3LGNA

Crystal structure of isdi in complex with heme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme-degrading monooxygenase isdI
publication title The IsdG-family of haem oxygenases degrades haem to a novel chromophore
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 29
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lgnA00
1FVSA 1SB6A 4DPOA 2GO8A 3F44A 2OD6A 1X8DA 3FRYA 1AFJA 5B0AA 3HHLA 1X7VA 2W4DA 5B09A 1Q4RA 2ACYA 2OKQA 2GFFA 5KAKA 1N5SA 2K7JA 2ZDPA 1SI9A 3HFKA 4OJ1A 2QLWA 4DN9A 2IYIA 3HF5A 1OSDA 2ROPA 1YJVA 1MWYA 2L3MA 2OFHX 3I9ZA 2BYCA 2XMVA 3LGMA 3T9NA 3TOQA 2N4DA 1Y3JA 2VH7A 3UDCA 1AW0A 4DL0C 1CPZA 1VQYA 1V3ZA 5B08A 4OJGA 2XMMA 3E8OA 2K7KA 2IFXA 3BN7A 1JK9B 2G9OA 2QLXA 2RSQA 1SQEA 3FGVA 4OJ3A 1R6YA 1Y0HA 2FHMA 2LDIA 2XMKA 1QUPA 4EFAC 1AFIA 1S6UA 5F0WA 2XMTA 3BGUA 5B0DA 3BDEA 1Q53A 2FTRA 2GGPB 4Q2LA 4OJHA 4A48A 3BR8A 3HX9A 2RILA 2KT2A 3CJKB 1GXUA 2N7YA 5B0GA 5F0UA 1RJJA 2N4CA 1IUJA 2VV5A 1OPZA 1WD6A 5K9FA 1FD8A 1Y9OA 3TNVA 3HHLD 2K1RB 2LQBA 1X0PA 4ZOSA 3VTIA 1K0VA 2OP5A 1YJTA 2HIQA 1YJRA 2ZDOA 3K7RA 1Q8BA 2BUNA 1KVIA 2IYGA 2HFNA 3MZIA 1MWZA 2GGPA 3KG0A 3GZ7A 2RMLA 2QYCA 3CJKA 4YEAA 5T7LB 1GXTA 1Y3KA 2ASYA 1FVQA 2GCFA 2ROEA 3BM7A 2PD1A 1N5VA 1FEEA 4Y2IA 2KYZA 2K1RA 2KKHA 2W4CA 1U7LA 4HI2A 1TUVA 2QIFA 2W4PA 3QMQA 1CC7A 1TR0A 1N5TA 2EW9A 4HL9A 5B0CA 2BJDA 1OQ6A 4A4JA 1JWWA 5B0BA 1YRXA 4HH1A 4QOTA 3IWLA 5T7LA 2HLTA 4YDXA 3TRGA 1URRA 4Y2KA 1TL5A 4Q2MA 1CC8A 2HLUA 2JDJA 2KT3A 3HHLC 2Q3PA 3MCSA 2GV1A 2LXFA 4Y2MA 2OFGX 3WDOA 2HQIA 1N5QA 3DCAA 3BB5A 1OQ3A 2AW0A 5B0EA 3DXSX 2AP6A 1P8GA 2K2PA 1TL4A 2CRLA 1XBWA 2LQ9A 4ZA1A 1FE0A 2ROGA 1VQSA 2FB0A 4NL5A 3BF4A 5A6WA 2BJEA 2BBEA 3HDSA 1KVJA 4F67A 2OMOA 3FMBA 4NPOA 2FIUA 1KQKA 4A46A 4HI1A 4FNIA 4A47A 1P6TA 2XMUA 1S6OA 3KG1A 3KKFA 4OIXA 5B0FA 3LO3A 1ULRA 2HFOA 3HHLB 2GA7A 2PGCA 2AJ0A 2OAUA 2XMJA 5A6PA 2XMWA 4U9RA 4HH0A 5IXUA 1FESA 1W2IA 1LQ9A 2OD4A 2RU9A 3KNGA 1APSA 3IWXA 1Q8LA 1TZ0A 1YJUA 3LGNA 1YG0A 1FE4A 3QGPA 4FNHA 2AJ1A
chains in the Genus database with same CATH superfamily
4DFKA 3SCJE 3HHNB 3IGNA 4UOFA 2ADCA 3GP9A 3QIDA 2MY7A 2KG0A 2RQMA 1YJ7A 4OX6A 2AEJA 1FA0A 2KM8C 1H73A 5CYMB 5ETOA 1B7YB 1NPPA 4OZ5A 4M94A 4K4WA 1HQUA 1IKWA 5KG1A 1VC6A 4USUA 4DV3J 4NA1A 3CJKB 1CLFA 2N7YA 1YK9A 1S1XA 1YITS 3TNVA 1S4EA 2EK1A 4NEZA 4NZ6A 2KDOA 3NBPA 3DHWC 1SIZA 3KWMA 3T6BA 2FHJD 3DLHA 3AQOA 5ETLA 1TUVA 2EKNA 1HNXF 3RBXA 1QE1A 1PJ5A 2K3IA 2DO0A 5C2CA 1SKUB 2O5DA 2BXJA 2V8HA 4B9UA 5D4LA 3MR3A 1N0VC 1S1TA 4YHHJ 3MOJB 3PACA 1SJ4P 5LT5A 2B7CB 2HAFA 3M4XA 4EMDA 5C42A 1R43A 2EWHA 3M32B 4A8SA 4JI6J 4ZHRA 2YX1A 4J9VA 1HNZJ 2F4FA 4B3RJ 2E9ZA 1RAEB 1LWCB 2DGXA 4F0HA 3C6TA 3MFHA 3V6KA 4R8UB 2HQFA 3O2IA 3MR5A 1VK3A 2B4VA 1T9VA 1J5OA 1NKBA 1RTHB 3H20A 2Q66A 4WFXA 4PR6A 3GCXP 4C6AA 3M30B 5IT9Y 1RWXB 2DGOA 2N4CA 1KQGB 1BWEA 4TYBA 4H4MB 5F9NA 1J5EF 1H3DA 5HVFA 2UVWA 3T41A 2JLGA 1VRTA 2K1RA 3D6HB 2QIFA 1R8CA 1GMUA 2DH8A 4C8NA 1SJRA 2ZOMA 2ZE2A 4PG5A 3ZTSA 1ZZFA 4ZP6A 3GR1A 1TL5A 1NSQA 5LSRA 2NLWA 4M5DA 1VQPS 4UOGA 3VGTA 3WX8A 1XQIA 1U1RA 4AYBD 4USMA 1G2EA 5E2QA 3JYTB 4F4WA 2MHNA 4BLGA 4Y2CA 2Z4PA 1YG0A 1PBUA 3TJ8A 2ZKTA 4F2RA 4I69A 4MK7A 7FD1A 2XO6A 2M5YA 1H74A 3RB0A 5ETQA 5KG3A 3IBCB 2DK2A 1K9MT 1C0UB 1FDBA 2R2UA 4DS4A 5E0OA 2VG7B 3DRRB 3BSNA 2ZHOA 1WACA 1S6UA 3KLIA 4FF3A 2YWGA 4YY3J 3J81Y 4RKUC 2HS4A 4CIOA 5KFYA 1RTIB 2GQ2A 3C2PA 3BGLA 1FX2A 2R7TA 4P73A 4LSNA 1FRKA 2PI5A 1PJ6A 2HVHA 4N47A 4J9UE 2H9ZA 1KFSA 2NS1B 2C3UA 1IBMJ 3NLCA 1KLMB 5HANA 3PY8A 5CAAA 1HWJA 1URRA 3M1VA 5FD1A 4PQAA 1PAEX 1VFJA 4KHPF 3DOLB 3BSAA 1HQEB 1F5AA 2KFZA 2RKIB 4CRJA 1N6QA 4JI3F 3I56S 5KFXA 4OHWA 3D9BA 2RF2B 4KV8A 2RU9A 1TAUA 1XEZA 2AGQA 3C6UA 2OGUA 3N0VA 4USTA 1JIHA 2W9CA 2QL9B 1M5VC 3K5MA 2VODA 3VAMA 4C0HA 3R1LA 4JI2F 5HMXA 4ECYA 5KG0A 2XQCA 3DM2A 3QSYB 2RRBA 1LEOA 1FKOB 1FRMA 2ERRA 3VAKA 2QN6B 2RQKA 4QPTA 2MKSA 1WEYA 1SKRA 3VV2B 5GMEA 4J9LA 2J0WA 4NI2A 4V19J 3CDWA 5AE1A 1JWWA 2D1CA 4DHVA 4WZQA 3ADAC 2D74B 3RRKA 1U2FA 3BB5A 1G6BA 2QA1A 2HQDA 2O3DA 2VFVA 1FJEB 5BYRA 4R5PA 2ZH2A 2PMHA 2OLWA 1S59A 4NZ0A 1F5BA 5DLFA 3TJ9A 2I5JA 4DPOA 1BD6A 4C7QA 1QAYA 6AT1B 3MM5B 3CCSS 3PO4A 2IM2A 3HULA 1BHNA 4XAKA 4A8WA 5J2PA 4KB7A 3I4HX 3HD2A 1AFIA 2GAGC 3M2UB 4FYWB 1CJVA 2DH7A 3L7OA 3TQ1A 1H2UX 2ZH8A 2PN6A 1HD0A 2ABYA 1PJ7A 1MU2A 2FVRA 1TKZA 3SSSA 4LF6J 3MM9B 1RHRB 1SJ3P 2Q43A 2ZNZA 5BR8F 2HURA 4OV6A 4ZVSB 1G1XA 2B9XA 1NKEA 2YX4A 2CQPA 2OFGX 3GSDA 3GV7B 2EG1A 1YI2S 5IT9U 1RI7A 2MYFA 2FVPA 2QO3A 4NL5A 1TKTA 2CQ0A 2Q6BA 2Y8YA 5B7WA 5HROA 4Y00A 3B54A 2DNQA 4KO0B 4L72B 4B17A 2FJVA 2N4DA 1RT1B 4FS1A 3OVBA 3D6MB 4U7UD 2BJ7A 3MM6B 5ETTA 2AGPA 5CCMA 2MGZB 4QCLA 4P52A 4X4RA 2K3KA 2FJEB 4OLPA 5ETKA 3H2UB 3W1YC 2YBVA 1T9UA 2C28A 4OZNA 1FF2A 2FHMA 2V2KA 2GIFA 3HXMA 4CP5A 1R3NA 5K8PA 5DM6Q 1YJTA 2QMXA 4B9MA 4NLQA 2ZH9A 4I2PB 2DNKA 1RAAB 2CPYA 3K5LA 1N5VA 5F8NA 2K8GA 1XIQA 2V8PA 4DX8H 5A8RA 1RT5B 3N28A 3QWUA 4YDXA 3DGPB 1WOOA 1NRKA 4HYKA 3OJUA 1SJQA 4UF4A 2C2OB 3J81U 3VQSA 4ES3A 1F5CA 1JLQB 1N5YA 2FY8A 2EG2A 1WF1A 2VICA 2P2CB 3SI8A 3DLEA 3J7YI 2YNGA 2W4DA 5H1SV 4ZPDA 4ANEA 4ED4A 2DHAA 2CVEA 2UXBF 1HYSA 1VGYA 2NXUA 3DLGA 3AH6A 3HSZA 5F41A 3CMAS 1NDKA 2XSJB 4RPFA 4D3HA 2CPZA 4M95A 4Y2AA 2M88A 1GMWA 1WELA 1VJQA 3PRBA 3H7HB 3OD2A 4ZVUB 3HT3A 4QBUA 1H7XA 3THPA 3KLFB 3ZZ0A 1S6QB 1WC4A 1UPMB 3C66A 4ANDA 1RWVB 2V2ZA 4CO0A 2ZD1A 2PD1A 1IJEB 4LF9F 1Q5VA 1N36F 1JLFA 3HKZD 1HBMA 2MKKA 3KXDA 4KHPJ 2GJ2A 4OI4A 4EBDA 4NX9A 3D4JA 1UEVA 4JI3J 5F8JA 1ZTTA 5HJXA 2FLLA 3C14B 2LLZA 3K5NA 2XNQA 4HH0A 3MR2A 3LTOA 1WI8A 1XJWB 4DSEA 2IBOA 3D1OA 1LW2A 2RAQA 3FK4A 2ZUGA 1LWFA 3PIPQ 1HHTP 1BXNA 2ZH7A 1SIWB 5E7OB 2ATCB 4JI2J 2F8MA 2PMWA 1BGXT 2E5IA 2HHPA 1CPZA 1ZTWA 4DUYF 3WC0A 4M5JA 3PM9A 4ZDNA 1UVIA 2VFUA 2ZITA 4U7CA 4OI6A 5CYMA 5C7PA 3SSRA 3HFVA 2RT3A 1RJJA 2W2QP 2DCLA 1HNVB 5KFUA 2DNYA 2DHXA 4C8KA 3EMTA 3CJKA 1NDLA 2E1MC 2VPWB 2PT0A 3K5OA 4DR3J 3TYTA 4QR1A 2YNFA 2CNLB 3PYDA 2W25A 1RU2A 3P8BB 2LXFA 4DQQA 3N6NA 4USVA 4ANCA 5CHCB 1JLAB 1VBKA 1U45A 4G6VB 2DRDA 4NRTA 2DNOA 5D0HA 1B3TA 2BOAA 4ZJOA 3IBFB 4W92B 3ULHA 2C22A 2GVDB 2YH1A 1CJKB 1YDLA 4DL2A 4DLEA 3T6JA 4ES2A 2HVIA 4RBUA 3NWRA 1CQNA 4JV1A 3CXCR 3O44A 3M32A 4GVBB 2JZ5A 4DN9A 3GFXA 4BHQA 2BYCA 2HQCA 3V4IB 3HVTB 2KT5A 3RB3A 1LWCA 5HAOA 4R8UA 3G82B 5F0WA 1X5SA 2YY3A 5KFBA 2ZWOA 4KBIA 3FRZA 1L3KA 1RTHA 3IM9A 4NA2A 1FD8A 2LA6A 3R7BB 5T14A 1NZAA 4FKYA 3M30A 3J7YU 1Y3KA 2BMBA 4Y2IA 2VB6A 2J0QD 4H4MA 3MCNA 2V0NA 2NXJA 3A3OB 4WFAQ 4OX7A 2NYHA 4JI7J 3PKYA 5KFFA 4WKRA 3BREA 1KBRA 4OYBA 2QA4S 2HQ3A 4JV5F 3FBFA 3H25A 1RDRA 9RUBA 2AYGA 3V6DB 5CZXA 2JJ4D 3HSDA 5AXNA 4NMXA 4M8LA 2U1AA 1VBZA 2KFNA 2XWYA 3NOGA 3QFHA 3JYTA 3W2VB 2GAHC 5LJ5Y 1K44A 3OTCA 2J9DE 3GWCA 3V81B 2RUGA 5I3UB 3VAFA 3AA8A 5KFZA 1JNRB 4DV4F 2VFTA 4OJ3A 4PKDB 5M2PA 1YBUA 2EFPA 3AA9A 3H8YA 4A8QA 1HNIB 4P2MA 1C0UA 5HK4A 4DSJA 1U26A 3G8QA 2VG7A 3DRRA 1NNDA 1RABB 3G86A 1NU4A 2BUNA 2GVZB 4O3OA 3HSGA 3CVKA 3NGRA 5DGAA 1HQ2A 1KOHA 1QVFR 3CW2C 4M5MA 2RU3A 3CEDA 3DYAB 3KJQB 3L4BC 1RTIA 4KC5A 4ZLLA 1X4EA 3KNAA 2IMOA 4GO7X 1AXQA 1VYAA 3M9NB 4QW9A 4AQYF 3I0SB 1VI7A 1DRZA 1L3VA 1KLMA 3AD8C 1X5PA 4QYRA 3SCKE 2R42A 1X9SA 3N6LA 1DTQB 1GQEA 3ZZTA 2N3OA 4P75A 3DOLA 1HQEA 3EGNA 2RKIA 4ETXA 4EO8A 3D1QA 3F44A 1AUSL 1U0HB 2RF2A 2UXBJ 3OFFA 3HHDA 3A13A 3CNQP 4QR2A 4YN3B 4DL6A 2WOMB 1RTDB 2KH9A 3M6XA 1G4CA 4Q0BB 4QWDA 4LT6A 2VA3A 3TP2A 3H4BA 4MIAA 1PC4A 2ZH1A 2R7SA 1MWZA 4LF9J 1FKOA 2L48A 4C8LA 4IO9Q 1UEUA 2DNPA 3T5KA 1ZOTA 8RUCA 2Q1LA 4NXNF 4IUFA 3JSYA 1VQ7S 1N5TA 4K8RA 4KR0B 1S9GB 4I67A 5BYSA 2CJKA 2FYXA 1ZAXA 4K5SA 3S1TA 1RUSA 3MI7X 2WZ1A 2BE9B 3W65A 4CCHA 5DZ6A 4C8MA 1F0XA 3E2EA 4PG4A 4N8NA 4CLZA 2WVCA 2Y8WA 3RU0A 1CEZA 2NZCA 2UXCJ 2HVEA 5HL7Q 3UDLA 1KP6A 2YQ0A 1M5SA 2IC3B 1U02A 3MMCB 3PW2A 1R0AB 3EPIA 1IR1A 3PFOA 1OSDA 2L3MA 2F4VF 1J2VA 4Y65A 4ECRA 2G9OA 1DTTB 3MM5A 1VQKS 2LQJA 2E29A 2ILYA 2DGWA 2I6WA 1D9DA 4EU0A 5CYJA 2RNEA 2ASJA 2HIYA 1TFYA 1HW9A 3M2UA 2D41A 2YWWA 5CD4H 5IT0A 2F3JA 3T1AA 1TU0B 1NSAA 3K5PA 1QDUB 3WHIA 1BQNB 5C25B 1RTJB 1MN9A 4J37A 2YNIB 1RZMA 3D28A 4FKXA 2HLTA 2DR7A 4HKQA 1XMQF 5KFDA 3MM9A 1KOOA 3K8VA 1RWNB 1SC6A 4IH6A 5AT1B 1MMLA 2D3UA 4ZVEA 3LO3A 5EWEA 4O0IA 4FXWA 5HQMA 3BGRB 1FESA 2AYBA 2VZ9A 3LWLA 5M2RA 2E66A 4KO0A 5D15A 4URQU 4P72A 1RT1A 5IC4B 4ED1A 3DRYA 4ILLA 2DB1A 3QBCA 4UTGA 3MM6A 1TK0A 3CC4S 4EZ9A 2GC8A 3VAGA 3TEGA 1V6HA 1R89A 2XMKA 2MGZA 1IN0A 1RT4B 1DAXA 1YBTA 4YR3A 2KXNB 3KDNA 1TELA 2RE1A 1TL3B 2XYPB 2L08A 4JI5F 1PSDA 2KHCA 1S7HA 4TU7A 1RWPB 3TZXA 3FJ2A 3FCVA 5BYQA 1HFEL 3PYFA 1GNKA 3CD6S 1H7WA 2LU1A 4ECQA 2VQEF 2KM8B 1PYOB 4I2PA 2FLNA 3U7JA 4CYUB 3CT9A 1SXLA 2GHPA 3W7BA 3JSBA 1F9FA 2XWXA 2EI5A 4WE1B 1RE1B 2LEPA 3D54A 2CQDA 2CXEA 5HBMB 1VQSA 2DXDA 1RT5A 2DNRA 5A8WB 3DGPA 2QX0A 1IKYB 2VFRA 4RNNA 5IXUA 1M0SA 1KDNA 3R6LB 4IFVB 1WKLA 3BPSP 4ZLJA 2GO8A 2CQBA 1JLQA 2XM3A 2HBRB 4OZLA 1U6FA 4PRFA 3NS7B 4ED5A 4FPRA 4DV4J 2VOOA 3C19A 2DEIA 3RRHA 2F5GA 2ZFHA 3F0NA 2CG8A 1NMEB 2RDDA 1VQ4S 4USJC 1Q8IA 3SBMA 5LMNJ 4JYAF 3UQSA 1Q5YA 4F26A 1EQMA 4IRDA 5D4NA 2XSJA 4I6AA 4URSA 4YS2A 3M2RB 4RW4B 1S57A 4ZVHA 3CJ5A 4UQGA 4NLDA 1JKHB 2Y1RI 3AB4B 4CZCA 1RACB 2JFDA 3KLFA 1S6QA 1SV5B 3FCWA 3KK3B 4N7TA 3OL8A 1WC3A 4LF1A 1JMTA 1OY6A 2AF6A 3M8YA 1HBUB 3QGGA 3MAQA 1R8HA 3ILJA 2UUCF 2HK2A 1LWEB 2ASDA 2KL8A 4J9OA 1R8PA 4G1QB 1L5UA 2JEGA 3TZZA 4NYPA 3Q22A 3DDKA 2Q6CA 3QGPA 2EBGA 3D5MA 3C14A 5B09A 2GFFA 1PYTA 2IA0A 1RT3B 2VDIA 2LYVA 3G6YA 3Q23A 2V8VA 2HS0A 1LNQA 2V67A 1WOPA 4WFYA 1PCAA 1F3FA 4UOCA 4NWBA 5ETMA 1QUPA 2NR0A 4WIQA 3KTQA 1RB0A 1Q53A 1T8EA 1NJIT 3K59A 2H5JB 3Q8VA 1WD6A 4B3MF 1EAYC 2R8JA 5LJ3Y 2CPDA 1FDNA 1HMVB 3KUHA 4NXNJ 1MROB 4AUKA 2Z57B 4X4QA 3VZIA 1HNVA 1TV6B 3TI0A 5IM0B 1VBXA 1EIYB 1GEHA 3GG0A 4PYDA 3D0HE 1UVNA 4USHA 2R7XA 2BOPA 3I5BA 2B3TB 4L3NA 3U02A 4N77A 4ED3A 3K58A 2BZ2A 1N33F 3Q8PB 1JLAA 3LANA 2ZH5A 3CMQA 2GVDA 5IS2A 1CJKA 5GAHU 2OO4A 4GC6A 2R8IA 2KVIA 1VIOA 3PKMA 1YJNS 4GVBA 1JK9B 4RUHA 4E0DA 3KHGA 2FHKA 1R6YA 5L9XA 3TZYA 3M2VB 3V4IA 3HVTA 1O6XA 4F4KA 4OHXA 3G82A 1L3UA 3OJSA 1QY7A 1T7PA 2XULA 4LRCA 1FEHA 1GXTA 1T9TA 1FEEA 1I5OB 4ZLPA 2KU7A 1YLXA 4MFBB 1XMQJ 1FDAA 1NDPA 2XHWA 4F0KA 1WKJA 3DDNA 3TRGA 3NGSA 3MPYA 1U25A 2KT3A 4WU2A 4L76A 4TVAB 3DDIA 1T3NA 5KFNA 2H51B 3PX4A 1LKZA 1OS5A 2ROGA 4C0OC 3L9ZA 2CJYB 1PAUB 4A8FA 2XLIA 3A8KA 1XWLA 3LGNA 2DPJA 1E6YB 5BXIA 1OY8A 3V6DA 2ACYA 1WTBA 1HNWF 4DL7A 1FTRA 1WWHA 1VQYA 3GIKA 3VWSA 3LOUA 3W2VA 3MCOA 4R0JA 2WSFC 3V81A 4HLBA 4ZCMA 5I3UA 2LEAA 4LREA 4JI5J 1FX4A 2IA6A 1KHWA 2VOPA 5HVGA 1R6VA 1R7IA 2VQEJ 3QRRA 1D1UA 1HNIA 4FVMA 2KYZA 3GONA 2W24A 2IRYA 4J9MA 2GVZA 2O67A 4K4VA 3DLKB 2YVSA 4QIWD 4KRWA 4ED0A 2E5LF 2JDJA 3TA2A 3DYAA 2JEIA 4J5OA 3RBDA 1GAOA 3M8PB 3LH2S 3LP1B 1FERA 4URGA 7AT1B 2MQ8A 3UW1A 1VRQC 2EVZA 2GIQA 2YKQA 3I0SA 1TTHB 1IXKA 4PEOA 1BLUA 4FF1A 1SJ1A 1T03B 2JEJA 4B9LA 1FE4A 4RUCA 1U4BA 4ED2A 4TQSA 4OMFG 1GH8A 2F65A 2UXDJ 4F2SA 1DTQA 3AD7C 3HFKA 1PO6A 1HD1A 2V8GA 4MT1A 4IH5A 4DV2F 1U0HA 2VQFF 4NLYA 3GYXB 1IM6A 1ZAWA 2AHOB 3LPEA 1V9OA 2P9GA 2KT2A 5KFEA 2FD2A 4OL8A 3FSIA 2WOMA 1RTDA 3MHYA 1RA6A 1ZPVA 1NJWA 4Q0BA 1U6ZA 4C4WA 4JP8A 1RLDA 1DLOB 1S49A 3GFYA 5KFSA 3PR5B 2XS2A 2CPHA 2CPEA 1TAQA 1FKPB 3KJFB 5L39A 1RHKB 1TP7A 4FYYB 1ZZNA 2EW9A 3KMSA 2BJDA 3E3XA 5M2UA 3EZOA 1KVKA 3W63A 2HHTA 4ZPWR 1S9GA 4DFPA 1P1TA 1S6OA 4B9TA 4CO2A 4OZ3A 3C16B 2W9BB 3K0JA 4IG0B 2X3DA 3SQGB 1RQ0A 3NMRA 1XR5A 2MZ1A 4OX9J 3NCRA 3A8JA 2QG9B 4HHHA 4AFFA 2H4YB 2IC3A 4DR4F 3MMCA 3DRXA 3IBWA 3MM7B 1R0AA 2DISA 4DQIA 3UI3A 4B3MJ 4OZJA 4ZPBA 3MPUB 2CJQA 3EGWB 2ZBCA 3OBIA 2HNDB 4WP8A 2UUBJ 3PYEA 2KTQA 3AXMA 1DTTA 2VIHA 3MZIA 2DHSA 3I82A 3OXGA 4DBQA 3KHRA 3OT9A 4ITSA 1NPRA 3IFEA 3W64A 1MMDA 3GPAA 1HARA 4I2QB 3U1LA 1BQNA 5C25A 1RTJA 3MCSA 2MQNA 2YNIA 4GRSA 2IPOB 5GVQA 4F0MA 5DG7A 2AU0A 4WTOB 2IVFB 5KFIA 3B6BA 1RGVA 5EDWA 2MQQA 3EVMA 2FJBB 1WOSA 4C8ZA 4C0BA 3VAHA 3HZEA 3HVRA 3DI6B 2MPUA 4ECXA 3BGRA 2DJWA 3KJVB 1CJTB 2OFHX 3S01A 4W98A 2OTLS 2ALZA 2JH3A 1SL0A 5ADZA 1RWOB 1B4SA 1U09A 1UJ6A 2VD3A 3A3PB 3RR8A 1EHWA 4PQUB 1OMSA 1T95A 2SXLA 1U47A 4KH1B 1RT4A 4XDCA 8ATCB 4H4KA 2IIHA 1M5OC 3PHEA 1TL3A 1SQGA 4NCAA 4K2JA 1DHMA 4WCEQ 3J7AN 2X1FA 1XR7A 4QW8A 1WORA 2KZMA 1JXEA 1R0CB 1QUVA 3OTOF 1FXDA 2M8HA 3CCZA 2LQ9A 4CYUA 2KRBA 2QFJA 3NEKA 1WG1A 3FMBA 4WE1A 2BQRA 1Z2ZA 2OPRB 5KFKA 1H98A 5HBMA 1XMOJ 1JLEB 5A8WA 1KEKA 3UPFA 4DFMA 4QYZK 1IKYA 2B8PA 3AOCA 1VBYA 1FKAF 3R8YA 4IFVA 2QV6A 3NMAA 5DDPC 3RTVA 2C3YA 1V3ZA 5LL6d 1WNEA 2XI2A 4ZP8A 4KHRA 3SIPB 4TY8B 3HX9A 2GHVC 5GADU 2VV5A 4DV0F 2L41A 3D6FB 4X65J 3PRDA 2BABA 1AZSB 1QTMA 4F4AA 4DUTA 2GX8A 5KFAA 3L7PA 2F63A 4FDFA 1KHVA 4R25A 3ZFVA 2E5LJ 1KONA 1I1GA 3TX0A 4LF5F 3M2RA 4RW4A 2ZM6J 4RW7B 3UD3P 1UMJA 1CC8A 1JKHA 4O3NA 3O5TB 3BF4A 5EUHA 1SV5A 1CULB 2J8AA 3KK3A 2HFOA 1DY3A 1Q7LB 2XMWA 1S0NA 4OI3A 1NB2A 3VAIA 5J2QB 3AD9C 1HBUA 4PPZA 1LWEA 1T9XA 2WBMA 1XC9A 4G1QA 4YP3A 1QSLA 4ZVFA 3TEHB 5G0RB 2VQFJ 1YJVA 3LGMA 4M1KA 5HP1B 4ELUA 2HRUA 4RNHA 4I4BA 2OPPB 3OFHA 3ITHB 3PV8A 3ZTOA 4X2BA 1RT3A 4ECUA 5I3QA 4LF7J 2B0GA 4I68A 2RILA 1AROP 1OPZA 3JQMA 2L9DA 5DLGA 2J6SA 4KTQA 3TA1A 2FJDB 3G96A 1Y7PA 3D0IE 4BC7A 3Q8SB 2BJ8A 4AXJA 2BKPA 3IM8A 1VQMS 2W4CA 3R27A 1X31C 4EK2A 2DITA 2ZEJA 1HMVA 1VQ8S 1MROA 3C3LA 1G7CB 4QIVA 2Y9HA 3BO3A 2BX6A 4TLRA 1TV6A 2O1PA 5IM0A 2IDEA 3W8PA 4X4VA 3FFIB 3MMAB 4FNIA 4DV1F 1EX8A 3IRXB 3W60A 3RAMA 1UJ5A 4YOEA 1S77D 4JV2A 3ZTPA 2XS5A 3R3TA 3MGJA 1X4DA 2BM1A 3O8WA 3I9ZA 2CPXA 2BV3A 1Y5IB 4OZ1A 3MEEB 2J0XA 3G8TA 1X4BA 3HMJG 4CNZA 1S12A 3P3DA 2OEKA 1NUEA 3PYGA 4DR5J 2FDNA 1YZ6A 2MZRA 1UFLA 4I64A 3K7RA 1B7FA 1QLNA 3M2VA 2V69A 2YXLA 5HMYA 4RBVA 1FRHA 4Z7CA 3EE3A 3O1LA 4OFZA 2RHSB 2YH0A 1TVRB 2UZAA 4N41A 3VHQA 5F8IA 5IQQA 4DR7F 5JUMA 4LF2A 2R3VA 1VHFA 1U1MA 5EGYA 4ECWA 3CB4A 1NEEA 4IOAQ 4MFBA 3KOAA 1U8WA 1NPKA 3P6YC 4OLOA 3NGTA 4A46A 4HI1A 4HHUA 1NK6A 3R5DA 3DRPB 1NK4A 2I1RA 4ELVA 1CQMA 4AXIA 4FXDA 1HWKA 1F2HA 2XTJP 3BKFA 2IJNA 1S48A 2E5HA 2HWTA 3CJ2A 3QNWB 2OKQA 3SZ2A 3T5LA 1YGYA 5SUHA 5K8MA 4O4GB 3HF5A 4ZCIA 1E6YA 2MY8A 1FJ7A 4CLUA 1DARA 3M6VA 2IFXA 1QM9A 3HT0A 3R5BA 4P10A 1C0TB 2YWKA 2CZ4A 1XNQF 4CH1A 1KNZA 3AQPA 5D4PA 3GIMA 2KN4A 4YR2A 1ZYQA 3W5YA 1EQ0A 3Q8UA 3EYZA 3R7NB 2LECA 3VVTA 3EVWA 2Y0SD 3PX6A 2JLEA 3OTOJ 2KG1A 3D6TB 1D3WA 2P6SA 3DLKA 2CQCA 3L95X 1UTAA 1NZ8A 3M8PA 3LP1A 3CD7A 3RW6A 3CGIA 2AKWB 4ZK7M 3FBCA 1ZM2A 2NSCA 4Q43A 4ID5B 1U1PA 2CAJA 1S1WB 4DSLA 4NMLA 1YBAA 2B4OA 2FZGB 4FYDA 1T03A 5DM7Q 4KH0B 5A0YB 3HK2A 2CPJA 4F3OA 2LFVA 3W62A 1Y0HA 2R7UA 2OSRA 3VGUA 2YWEA 4FYVB 1B0VA 2DT9A 1HI1A 4C3MA 3CCRS 2CIMA 4DWIA 2DNNA 3RBEA 2OP5A 2DO4A 2FQQB 2H5EA 4DV7F 3J80U 3UDEA 4YEAA 4LQ9A 3KLEB 3UWTA 2ZVSA 1JLGB 3OXLA 1UWAA 1P27B 3PDNA 3KK2B 4N8OA 5C2GA 5DZ7A 3HCXA 1DLOA 1IR2A 3CD5A 1U8SA 3GILA 1FKPA 4K2XA 2HFSA 5T41A 1C4AA 3N79A 4IR1A 4J9RA 2ZC4A 1LV5A 2QT7A 4K50A 2OHDA 4IG3B 5KFJA 2DR5A 1IQZA 3AOAA 3QZ7A 3QJPA 1RP5A 5IC6B 1Q79A 2UVUA 5L1LA 1RWWB 4ILMA 3C16A 2R7RA 1RAHB 2W9BA 5KFLA 4IKAA 4O3RA 4QJVA 4IG0A 2CNOB 3GR0A 3SQGA 5IV4A 4UY85 3JS9A 1JJHA 2IHR1 4KHMA 2B6AB 4IO1A 4N76A 4YB5A 4NLOA 4CQ1A 3BGUA 1QAJA 5KG4A 1FO1A 3MM7A 4ZPCA 5E3RA 4P7TA 1UFWA 1SH0A 3IAM9 4JI0F 1D8ZA 3T1YF 2HNDA 3N01A 1P9QC 2HRTA 3WX4A 3BQ1A 1OWXA 4U8YA 2B43A 4RZRA 4B3OB 4BC9A 2ZH3A 2VBZA 2G1HA 5KFOA 4WU3A 2IVYA 2R7WA 3HJFA 3MURP 2AIRB 4B08A 2HNYB 2AW0A 2C2KB 1TMMA 4DV1J 2AJ4A 4I2QA 1QAIA 1RKJA 2CJ9A 2A2DA 2OAUA 1UAWA 2Z30B 4IH7A 4KQZA 1RHUB 1IJFB 1SB6A 4L73A 5KG5A 1IBKF 3SYZA 3ISNC 3GIJA 3EZ5A 4A8OA 3CCTA 4EUVA 2AEFA 3UCGA 4D3GA 3PFEA 2ZZMA 3RG6A 2DNMA 3D7SB 3DI6A 2R7QA 1DFDA 3E8OA 3UN5A 4TU9A 3G87A 3KJVA 1IBLF 5E5NA 1CJTA 3NGUA 3DLJA 2QGFB 2LP4A 5HI7A 2Z2MA 3TQEA 2ZH6A 4NLUA 3RGIA 4LF8F 2F8HA 4YFUA 4OYAA 1U1OA 3QSIA 4X66F 4PQUA 4LSLB 4ED8A 3PVXA 4MH8A 4DR7J 4A4JA 1K1QA 4KIAA 1BUXA 3TJAA 2IM3A 3EICA 3EZUA 4PG6A 3CCUS 3OLAA 4PYAA 3E01B 3CSKA 1BQMB 5ETNA 1VC5A 3K89A 4HEA9 5DRKA 4IOBA 3N6MA 4LRFA 1N5SA 2OPRA 1SI9A 2HGLA 3CDAA 1JLEA 1S99A 8AT1B 2RDIA 2ZZNA 4LVOP 1H2VZ 3TO8A 3DHXA 4UY8T 2YNFB 1XNQJ 3TUIC 4DZ6A 2H1YA 3S8SA 4KPCA 1CSJA 2ZBRA 1RYSA 2HVZA 3PZPA 3CJ8A 1RBLA 4EBEA 1DQ8A 2L9NA 1K0VA 3G6XA 1OY9A 2DKOB 3ZZZA 4MKYA 3D3BJ 4TY8A 3ZZUA 2MJNA 1AZSA 1KSPA 3QO9B 4P74A 5C5JA 2XYGB 5K14B 3OLBA 1FWPA 1GMWD 3NGDA 4K0KF 5I42B 2E1PA 5KT5A 4QU6A 1EP4B 3V2UC 4RW7A 2HYIB 4GKJJ 1GT8A 3RR7A 2MEWA 3I87A 2GJIA 3DRSB 1XERA 4Q8EA 2LU2A 3SSQA 1CULA 3MWBA 2HBZB 2J7WA 1N32F 2ZBPA 2J8SA 4F8RA 4I0WA 5J2QA 1Q78A 2NREA 1R0BG 2VH7A 4Q7AA 1HWUA 1U2CA 2MHEA 2R8KA 1FJGJ 5G0RA 1VCTA 5HP1A 4Q2LA 2OPPA 1KR4A 3NNAA 3ITHA 1Y9OA 3QLHB 2ZDOA 3M8RA 1Q16B 4CLYA 2BA9A 4NLXA 2UUAF 2EK6A 4O3PA 3WQPA 2RJZA 3R6GB 2B7BB 3W5XA 3R2DJ 1C2PA 2HPUA 3F56A 3U1NA 5IQ6A 3WDOA 4GMKA 1R8AA 4AT1B 4P2FA 5JXSA 1N52B 2PIIA 3NCPA 2N82B 4EZ6A 3EVOA 4ZITA 5EX3A 1UKUA 4DLGA 3FFIA 3MMAA 4ETZA 3OTEA 4DL4A 3P49B 1QVGR 5KFCA 1X4AA 3IRXA 1T94A 1ZM3A 3TUZC 3JXOA 1Q8KA 1U1KA 3MAHA 4V1Ak 1MLAA 4DR6F 4K4SA 4Z2XA 3B78A 1REVB 1IVZA 4U67Q 3MD3A 1UW4A 2KHDA 4MTPA 4ZP7A 5H9EJ 3T9ZA 2GGPB 4HTJA 3MEEA 1N88A 5H9FK 2X3GA 7FDRA 3BYRA 3T1YJ 4HT5A 3DLLQ 1YJRA 4RO0A 2RRAA 2AV5A 4OHVA 4LR7A 2H5IB 5KFPA 2J9EA 1NH8A 3ZZPA 3BQ2A 4XTTA 1FFWB 1RWUA 2E1AA 5KFVA 1I51B 2C2RA 4PCQA 2KJVA 1OYDA 3ISND 2VL1A 2R7VA 3CO0P 3DCAA 2J6TA 3NGKA 1TVRA 3HM9A 2WHOA 2V2QA 4A8XA 3BSOA 5E3QA 3GQCA 4Y0FA 2JL9A 3KLHB 4K4UA 4I7FB 3DRPA 3VZHA 4FPIA 2ZUAA 3MR6A 2VA2A 1Y5NB 2XMVA 2ZJPQ 1IBLJ 2FZCB 3OVSA 2CUYA 2I8EA 4O4GA 1NAQA 1TK8A 1LFWA 3BR8A 4RUBA 1ZBTA 3GTYX 4LF8J 2VUGA 3GG1A 4C98A 1C0TA 3W2WB 5HATA 2ZJRQ 2COLA 2JX2A 2JC1A 4PABA 1UFKA 2XEXA 1B70B 3PRVA 3TAPA 5FLXU 2BDPA 5CH7B 3ZNJ1 4Q2MA 3NY0A 2HMIB 2LEBA 1U24A 3EJMA 1OJ4A 2PC6A 3IAS9 2CQIA 2M52A 1NCLA 5C24B 3C46A 3HHLB 2GA7A 4YB1P 4CT9A 2YX7A 4JB8B 1N34F 4TN2A 1NM2A 1RA7A 9ATCB 5LMUF 2E9TA 5AXLA 1Q95G 1FWLA 2C2NA 4ID5A 5G4DA 4HDGA 1KWMA 2F8EX 1S1WA 4OYZA 5D78A 1IWGA 2ZBIA 1HNXJ 2DXEA 5A0YA 4RBTA 2YNHA 3CTRA 4ZVOB 1EZZB 4DCJB 3VGSA 3NP5A 2DBBA 5F8GA 2MZSA 3MUTP 2MKIA 2YQ1A 3QZ8A 2FGCA 1JLBB 4CLPA 2V8DA 5KT7A 3JSMB 4K0KJ 3CF5Q 3BSCA 3KLEA 1PC5A 2Q3PA 1JLGA 1H72C 3KK2A 5KTQA 3DN9A 3TW0A 4ZLNA 4FXVA 3HP6A 4ED6A 4KY3A 3GYNA 2XY7A 4WXOA 2HZAA 4U9RA 1GTHA 1K1SA 2Z2ZA 4KJIA 5GAGI 2H54B 2XC9A 2PFDA 2HBQB 1X7VA 1YJWS 4IG3A 3IR7B 3RB4A 2ZDPA 4NCGB 4JOUA 1J5EJ 2WCXA 1F9EB 1GXLA 1LFPA 5L1IA 2CADA 2H3EB 3TARA 1WTFA 4NLTA 2PEHA 2XMMA 5EX0A 4E8UA 3CCJS 3T1HF 1I3OB 3I31A 2V68A 5F3TA 2HHHF 2VF3A 5L1JA 2B6AA 4G65A 4GO5X 3T5HA 4E98A 2NUHA 3DXBA 1UETA 3QGHA 2V6AA 2VU5A 3ZNUA 2LDYA 2DHHA 3ILLA 2OELA 4X4TA 6FD1A 4I6WA 2CJAA 2DHGA 3BS9A 3LAMA 2KB2A 1FNMA 3OXFA 4LFCF 2XG8A 2VG5B 4MIBA 4B3OA 2DXFA 2QZ8A 2BQ3A 1K73T 2H65B 1XNRF 3QAUA 1D9AA 3D1HA 3P5TL 2UUTA 2HNYA 2XO7A 4AE5A 4CO1A 2DR6A 3DOMB 3ISZA 4DR6J 2X1BA 4M5IA 2BJ3A 1Q7YT 3C15B 5A2QY 1QAXA 3I0RB 1RCXB 3IRWP 2YKAA 3FBEA 1FRJA 5ETVA 2OI2A 2ZZTA 5J1NA 3BGFA 2IMWP 3ZZYA 2HIQA 1UJ4A 3VQTA 3FDSA 4IYQA 3EXYA 4F50A 4DZDA 2MSSA 2MLYA 2FPHX 3GLJA 2AJFE 3BBBA 2WW8A 4LSLA 2DGVA 4RW9B 2V63A 1CJUB 3VVUA 3CPWR 2J0SD 2HGNA 1GFWB 3BV8A 4KE5A 3PW7A 4S0MA 3BQ0A 2BR0A 5GMDA 1VQLS 3R5GA 4PG8A 1UEKA 3LPYA 3E01A 1FFGB 1BQMA 3TX8A 3A1YG 1AFJA 1C1CB 3MF5A 3KK1B 3BO4A 3J7A1 4OJ1A 5GMKa 1WDTA 2NYIA 4YHHF 1N48A 2DNGA 2EKYA 4TYAA 3TA0A 4F25A 3I6PA 1RAFB 4M5NA 2JVRA 1RK8A 2DRAA 4AL7A 3H90A 4ZPTR 4MK9A 5DDOC 2R7OA 3VF0B 1R8BA 1T0TV 4DX5A 3FEZA 2HEKA 5D0RA 3KG0A 2RMLA 5GAGU 1LK5A 5HMZA 5MAOA 3CIMA 3AHPA 3RYLA 2JFKA 3BJYA 2CWKA 2B8QA 1O0PA 4DJBA 4F4ZA 3GU0A 4QQBA 3RBZA 1VOMA 3QO9A 4IFYB 4YMEA 2HG4A 3BEGB 4K7QA 3GJQB 1KFDA 5K14A 5B0FA 1S10A 5KFTA 1N34J 1RAIB 5I42A 1RCOB 3W61A 5LMUJ 2A1BA 1A0OB 1EP4A 5KFMA 2CJBA 3DRSA 4O44B 4OI2A 5EWFA 5IOLA 2HHVA 3Q8RB 3K57A 4NEYA 2DY1A 5BR8J 1RADB 3ZZRA 2M3DA 1NJYA 2GIRA 4DPTA 2RQCA 3QYYA 1MW7A 4ZVTB 3PJXA 4MJKA 5I3PA 3RB6A 2W8KA 3HVWA 1F1BB 1Z1ZA 5T7LB 2A3JA 1ACMB 1UP1A 4ZCKA 4ECTA 3M7VA 3QLHA 2BE7D 1EETB 3IO1A 1FRXA 1FJCA 1Q86T 4EI2A 2JLFA 5MLCV 3V4MA 1NK0A 4WWSA 1P8GA 2X1GA 2CA9A 1N54B 3VCDA 1RXOB 1HR0F 3T19A 3AB2B 4UQTA 5CQGA 3QPIA 1YJUA 1HKAA 1IBMF 4UW2A 3CC2S 1S0MA 2CPIA 1YTYA 1RHJB 1JJCB 3TOQA 2OPSB 2MQOA 2K7KA 1NK5A 4L74A 3FGVA 1MG7A 2B5JA 2E7WA 2XI3A 2FTRA 1B0PA 5D77A 1REVA 1F6TA 3DNCA 4RNMA 3J81j 4MYTA 2GW8A 2KI2A 3G2XA 2GGPA 1CVJA 4TQRA 4IR9A 5AXKA 3CCES 1WHVA 2FC8A 3A12A 2D9PA 5A2QU 4LFCJ 4DSIA 5HJYA 3PIOQ 1XNRJ 4YQWA 4IDKB 2VPYB 1WHWA 4TLQA 1FDDA 3A8IA 1CS4B 2J9DA 2Z56B 1KQKA 4DSFA 3I5AA 1UVJA 4HDHA 1WG5A 4NLWA 3IR6B 4P7VA 2NZ4A 2NPIA 3KUEA 4FS2A 1SUQB 3KLHA 4ZVRB 4I7FA 1HBNB 4H4KC 2QE5A 3SEOA 4Q44A 1N36J 2MQPA 3RRGA 1TKXB 4M5KA 2K06A 1FXRA 2XZTB 2RD5C 2AGOA 3NKYA 4B02A 5FIIA 3ZXWA 4LQ3A 5DETA 2KXHA 4M5GA 2LVWA 3TVZA 3UNGC 4N5SA 2VC1A 4JI1F 2G1DA 3O3LA 5E3PA 3KDOA 5B0CA 2VBYA 3W2WA 1AA1B 3OL9A 4ZN3A 2HQIA 2AT1B 2K2PA 4BDPA 3CC7S 3CJQA 5H9EK 4DUYJ 4ZJLA 2H48B 2HMIA 2W2NP 4LF6F 1NKCA 5J2NB 3PW5A 3R2CJ 2GO9A 5CCLA 2EC0A 3Q86A 5C24A 4ED7A 1PGZA 2FY1A 3HHLA 1Z4UA 2F9JA 3OL7A 2V94A 2I0XA 4DS5A 4CO3A 2YWHA 4QR0A 3CJRA 3HI9A 3LP0B 2XGPA 5F9LA 3J7Z5 3MUMP 2QSFA 3LA0A 1Q81T 1MWQA 2HK3A 2FLOA 2MKHA 1PILA 2GMHA 2OPQB 2HZCA 3Q0AA 3KG4A 2AZ3A 3BM7A 2WK4A 3UR0A 2KKHA 4CWBA 3SV4A 1S1UB 4M63A 1A9NB 2BJ9A 1NBEB 1WC1A 1JLBA 2VJUA 2AEMA 2WTFA 4RX6A 2WVFA 1H6KX 3MMJA 3JSMA 1FE0A 2VG6B 4O0NA 3H4DA 3HDSA 4ICLB 3HD1A 4K4XA 1X60A 3BBFA 3CE8A 4WYLA 3Q83A 3FRYA 2BANB 1TL1B 2UU9F 4LSZB 2VDHA 2RVJA 1RLCL 2AD9A 4DEZA 1IKVB 4F4YA 3SMZA 2CDQA 2CNKB 4NCGA 3MOZA 3OQ2A 4C48A 3BDEA 2ZBQA 2HFUA 3MAAB 2EFNA 4H54A 1IUJA 3MFIA 2OSQA 3SQOP 3OSPA 4C3KA 4IOCQ 1XK8A 2GMJA 2P9EA 4FP9A 4JV5J 2W2PP 1FVQA 3FC9A 3WC2A 2G13A 5CXTA 4N56A 3DKDA 2LA4A 3LP2B 4HH1A 3BR9A 4WTYA 5ETSA 1UVLA 3SCIE 4KGKA 2QC3A 3PW4A 4QPXA 1HR0J 3CMES 1ITPA 4HACB 4EYHB 2WVBA 2P9CA 1UA1A 2P8IA 4C3LA 1H0HB 1T02A 2C2MB 4QIGA 2XHCA 3JTNA 1IKXB 3UFCX 2VG5A 5GAEI 1W2IA 2VHGA 4CH0S 1WSRA 2I38A 2ZH4A 4HR2A 3CCWA 2EBEA 4DMZA 2DY9A 4X4PA 2DRBA 4R0EA 4RUAA 3UCUP 1PBAA 4L6V3 2XGQA 2E1CA 4K4ZA 3CDUA 3CWJA 3X1LB 1BWVA 3DOMA 2ATLA 2B4PA 3M8WA 1KN6A 5AJ3F 1T11A 2PFFB 4JI4F 2RH3A 3PO5A 2B9WA 3M05A 3C15A 4AQYJ 4KGZB 1Y4ZB 1RWKB 3I0RA 5KT3A 4RNFA 2EC2A 3J7ZT 2HHUA 3U27A 4WP3A 1E6VB 3GIRA 3AODA 4NLSA 3G71S 4FBUA 4Q5VA 1TL7B 4QZVB 1JNZB 4WP9A 2DVIA 1I94F 4WK1A 4RNOA 4X64F 1VQNS 2Y1LB 4Z37A 2KO1A 2YKOA 3M8QB 2BRLA 1XTZA 1FI4A 4ILRA 3QAEA 2ACMA 2BBEA 5E33A 1SL2A 2CZ9A 4OV1A 3CCLS 1OO0B 4RW9A 3G9CA 4X4OA 1CJUA 3MEGB 3ETOA 4DPUA 1I6JA 3KNGA 1OPIA 3ILOA 2AX0A 4DR3F 4ZIVA 5E3CA 2IDLA 1ZAVA 2DNZA 3MPDA 1MWYA 3THTA 2CQ4A 3UDVA 1C1CA 2D3OR 4L3KA 1X4CA 3KK1A 2UVVA 2IJFA 4AL5A 2MZJA 1ROFA 3KMQA 2RS8A 4LIRA 5HO4A 3N9UC 2YKPA 4KGVB 5B0GA 2FVCA 1NHUA 3BPDA 1TMJA 1UVMA 4JI1J 5LSLA 5DS7A 1ZETA 3SXLA 3ETMA 2Y1JA 1VHIA 1ICEB 1NHVA 3EPGA 4HL9A 3ENQA 2WAQD 1KLNA 2HW3A 3QGIA 5B0BA 4YB7A 4MKBA 1FHTA 1LOUA 1URNA 3H0PA 3DXSX 5A6WA 2F4VJ 2DGTA 3GV5B 1K47A 4RWWA 5IWAF 2PGCA 2R9LA 4JI7F 4IFYA 4GKKF 3D66A 5SZTA 1RKIA 3GB0A 1APSA 3ENAA 2DGQA 4DOZA 2QL5B 2A2CA 4NLVA 4O44A 2V9WA 2Z2LA 4BCAA 2FZKB 3GE9A 3MPVA 1NB7A 2FUG9 5DO2A 3EX7B 3FSYA 2QL7B 2E7XA 1YWXA 2AYEA 4C97A 5GAEU 2IYGA 4FZVA 2GS8A 4UZBA 1WKKA 3QJLA 3Q2SC 1FFSB 1UPPA 1KS2A 5RUBA 3OHBA 5T7LA 1UWBB 1ZA2B 4WKYA 2Z8QA 5HN0A 3LQVA 3BH7B 1EETA 1S0VA 2A10A 4FF4A 1S5ZA 4C8OA 3PR4A 3TZWA 5J1PA 1ULRA 3BBCA 1NLKL 2AJ0A 2E44A 2IRUA 3FUYA 2UU9J 1JXVA 4RWXA 1HWLA 4MYUA 5HQLA 4KSEB 3PXGa 3M9OB 1HHSA 3H5UA 4OI0A 3UVJB 4Z7YA 2FHJA 4MKAA 2B9EA 4AD6A 3ENWA 1XR6A 1IM4A 4KGXB 2KVQE 3QRQA 2LDIA 2UV8A 2KJWA 1HWIA 1LXNA 3NL0A 2VASA 2OPSA 2F1FA 1GXUA 3KFWX 2AJ2A 4Q45A 4MMOA 3NS5A 4CDIA 1WHXA 1VRUB 1HA1A 1VR6A 3QWPA 4LFAF 3RAQA 1TKDA 3G6ES 4FF2A 3H59A 1NDCA 3NRBA 3CIZA 5E41A 3CCMS 2JWNA 1JJ2R 1F2GA 4IRKA 1NO8A 1WC5A 2MZQA 2L9WA 2BQUA 2ASLA 2WBRA 3M6WA 4LMZA 2R8GA 1T05B 4P6QA 4IDKA 2RRNA 1SC4B 3F73A 2UV8G 1CS4A 1U1LA 4JYAJ 3T5JA 1SKSA 2MSTA 4DQSA 4KYZA 2FVSA 1HW8A 2DD8S 4DV6F 4X4NA 4ZVQB 1IQTA 4IQMA 5AJ3J 1RSCA 2OMLA 3NG8A 4WFBQ 4JI4J 1SUQA 5LM7E 2PSZA 2XY6A 1U1QA 3R97A 2MLZA 1HBNA 1SJFA 1GTEA 1LK7A 2CQ1A 5D0GA 3AFGA 4DL5A 2UXCF 1RWMB 3ZZOA 4WFNQ 2QTWA 2LMIA 1TKXA 5LXRA 2F40A 1WEZA 1PKUA 2FVQA 2GNKA 2UUCJ 4MKVA 1AT1B 4K5RA 1I94J 2HHXA 3AXKA 3DU6A 3MECB 1HIYA 4X64J 2M70A 4CTAB 4DPXA 2P5VA 2IAJB 4Y2KA 4OX8A 4BBYA 2FC9A 2G0CA 1EKRA 2LCWA 3CJ4A 2NSBA 1TK5A 4XO0A 4ZMMA 4W4MA 4J9QA 3ONQA 4J90A 4CLSA 4CI0B 1O8BA 3LGHA 5K20B 2HKEA 3UO0A 4E2FB 2APOA 2UP1A 5HSPA 4BWJA 4OHZA 3R5CA 1NSPA 5J2NA 1AB8A 5L46A 3OHAA 4OZ2A 1VC0A 4F7VA 1B99A 2AYMA 3I96A 1EARA 3HVAA 2X7IA 5A76A 2XMTA 4O3SA 2GQCA 2M0GB 2KFYA 4NZ7A 2XCPA 4PAAA 1CG2A 2HRYA 4ZOSA 1BY9A 3LP0A 4UOHA 2ASYA 3EM1A 3EWGA 3M9MB 1N33J 2OPQA 4DCOB 2X51A 1KD1T 1WEXA 4F04B 4OHYA 3RW7A 2DTJA 3TANA 5LSOA 2GV1A 4DUZF 3DU5A 4C11B 1S1UA 2M8DB 3NAIA 4USIA 4NXMF 5IWAJ 4OI1A 3CDEA 3OR1B 4ECZA 3IC1A 4IQXA 4GKKJ 2ZC3A 1RT7B 2ZOGA 3PCOB 2V4RA 2A6MA 2VG6A 4ICLA 1M1GA 3HZGA 4TKTA 2MZTA 5ETPA 1KQFB 3WBZA 5A8KB 4DDFA 2POKA 1Y3JA 1ZM4A 3BYPA 1X4FA 2BANA 1N0UA 3QQCD 4PWUA 1TL1A 2A0FB 4W90B 2ZVIA 1RYRA 4KFBB 3QT5A 4DL3A 2UVRA 4OJHA 2MB0B 1IWAA 1YQHA 3ELHA 1IKVA 3EDRB 4U8VA 4LRBA 3P5BP 2VBWA 1DZ5A 3MCMA 3MAAA 2V4QA 1JX4A 3H5XA 1LW0B 4M5LA 3OFEA 2C3PA 3KHLA 3E51A 3OTBA 4HI2A 2HGMA 1UL3A 2QMWA 4WFZA 3OUYB 4Y34A 1CBKA 3I9V9 4U6PA 5LMNF 2V9KA 1U6BA 2XMAA 3SDEB 1HNWJ 4ZVGA 1XBWA 1HPZB 1W26A 2J7KA 2RB7A 3LP2A 4ENOA 1V3SA 1A7GE 3FNNA 4MK8A 4HACA 4PZVA 3DGVA 3ICLA 4DI6A 3FQLA 4IRCA 2HHWA 4DU8A 2DEJA 1D8YA 4NA3A 3H98A 1IKXA 2BVZA 4G3IA 5F3ZA 1HHQA 3W9HA 1M5KC 3IR5B 5F8LA 2IM0A 1VQ6S 2IYIA 1JXLA 4A8KA 5THWA 2X1AA 1W25A 2H4WB 4ZP9A 2W8LA 2W1BA 1V5VA 4NRUA 4CLKA 2D7SA 2NXNA 3UNYA 4J9SA 3X3UA 2XZWA 4XIUA 2CJXB 3M8ZA 4LFAJ 3IA0A 3R5AA 1TFWA 3HFZB 4LF4F 1K0TA 1YIJS 1U7LA 3KLGB 2ZOFA 3VGVA 1TUWA 4DCPB 1E6VA 1YVFA 2J7UA 4UZCA 3CJSA 3KLVA 2J76E 2Y0BB 1TL7A 4ZS6A 4ZN1A 3J80Y 4WXWA 3GFZA 2C2DA 1R31A 4DV2J 3TWZA 3WZ0A 3TVYA 4WK3A 2YWFA 3M8QA 3QT7A 4ELTA 4C8YA 2XBPA 2CQ3A 3JTOA 4DV6J 3PW0A 4LIWA 3JSRA 5CYQB 3MEGA 4B3TF 2AZ1A 2ROPA 1T9WA 3D2WA 3UDCA 1RISA 2DPIA 1NH7A 1KTQA 2QMUB 3V6JA 4HHJA 4XDDA 1SBRA 5D3GB 3QT8A 3PEJA 3MEDB 3HKWA 5DDRC 5K9FA 1EB0A 4GC7A 2V2VA 2ALYB 3Q8YA 1ZM9A 3H2VE 1VISA 3ZTQA 4NLPA 3H2LA 4EGLA 3CUNA 4C9DA 2OJ3A 3FQKA 4WBFA 2ADBA 3IWLA 2XCAA 4EEYA 5FDLB 2FJWA 5U47A 1SPBP 3B82A 4QYZJ 1VQ9S 4DR2F 4X84A 4G1IA 1YKWA 2W2MP 1LXJA 4DR4J 2W7AA 1S97A 3OVAA 2PI4A 3OPKA 2CQ2A 1KTVA 4BWMA 3PX0A 3OW2R 3H42A 3NCQA 3FBBA 2FGOA 1S1VB 5D8HB 5B0AA 1Y5LB 3MDFA 3FVYA 1NK7A 3KHHA 5DGBA 1FD2A 3ZO7A 2A6OA 3GSIA 4LR9A 1OYEA 4OYPA 4Y28C 2HHQA 3MM8B 2LKZA 4DSKA 1FT8A 1QSSA 4B9NA 2CVIA 3UCZP 2B51A 4O4RA 1YX2A 1KRPA 3GZ7A 4AL6A 2GCFA 3NS6A 2W9AA 1AYEA 3ZTRA 4DUZJ 1U48A 3VR1A 2XNRA 4DQPA 2CQHA 3IP0A 2PA8D 4B3SF 4NXMJ 2HWIA 2KZZA 4FN5A 2FJAB 2B9YA 1F60B 2YKNB 5GAHI 1UWBA 3DMJB 4PXBA 3KG1A 2CKWA 5IV3A 4Y3CA 2WB1D 4OYWA 3G6VA 2LXUA 3CULA 4KPYA 3NNHA 4NCBA 2VBXA 2YPZA 5DQIA 3VAJA 4PWDB 1N56A 2ZHAA 5IZHA 3IN5A 3I55S 3CJ3A 2CYYA 4Q8FA 3WIUA 3GV8B 5F8HA 2QLJB 4NASA 4DFJA 4WZMA 3UVJA 1P1LA 5KOXA 4XK8C 1SVDA 1HBOB 4M5HA 5J2MB 2UXDF 4WF9Q 3BGOP 1Q8BA 2G4BA 2AJQA 3BN4A 3L7UA 1SCJB 1HL6A 3PJWA 1YHQS 2PE8A 2PDAA 2HVDA 2HAIA 2D3ZA 2MKCA 2CFXA 3R7SB 1JB0C 1VRUA 1OIAA 5J1EB 2YKMB 1TUGB 1N5QA 3B4DA 1TL4A 3OFGA 4DPWA 1M90T 3GFHA 4RLEA 4RW8B 2NQPA 4HTIA 4F67A 2MQMA 2HQGA 2IRXA 2HNZB 2BM0A 1IBCB 5LXYA 1RAOA 1VLOA 2YNHB 1Q8LA 3ET6B 4PUOB 2DIVA 1D9FA 1SKWA 4DV0J 1KQSR 1T05A 4DF8A 1Q4RA 1UA0A 4DX6A 5IFMA 2FJXA 2J9CA 2Z0GA 3BKUA 3ILIA 2ZJQQ 1ZH5A 4DG1B 2RQ4A 4LF5J 4RJVA 5EN1A 3VALA 1QJHA 4OX9F 1PYSB 4LF4J 1VQOS 4ALZA 1KVIA 1REGX 2DNHA 1R27B 1VMBA 1VQ5S 1WC0A 2AQ4A 2BE2B 2U2FA 4CM0A 4GVLA 3MEKA 1U0SA 1EKSA 5CD4A 2DYAA 5AXMA 5KT6A 3U1MA 2UUBF 1SC3B 5B0EA 3MECA 2Z2YB 3WIVA 3NAHA 4CTAA 2IAJA 2MJUA 1S72S 3FMWA 5BJRA 3W8GA 4A47A 2I9SA 4ZVPB 2MXYA 3BDPA 1H38A 3FZ2A 2JSXA 2RS2A 4B3TJ 2KRRA 5ETRA 1M5HA 2D9OA 1VIXA 4J7CA 3JTPA 3TAQA 4FYXB 5ITHA 2DH9A 3QATA 1X4GA 2E7VA 1JLCB 2MMYA 2V4JB 3CCQS 1SQEA 1HI8A 1YSJA 3G8SA 4KKOB 1VLYA 4QU7A 1YRUA 2ZNYA 2D3O1 2E9RX 1BE4A 2W7PA 3BZQA 3W3SA 4DX7A 1FRIA 1C1BB 4I1TA 5KFRA 1ELOA 3UR3C 4QWBA 3JQKA 4RR5A 1CC7A 2BW2A 3NWGA 2WONB 4JV0A 2M9KA 1B64A 4DR2J 2XB2D 3HHEA 3LALA 4H4OB 2Y3YA 1DURA 3THVA 1JQGA 4EYIB 2FB0A 3US5A 4UT4A 3IG1B 4PPDA 1KC8T 2BRKA 2MKYA 4XPEA 1L3SA 4C11A 1B0TA 1LQ9A 2KYXA 5KG7A 3UN2A 3EGZA 1WJ9A 3OR1A 4ERDA 1S6PB 5KAKA 4EBCA 1RT7A 3H40A 2CPFA 3GIIA 1BC6A 4WIIA 4RW6B 5FJ4A 1G3OA 2MLXA 4ZCLA 3W9IA 2RSQA 5A8KA 4G1PA 4LBIA 4TXSA 3OL6A 2JC0A 1XMOF 3TUPA 4CLTA 5I4MA 2GZOA 5DQHA 4TNOA 2IJRA 4DN0A 3N5BA 4KFBA 4PG7A 1RHQB 2M4MA 3IGVA 4X62F 5CZVA 3G4SS 4B3SJ 1MSWD 1LW0A 2ZKUA 2W01A 4Y2MA 4CM2A 3GJTB 3JAMY 4X65F 3OUYA 1GMVA 3LW5C 1RBOB 3UE2A 2B56A 3CD0A 3SDEA 1Z2LA 4CH7A 1HPZA 5KFHA 2D69A 5FLXY 3LAKA 2MDAA 4Y6IA 2ZM6F 2NXEA 4F3QA 2F9DA 2G2ZA 3B4MA 4QWCA 2Y1IA 3RUBL 2QSWA 5DQGA 3MXHP 4NYOA 4U96A 3SV3A 2WW4A 1NSKL 3KYLA 1NK8A 3ZC4A 5HLFB 3QJJA 1RT6B 3R1HA 3LWMA 1N4LA 1X0PA 2PEBA 3KUGA 5JVHQ 3IWNC 2QYCA 4ATNA 2GHWA 2ROEA 1VJWA 3D68A 5K5MA 1M1KT 2M2BA 3K8WA 4YB6A 4LF7F 5KOWA 4RL1A 4NE9C 5DDQC 3KLGA 1FWKA 3A4TA 5L8RC 2LXIA 2OMOA 3N5FA 2OH2A 2XMJA 4NOHA 5F8MA 1WI6A 3IWXA 4JUZA 3MMBB 2Z58B 2JOQA 4OQJA 1Q82T 2XLJA 5HMWA 3Q2TC 3AJDA 5GADI 4DV7J 2XY5A 1JJ4A 1ZA1B 1DQ9A 4DV5F 3D67A 2CQGA 5CA5A 2J6UA 3HSJA 1U49A 4P2SA 5CYQA 3H5YA 1UZHA 1RT2B 4WJBA 1FXLA 2YQ3A 5F0UA 4XPCA 2YPYA 5D3GA 4U7UK 3N4WA 4OYIA 4TU8A 2Q79A 2FLPA 2BKNA 3MEDA 2VC0A 3POTB 2NCKL 2V50A 4CNYA 1RBAA 1QTNB 4EWTA 3V5RA 4NYZA 2OTJS 4PXEA 3RAXA 1WSVA 2MTLA 4DXLA 3A3NB 3DOKB 5L1KA 1V3RA 4DR5F 2HLUA 3HHLC 1FTCA 2DGUA 3T3FA 1K8AT 3CCVS 2WVDA 2B5JB 2HHSA 5FDLA 1F9HA 2G2OA 5JJBA 3EDQB 4B9SA 4PXCA 2M7SA 4FNHA 2AJ1A 1S76D 4F4XA 4QIFA 2K7JA 2ZHBA 1BQXA 3NXZA 3FCHA 3NOCA 4JI0J 4J9KA 1Y10A 3IS9B 4CLFA 4DF4A 1S1VA 2DIUA 2YTCA 1DJ0A 1SQFA 1PG5B 4QWAA 4ZJQA 1S9EB 1DQAA 1FK9B 3MM8A 1GX6A 2LQBA 4K4YA 5EWGA 5KG6A 1W7WA 2WSCC 2NPFA 1WF0A 3D0GE 3OSNA 3QFWA 1WC6A 3TUJC 4F02A 1WG4A 2N7CA 3P96A 3H5SA 3CJTA 1WHYA 2N3LA 3FKBA 3OR2B 1IBKJ 1GX5A 1UW9A 3TAMB 2F7VA 2G0JA 4EO6A 6FDRA 2AP6A 3QIPB 2GQQA 4K59A 5D6GA 2FIUA 2XZDB 2DNLA 1T9YA 2IBKA 1WDDA 2GJFA 2OD4A 2VPZB 2YKNA 4I56A 3DMJA 1YZ7A 2OD6A 3HPOA 3AJ2A 4LBHA 2DGSA 1FRLA 3MD1A 1HQUB 5EHHA 1IKWB 1OSCA 3A8EA 4HT7A 2W2OP 2ILZA 4P2XA 2RIJA 4X66J 3JAMU 1S1XB 4PWDA 3UD4P 4TY9A 3Q24A 3UD5A 3NBPB 3OTDA 2EXUA 3D3CJ 2C3MA 2R8HA 5K8NA 2HFVA 2JEFA 4UUWA 3PHTA 2C1EB 4X62J 4JI8F 1ZS6A 1QE1B 3W9JA 1HBOA 3R5JB 4DR1F 5DJBA 3HO1A 4JBCA 5J2MA 1SH3A 1UZDA 1S1TB 3FSXA 3P45B 1NXIA 2XLKA 3FZBA 5C42B 5DG8A 3FEYB 4DU7A 2OIHA 1OQ3A 4ZHRB 4CLLA 4NPOA 4LBPA 3I5CA 5CABA 5J1EA 3GYGA 3ENVA 2YKMA 2UUWA 3C6TB 3GJRB 3I4PA 4QIEA 4RW8A 4QWEA 1J5OB 1X5OA 1Y11A 2HNZA 3LUYA 3EGVA 5H9FJ 3IXQA 4O23A 2QLWA 3ET6A 4PUOA 4LR8A 2DCUB 2JNJA 1SL1A 2XSFA 1DBDA 4FBTA 2P6TA 3SFUA 1EJ7L 1M5PC 3CJ0A 2J5AA 5KFGA 3M6UA 4B9VA 1VRTB 2K1RB 2OUGA 3W66A 4DG1A 2BACA 1YRTA 2ZE2B 1U1NA 4M5DB 5KT2A 1OQ6A 2VFSA 2C3OA 4QOTA 1X0FA 2BE2A 1N32J 4OYXA 3CDBA 3O6QA 4MIWA 1KVJA 1HI0P 2NXCA 2QYGA 2E5JA 2QRRA 3UN3A 4X4UA 1MN7A 2VONA 5A6PA 5KT4A 2PMZD 1FVSA 1VK8A 4ECVA 3EUNA 4J9NA 4DV5J 4J9PA 3DC2A 1A6LA 3LF0A 1X9WA 3KLIB 4LRDA 4PXDA 2UUAJ 2V5HG 4LFBF 1S0OA 3F41A 4OJGA 4YDDB 2QEXS 4CT8A 3GCWP 2HWHA 5DG9A 2CWXA 4LSNB 2O01C 1JLCA 2V4JA 3HHLD 2IY5B 1MMNA 2QLBB 4KKOA 1X9MA 4X4SA 3M1VB 3BKTA 2R4FA 3MTKA 1RHMB 2FHOB 1C1BA 5AE2A 1N6QB 3FEXB 3HHKA 1M1HA 1QD1A 4KV8B 4ZA1A 2WONA 3KJNB 3C6UB 1PIEA 2C2EA 5HVHA 4H4OA 3KKFA 2VPXB 4OIXA 4F36A 5KG2A 3BH6B 2W9CB 1TZ0A 3IG1A 2WVEA 3QRPA 2HFZA 2KXFA 2HS3A 2EEYA 3DM2B 4OYOA 2PA3A 4LRAA 3T9NA 4DL0C 4MAKA 4CO4A 3DFEA 1S6PA 2QJ3A 1HLWA 1X4HA 3PEHA 2QLXA 4LUBA 1O5JA 4RW6A 4L75A 5L9NA 4DV3F 2AMCB 4I6YA 3L3CA 4NI2B 2DR9A 3VTIA 2EFQA 2EFOA 3HJVA 4DQRA 2RDJA 2G0IA 3I32A 3AAWB 2JHEA 1S9FA 4WPAA 1TR0A 1H2TZ 2IM1A 5LOQA 3C8YA 4OYMA 3W5ZA 5IT4A 4R5PB 2B4UA 2BEFA 1W2BR 3TR5A 2CDRB 2WB4A 1X5TA 2OEJA 2I5JB 1IR0A 1P6TA 4KAIA 2C2ZB 4ZIWA 2ZWPA 5K8OA 1L3TA 2E1RA 2BJ1A 1FCAA 4JI6F 4ECSA 4V19X 1X8DA 3AT1B 1AUDA 1HNZF 5J2PB 4B3RF 1NJZA 5L38A 3EXCX 4YUDA 1AW0A 1RTZA 1NJXA 4GKJF 4BS2A 5B08A 1ZPWX 1CJVB 2CG4A 2HSEB 4CO5A 5B0DA 4ER8A 4ZPAA 4DPYA 4JI8J 4ID8A 1V5IB 2JRSA 2AWZA 3SFGA 4A8YA 1MU2B 3S7RA 1TKZB 1WUUA 4USWA 5HLFA 3V6HA 3PTWA 4DR1J 1RT6A 1SC1B 3B8HA 3GMGA 1S4FA 4NLRA 3M8SA 1RAGB 2W4PA 3QMQA 4U95A 3Q8QB 1T3OA 1FJGF 1TKTB 1YJ9S 2QLFB 2R2TA 5AE3A 2XS7A 5HROB 3L09A 3K2YA 4K4TA 4PWWA 3RJMB 4LJMA 1FNOA 1XMBA 2BJEA 2MQLA 3BO2A 2CZVC 2BKOA 2XMUA 1N8RT 3HLUA 3IMQJ 4LVNP 4J91A 4UUXA 1Q1KA 1RU1A 2QFIA 3MTJA 2JVOA 2V34A 2OEMA 4F3MA 4CLWA 3MR7A 1NK9A 3MMBA 2VKZG 5JVGQ 5E3AA 2CNNB 2WRMA 4KT0C 3PNIA 4O3QA 3PJ9A 2AX1A 4KGMA 3S6EA 4A48A 1Y00A 1D0EA 3AOBA 2R2RA 2HBYB 3Q89A 1UVKA 4P71A 1RT2A 1TQLA 4YY3F 5A8RB 4HVZA 1F3VA 1O51A 3AJ1A 4FVCA 2A18A 4RU2A 1P9YA 2MKJA 2QA4G 3MUVP 2QA2A 4ZPVR 1YRXA 3POTA 2WSEC 1VDHA 1C4CA 1N5YB 3TVKA 2RUSA 5KFWA 2CRLA 5KFQA 3OV7A 1KKHA 5D4OA 1NHKL 3DOKA 3DLEB 1RAJA 2YNGB 4YR0A 3T1HJ 4NLGA 1VS3A 4ZKAA 2VJVA 2EPIA 1BMQB 2GMLA 2HHHJ 1HYSB 3DLGB 1XN9A 1Q0NA 4WYWA 4LFBJ 2EFGA 3P4UB 3AY0A 1LWXA 4USKA 2NUUG 1J27A 3BN7A 2HZVA 3R9LA 4EFAC 3IS9A 2XYHB 3MPWA 2EFVA 2R2SA 3NNCA 1S79A 2I2YA 4OZ0A 4ES1A 2ZD1B 2LQ5A 2G2YA 1UCNA 3PG9A 1JLFB 2HFNA 1HBMB 4P9SA 2IVMA 1S9EA 1SH2A 1FK9A 1WF2A 1U2RA 3RZAA 2VKRA 3JB9k 4A8MP 1S7IA 2PO4A 2E5GA 2O66A 2C42A 5D0EA 1GK8A 3CO9A 2W7OA 1MNEA 3GJSB 4C2MA 1QSYA 1LW2B 5JMNA 3DLBA 3OR2A 3TAMA 2RHQB 1LWFB 5HQ8A 3QIPA 3SCLE 1D09B 3K17A 3JQJA 2LQ8A 2DR8A 3QT6A 4RU9A 1FNXH 2BW7A
chains in the Genus database with same CATH topology
4LIWA 4DFKA 3JSRA 2XC9A 3SCJE 3HHNB 3V6DA 3IGNA 1X7VA 2ACYA 4IG3A 2ADCA 1YJWS 1WTBA 3IR7B 1HNWF 5CYQB 4DL7A 3RB4A 3QIDA 3MEGA 4B3TF 2ZDPA 2MY7A 4NCGB 2KG0A 2RQMA 4JOUA 4OX6A 1FTRA 2ROPA 2WCXA 3D2WA 1GXLA 1FA0A 1LFPA 2KM8C 1WWHA 3UDCA 5L1IA 5CYMB 1RISA 2DPIA 1NH7A 1KTQA 1VQYA 3GIKA 3VWSA 3LOUA 3TARA 1WTFA 4NLTA 4OZ5A 3W2VA 2XMMA 2PEHA 3V6JA 4K4WA 4HHJA 4M94A 5EX0A 4XDDA 1HQUA 1SBRA 1IKWA 5D3GB 5KG1A 4E8UA 1VC6A 4R0JA 3CCJS 3T1HF 2WSFC 3PEJA 3V81A 4HLBA 4ZCMA 3I31A 3MEDB 5I3UA 4NA1A 2LEAA 3HKWA 3CJKB 1CLFA 5DDRC 2N7YA 5F3TA 2HHHF 1S1XA 1YITS 2IA6A 1KHWA 5K9FA 3TNVA 2EK1A 4GC7A 2VOPA 5L1JA 2B6AA 1ZM9A 4GO5X 4NZ6A 2KDOA 4E98A 3T5HA 2NUHA 3H2VE 3DXBA 3NBPA 1R7IA 1UETA 3DHWC 3QGHA 1D1UA 4NLPA 1HNIA 3H2LA 4FVMA 1SIZA 3KWMA 2LDYA 3T6BA 2FHJD 4EGLA 3DLHA 3AQOA 2KYZA 4X4TA 3CUNA 4C9DA 1TUVA 6FD1A 2OJ3A 2W24A 2IRYA 3FQKA 4I6WA 4J9MA 1HNXF 2CJAA 1QE1A 2O67A 4K4VA 2DHGA 2ADBA 2K3IA 3BS9A 3DLKB 3IWLA 2YVSA 2DO0A 4QIWD 3LAMA 4KRWA 2XCAA 2KB2A 4ED0A 4EEYA 2JDJA 5FDLB 1FNMA 2O5DA 2E5LF 3OXFA 3TA2A 2FJWA 5U47A 4LFCF 2BXJA 2V8HA 2XG8A 3B82A 2VG5B 3DYAA 4B9UA 1VQ9S 4QYZJ 4J5OA 2JEIA 4MIBA 5D4LA 3RBDA 4DR2F 4B3OA 1GAOA 3M8PB 4X84A 2QZ8A 3MR3A 1N0VC 1S1TA 3LH2S 2BQ3A 4G1IA 1K73T 3MOJB 3LP1B 1FERA 1LXJA 3PACA 1SJ4P 5LT5A 1XNRF 2B7CB 4URGA 3QAUA 2W7AA 1D9AA 3M4XA 1S97A 3OVAA 3D1HA 3UW1A 5C42A 2PI4A 3OPKA 2CQ2A 1KTVA 2EVZA 2GIQA 2YKQA 3I0SA 3P5TL 2UUTA 1R43A 2EWHA 2HNYA 1IXKA 3M32B 4BWMA 4A8SA 3PX0A 3OW2R 1BLUA 2XO7A 4FF1A 1SJ1A 4ZHRA 4AE5A 1T03B 2JEJA 2YX1A 4B9LA 4CO1A 3NCQA 1FE4A 4RUCA 1U4BA 4ED2A 2FGOA 1S1VB 4TQSA 2E9ZA 5D8HB 5B0AA 1Y5LB 4OMFG 3ISZA 1GH8A 1LWCB 2DGXA 4F2SA 2X1BA 1DTQA 3C6TA 3FVYA 3MDFA 3MFHA 3KHHA 3HFKA 3V6KA 1NK7A 4R8UB 1PO6A 5DGBA 1HD1A 1FD2A 1Q7YT 3O2IA 3MR5A 1VK3A 2B4VA 5A2QY 2V8GA 4IH5A 1J5OA 4DV2F 1QAXA 1NKBA 4Y28C 2HHQA 3I0RB 1RTHB 2VQFF 4NLYA 3GYXB 3IRWP 2YKAA 3MM8B 3H20A 1ZAWA 2Q66A 2LKZA 1BC6A 4DSKA 4WFXA 1FRJA 1V9OA 4PR6A 1FT8A 2P9GA 1QSSA 4B9NA 3M30B 5IT9Y 2KT2A 5KFEA 2FD2A 4OL8A 2DGOA 2N4CA 3FSIA 1KQGB 5J1NA 1BWEA 3BGFA 2WOMA 2IMWP 1RTDA 2CVIA 4TYBA 3MHYA 1RA6A 4H4MB 3ZZYA 1ZPVA 2HIQA 3UCZP 1UJ4A 1U6ZA 5F9NA 2B51A 1NJWA 4Q0BA 4C4WA 4O4RA 1DLOB 1S49A 3GFYA 1J5EF 3VQTA 5KFSA 1H3DA 3PR5B 1KRPA 3GZ7A 2XS2A 2CPHA 4AL6A 2UVWA 3FDSA 2CPEA 2GCFA 3NS6A 4IYQA 2W9AA 1TAQA 3EXYA 1FKPB 2JLGA 1VRTA 2K1RA 5L39A 1TP7A 2QIFA 4F50A 1ZZNA 1R8CA 2EW9A 2MSSA 2BJDA 2DH8A 3E3XA 5M2UA 3KMSA 4C8NA 2FPHX 1SJRA 2ZOMA 2ZE2A 4PG5A 1U48A 3VR1A 2XNRA 1ZZFA 2AJFE 4ZP6A 2CQHA 4DQPA 3GR1A 2WW8A 4B3SF 2PA8D 1TL5A 2HWIA 2KZZA 5LSRA 4FN5A 2NLWA 4LSLA 2DGVA 4RW9B 4M5DA 2FJAB 1VQPS 2HHTA 2B9YA 3CPWR 2J0SD 4ZPWR 1F60B 2YKNB 2HGNA 1S9GA 4DFPA 5GAHI 4KE5A 1UWBA 3DMJB 1U1RA 4PXBA 4AYBD 3PW7A 3BQ0A 1P1TA 3KG1A 1S6OA 2CKWA 2BR0A 5E2QA 4B9TA 4CO2A 3JYTB 1G2EA 4Y3CA 1VQLS 2WB1D 4F4WA 3G6VA 2LXUA 2W9BB 3CULA 4PG8A 2MHNA 3LPYA 3K0JA 4KPYA 4Y2CA 4IG0B 3NNHA 3E01A 3SQGB 4NCBA 1RQ0A 2Z4PA 1BQMA 1YG0A 3NMRA 1XR5A 3TX8A 2MZ1A 2VBXA 2ZKTA 4F2RA 3A1YG 1AFJA 1C1CB 4I69A 4MK7A 7FD1A 3MF5A 2M5YA 5DQIA 3VAJA 3KK1B 3BO4A 4PWDB 3NCRA 3RB0A 1N56A 3J7A1 4OJ1A 5KG3A 5GMKa 2NYIA 4YHHF 2DK2A 1N48A 2ZHAA 5IZHA 2DNGA 4AFFA 2IC3A 1K9MT 4DR4F 3MMCA 3IN5A 2EKYA 3DRXA 1C0UB 3CJ3A 1FDBA 3IBWA 3MM7B 2CYYA 4TYAA 3TA0A 4F25A 3I55S 2R2UA 1R0AA 3I6PA 4Q8FA 4DS4A 5E0OA 3GV8B 2DISA 2VG7B 2JVRA 3DRRB 5F8HA 1RK8A 3BSNA 2DRAA 4DQIA 2ZHOA 3UI3A 4AL7A 1WACA 1S6UA 3KLIA 4DFJA 4OZJA 4ZPBA 2CJQA 4WZMA 3EGWB 4ZPTR 1P1LA 2ZBCA 4MK9A 3OBIA 5KOXA 4FF3A 4XK8C 2HNDB 1HBOB 5DDOC 2R7OA 3VF0B 2YWGA 3J81Y 2KTQA 4RKUC 1R8BA 5J2MB 2UXDF 2HS4A 1DTTA 4CIOA 5KFYA 1RTIB 2GQ2A 3FEZA 4WF9Q 3C2PA 1Q8BA 3BGLA 3MZIA 2G4BA 2DHSA 2AJQA 3BN4A 3KG0A 2R7TA 3I82A 2RMLA 3OXGA 5GAGU 1LK5A 4LSNA 1HL6A 3PJWA 1FRKA 4DBQA 1YHQS 2PE8A 5HMZA 2PI5A 3KHRA 2PDAA 5MAOA 2HVHA 4ITSA 3CIMA 4N47A 2H9ZA 2HAIA 1KFSA 2NS1B 2D3ZA 2MKCA 3AHPA 3IFEA 2CFXA 3RYLA 2C3UA 1MMDA 3NLCA 1KLMB 3PY8A 1HARA 4I2QB 2JFKA 1HWJA 3U1LA 1JB0C 1URRA 1VRUA 3M1VA 3BJYA 1BQNA 1OIAA 1RTJA 3MCSA 5FD1A 5C25A 5J1EB 2MQNA 2YNIA 2YKMB 4PQAA 1N5QA 1VFJA 5GVQA 4KHPF 1O0PA 3B4DA 4DJBA 1TL4A 3OFGA 4F4ZA 4QQBA 1M90T 3GFHA 1VOMA 4RLEA 3DOLB 3BSAA 1HQEB 3QO9A 1F5AA 4RW8B 2NQPA 2KFZA 4HTIA 4IFYB 4YMEA 2RKIB 2HG4A 4F67A 5DG7A 1N6QA 4JI3F 3BEGB 2AU0A 1KFDA 2MQMA 5K14A 2IVFB 5KFIA 3I56S 2IRXA 5B0FA 1RGVA 5KFTA 1S10A 2HNZB 5KFXA 5EDWA 4OHWA 2BM0A 2MQQA 2RF2B 5LXYA 5I42A 2FJBB 4KV8A 2RU9A 2YNHB 4C8ZA 1Q8LA 1XEZA 2A1BA 2AGQA 4C0BA 4PUOB 1TAUA 3C6UA 1EP4A 5KFMA 2DIVA 3VAHA 1D9FA 1SKWA 3HZEA 2CJBA 3HVRA 1KQSR 3N0VA 3DI6B 2MPUA 1T05A 4DF8A 1Q4RA 1UA0A 3DRSA 1JIHA 4ECXA 5IFMA 4O44B 3BGRA 2DJWA 4OI2A 5EWFA 3KJVB 2W9CA 2FJXA 1M5VC 2OFHX 3K5MA 2J9CA 2VODA 3S01A 3VAMA 2Z0GA 2OTLS 2HHVA 4C0HA 2ALZA 3R1LA 2JH3A 4JI2F 3Q8RB 5HMXA 3K57A 2ZJQQ 1SL0A 4ECYA 5KG0A 1ZH5A 3DM2A 2RRBA 5ADZA 4DG1B 1U09A 1UJ6A 2VD3A 2RQ4A 3RR8A 3ZZRA 1FKOB 2M3DA 1FRMA 2ERRA 1NJYA 5EN1A 3VAKA 2GIRA 2RQKA 3VALA 1QJHA 4OX9F 4QPTA 4PQUB 2RQCA 3QYYA 1MW7A 3PJXA 2MKSA 1WEYA 4MJKA 1T95A 2SXLA 5I3PA 3RB6A 2W8KA 1U47A 1VQOS 3HVWA 4ALZA 1KVIA 1RT4A 1SKRA 4XDCA 1Z1ZA 2DNHA 4H4KA 1R27B 5T7LB 2A3JA 1VMBA 1M5OC 3PHEA 1VQ5S 1TL3A 2AQ4A 4J9LA 1UP1A 4NCAA 4ZCKA 2BE2B 2J0WA 2U2FA 3QLHA 4ECTA 1DHMA 1EETB 4V19J 4WCEQ 3CDWA 3MEKA 5AE1A 1JWWA 2X1FA 2D1CA 1XR7A 3IO1A 4DHVA 4QW8A 5AXMA 1FRXA 2KZMA 4WZQA 1JXEA 1FJCA 1Q86T 1QUVA 2JLFA 5MLCV 3V4MA 5KT6A 3U1MA 3OTOF 2UUBF 3RRKA 2D74B 1U2FA 1NK0A 1FXDA 3BB5A 2M8HA 5B0EA 3CCZA 2LQ9A 1P8GA 2KRBA 3MECA 2QFJA 3NAHA 1G6BA 4CTAA 2X1GA 2QA1A 1N54B 2IAJA 3VCDA 2MJUA 1S72S 1HR0F 1WG1A 3FMBA 2O3DA 3FMWA 3AB2B 3T19A 2VFVA 5BJRA 5BYRA 4R5PA 1FJEB 4A47A 2ZH2A 4UQTA 2PMHA 2I9SA 4WE1A 2BQRA 1Z2ZA 2OLWA 2OPRB 4NZ0A 5KFKA 2MXYA 3BDPA 5CQGA 1F5BA 1H98A 3QPIA 5HBMA 5DLFA 1YJUA 1H38A 1IBMF 1JLEB 3FZ2A 2JSXA 2RS2A 2KRRA 5A8WA 1M5HA 1KEKA 3UPFA 2I5JA 4DFMA 4DPOA 1IKYA 4UW2A 2D9OA 1VIXA 3CC2S 1S0MA 1BD6A 1VBYA 2CPIA 4C7QA 3JTPA 3TAQA 1YTYA 1QAYA 3MM5B 5ITHA 1FKAF 3TOQA 4IFVA 3CCSS 3PO4A 2DH9A 2QV6A 2IM2A 3NMAA 5DDPC 2OPSB 3RTVA 1X4GA 2C3YA 1V3ZA 4XAKA 5LL6d 2MQOA 4A8WA 1WNEA 1JLCB 2MMYA 2K7KA 2V4JB 2XI2A 1NK5A 3CCQS 5J2PA 4KB7A 3I4HX 1SQEA 3FGVA 1HI8A 1YSJA 2B5JA 1AFIA 2E7WA 4ZP8A 3G8SA 3M2UB 4KKOB 4KHRA 2XI3A 2FTRA 4TY8B 1B0PA 1VLYA 3HX9A 4QU7A 1YRUA 2ZNYA 2GHVC 5GADU 2VV5A 4DV0F 5D77A 1REVA 2L41A 2E9RX 2DH7A 3L7OA 3DNCA 3TQ1A 3PRDA 4RNMA 2W7PA 2BABA 3BZQA 1H2UX 4MYTA 3W3SA 1FRIA 2GW8A 2ZH8A 1C1BB 2KI2A 4I1TA 2GGPA 2PN6A 1HD0A 2ABYA 5KFRA 1QTMA 1CVJA 1ELOA 4TQRA 2DPJA 4IR9A 3UR3C 4QWBA 2GX8A 5KFAA 5AXKA 3L7PA 1KHVA 3CCES 1MU2A 2FVRA 4R25A 1WHVA 1TKZA 2FC8A 3SSSA 3ZFVA 1CC7A 3MM9B 1SJ3P 2D9PA 2Q43A 2BW2A 2ZNZA 3NWGA 2WONB 5BR8F 1KONA 4JV0A 1I1GA 4DSIA 4LF5F 3M2RA 2M9KA 4RW4A 1B64A 1G1XA 2B9XA 4RW7B 2XB2D 3UD3P 1NKEA 1UMJA 1CC8A 1JKHA 2YX4A 3HHEA 3LALA 4H4OB 3PIOQ 2CQPA 2OFGX 4O3NA 3GSDA 1DURA 4IDKB 4YQWA 3GV7B 2EG1A 3THVA 3O5TB 1YI2S 1RI7A 2MYFA 2FVPA 4EYIB 2FB0A 2QO3A 4NL5A 2VPYB 1TKTA 1WHWA 3BF4A 4TLQA 3US5A 3IG1B 4PPDA 1KC8T 1FDDA 2