;  2EFI A;  1VQ5 A;  1N6A A;  1WGS A;  3OMC A;  3CCE A;  2LCL A;  4JRQ A;  5FRN A;  1MGQ A;  2V8I A;  1VIE A;  3OYF A;  1G5V A;  2DKG A;  3Q1J A;  5GAN 4;  4IKF A;  1QVF A;  3MP6 A;  3L2R A;  3HPW A;  5A0L A;  3OB9 A;  3M57 A;  4FT2 A;  3JCM d;  3OYL A;  1X6O A;  1W2B A;  1H3Z A;  3JB9 G;  1O75 A;  1OI1 A;  3GNF B;  4MZP A;  4PJO E;  2LVM A;  1YIT A;  2L3R A;  1YBY A;  2H3J A;  4IUT A;  4O6J A;  3G71 A;  1KQS A;  1X75 C;  1NZ9 A;  3OS2 A;  3JCM W;  1Q7Y U;  3LWH A;  2WSF E;  3M4Y A;  2X4X A;  3V7R A;  3CCU A;  4L5G A;  4PJO D;  3PT9 A;  4BE0 A;  1XTD A;  2WSC E;  2Y4Y A;  3LLR A;  2XDP A;  2VUB A;  2VYT A;  2DVE A;  1OYX A;  2QDY B;  4X9D A;  3VYH B;  1UGS B;  5GMK i;  3JB9 J;  4GY5 A;  5HKC A;  4QQD A;  1BI1 A;  2VXF A;  4OB2 B;  3JCM P;  4JRK A;  4L59 A;  3VYG A;  3PMI A;  4P5N A;  3X28 B;  2DAQ A;  4R56 A;  3OW2 S;  1WNL A;  2DD5 A;  2EJF A;  3O8V A;  5KCH A;  1Q86 U;  3A8M B;  2QQR A;  2M0O A;  3TRE A;  3QPH A;  1X01 A;  1KC8 U;  1ZBX A;  4BDY A;  3GIB A;  3RKX A;  2CKK A;  4BE1 A;  1M1K C;  2DIG A;  2Y90 A;  2VV5 A;  4XTY A;  4C0G A;  4OGC A;  5DLQ E;  3X20 B;  3QZ5 B;  1K73 U;  2RO0 A;  2QQA A;  2ZCF B;  2DXU A;  2GFU A;  1M4Z A;  3EFS A;  1I8F A;  5GAN e;  1Q81 C;  2KK4 A;  2MWP A;  4C0F A;  2E6Z A;  3M9Q A;  3BY7 A;  4A4H A;  2YRV A;  5CKB A;  1BI2 A;  2VXE A;  4M78 F;  4C92 E;  5GAN j;  2KDS A;  4IUU A;  2ZPE B;  4NS5 A;  5DY9 A;  4C8Q A;  2LRQ A;  2YLB A;  3TEE A;  4JDS A;  2VGM A;  4JS5 A;  4XTW A;  2EQM A;  4X34 A;  1BYM A;  3NTI A;  3I55 T;  2QI2 A;  2VC8 A;  4HKE A;  1YHQ T;  2D0Q B;  2RB6 A;  2ZPI B;  3QDR B;  4GLK A;  2F5K A;  4EMG A;  3J80 E;  1ZHI A;  4C5H A;  3RES A;  3OYD A;  3CCM T;  2PQW A;  3QO3 A;  4C8Q B;  1WPY A;  2MAM A;  4C0Z A;  4VUB A;  1VQ8 T;  1PSF A;  4CRI A;  4MML A;  4C8Q C;  3HRS A;  3VKI A;  2EQU A;  2F69 A;  2CZ7 B;  2RA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...