3LGNA

Crystal structure of isdi in complex with heme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
b'AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme-degrading monooxygenase isdI
publication title The IsdG-family of haem oxygenases degrades haem to a novel chromophore
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 29
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lgnA00
1URRA 2KYZA 5A6WA 2BJEA 2HFOA 3BGUA 2AP6A 3WDOA 3QMQA 3BR8A 4OJHA 5T7LB 5IXUA 2ACYA 3HX9A 1QUPA 1IUJA 4U9RA 2BBEA 2K7KA 2AJ0A 5F0WA 4NPOA 3TRGA 1FE4A 2BJDA 2GA7A 4QOTA 1N5VA 2KT3A 5F0UA 4HH0A 4FNHA 5KAKA 2GGPB 2AJ1A 5B0GA 1K0VA 2OD4A 1TL4A 1TL5A 3F44A 1APSA 5B0CA 2VH7A 5B08A 1X8DA 2K7JA 4YEAA 1YRXA 5B0FA 3CJKA 2LQBA 1P6TA 1CC8A 1ULRA 2HFNA 4ZA1A 1KQKA 4DPOA 1VQSA 3LGMA 1YJUA 2OKQA 2XMJA 1SI9A 1XBWA 1JWWA 2GFFA 3CJKB 2KKHA 3BDEA 2W4DA 3HHLC 1GXUA 1VQYA 2L3MA 1FEEA 2OMOA 2XMKA 2K1RB 3BB5A 1TZ0A 2G9OA 2AW0A 1RJJA 3I9ZA 4NL5A 3TNVA 1AW0A 2RSQA 1Q53A 2ROEA 2W4CA 2XMWA 1Y0HA 2BYCA 1TR0A 3KKFA 1CPZA 4A46A 2FHMA 4A4JA 1YJVA 1Y9OA 3HF5A 2HQIA 1Y3KA 3IWXA 2FB0A 2QLWA 1W2IA 2W4PA 3VTIA 2PD1A 3BM7A 2BUNA 2XMVA 4EFAC 2GV1A 4HI1A 1OPZA 2PGCA 1N5TA 1X0PA 3HHLA 3KG0A 1R6YA 5K9FA 2OP5A 4OJGA 4Y2MA 2ASYA 1CC7A 4Q2MA 1S6OA 2N4CA 4A48A 2LXFA 1Q8BA 3DCAA 4ZOSA 3E8OA 2GO8A 2ZDOA 3LO3A 2HLUA 3K7RA 3KNGA 1TUVA 4Y2IA 3QGPA 2IYGA 2K2PA 1FD8A 2FIUA 2HIQA 1Q8LA 2N7YA 1GXTA 2RMLA 3GZ7A 2GCFA 4YDXA 4OJ1A 1KVJA 5B0AA 2ROPA 2RU9A 2QLXA 3FMBA 2CRLA 5B0EA 1MWYA 3FGVA 3MCSA 1OQ6A 1P8GA 1Y3JA 1FE0A 4A47A 5B0DA 4OJ3A 2ZDPA 1FESA 1YG0A 4HH1A 4Y2KA 1S6UA 2OFGX 4DN9A 1N5QA 1SB6A 5B09A 1SQEA 2QYCA 2N4DA 1FVQA 1YJRA 1KVIA 1JK9B 3BN7A 1LQ9A 2IYIA 2OFHX 2QIFA 2ROGA 1YJTA 3HFKA 4HL9A 2GGPA 4HI2A 3UDCA 4F67A 2JDJA 3HHLB 2OAUA 4DL0C 2EW9A 2RILA 1OSDA 2HLTA 2LDIA 2OD6A 5A6PA 3IWLA 3HDSA 3DXSX 1FVSA 1OQ3A 2XMTA 2XMUA 3MZIA 3T9NA 1V3ZA 1WD6A 3FRYA 1MWZA 4FNIA 3TOQA 3HHLD 3KG1A 4Q2LA 1X7VA 2FTRA 3LGNA 1Q4RA 2Q3PA 2VV5A 2IFXA 1U7LA 1AFJA 1AFIA 2KT2A 2K1RA 3BF4A 5T7LA 2XMMA 1N5SA 4OIXA 2LQ9A 5B0BA
chains in the Genus database with same CATH superfamily
2C42A 1UL3A 5CD4H 3J7Z5 4YN3B 5HQLA 5B0GA 5L39A 4AT1B 4ZMMA 5KT5A 3NCPA 2LXIA 2YWKA 3KK1A 1LWCB 2HNDB 4X62J 2G9OA 1HNXJ 2E1AA 2WBRA 5K14A 2HFSA 2KRRA 2BE9B 3EGWB 2W01A 5KG3A 1GT8A 1REGX 1HD1A 1NH8A 3NY0A 1PG5B 1DTQA 2EFGA 4OYZA 2YWHA 2HW3A 3R97A 5HLFB 2N4DA 4B3RF 2LLZA 3NBPA 1E6VB 3SZ2A 1YJWS 3UI3A 2QG9B 1OQ3A 4NYOA 2Z2MA 3BH6B 1JLFB 3ZNJ1 2ZHBA 3HFZB 1C4CA 5DJBA 4K50A 1QE1A 4ECZA 2J8SA 2ZH9A 4I2PB 1K8AT 3TVKA 1JLQB 2AP6A 3TI0A 1QUPA 2CQIA 1O0PA 1IR1A 1YHQS 3DMJB 3TJAA 2XSJA 3ZTOA 3T1HF 2KT5A 1SPBP 2EKNA 2BOAA 1CBKA 2FQQB 1JLEA 5L9XA 4NMXA 1KFSA 1K47A 1Z2ZA 1K9MT 1F5CA 1PBAA 2B9WA 3OW2R 4JB8B 1C1BB 2M4MA 5A0YB 1JX4A 2RKIA 1ELOA 1SH3A 2OSRA 2KHCA 1QTMA 1S6UA 2DXDA 3KLGB 2VG7B 3JQKA 2DCUB 2DTJA 3OTEA 2DXEA 4MYUA 1UVLA 5C24B 2OAUA 4USUA 2Q6CA 4TN2A 3ONQA 3RRKA 5DS7A 3HPOA 3CC2S 4IOCQ 3HHNB 1YQHA 1ITPA 1T9UA 2BW2A 2DBBA 3TVZA 2ZFHA 4ZPTR 3IP0A 1IUJA 2VA3A 3MD1A 4J37A 3M30A 2DIVA 3UO0A 1UFLA 2XMAA 4DV4F 1ROFA 3M32A 2WVFA 4OYIA 3LGMA 3AJ2A 1XBWA 3DLEA 4OI3A 4DL4A 3VV2B 3D1QA 5LSLA 4UOHA 4NCGA 1N34J 4OI1A 4QU6A 3B6BA 3CCWA 1EQMA 2YNIB 1S1WA 4DUYJ 3FCWA 1VBZA 3D6MB 5DZ7A 2UVRA 5F9LA 4N47A 3QO9B 3OTOF 4RUHA 1N36J 1N8RT 1IQTA 1NPPA 4C0BA 1RBLA 5DDQC 1QTNB 4DEZA 4F67A 1O8BA 2JFKA 2EW9A 1D9DA 1PJ5A 4DSLA 3DLKB 5KFLA 3ETOA 3QBCA 2Q3PA 5D77A 5EDWA 3M8PA 3NG8A 3UPFA 1JB0C 1SJQA 1HR0J 1X4CA 1ZETA 3KHLA 3H4BA 3CC7S 1KONA 4QIGA 2EVZA 3OL8A 4K7QA 4C8YA 1T0TV 1RBOB 5G0RA 3TW0A 3PACA 2PA3A 1YBUA 3KG4A 5DLGA 1QD1A 3P49B 4CM0A 2FVQA 1DLOB 1TL1B 5CXTA 4IR9A 5A2QY 4GKJF 2V9KA 3P3DA 3IAM9 3PKMA 1XR5A 3SSRA 2DT9A 2EC2A 2IY5B 2IJRA 5L1LA 3VWSA 1L3TA 1PC4A 3VZHA 2R7RA 3CE8A 3G96A 4EBCA 1TVRA 1HNZF 3DN9A 2C2NA 2KG0A 3C66A 4CLZA 2C2EA 4NYZA 3UD4P 2OD6A 1FVSA 3THVA 4QWCA 2OPSB 4CLKA 3R1HA 1Q4RA 2XYHB 3V4IA 1IBCB 1FK9B 3CIZA 3BGUA 4B9MA 3LA0A 2BMBA 3M2RB 2CJAA 1K44A 4PPZA 2PIIA 3H42A 4BLGA 1S4FA 1HFEL 2KI2A 3QRQA 2UV8A 1DAXA 1ZM9A 3W60A 2MKSA 2VODA 1DY3A 4X4QA 1RTDB 1R0BG 2IM2A 4P52A 4L3NA 4D3HA 3HCXA 1VS3A 1ZH5A 1V3SA 4DR1F 1AZSB 1HBMA 1Q8BA 2F4FA 5HK4A 2WONB 3D66A 1LXNA 2EI5A 1FESA 1P9QC 2U1AA 2FZGB 2Q6BA 4CO3A 3OHAA 8AT1B 3WHIA 2OFHX 1HPZA 1NEEA 3RB0A 1D1UA 2C1EB 2LDIA 2M2BA 1JJ4A 3L4BC 2ZH2A 4KKOA 2IBOA 2B4OA 2C3YA 2F4VF 2YKNA 3QGGA 1IR2A 1RT1B 4U8YA 5CYJA 4G1IA 2HK3A 3MFHA 4ICLA 3QRRA 5F0WA 3BBFA 4KGMA 1ZM4A 4O3QA 2KN4A 2AJ1A 4YB1P 2CPYA 3D0IE 1S1TB 1X4AA 1FDAA 4RZRA 4ALZA 1C2PA 2GFFA 1FEEA 2DY1A 3O2IA 3L9ZA 2NQPA 3EPGA 1NK9A 1KHWA 3IS9B 4EO8A 4YY3J 1TELA 1S1UB 3TUJC 5D8HB 2WOMA 4KHRA 4ES1A 5AJ3F 3J7ZT 2E1RA 3GR0A 3KG0A 2XGPA 1IBKF 1G4CA 1KS2A 1RT2A 4NRUA 3D6HB 4A48A 4ZOSA 5CCLA 4OL8A 4F4AA 1IN0A 4RNFA 3IRWP 2NXEA 3R2CJ 1Q7LB 4LJMA 3UNYA 4FXDA 1HWLA 2F8MA 1LK5A 4F4YA 3V6HA 3LALA 4KH0B 3P96A 2HS4A 4CO2A 5GMDA 1AUSL 1RBAA 4WFBQ 4DQRA 3NGTA 1JLBB 2OGUA 5ETQA 2RIJA 4URGA 3GQCA 4P10A 3FDSA 4WIQA 1F3FA 5KFAA 1R0AB 1SC6A 3SSSA 1E6YA 4ECUA 4I6AA 1ZTTA 3TP2A 2NXNA 1T9YA 2ZBRA 1FKOA 5MLCV 5CD4A 3GIJA 2MEWA 3I0RB 5AXMA 1A6LA 3UDVA 1WG5A 2CQ0A 4K5SA 2YXLA 5KFJA 3I9V9 1W7WA 2BE2B 2RDIA 2BX6A 2DNQA 3HF5A 5BYQA 2RE1A 5EWGA 2ZWOA 3PRVA 2LP4A 3RW6A 2GJ2A 3ISZA 4IOBA 1XR7A 1NAQA 1WI8A 3GG1A 4I1TA 2XGQA 3SCLE 1T02A 3KK3B 4LFBF 3NRBA 5KFDA 3RUBL 1LV5A 2XTJP 3FZ2A 3KLFB 1TL7B 3GWCA 1VQPS 2HRTA 4KHMA 2EPIA 1ZA2B 1YSJA 2CPZA 2KZZA 4NLPA 1CJVB 3UDLA 2QL9B 3PJ9A 1LWCA 3EZ5A 1U1PA 4X65J 2HNDA 3ENQA 1BUXA 3SBMA 3IO1A 4USKA 1L5UA 2NZCA 2HKEA 3CJ3A 1Q5VA 2A2DA 4R8UB 2YKOA 1WUUA 3KJVB 1VLYA 5DLFA 1Y11A 1NJZA 5KT7A 3GU0A 1SBRA 5KFMA 3FSIA 3CDAA 1X8DA 5A8RB 3M9NB 3JSMB 2FJWA 3BDEA 2W4DA 7FD1A 3RW7A 2L3MA 2AHOB 3W61A 1TTHB 4DV0F 5HLFA 2ZH1A 2VFVA 2WW4A 1E6VA 5GMKa 2YPZA 2J9DE 1H38A 2E9TA 4G65A 3FQKA 4C0HA 2QL5B 3OL6A 5KFIA 4U8VA 4DU7A 1RAIB 2B5JB 1VQ4S 1UA0A 3ZZYA 3SSQA 1KVJA 2N3LA 3UQSA 4I2PA 1JLQA 4OJ3A 3N6LA 2OFGX 3AT1B 3QQCD 2VL1A 4LSNB 3AJDA 5F8NA 1RHKB 5D3GA 6AT1B 3DMJA 2QFIA 3GV7B 5LT5A 2CQDA 2OSQA 3DRRA 1AFJA 4FYDA 4OIXA 2FJVA 3ILLA 4PXBA 1ZS6A 2ZWPA 1FWLA 1VQ8S 3D0GE 4ZN3A 4BC9A 1HNWJ 4NZ0A 4D3GA 3GONA 1ZAWA 4O0NA 3TA1A 5E3QA 4NZ6A 5I3QA 1C1BA 4ZA1A 5CABA 5A0YA 4JV5F 4ZK7M 4B3SF 4OYMA 4PG5A 3V6DA 2RHQB 2VA2A 3SCKE 4C0OC 3KLGA 2VG7A 3D2WA 2QSFA 2FC9A 3R5DA 3A3OB 2ZKUA 1Z4UA 3BM7A 2DNRA 4EFAC 3GFXA 2E5LJ 4EGLA 2PSZA 3GB0A 5C24A 2ZOMA 2PO4A 4N41A 2FZCB 2W25A 4IOAQ 2NUUG 5ETMA 3BBCA 1Q8LA 2RMLA 4HEA9 4UQTA 3RB4A 4XPCA 1PILA 4NXMJ 4ED5A 3T6BA 4XDDA 3AXKA 3QZ8A 3M8RA 5JVHQ 2M3DA 4LR7A 1VIXA 2LXUA 4IFYB 2BM1A 1HBNA 1WF0A 1T9VA 1V3ZA 2AZ3A 2AGPA 5ETPA 4F02A 3P6YC 5CYMB 2KZMA 2ZKTA 4BWMA 5IXUA 3U1MA 3TZZA 4KR0B 5EX0A 4YEAA 3JXOA 1RU1A 1KP6A 2HRYA 3TARA 2AJFE 3QO9A 2VDHA 2WK4A 2V69A 1HKAA 4ED0A 2HS0A 2XI3A 3ZZ0A 2ZC3A 5IV3A 2ROEA 3FNNA 3RBEA 3PV8A 1NM2A 2FJDB 2HHSA 1S72S 5GAEI 4PRFA 2FHJA 2N7CA 3DLKA 1TKZB 2P8IA 5A8WB 1NNDA 1TKTB 4Y2KA 1R27B 5J2PB 2NXUA 3VAKA 5E2QA 3KOAA 3OTDA 2WVBA 2XMUA 2DNZA 4X64J 1WHXA 2UXDJ 1FFGB 2PMWA 2ASDA 3CULA 4MT1A 1JWWA 1WC4A 2AQ4A 1ZA1B 2ZBQA 3T3FA 1DQ8A 4HLBA 4YOEA 1DLOA 1TL1A 1VK8A 1KWMA 1PAEX 3DRPB 4Y28C 4YDDB 3TAQA 3CNQP 2Y8YA 1C1CA 1S9EA 5M2UA 5LMNJ 2X7IA 4IRKA 2Z2YB 3R7BB 4J9SA 2V4JA 5H9FK 2AMCB 2CNNB 3ZTQA 4YB7A 1FX4A 5SZTA 1VFJA 5EHHA 1S49A 3GJQB 3B78A 1GMVA 1HQ2A 2LFVA 1MROB 3A8IA 1RWPB 3PTWA 2FIUA 4JI1F 2YH1A 3G8SA 4JBCA 1KSPA 1WOPA 3FGVA 1FK9A 3K8WA 4UY8T 4ZLJA 4MIBA 2VIHA 2UU9J 1GQEA 3M2RA 1NH7A 4QW9A 3AODA 4RUBA 2Z2ZA 4ECYA 3F73A 3NS7B 3MXHP 5A2QU 1X4DA 4LSZB 5HMWA 4MTPA 4ZLPA 3MM5A 5D4LA 4ZCLA 3RG6A 2VG6B 1RTDA 3W2WB 2QZ8A 2O1PA 2HFVA 3CCSS 1RWMB 2MSTA 2XO6A 3LPYA 3A12A 1VRUB 3CJ2A 2UUBJ 4Y0FA 1T7PA 1AZSA 1KDNA 1PJ7A 2WONA 3MHYA 1XMQF 2DO4A 1U8WA 2DPJA 2GAGC 3OXFA 2R7OA 1UJ5A 4J9QA 3UDEA 4HI1A 3KJFB 2XSFA 3CD7A 5AE1A 5KOWA 5I3UA 2ILZA 1UVNA 2HLUA 3PO5A 2FVPA 1JQGA 4HACB 4ZP9A 1VQMS 4L73A 4DV7J 5B0AA 3E01B 1RT1A 5E41A 1N32F 3CGIA 4ECWA 2ZDPA 5M2PA 1YG0A 2VC0A 1RT3B 3SMZA 4HDHA 1L3VA 1KVKA 4X4NA 4DX8H 1FKPB 3HJFA 3DXSX 2ZEJA 1S1TA 2JZ5A 3KLEB 2CA9A 4Z2XA 3KMQA 4DQSA 4PR6A 5J2MA 1AFIA 2E44A 2E29A 4WP9A 2H51B 1U2RA 3CCTA 2ZJQQ 3BKUA 3QATA 1S1UA 4DCOB 4QWDA 4J9OA 3N4WA 1GEHA 5HVGA 1T9XA 3A8JA 3D67A 4LRBA 5GAHI 4N7TA 4I6WA 3R6GB 1VR6A 3LP2B 1U4BA 4A8KA 3NWRA 2VFRA 1RT5B 4JI3J 2CQ2A 2F7VA 5IV4A 1NK5A 5HSPA 3OVSA 1S9GB 3UVJB 1OMSA 4USWA 5D15A 1NO8A 1QDUB 3EUNA 2JJ4D 3IM8A 1VIOA 4IG0B 3C6UB 3BKFA 1JLBA 4RLEA 3H5YA 1Q78A 3KWMA 1R0AA 2HEKA 1RAHB 2QLFB 3QT6A 3K2YA 4CO5A 1U1MA 4YHHF 1D0EA 2KYXA 3TEGA 4WYLA 4MKYA 2C3PA 1MMNA 2JC1A 4KB7A 5ETSA 1FXRA 1HW9A 4KGZB 1AROP 2R42A 2BE2A 1JNRB 4F7VA 2BACA 3G87A 3SI8A 3GV8B 1HHQA 4FKYA 3RB6A 1GFWB 4ZCMA 2JNJA 3FK4A 4LSLB 3QPIA 4DMZA 3OV7A 2K7JA 2XLKA 2YKQA 4HT7A 4OHZA 3D3CJ 4IH6A 3OD2A 2XS7A 3E51A 1OO0B 3KK3A 1KOOA 1TMMA 3O3LA 3I56S 4QWAA 3NMAA 3KLFA 1TL7A 1RXOB 1EAYC 3R8YA 3FSYA 2HZVA 2CZVC 2CJQA 3KXDA 2ZH8A 4OYOA 2FD2A 1KTVA 2VONA 5F8HA 2CZ4A 4W4MA 4AQYJ 1FJEB 1OY6A 2OI2A 4I7FB 1PCAA 3DOMB 4IRDA 4P2XA 1K1SA 3TO8A 3Q8SB 3DFEA 1WKJA 4R8UA 2R4FA 3Q2SC 3KJVA 3EPIA 5A8RA 3I82A 1M5VC 4K4WA 3JSMA 1Q81T 1U09A 2J6SA 2DNKA 3W2VB 5F8GA 1VQ6S 1FDBA 3KLIB 4J9PA 3DOLB 3KMSA 2D69A 3KHHA 2HQCA 1SIWB 2BJDA 4RWXA 2CXEA 3DLBA 3R7SB 1LFWA 3R27A 4JYAJ 5KFXA 4EZ9A 1S97A 1P6TA 3OFEA 3GMGA 3I96A 4JI2F 2B5JA 3LWLA 5IM0B 2VKZG 2HHVA 2YKPA 4NL5A 3DU6A 1OY8A 3BPSP 3K89A 2RRBA 2J6UA 2HVZA 2DHXA 4F0KA 3LAMA 4URSA 5KFWA 3PX0A 1VLOA 2QA4G 3MAHA 2CVIA 2LXFA 4M5JA 4LMZA 4DX5A 1HMVA 2BQ3A 2FZKB 3EXYA 3C6TB 4OHXA 3MMCB 1Q7YT 4DN9A 5I42B 1RT4B 2CIMA 4Q43A 1XNQF 4ZPCA 1RAAB 4B3OB 2HVEA 1UVJA 3MI7X 3RBXA 2ZHAA 2Z56B 2LQ8A 1W26A 1X9WA 3KLVA 2GC8A 1QSLA 1VOMA 4AL7A 3FCHA 2AX0A 4M5MA 1XNRJ 3E3XA 3MM6B 4A8XA 1GTHA 4ENOA 5GADI 3M1VB 2APOA 3FBEA 3ICLA 3T5LA 2V6AA 3L7OA 1S79A 2IA0A 2NPFA 2G2YA 2HBQB 3TVYA 1FJGJ 2AKWB 2BJ7A 4TU8A 2BJ8A 2F65A 1CJTB 1RTJB 4DR5F 4IH5A 3SIPB 3I9ZA 4OMFG 4KSEB 2GIFA 1SL2A 4IRCA 3AD7C 4HDGA 4IFYA 3DLHA 3PDNA 4DCJB 2D9PA 3LP0B 2CWKA 3GTYX 4CTAB 4F4XA 4BDPA 1UJ4A 3N01A 2GMLA 2H65B 3BQ1A 1B70B 1Q79A 1YX2A 2HWIA 2QV6A 3MDFA 2EFQA 3D28A 2RQMA 5KFEA 4TNOA 4Q2LA 3PW2A 4ECVA 2ZUAA 1S0NA 4DZDA 3G71S 5KTQA 2X1FA 4LR9A 5A6WA 2GIRA 3WDOA 1IWAA 2GZOA 2V8DA 1HNVB 2YH0A 2K7KA 2AJ0A 2AEFA 4B3RJ 3NNAA 1JLCB 3T5HA 3QGHA 3WIVA 3DYAB 3R6LB 5HN0A 5HO4A 2Y0BB 4RBUA 4DG1B 3WIUA 3H8YA 1TKZA 3EJMA 5JJBA 1SL1A 3KUHA 1F2GA 2P9EA 2LECA 4J7CA 1RLCL 1HBOB 1TKTA 1CULB 2MQMA 5AE2A 5J2PA 2EG1A 1TK8A 4PYAA 1YK9A 4KAIA 3HD2A 3ZTRA 1LKZA 1X60A 2HSEB 3DDIA 2FUG9 1QY7A 3D6FB 3T1HJ 4PEOA 5KFTA 3KHGA 4HH1A 4NA3A 2UZAA 4Y00A 2FPHX 1FRMA 2Z57B 1HQEA 1RGVA 4PXCA 2LU1A 1N0UA 4DCPB 3QJJA 1M5PC 3ZFVA 4A8OA 1EP4B 3M9MB 3W9IA 2XZDB 1VK3A 3RRHA 3NNHA 2YWGA 2O66A 4LF7F 5EN1A 1FE4A 2CQHA 4FNHA 4ECXA 2M5YA 2A2CA 4C8LA 1AXQA 2CQ1A 1MROA 1NDPA 3TQEA 2WRMA 2ALYB 2XCAA 1HBUB 4WYWA 1IKWB 3BB5A 4G1QB 1C0UB 2AW0A 3TUZC 2BYCA 4C3KA 2XWYA 5CQGA 1VBYA 4GC7A 2RJZA 4N8OA 3VCDA 2GS8A 3G6ES 3MPYA 1VQ9S 4M95A 3PJXA 1UP1A 3RU0A 1NK0A 1X0PA 1BLUA 2CPJA 2NXJA 1I5OB 4OHVA 4DV4J 1UW9A 3AA9A 4K4XA 5HROA 3M8QB 3W5YA 4IO9Q 2VG6A 1BQXA 2HBRB 2HIQA 4F4KA 1T95A 3W2WA 3CD6S 4MYTA 3VGTA 1DURA 1X4FA 3ZZTA 2G2ZA 5HQMA 3MCSA 1I94F 3HM9A 3DOKB 2CNKB 2UP1A 2XY6A 1VRUA 3HVTB 2VOOA 2ZZNA 4MIAA 3DC2A 3HULA 5KFUA 3W62A 4RBVA 3PX4A 3KG1A 2GNKA 3NXZA 2WSEC 3FEXB 3KJNB 1ZPVA 3OTOJ 2R7QA 3D7SB 4EI2A 4KGKA 4USTA 3HSDA 2G13A 4KY3A 4KGXB 4AL5A 2P9CA 1VRQC 5J2QB 5DZ6A 2KFZA 4F36A 4RNMA 2QEXS 1N5YB 3Q23A 2CNOB 3DM2B 4E98A 3CIMA 3E01A 5M2RA 3EVMA 1RT3A 1YJVA 4A8QA 4JI0F 3MUTP 4U96A 4RW9B 3GYGA 5HMXA 4RNHA 1CC7A 4Q2MA 3FBBA 3SQGA 3KLEA 5ITHA 5LXRA 3HSJA 2HNYB 2Q1LA 4Y2IA 4DV5J 2XULA 3GFYA 3T6JA 3BSNA 3MTKA 3I5CA 2MHNA 1WORA 3MGJA 2QE5A 4IG3B 4DL7A 2D3ZA 3DXBA 1GMUA 2E5HA 3HDSA 2J8AA 3KUEA 1CVJA 2WCXA 2UV8G 2VB6A 2EBGA 1HYSB 1RT5A 1URRA 3D3BJ 2Q66A 2HBZB 5T7LB 4F04B 2YWEA 3C19A 2H9ZA 4DQIA 1HNZJ 1FJ7A 1S9GA 1JNZB 1J5EF 3UVJA 4NLRA 4U95A 4LF9F 3X1LB 4IG0A 1S0OA 1MW7A 2MJUA 7AT1B 4UQGA 3CTRA 3V6JA 2ILYA 1D3WA 3CPWR 4P2SA 1NKEA 1FDNA 1Y10A 2LDYA 2JEIA 2CQBA 4LF4F 1S76D 2YQ0A 3MMAB 3AQOA 1QLNA 2N4CA 1IKVB 4TXSA 3ZNUA 2R3VA 2NR0A 2C2KB 4F26A 1U02A 4UOFA 2A18A 3OR1B 1YJ7A 4LSLA 3THTA 4HVZA 4F25A 1FX2A 5A8KA 4KH1B 2ZH3A 2V5HG 5HJYA 2H1YA 1H7WA 3CF5Q 4DR1J 5L38A 5KFKA 4ZJQA 2IRXA 3AA8A 5D4NA 2Y1IA 5AXNA 1LXJA 2A3JA 2CNLB 2GVZB 1X5OA 2MYFA 4OI6A 5HVFA 1M90T 5LOQA 1FO1A 1WC5A 2YKAA 4I7FA 1NJIT 4K4UA 3DOMA 1L3SA 2FJBB 2F4VJ 5J2NA 3T1YF 4ZP6A 3DRXA 2MKYA 4R5PB 3D54A 1KQGB 6FD1A 4OV1A 2YVSA 4MAKA 2F8EX 3DLGB 2ZUGA 4IQXA 3M2VB 3W2VA 4GVLA 3KLIA 3DOLA 2BQUA 4UTGA 2ZVIA 5EX3A 2W7AA 3HMJG 1SCJB 2VQFF 1HWJA 5AJ3J 1TAUA 1IBKJ 1U2CA 2DR9A 3QLHB 3PJWA 4LBPA 4WTYA 3UCZP 1B0PA 1DFDA 3T41A 1IM4A 4X4TA 1SKUB 2Z8QA 2ZNZA 3PW7A 1QSSA 4KFBB 1RAEB 3EX7B 3F44A 1D8YA 5BYSA 3TAPA 4WZQA 4C4WA 1TAQA 2H3EB 4OYPA 1T05B 1SVDA 2J9EA 3UR3C 4NLVA 2DR8A 2GO9A 2DNOA 2BJ3A 1UZHA 1UCNA 5A76A 3MMCA 4OX9F 5I42A 1RT4A 2CDRB 2QN6B 3ADAC 2DR5A 3NNCA 1HQUB 1EETB 4B3OA 1JLGB 4IH7A 3Q8RB 3MUVP 2IVYA 1NB7A 3JQMA 2HHHF 3TX0A 2PI4A 2HG4A 2LEBA 2CQCA 4RO0A 1IQZA 1FVQA 3MM6A 2GHPA 2OJ3A 2XCPA 4USMA 2MXYA 4ZPWR 4DPYA 4KHPF 4X4VA 2QMWA 3S7RA 4PKDB 1S9FA 1MWZA 1CJTA 1RTJA 3ZZZA 3F0NA 1U2FA 2DNLA 2MKIA 2UXBF 4LFBJ 4B9LA 1AA1B 1BGXT 2ZOFA 4MFBB 3BR8A 3GSIA 2NS1B 4PAAA 2WHOA 2MDAA 3IR7B 4ATNA 2NREA 1KTQA 4CNYA 3M32B 4CTAA 3CCES 5DQIA 3OFHA 3DKDA 1UFWA 4IO1A 4B08A 1S99A 2HMIA 1RYRA 1IBLF 2PMZD 3EICA 5HP1A 4NLQA 1WELA 1TP7A 1S1WB 3FVYA 4AL6A 5HAOA 2PEHA 3Q8VA 2DNYA 2CRLA 4WBFA 3CJSA 4WXWA 4TU9A 4AXIA 1HNVA 4DV0J 4XPEA 4N77A 2AYGA 5E7OB 4YR0A 1PO6A 1JLCA 3EM1A 1N6QB 5F8JA 1FNMA 4JI5J 3JTNA 3FKBA 4DG1A 4PCQA 2V2VA 4Q5VA 5D4OA 2DGTA 5CYQB 4FP9A 4N76A 2ZH5A 3BO4A 5HI7A 1BQNA 1HBOA 3CXCR 2CPFA 1CULA 4Q8FA 3AHPA 1F2HA 4DLGA 4FS2A 1XWLA 4A8WA 2WZ1A 2VH7A 3AB4B 1EB0A 2B9YA 2ZH7A 1ZZNA 5G0RB 2FYXA 1B0TA 1P9YA 1S1XB 1FTCA 1YBTA 1LW2A 2W2PP 1R6YA 1UETA 3BQ2A 3US5A 1UVKA 2JRSA 3PEJA 5KG5A 4K4SA 3QAEA 4JV5J 1EP4A 4EK2A 2RU9A 4B3SJ 3U27A 1TUWA 2EXUA 2E66A 1PC5A 2OHDA 4X4RA 4OLPA 4KRWA 1BY9A 1RWWB 2R8HA 3J7YI 2KJVA 4NLXA 2BA9A 3R5BA 2ZNYA 3KTQA 1HARA 3Q89A 1HBUA 1IKWA 3K17A 2PMHA 4G1QA 1C0UA 5EUHA 2XS2A 4I2QB 1VISA 3TAMB 3LPEA 4ELTA 1PYTA 1U6FA 3H25A 5KFVA 3V4IB 4CT8A 4HH0A 2HGNA 3HHEA 4ZVOB 3GIIA 2DRAA 1GH8A 1SV5A 2O01C 3R9LA 4ERDA 4MK7A 2OKQA 1U25A 1VBXA 1EKSA 4RU9A 1HNIB 4DX6A 3W1YC 4Q44A 2DGVA 3JS9A 2Z2LA 4PWWA 4A46A 1FNXH 3DOKA 2IHR1 1RLDA 2MQQA 4W92B 4RR5A 2RT3A 2PD1A 2IC3B 3NGUA 2IM1A 3HSZA 3FJ2A 3VQTA 4K2JA 1MWQA 3LO3A 1N36F 1HBMB 2I5JA 3UN3A 2R8JA 3L09A 2J9DA 3EGVA 2MGZB 2J0XA 3HHLB 4O4GA 1V9OA 4KTQA 5JMNA 4TLRA 2XMTA 1TV6A 2JX2A 3DNCA 1N5YA 3DM2A 5D78A 2E5JA 3IG1B 5GAEU 3HO1A 4PXEA 4B9SA 1WNEA 1TKXB 4RW9A 2X3GA 2FVSA 1FD2A 3NL0A 4C3MA 2HNYA 1KHVA 1T9TA 2CJBA 4ES2A 2BJ9A 4MK8A 5LM7E 1S4EA 1RWXB 4AE5A 2DH7A 4OV6A 3IWXA 2DNNA 5IC6B 3CDEA 4IG3A 1FI4A 4YMEA 4B9NA 3CCVS 3T5JA 2EFOA 2HURA 3W64A 4ZIWA 5C42B 5FD1A 4DQPA 3UCGA 2KXFA 2MPUA 3EMTA 2XEXA 4DV6F 5HBMB 5KFHA 2DHAA 2R7XA 3SYZA 4DHVA 3T1AA 3S8SA 1RTIA 3F41A 3CUNA 2K8GA 3NLCA 3UCUP 2RF2B 1X9SA 2RB7A 1VQNS 4V19J 2MZQA 1SKWA 2I1RA 4B3TF 2DGOA 3K57A 1NLKL 1R89A 2Z0GA 2DO0A 1IJFB 3SCIE 1GXUA 2PDAA 2XMKA 4H4KA 4AD6A 2JC0A 4CH1A 3D0HE 2YKMB 2PT0A 2QA4S 1QJHA 3OR1A 3QJPA 2VOPA 3W8GA 2GV1A 4IR1A 1HI0P 4OJGA 3C2PA 3TWZA 4CLSA 4ILRA 3B54A 5FDLB 3H2UB 4M5KA 1XMQJ 1S77D 3PCOB 1L3KA 1MWYA 4FVMA 3IM9A 2FHKA 3CWJA 3AY0A 2GVZA 2DEIA 3IBWA 4K0KF 4AUKA 3R5JB 2AIRB 3LGNA 1YJNS 1KC8T 1R8HA 4LF6J 2NLWA 3BSOA 1N32J 5D0EA 2W7PA 3NOCA 2HAFA 4R5PA 3OJSA 2KDOA 3CT9A 1VQKS 3IWNC 1RP5A 2AGOA 4FN5A 3DLGA 1NKCA 3M2VA 3U1NA 3TEHB 1SJ3P 2B0GA 2FB0A 2R2TA 3AAWB 1FA0A 4AXJA 2MTLA 2ASYA 3VGVA 3FMWA 2EFPA 3PRBA 4DPXA 2GO8A 1UWBA 3QLHA 1DQAA 1JJ2R 1GXTA 3CJTA 2H48B 4J5OA 2QMUB 2CJXB 3QT8A 5DQHA 4J9VA 4ZPVR 4KFBA 1OSDA 5D3GB 4ITSA 2P6SA 1T05A 3MPWA 4I56A 3MEDB 3QYYA 5E3RA 5KG2A 3DI6B 3MCOA 5DG9A 2VHGA 2W8LA 3DRRB 1LWFB 4WKYA 1PGZA 1FFWB 4FBUA 3Q2TC 1JMTA 1NB2A 4YHHJ 4DBQA 4V1Ak 3CJRA 1HQUA 1EETA 1NPKA 1JLGA 5B0CA 2DRDA 1SH0A 2GMHA 2JSXA 4F4ZA 2PEBA 4YS2A 1QVGR 3H59A 2DGUA 3HHKA 3J81j 2KKHA 2RUSA 1M1HA 3N0VA 2HPUA 3V6DB 1UPPA 4JOUA 5DQGA 3TUIC 3M6UA 2PGCA 3CCMS 2I8EA 3AXMA 1RADB 2K2PA 2ALZA 1SC4B 2ZE2B 2WVEA 4OJ1A 4RKUC 5IOLA 2QLXA 2HHWA 3Q8UA 4MFBA 2E7XA 2A1BA 4DR3F 3ITHA 1U1LA 4DL0C 3UWTA 3LGHA 1X4HA 2UVUA 2D3UA 1U6BA 1XJWB 4HR2A 2D41A 1HBNB 5DG7A 2IJNA 4YFUA 2XC9A 1FDDA 2L9NA 1KN6A 2HQFA 4EEYA 5DG8A 2NZ4A 3GJTB 3MPDA 4Y65A 2Z30B 3QIPA 3HHLC 2BRLA 1BHNA 5THWA 3WX8A 4TVAB 1UZDA 2DB1A 3NMRA 5E3CA 2IVFB 3JQJA 4WPAA 1N6QA 1RTZA 4J91A 1U1RA 1EKRA 3AOAA 5E0OA 1TUVA 3GFHA 4JI2J 5CYQA 3DRYA 3V2UC 5E3AA 5DDOC 2B56A 3KDNA 1DBDA 4LREA 1PSDA 3R1LA 3JSBA 5HJXA 2J76E 4WFXA 1G7CB 2L9WA 5ETRA 3CVKA 2KXNB 4DUZF 3MM9B 3BF4A 4YQWA 3OLBA 1RWUA 4X4UA 4ETXA 3CD0A 4O0IA 1S1XA 4NPOA 5HL7Q 1H3DA 2DNPA 2PA8D 2DK2A 5KFYA 1F3VA 2R7TA 5CA5A 1TK0A 1S57A 2IDEA 3H40A 1UEUA 1U0HB 2M70A 1C1CB 4TYAA 1S9EB 2YX1A 2Y1JA 2B4PA 3BR9A 2V4JB 2HQIA 2Y1RI 1KEKA 4PQUB 1A9NB 3N5FA 4OZ5A 4ELVA 2W9CB 2J7WA 1NJYA 1MMDA 5DDRC 5ETKA 1UWAA 1WEYA 5F3ZA 1RK8A 4WP8A 4DR5J 2GMJA 4I67A 3HVAA 1IKXA 4ANEA 1U8SA 2FHOB 4A47A 4I2QA 3TAMA 2N3OA 1WOOA 2MKHA 4P71A 3S6EA 1JJCB 4OZLA 2BM0A 1LW0B 3KUGA 2UUTA 1IXKA 3RR7A 4B3MJ 4NLWA 2ZHOA 4MKAA 5H9EK 2FHJD 4CI0B 1JXEA 1HNIA 5JUMA 3MM5B 3NGRA 4OYXA 2F5GA 4PG8A 2GQCA 4RW8A 2IC3A 1A0OB 2NUHA 2RVJA 2OEKA 3IGVA 1ZAVA 4Q45A 2KXHA 1H2TZ 2AJQA 3IXQA 2BEFA 2B6AB 2NXCA 4P9SA 1Y7PA 1T03B 2OO4A 4ZHRB 4Y2CA 5KFRA 1SJ1A 1NK6A 1SKSA 1RUSA 3GR1A 2F40A 3DRSB 4C8KA 3QT7A 2MGZA 2BW7A 3HHLA 1WDDA 3MR2A 1S0MA 4N8NA 4GRSA 4LVNP 4ZVTB 4DV3F 4CLTA 2V0NA 4OZ2A 5I3UB 2E7WA 3IG1A 3KYLA 2RQ4A 4GVBA 2OPPB 4C7QA 3WBZA 3EDQB 3FBCA 3BN7A 1TKXA 4M5IA 3HXMA 2BRKA 2UXDF 4U6PA 1QAJA 5IQ6A 2POKA 1WD6A 4I69A 1OSCA 4LRCA 1R6VA 2DGWA 2KT2A 2HZCA 5SUHA 3CO9A 1RTHB 3VALA 3H5UA 3QMQA 5J2MB 4KT0C 4QIWD 1BE4A 2C2ZB 1MG7A 3OTCA 4B17A 1FRHA 1J2VA 2WVDA 1K0VA 4WCEQ 3QSYB 2VU5A 4DL6A 3PFOA 4W90B 1VQ5S 1WEXA 2BXJA 5C42A 4USJC 5GAGU 3E2EA 1N4LA 1AW0A 5I4MA 3UD5A 5HBMA 3BO2A 2IPOB 1HD0A 2R8KA 2GIQA 2D3OR 5KG0A 1VYAA 3PVXA 3CJ5A 3OBIA 4FS1A 3CEDA 3IFEA 4CRJA 2RF2A 2MQNA 4JI8F 2XY5A 2DEJA 4PYDA 2ABYA 4RWWA 4KJIA 3PIOQ 3VZIA 3Q8YA 4U7CA 2VPWB 3CMAS 4LR8A 1IVZA 3M8SA 4RW4B 3G82B 3OUYB 4DFPA 3VAJA 4HHHA 3QT5A 2B51A 2K3IA 4EBEA 2YKMA 1NPRA 2F1FA 4RJVA 3SDEB 1I94J 3KLHB 4DUTA 4XO0A 3GJRB 2Z4PA 2R7UA 4ED2A 2BABA 4UUXA 4ID8A 1WC6A 3U7JA 2IA6A 4P73A 1KOHA 4S0MA 4JI6F 3ZTSA 1RAFB 5FDLA 2JVOA 1GAOA 1GX6A 3C46A 3AJ1A 2AYBA 4CZCA 1BC6A 1NXIA 4FYYB 1NDKA 2OP5A 4EZ6A 1Z1ZA 3UW1A 4RPFA 2IAJB 4I0WA 1FWPA 4LT6A 5BR8F 4Y3CA 5RUBA 2W24A 2Q79A 3PRDA 2BDPA 3VVTA 1C4AA 5G4DA 3EXCX 4NYPA 4ELUA 1F9EB 3JAMU 3O6QA 4JI0J 4LQ9A 5BXIA 1U26A 1YIJS 2BKPA 2XYPB 2FTRA 4ZVUB 5LSRA 3LQVA 2ZD1B 3G4SS 1N52B 1BXNA 1G3OA 4QU7A 3BPDA 1JJHA 4NCBA 1XC9A 3MF5A 3L3CA 1APSA 2A10A 4YB5A 2IM3A 2AZ1A 2I2YA 4BHQA 1NSAA 3WC2A 1F6TA 2DGXA 3GE9A 3KK2A 3AOBA 2VDIA 1J5EJ 4ID5A 4Y2MA 3GIKA 3GFZA 3W5ZA 1UTAA 3I6PA 4LF9J 5KFPA 3MEDA 3M8ZA 4PZVA 3DI6A 1X4EA 1YKWA 3VAFA 2BKOA 4WFZA 4WTOB 1HMVB 2R7WA 4ED7A 2B8QA 4PUOA 1LWFA 1TMJA 3PYDA 2D74B 3KJQB 2QIFA 1WTFA 1T94A 1EIYB 4LF4J 2R2UA 4PG4A 2GAHC 2CJYB 4ED4A 3BBBA 2M8DB 2FDNA 1HI8A 2L08A 2Y3YA 4DFKA 4P2FA 1WC0A 2EEYA 5F0UA 5U47A 4E2FB 1AB8A 2ZE2A 2C3MA 4DSFA 3QIDA 3WQPA 3QRPA 3KKFA 5IFMA 5KFFA 1OS5A 5KT6A 3CC4S 2W4PA 3VHQA 5F3TA 2IRUA 2UUCF 2H5JB 4JV2A 2CUYA 4IYQA 1FRJA 3T1YJ 1K1QA 5MAOA 3MFIA 1JK9B 3IN5A 1P1LA 2VC1A 4OI4A 1R3NA 3GV5B 4ZJOA 3BYRA 4ZVSB 1IBMF 2M9KA 1B4SA 5IT4A 1OJ4A 3CCLS 4CYUB 3OPKA 5IWAF 1R8AA 1IJEB 1N5VA 2KT3A 4C8NA 1XERA 5E33A 4RU2A 2MB0B 2ZM6J 1RU2A 2VQFJ 1H0HB 2X1GA 5B0FA 2DIUA 1RDRA 3J7AN 3AB2B 3PKYA 2M52A 3VTIA 4QYZJ 2RAQA 2EWHA 4DR4F 1RWNB 2EFNA 4IQMA 4YP3A 3BN4A 4J9KA 3E8OA 3V4MA 1WJ9A 3MM9A 1FEHA 2CJKA 1XTZA 4DV2F 2HS3A 4PABA 5CAAA 4OX9J 2XZWA 3T5KA 3CW2C 5IQQA 1PJ6A 4DU8A 4WE1B 2FY8A 3GP9A 2HHTA 2UVVA 1HQEB 4RW6A 2F63A 1NJXA 1U0HA 3ETMA 3GLJA 3O5TB 2E1PA 2EK6A 3EVOA 1FCAA 2HHHJ 4PQUA 3R5GA 2ERRA 2W9CA 1VHFA 4KHPJ 5ETNA 3G2XA 3VGUA 4ILMA 3PIPQ 2BVZA 4ZPBA 3W8PA 1TL3B 4CIOA 4LUBA 2EK1A 2I6WA 3O44A 2RSQA 5K8PA 5BYRA 3Q0AA 2UXBJ 1Y3KA 3IMQJ 1RYSA 1VBKA 4O44B 2QLBB 1LW0A 4A8SA 3NWGA 3A1YG 3MAAB 4NX9A 4WZMA 3HSGA 1H73A 4K59A 3VF0B 3OFGA 1Y5NB 3K58A 2MZJA 3OHBA 5ETLA 4X4OA 3NOGA 2LU2A 3FMBA 5HROB 1NRKA 2FGOA 4A8YA 5GVQA 4NLTA 5ADZA 1IBLJ 2FC8A 3MM8B 2B6AA 1SKRA 4ZVQB 1TU0B 2VFUA 2JLEA 3M2UB 2IJFA 2D7SA 1T03A 3L7UA 3R2DJ 4WIIA 4ZHRA 4C8OA 1W25A 1UAWA 3DRSA 2ZOGA 2FJXA 2B4UA 1N48A 2YWWA 3N28A 2EFVA 3QFWA 3QWUA 4N56A 2RNEA 4NLSA 1YZ6A 4ZCKA 4RUAA 5KG6A 1XK8A 1EZZB 5C7PA 3MR7A 5F9NA 3CO0P 4WXOA 2OPPA 4HTIA 2CZ9A 4GO7X 2G0JA 3MAQA 3V5RA 2CJ9A 2ZC4A 3CMES 3SQGB 3SV4A 3R5CA 1T3OA 3NCRA 4F8RA 3BS9A 1RTHA 4ZPDA 2V4QA 3I87A 1R8PA 3M4XA 4FYWB 3AOCA 3B8HA 1EQ0A 3HFKA 1FJCA 4EWTA 1VI7A 1FXLA 4X66F 4WFNQ 4FZVA 4LF2A 3C16A 4XK8C 1ACMB 3CB4A 2G2OA 3KFWX 2JHEA 2IIHA 4R0EA 2L48A 4CDIA 3RAXA 4K4VA 1V5IB 2DNHA 3CJKA 3PNIA 1S6PA 2M0GB 5KFGA 2ZH4A 1VQYA 1WSRA 3PO4A 4DR2F 2FVRA 2IMWP 2K06A 3BYPA 2PFDA 5H1SV 3J7YU 3H7HB 5J1EB 3IR5B 1CJKB 4RW4A 3JSYA 4WF9Q 3FFIB 1M0SA 3G82A 3OUYA 1SUQB 2V50A 3FSXA 1XQIA 2JH3A 1DJ0A 1VQOS 4ES3A 3D1OA 5E3PA 1G2EA 4H4OB 3SDEA 4CQ1A 1Y5IB 3KLHA 4HHUA 4LF1A 2NPIA 4NLUA 2R8IA 2IYIA 2X3DA 1RWOB 4FKXA 5C2GA 1BWVA 2H4YB 1F1BB 1NSPA 2QLJB 1VJQA 3MZIA 2BANA 3EZOA 5A8KB 3FCVA 2XG8A 1S6QB 3NAHA 3BH7B 2VD3A 3CD5A 2HVHA 3QFHA 3H5SA 3HVWA 3LTOA 4ED6A 2SXLA 1N33F 4OX6A 2HIYA 2WAQD 3ZZUA 2W2QP 3V6KA 1CC8A 1GMWD 1NBEB 1NCLA 2IAJA 3I31A 3PY8A 1CG2A 2R2RA 2J5AA 4O3PA 3CCQS 4K8RA 4M1KA 3GCWP 4LF5J 4L3KA 5J2NB 1SH2A 1W2IA 3TQ1A 4ZDNA 4LFAF 3DDNA 1SJFA 4DV5F 2HHXA 3MR3A 4DPUA 3EGNA 3Q22A 3QZ7A 3PX6A 2ZD1A 3CDWA 4WU3A 3D6TB 2J7UA 3JSRA 1HW8A 5H9EJ 3CJ0A 3GG0A 4G3IA 2FGCA 3MCMA 2ROGA 4AYBD 3UFCX 2ZZMA 3OSPA 1QAIA 5L8RC 3B4DA 4DN0A 5CZVA 4ED3A 3FRYA 4QJVA 2W2OP 2VQEF 4L75A 1U48A 4UUWA 1N5SA 3FEZA 4NOHA 3P8BB 4DV6J 1LEOA 1YBAA 3H20A 2VBYA 2LYVA 1FRKA 2QL7B 4M8LA 4J9MA 1YJUA 2CG4A 4WFAQ 2RQKA 1U1KA 1EARA 1VRTB 3TNVA 2BKNA 2W4CA 1O5JA 4C97A 3SFGA 1SL0A 1TR0A 4A4JA 5L1JA 5D6GA 4QIEA 2MLZA 1CQNA 4L76A 4JP8A 4B3TJ 3LOUA 4YR2A 1IR0A 2J0SD 1VQLS 1PBUA 2OELA 2QO3A 3PYEA 2V67A 3H0PA 2E1CA 1U49A 5KFNA 3O8WA 2R9LA 2R7VA 4OHYA 1LWEB 2ASLA 1FNOA 5EWFA 4B9VA 4DR7F 1RAOA 2AYMA 2MZ1A 3GYNA 3RYLA 1Q8IA 2CFXA 2AGQA 2CAJA 3CCUS 2GQ2A 1D9FA 4FBTA 3JYTB 2AEMA 3PFEA 1VC6A 2XLJA 1FTRA 3IBFB 3HK2A 4DFJA 1BWEA 2AF6A 5KFQA 5JVGQ 4W98A 3A3NB 3NAIA 2I9SA 1R43A 1GXLA 2OEMA 2OH2A 2HVIA 3S01A 5DM6Q 1B64A 5KFCA 4K0KJ 1HA1A 4ZVGA 2O67A 3PHEA 2YQ3A 3A4TA 1RA6A 2IBKA 4OZ1A 3W7BA 2HNZB 4LRFA 1CJUB 4Y34A 4IKAA 2QFJA 1U1NA 2HMIB 2DHSA 2RDDA 1S10A 1S6OA 4UY85 5HP1B 5FIIA 4JI7F 4MMOA 2LCWA 2DY9A 4CYUA 4NA1A 1NDCA 2MSSA 3CSKA 4RUCA 4L72B 3UR0A 2J9CA 2E7VA 3IAS9 1I51B 4DSEA 4CLPA 3HFVA 4Z7CA 2VPXB 4QW8A 3QAUA 3FEYB 2E9ZA 1X9MA 2AD9A 3ILOA 4QWEA 1ZTWA 1UKUA 2DCLA 3TA2A 2VUGA 2XWXA 5B0BA 3VAMA 4GO5X 2B8PA 3POTB 4DSKA 1BQNB 2Y0SD 3H2LA 3MM7B 5KAKA 1T9WA 2YY3A 3NGSA 1KQKA 3M8YA 1OIAA 2V2KA 4OZ0A 4FF3A 4USHA 1WHVA 1XMBA 2N82B 1FERA 5D4PA 2HYIB 4RX6A 1KQFB 3W5XA 3MR6A 2RUGA 4ECRA 4WE1A 4F3OA 1Q16B 3N5BA 4C8ZA 3HT0A 5J1NA 1DTTB 1BMQB 1EJ7L 3NEKA 1LW2B 4K4YA 5IS2A 4ZPAA 3NCQA 2N7YA 2DKOB 2GCFA 3MEEB 4YB6A 2KU7A 4O3NA 1RT7B 1X0FA 2NSCA 5C25B 1B7FA 1A7GE 1CSJA 5A6PA 1QUVA 2VKRA 4U67Q 3T9NA 1S7IA 2LMIA 2DHHA 4EUVA 1TL3A 4DR6F 3Q8PB 1U0SA 3H90A 3IA0A 2W9BB 2FY1A 2EC0A 3HLUA 2WW8A 3I55S 3BKTA 4O44A 4CO0A 4DR3J 1WG4A 3MAAA 4DQQA 4NLYA 1RHQB 1NHVA 1KNZA 2QA1A 2CYYA 2B7BB 1SV5B 3OL7A 4RNOA 4DF4A 2V63A 4OYWA 2HQGA 4LFCF 3M6WA 4ZP8A 4JI4F 3BZQA 1M1GA 3MM8A 3I5AA 4A8FA 5F41A 1FD8A 4TU7A 4NLDA 3BV8A 5AXKA 1URNA 3M2UA 5KFSA 1H2UX 2PFFB 3SFUA 2J0QD 4F2SA 2I5JB 1SB6A 1UEVA 5J1PA 4HYKA 1RQ0A 3VAHA 4JI5F 5ETVA 3MECB 1RWKB 1KRPA 1JLFA 3ZZOA 2A6OA 2VICA 4ETZA 3PHTA 4QCLA 4O4GB 1EX8A 3QWPA 6FDRA 1Q1KA 5DETA 1TV6B 1V5VA 2LQ9A 4M5NA 2M8HA 4BWJA 4J9LA 2I0XA 4DWIA 2DD8S 1S7HA 2G0CA 5ETTA 4KQZA 1OYDA 5I3PA 5E5NA 2OLWA 5CCMA 1JLAB 1SJRA 3DLLQ 1HI1A 3MOZA 4FPIA 4DUZJ 2IRYA 3BGFA 4R0JA 5EGYA 2XY7A 5CH7B 3OLAA 3P5TL 5LMUF 2FHMA 1J5OB 3DGPB 5HATA 3C14B 1M5OC 4ED1A 2IDLA 4GKJJ 1B0VA 1X4BA 1SQGA 4KO0B 5L1IA 4Y2AA 3SEOA 2BQRA 1N5QA 4DS4A 1HHTP 3KHRA 2BZ2A 3MOJB 2G0IA 1NK7A 1FHTA 1UFKA 1WC1A 2X1AA 3M8WA 1RACB 2VJUA 2H54B 3LUYA 5L46A 1RTIB 1B3TA 2M7SA 2V2QA 4CCHA 1PYOB 2MQ8A 3WZ0A 3OVAA 4CP5A 2R8GA 3GPAA 4FYXB 4KPYA 5J1EA 5CHCB 1CJKA 2GGPB 2KVIA 3FFIA 1SUQA 3HP6A 1KR4A 4ZIVA 1UW4A 2HWHA 4H4OA 2Y9HA 1L3UA 2YNIA 2KHDA 4FF4A 3UD3P 2K3KA 3IRXB 1LFPA 2GHWA 1MMLA 2MHEA 4NASA 2UUAF 4K4ZA 4NXNF 1MSWD 2I38A 8RUCA 2ZDOA 3QGPA 1C0TB 2LQ5A 1S6QA 2HGLA 4TKTA 1SQFA 3N6NA 2UXCF 3CCRS 3W9HA 2GHVC 4OYAA 4CLFA 2RDJA 1LQ9A 2E9RX 2JEFA 1X4GA 1Q86T 2GJFA 2W7OA 5H9FJ 2RD5C 1Y4ZB 2QTWA 4NLGA 4OI0A 4FNIA 4NEZA 3DHWC 3HHDA 4UW2A 4GKKF 4DV3J 2HHUA 4G6VB 5KFZA 5HQ8A 4CH0S 3OR2B 2F8HA 1TUGB 1U45A 3UN5A 3ZTPA 3IC1A 2WTFA 5DDPC 2P9GA 3JTPA 5F8MA 2V9WA 1W2BR 4KV8B 1JXVA 4BC7A 3TZWA 1FXDA 3C8YA 1JIHA 3DDKA 1GNKA 1XR6A 1TFWA 2D3O1 4O4RA 1OPIA 3K7RA 1KD1T 3OJUA 3M9OB 1UWBB 5B0EA 2LA4A 5B0DA 3G6XA 1ICEB 1GX5A 1SQEA 4OX7A 4ZVRB 3HVRA 1NU4A 1HHSA 3UDCA 2WSCC 3CJ8A 2OPSA 2E1MC 3MMBB 2AV5A 3ZC4A 3FZBA 3UE2A 3A8KA 4O23A 1VRTA 4JI8J 3NS6A 2XNRA 3CCJS 4ZS6A 1R8CA 4CNZA 1U1OA 3W3SA 2ZITA 1U6ZA 2WB1D 4ER8A 4MK9A 4M5GA 2HFZA 2MKJA 3DGVA 5LJ5Y 3D5MA 2QGFB 1S0VA 3RR8A 1YTYA 1XMOF 1UA1A 2OMOA 3HZEA 4DV1F 4QPXA 2V4RA 1LWEA 1VCTA 4LF8F 4WK3A 1RWVB 1YWXA 3JYTA 4JI6J 2XZTB 3K8VA 2UVWA 2FJAB 3DCAA 3VVUA 1MNEA 3LP1B 4OLOA 1NZAA 2LEAA 2QC3A 3TJ9A 5CZXA 4X84A 4EYIB 1T3NA 1VJWA 1REVB 1ZM2A 3RB3A 4PQAA 3GIMA 3ITHB 3TOQA 4LF6F 3B82A 2YNFB 5BR8J 4X62F 1RHJB 1U7LA 2XO7A 3W66A 1HNXF 1S48A 4I4BA 4RNNA 2YNHB 3HX9A 2HNZA 2KFYA 1CJUA 1M1KT 3FC9A 3Q8QB 2LQBA 4XDCA 1RHUB 2XQCA 2ZBIA 3IS9A 3MURP 3QIPB 3RAQA 4QIFA 2XNQA 4DFMA 3TUPA 4ZVEA 2KM8B 4KGVB 3ZO7A 1CS4B 3BGRB 3IR6B 4C6AA 3W65A 4USVA 2GVDB 4KE5A 4MH8A 3R7NB 3J81Y 5IC4B 4DL3A 1NMEB 4ZJLA 2E5GA 3MTJA 4FYVB 3POTA 4OZ3A 3MEKA 2XYGB 5KFOA 3N6MA 3ZXWA 3MM7A 4KYZA 1WKKA 2HLTA 2ZJPQ 1TQLA 4KC5A 4Q8EA 3EVWA 1WWHA 2OTLS 1JKHB 1HWUA 2DGQA 1QAYA 1QSYA 2JEJA 2GJIA 5F8IA 2PN6A 2GA7A 3H5XA 3I0RA 2FJEB 4PWDB 1DTTA 1YRXA 2MZRA 1NK4A 2OMLA 2AYEA 2H4WB 2HZAA 3MEEA 1TZ0A 4J90A 4TY9A 4QR0A 4QPTA 1RT7A 4ANCA 4RL1A 5KFBA 3H98A 3PW0A 5C25A 3BO3A 1OPZA 3K5PA 1XEZA 4QR1A 1NJWA 2FLNA 3EYZA 1VC5A 2ZBCA 1OWXA 4RW7B 2FVCA 3MEGB 3BDPA 2ROPA 2XI2A 3DHXA 5K8NA 2W9BA 4ZLNA 5DRKA 2YNGB 2MJNA 3T9ZA 1IKXB 2LVWA 1CJVA 2EG2A 2H5EA 4NMLA 4H4KC 2ZZTA 1RAGB 4HTJA 2UUCJ 1Q95G 3SQOP 1NHUA 2D9OA 3J80Y 1N34F 4R25A 2RQCA 2JOQA 3TJ8A 2RHSB 4C3LA 2YX4A 4DUYF 4M5DB 1I3OB 4RW8B 2MZSA 2OPQB 5B08A 5IT9Y 2ZVSA 1RHRB 3K5LA 1IBMJ 1WG1A 2LA6A 2JLGA 2AWZA 4YR3A 5IWAJ 2G4BA 1H7XA 1WI6A 5LL6d 1RHMB 5DGAA 4DSIA 2G1DA 2KH9A 4UOGA 3MECA 4I64A 4MJKA 2EBEA 3AD9C 5T14A 1H6KX 3THPA 4FF1A 2IYGA 2JVRA 4F50A 4CM2A 1J27A 5KG1A 1IWGA 1N56A 1P8GA 4LSNA 3GYXB 1HR0F 3UN2A 3I32A 4ZVFA 4GVBB 5K5MA 1UEKA 4F2RA 5AXLA 1JLAA 4DR4J 2DXFA 3M7VA 4JV0A 2HHQA 4LBIA 2ASJA 3BSAA 1RT6B 4WK1A 3MR5A 4C48A 1ZBTA 3EWGA 3P4UB 4DV2J 7FDRA 2CVEA 1AYEA 1J5OA 2C2OB 2J6TA 3DGPA 3C14A 2OD4A 3GIRA 1RB0A 4OZNA 2LQJA 1RZMA 4TQSA 4KO0A 1BD6A 4O3OA 4CLWA 4DL2A 2VBZA 3PR4A 4ECSA 1OY9A 1SJ4P 1WACA 2DITA 1X5SA 1KQSR 3M6XA 2P2CB 2NSBA 3QNWB 4L74A 2XMVA 3JTOA 1F5AA 2DNMA 2B9EA 2MKCA 1FFSB 3BEGB 3VQSA 4ZVHA 4PWUA 1ZZFA 1WKLA 3VR1A 2A6MA 3RGIA 1DHMA 1TKDA 1U24A 3KNGA 1R0CB 4P72A 2CQ3A 4H4MB 5B09A 4JI1J 4K5RA 3BREA 4B3MF 3PYFA 1YITS 3LWMA 4HL9A 3PYGA 1MN9A 2GGPA 3RRGA 2DYAA 4TY8B 5CYMA 3HHLD 2X51A 4NI2B 4C11B 3LAKA 1RAJA 1O6XA 3LANA 2JWNA 4YUDA 1PKUA 2W9AA 1Z2LA 3ET6B 2VFTA 1XN9A 9RUBA 3TA0A 3IRXA 1AUDA 1IKYB 3CDUA 2DR7A 2V8GA 4NRTA 2KFNA 1VQSA 4Q0BB 5KG4A 1OYEA 1S1VB 3FUYA 1C0TA 3R5AA 4UF4A 2QSWA 4J9UE 4UZBA 1VHIA 1YJ9S 4G1PA 5HMYA 1MN7A 2UUWA 2MMYA 3TX8A 2VBXA 5KT2A 1N0VC 2KJWA 2BR0A 5DGBA 4N5SA 3I0SB 5A8WA 1V6HA 2RS2A 3IGNA 4F0MA 4CO4A 2A0FB 1PIEA 4BCAA 4ILLA 5F8LA 2B7CB 2CDQA 4QR2A 3OR2A 3I4PA 2EKYA 1HWIA 1S5ZA 5LJ3Y 4ED8A 2JLFA 3C15B 2DR6A 3HZGA 1NZ8A 3VGSA 2KM8C 1N54B 5GAGI 4TYBA 5FLXY 4YY3F 1Q5YA 4KV8A 3LF0A 2YPYA 3GJSB 1SXLA 3RTVA 2QA2A 3DRPA 1LWXA 2RU3A 1Y00A 3VAGA 2DHGA 2DH9A 2ATLA 2V2ZA 4OYBA 3SCJE 1TL5A 4OFZA 4H54A 1FRIA 4BS2A 4X66J 2HFNA 4DLEA 3EGZA 2HK2A 2FLLA 4X4SA 1Y0HA 2AX1A 1QVFR 3ENWA 4P75A 3OT9A 4DPWA 5GAHU 2NCKL 2XHWA 2OIHA 2DH8A 3KK2B 3MMBA 3G8QA 4ID5B 1RCOB 2VZ9A 5DO2A 3FRZA 3V81B 3ISND 4ZLLA 4YDXA 4DR2J 4P7TA 2LEPA 3Q86A 4FXVA 2C3UA 3OQ2A 1EHWA 2QYCA 4PUOB 2MQLA 5AE3A 1JXLA 4E8UA 1KKHA 4HT5A 3G6YA 2JDJA 2HAIA 1T8EA 5K8OA 3MCNA 2AJ4A 2IVMA 1NUEA 3CJ4A 3RZAA 2IFXA 3QJLA 2XMMA 3ENAA 3MPUB 2BJ1A 4X2BA 2BJEA 1RISA 2KB2A 1M5SA 2H5IB 2VJVA 2ATCB 1U1QA 1TL4A 4ECTA 4FXWA 4KIAA 1X5PA 4DPOA 1D09B 1ZYQA 1KLMB 4RBTA 3AH6A 1GK8A 1PAUB 1S59A 3LP1A 3F56A 3K5OA 2YTCA 5K20B 3RBZA 4C9DA 5D0GA 1MU2B 3EZUA 4LQ3A 1N33J 1REVA 3W63A 3LW5C 2R7SA 3PW4A 4HACA 4LIWA 1NDLA 4UT4A 4X65F 2YNFA 1KLNA 3TYTA 1FF2A 5HVHA 2X1BA 5LSOA 4BBYA 3ENVA 4IDKB 2YNHA 2VF3A 2HQDA 1FKPA 1F9FA 1WHYA 4P2MA 1HWKA 4LFAJ 4ANDA 2RILA 2DJWA 2VASA 4FVCA 4QWBA 2CQGA 3OVBA 2D1CA 1LOUA 2AEJA 4I6YA 4GC6A 3QSIA 1CEZA 5D0HA 1BQMB 2JFDA 2HFUA 4CLLA 2HFOA 2E5IA 4OJHA 1GMWA 1FT8A 4XAKA 3PR5B 1VC0A 3LH2S 2VG5B 3LP2A 4EO6A 1CS4A 3BGRA 3OXLA 2GVDA 1P27B 2OPRB 1B7YB 1SI9A 2K1RB 2VQEJ 4LBHA 2WVCA 4GMKA 5K8MA 1ZPWX 2Z58B 4KBIA 3H4DA 4ZITA 2PE8A 3C6UA 4WKRA 2B9XA 4IFVB 2C2MB 3ZZRA 4FPRA 2GW8A 4QBUA 4EBDA 1YRTA 4TLQA 4CLYA 4HKQA 1JKHA 5L1KA 1AT1B 1HNWF 2HGMA 2BE7D 3D9BA 4DDFA 3MWBA 1RKJA 1CLFA 2FLOA 5IZHA 3BQ0A 2DGSA 4NLOA 2YWFA 4PWDA 5DM7Q 5EWEA 3BJYA 1TK5A 1DZ5A 1XNQJ 3DU5A 2RH3A 4C98A 4RW6B 3J81U 2KYZA 4ZCIA 2DISA 1NKBA 5T41A 4U9RA 2XM3A 4FDFA 2E5LF 2G1HA 2L9DA 4DR7J 4LRAA 4CH7A 2CPEA 3N9UC 2F9JA 3I4HX 1F9HA 4RW7A 2KL8A 2XMJA 3MUMP 4NEYA 3MEGA 4I68A 4EMDA 5ETOA 4NXMF 3JB9k 4DL5A 3HKWA 2YNGA 4PPDA 5GADU 4Z37A 3S1TA 2NYIA 3P45B 2BV3A 1RE1B 5KT4A 1WF1A 2DRBA 4LVOP 5K9FA 4DI6A 8ATCB 4DF8A 1U47A 3OTBA 3KK1B 2AU0A 1R7IA 1RABB 4F3MA 1B99A 2W2NP 4USIA 3PW5A 1Y3JA 4QQBA 1SC3B 2CPHA 3ISNC 1YVFA 4OZJA 4DX7A 4M5DA 1T11A 3OL9A 1YJTA 1F5BA 5K14B 2OPQA 4PG6A 3PM9A 4F0HA 2HRUA 4QIVA 4Q7AA 2C22A 4J9NA 9ATCB 1H74A 1Q82T 4JI7J 4CO1A 1H72C 1UMJA 4K4TA 1DTQB 2ZM6F 2ACYA 4TQRA 2M88A 2HWTA 3HJVA 2QX0A 2OUGA 3CJQA 3NBPB 3ILJA 1RCXB 1HL6A 3GCXP 5IM0A 4Y6IA 1X5TA 4ZP7A 2L41A 1QAXA 3T19A 1F60B 1H98A 1QE1B 2ZJRQ 1Y5LB 2RRAA 4JUZA 3CDBA 3J80U 1F0XA 4QYRA 4F3QA 1WF2A 3AQPA 1WEZA 2DVIA 1N88A 3GILA 2RS8A 1N5TA 2F3JA 1VMBA 4X64F 3EE3A 2XSJB 3TZXA 4JV1A 1S12A 3C6TA 5IT9U 2GX8A 4F4WA 3A13A 3GZ7A 3RJMB 1RT6A 2MZTA 2WBMA 1JLEB 3P5BP 3B4MA 3Q83A 2VBWA 2O5DA 2CPIA 4A8MP 4FF2A 3G86A 1Q8KA 3PG9A 2KRBA 2CQPA 5LMNF 2DNGA 1X7VA 1UVMA 2XB2D 2RKIB 5HANA 2VFSA 1I1GA 3C16B 5FJ4A 3L7PA 2MY7A 2ADCA 3M1VA 3I5BA 3OXGA 2C28A 1FRXA 4P7VA 4M5LA 3G9CA 1CQMA 3ILIA 4LF7J 3PEHA 3KDOA 1YDLA 2VPYB 4NA2A 2JEGA 5B7WA 1IM6A 2OEJA 3CJKB 3KNAA 4B9TA 2W8KA 1S6PB 2MLYA 4X4PA 4DR6J 4H4MA 2UU9F 5KOXA 1CPZA 4CWBA 1M5HA 2KTQA 3K5MA 1KBRA 2CQ4A 3M30B 3K5NA 2CG8A 4TY8A 4WFYA 3LP0A 2F9DA 1UVIA 2U2FA 3R3TA 3QGIA 1FRLA 4ZN1A 2C2RA 3DLEB 1G1XA 4NI2A 4C11A 2C3OA 1R8BA 4M5HA 4P6QA 3NKYA 1NSKL 2P5VA 3M6VA 1DQ9A 4NCGB 4U7UK 3ET6A 2IMOA 3HI9A 2QJ3A 2W2MP 4LFCJ 2UUBF 3D68A 2OTJS 4JI4J 4HI2A 1IKYA 2XLIA 3ELHA 2VPZB 2QMXA 2QRRA 4Q0BA 4M63A 1S1VA 1WC3A 5GMEA 1MLAA 2V8HA 3ZZPA 2BANB 1YI2S 4CLUA 3FQLA 1V3RA 3PXGa 5C2CA 3DYAA 3TRGA 1GTEA 4QOTA 4DJBA 2ADBA 4AFFA 4IUFA 4ZKAA 2CWXA 3I0SA 3TR5A 3PZPA 1RKIA 2XHCA 4DV7F 3O1LA 1D9AA 3M8PB 3U1LA 2IM0A 2AT1B 1G6BA 3NP5A 4O3SA 4DPTA 2MQOA 5IT0A 3VAIA 2XS5A 3C15A 4Z7YA 1PYSB 2MQPA 4MIWA 3K59A 2WSFC 1DRZA 3H2VE 4V19X 1OQ6A 1M5KC 4HHJA 5LMUJ 3RAMA 3SXLA 2YQ1A 3A8EA 2J0WA 3CMQA 3IWLA 3C3LA 4WJBA 4OQJA 3WC0A 2Y8WA 4LRDA 3MPVA 2HBYB 3M05A 3MD3A 2HQ3A 4JI3F 3OSNA 2ZBPA 3HKZD 1TVRB 2ZH6A 2V8PA 5D0RA 2B3TB 4ZVPB 4DS5A 4J9RA 4B9UA 3BGOP 1P1TA 2O3DA 4WU2A 2B43A 2ACMA 3BGLA 2CADA 4EYHB 3V81A 3AFGA 1RSCA 5BJRA 1WSVA 2HHPA 1HLWA 2NYHA 3D1HA 5FLXU 1K0TA 4LIRA 2W1BA 2WB4A 4WWSA 2BUNA 4K2XA 1VGYA 2V8VA 3M8QA 1NSQA 4NCAA 1Q0NA 2B4VA 2PI5A 3CCZA 2MKKA 2MLXA 5LXYA 1VQ7S 1FWKA 3K0JA 1FE0A 3N79A 1LNQA 3HVTA 1O51A 4XTTA 1YJRA 1NK8A 3HD1A 1YLXA 2Y1LB 3Q24A 1YZ7A 3TZYA 1TFYA 4OI2A 2UUAJ 1VDHA 4NXNJ 1KLMA 5JXSA 4M94A 4NE9C 3L95X 4DZ6A 2CKWA 2LKZA 5AT1B 4URQU 4EU0A 1RI7A 2UXCJ 2V94A 4ECQA 1MU2A 4MKBA 3NGDA 5J2QA 2QYGA 1HPZB 3G6VA 1RA7A 1WTBA 1UJ6A 4AQYF 1ULRA 2CPDA 4LF5F 1HIYA 4OX8A 4KKOB 4C8MA 3U02A 2YKNB 3OFFA 1RJJA 4GKKJ 3TANA 1ZAXA 1I6JA 1WDTA 4IDKA 1Y9OA 1DARA 2JL9A 1D8ZA 3A3PB 2V68A 4ICLB 5KG7A 4DSJA 1SC1B 4CT9A 3MMJA 4DOZA 4OHWA 3DLJA 2AJ2A 3HT3A 4PG7A 2GQQA 2RRNA 2Q43A 3EDRB 1X31C 1UPMB 4UZCA 5C5JA 3IBCB 1BQMA 3ULHA 4NZ7A 3NS5A 4P74A 2WOMB 4XIUA 2VG5A 4JYAF 1WHWA 2MY8A 3X3UA 1RT2B 4B02A 1NHKL 2HVDA 2OPRA 2FLPA 1HYSA 2YX7A 2K1RA 5T7LA 1WOSA 3J7A1 2BBEA 1FKAF 1YGYA 1SIZA 3GSDA 1LK7A 4NWBA 2R2SA 4QZVB 4MKVA 2C2DA 5HMZA 4IFVA 5KT3A 4U7UD 3SV3A 4WP3A 1Q53A 2XMWA 1E6YB 1ZOTA 5L9NA 2DPIA 2QLWA 2QT7A 3AD8C 4L6V3 3NGKA 1FKOB 3MMAA 4DXLA 1IKVA 2CPXA 4C2MA 3RBDA 4PXDA 1ZM3A 2KVQE 1XIQA 3FBFA 3G8TA 3WX4A 2BOPA 1XMOJ 3D4JA 3JAMY 2COLA 3W9JA 3UNGC 1R31A 4KPCA 3BSCA 4DV1J 1XNRF 4E0DA 2KO1A 1KVIA 4UOCA 4LF8J 1KFDA 1FJGF 1H2VZ 2J7KA 2XBPA 4O3RA 2PC6A 2P6TA 2V34A 2KG1A 2VV5A 1K73T 1YRUA 1QM9A 2YBVA 4QYZK
chains in the Genus database with same CATH topology
2XNRA 3CCJS 1RTHB 3VALA 2X1FA 5A6WA 2C42A 4ZS6A 1R8CA 2GIRA 3WDOA 3H5UA 2V8DA 3QMQA 5J2MB 1UL3A 4KT0C 4QIWD 1HNVB 2YH0A 4CNZA 1U1OA 5CD4H 2K7KA 3J7Z5 2AJ0A 3W3SA 2ZITA 1U6ZA 2WB1D 3OTCA 1FRHA 1J2VA 4B17A 4MK9A 3NNAA 1JLCB 2HFZA 5B0GA 5L39A 3T5HA 1K0VA 3QGHA 4ZMMA 4WCEQ 2MKJA 3DYAB 5HN0A 4DL6A 5KT5A 5HO4A 3NCPA 5LJ5Y 3D5MA 3PFOA 2LXIA 4RBUA 2YWKA 4W90B 1VQ5S 4DG1B 1WEXA 3H8YA 1TKZA 2BXJA 5C42A 1S0VA 3KK1A 3RR8A 1LWCB 4USJC 5GAGU 5JJBA 1YTYA 1XMOF 1SL1A 1F2GA 3E2EA 2P9EA 2HNDB 1UA1A 2OMOA 2LECA 2G9OA 1N4LA 1AW0A 3HZEA 5I4MA 4DV1F 4QPXA 1HBOB 1TKTA 5HBMA 2V4RA 3BO2A 1LWEA 2MQMA 5AE2A 1HD0A 5J2PA 2R8KA 2EG1A 4LF8F 2GIQA 1TK8A 2E1AA 2D3OR 5KG0A 4WK3A 2WBRA 3PVXA 3CJ5A 5K14A 2KRRA 4KAIA 1YWXA 3JYTA 3EGWB 3OBIA 1LKZA 4FS1A 5KG3A 1GT8A 3CEDA 3IFEA 3K8VA 2FJAB 2UVWA 3DCAA 2RF2A 1HD1A 2FUG9 2MQNA 1NH8A 1QY7A 4JI8F 5KFTA 1MNEA 2XY5A 3LP1B 4OLOA 1DTQA 1NZAA 2EFGA 2ABYA 2YWHA 4RWWA 2LEAA 3KHGA 4KJIA 3PIOQ 2HW3A 4HH1A 4NA3A 2UZAA 3VZIA 5HLFB 4U7CA 2VPWB 4Y00A 2FPHX 2N4DA 4X84A 5CZXA 4EYIB 1FRMA 3CMAS 4B3RF 1T3NA 2LLZA 1VJWA 1REVB 1ZM2A 3NBPA 1E6VB 3SZ2A 1HQEA 1RGVA 3M8SA 1YJWS 4PXCA 2LU1A 4RW4B 3RB3A 1N0UA 3UI3A 4PQAA 3GIMA 3QJJA 3OUYB 4DFPA 1M5PC 1OQ3A 3VAJA 3ITHB 4NYOA 2Z2MA 3TOQA 4LF6F 1JLFB 3B82A 2YNFB 2ZHBA 4X62F 1C4CA 1U7LA 3ZFVA 4A8OA 5DJBA 1EP4B 4K50A 1QE1A 2B51A 3M9MB 4ECZA 2XO7A 2ZH9A 4I2PB 2K3IA 4EBEA 1K8AT 3TVKA 1VK3A 2YKMA 1JLQB 2AP6A 2F1FA 1S48A 2YWGA 4I4BA 2O66A 3RRHA 1HNXF 3SDEB 3TI0A 3NNHA 4RNNA 3KLHB 2YNHB 4LF7F 3HX9A 1QUPA 2CQIA 4XO0A 2Z4PA 2R7UA 5EN1A 1O0PA 4ED2A 2BABA 1FE4A 4UUXA 2CQHA 4ID8A 2HNZA 2KFYA 1M1KT 3U7JA 4FNHA 1YHQS 2IA6A 1KOHA 4ECXA 4JI6F 2M5YA 2A2CA 4C8LA 3Q8QB 3DMJB 1AXQA 2XSJA 2LQBA 2CQ1A 1MROA 4XDCA 3T1HF 2WRMA 2XCAA 2KT5A 5FDLA 2ZBIA 2JVOA 1HBUB 3IS9A 4WYWA 1IKWB 3BB5A 4G1QB 1C0UB 1GAOA 2AW0A 1GX6A 3C46A 3MURP 3AJ1A 3TUZC 3QIPB 1JLEA 2BYCA 3RAQA 4C3KA 2AYBA 5L9XA 4CZCA 2XWYA 5CQGA 1VBYA 4GC7A 4QIFA 1KFSA 2XNQA 1BC6A 2RJZA 4N8OA 4DFMA 3VCDA 1Z2ZA 3G6ES 4ZVEA 1K9MT 3MPYA 1VQ9S 4M95A 3PJXA 1UP1A 3RU0A 1F5CA 2KM8B 1NK0A 1X0PA 1BLUA 2CPJA 2OP5A 4OHVA 3IR6B 3BGRB 4EZ6A 1Z1ZA 2B9WA 3UW1A 4KE5A 3OW2R 2IAJB 1C1BB 3AA9A 4I0WA 2M4MA 4K4XA 4MH8A 5A0YB 4LT6A 5BR8F 3J81Y 4Y3CA 5HROA 1JX4A 2W24A 3M8QB 4IO9Q 2RKIA 2VG6A 1BQXA 1ELOA 1SH3A 2HIQA 2OSRA 2Q79A 1T95A 3W2WA 4DL3A 4F4KA 2KHCA 3CD6S 3PRDA 4MYTA 2BDPA 1DURA 1X4FA 3ZZTA 1QTMA 3MCSA 2E5GA 3MTJA 1I94F 1S6UA 3HM9A 3DOKB 1C4AA 3POTA 5G4DA 3EXCX 3KLGB 2VG7B 3MEKA 2UP1A 4NYPA 5KFOA 3N6MA 2DCUB 2XY6A 4ELUA 1VRUA 2DTJA 3O6QA 3HVTB 3MM7A 2VOOA 3OTEA 2ZZNA 4LQ9A 4MYUA 1UVLA 4MIAA 3DC2A 5C24B 2OAUA 2Q6CA 1U26A 2HLTA 2ZJPQ 5KFUA 1TQLA 1YIJS 4RBVA 3ONQA 4TN2A 3RRKA 5DS7A 3PX4A 3KG1A 2FTRA 3HPOA 4KC5A 2GNKA 5LSRA 3CC2S 3LQVA 4Q8EA 2WSEC 4IOCQ 3HHNB 2ZD1B 1YQHA 3FEXB 1WWHA 1ZPVA 2BW2A 3G4SS 1N52B 2OTLS 2DBBA 2R7QA 1JKHB 1HWUA 2DGQA 3TVZA 2ZFHA 1QAYA 4ZPTR 1QSYA 1G3OA 2JEJA 1IUJA 4QU7A 2VA3A 4KGKA 2GJIA 1JJHA 2G13A 4NCBA 3MD1A 4J37A 5F8IA 2PN6A 2GA7A 3M30A 2DIVA 3H5XA 1XC9A 3I0RA 3MF5A 4AL5A 3L3CA 1UFLA 2P9CA 4DV4F 1ROFA 2FJEB 4PWDB 1DTTA 5J2QB 1APSA 1YRXA 2A10A 2MZRA 1NK4A 2KFZA 2OMLA 3M32A 4YB5A 2AYEA 4RNMA 3LGMA 3AJ2A 2QEXS 1N5YB 1XBWA 3DLEA 4OI3A 3Q23A 4DL4A 2IM3A 3DM2B 3D1QA 3MEEA 1TZ0A 4E98A 2I2YA 3CIMA 4BHQA 3E01A 4TY9A 4QR0A 5LSLA 5M2RA 4NCGA 4QPTA 1RT3A 1RT7A 1YJVA 4OI1A 4QU6A 3WC2A 3CCWA 2DGXA 3GE9A 5KFBA 4A8QA 4JI0F 3KK2A 3H98A 3PW0A 2YNIB 1S1WA 5C25A 3BO3A 1OPZA 3MUTP 5KTQA 4RW9B 5HMXA 4RNHA 3K5PA 1XEZA 4QR1A 1NJWA 4ID5A 4Y2MA 3GIKA 2FLNA 3GFZA 1CC7A 3EYZA 4Q2MA 1VBZA 3I6PA 3SQGA 1VC5A 3KLEA 5ITHA 5LXRA 2ZBCA 5KFPA 1OWXA 4RW7B 3MEDA 2UVRA 2HNYB 2Q1LA 4Y2IA 5F9LA 4N47A 2FVCA 3DI6A 1X4EA 3MEGB 3QO9B 3BDPA 2XULA 3VAFA 4WFZA 3OTOF 2ROPA 1HMVB 2XI2A 3GFYA 3DHXA 4RUHA 2R7WA 5K8NA 2W9BA 4ED7A 4PUOA 3T6JA 3BSNA 1LWFA 5DRKA 1N8RT 3MTKA 1IQTA 2YNGB 2D74B 3I5CA 2MJNA 3T9ZA 4C0BA 2MHNA 1IKXB 5DDQC 2LVWA 4DEZA 3MGJA 2QE5A 4IG3B 2QIFA 4DL7A 2D3ZA 1WTFA 2EG2A 4F67A 2H5EA 3DXBA 1O8BA 4NMLA 2JFKA 2EW9A 1D9DA 4H4KC 1T94A 2E5HA 4HTJA 3HDSA 3DLKB 2R2UA 4DSLA 4PG4A 2J8AA 5KFLA 3ETOA 2M8DB 2Q3PA 1CVJA 1NHUA 2FDNA 2D9OA 2WCXA 5D77A 2UV8G 2VB6A 5EDWA 1HI8A 2EBGA 1HYSB 1RT5A 2L08A 1URRA 3M8PA 3NG8A 3J80Y 1N34F 3UPFA 1JB0C 4R25A 2RQCA 2Q66A 1SJQA 2JOQA 5T7LB 2YWEA 4DFKA 2H9ZA 4C3LA 1X4CA 2YX4A 4DQIA 4DUYF 1FJ7A 4M5DB 5F0UA 1S9GA 1JNZB 1ZETA 1J5EF 3KHLA 3H4BA 3CC7S 4NLRA 1KONA 4RW8B 2MZSA 2OPQB 4QIGA 5B08A 4LF9F 2EVZA 5U47A 3X1LB 3OL8A 5IT9Y 4IG0A 1S0OA 4C8YA 2ZVSA 1MW7A 2MJUA 5G0RA 3TW0A 4UQGA 3PACA 3K5LA 1WG1A 2LA6A 3CTRA 2JLGA 3V6JA 2ZE2A 2ILYA 1D3WA 2AWZA 2PA3A 2C3MA 4DSFA 3QIDA 4YR3A 3CPWR 3KG4A 5DLGA 3P49B 3KKFA 2G4BA 5IFMA 5KFFA 1OS5A 1H7XA 1WI6A 5KT6A 4P2SA 5LL6d 5DGAA 3CC4S 1NKEA 2W4PA 2FVQA 1DLOB 1TL1B 1FDNA 5CXTA 2G1DA 2KH9A 4DSIA 5A2QY 5F3TA 2LDYA 4IR9A 3MECA 2IRUA 2V9KA 4GKJF 4I64A 4MJKA 2JEIA 2CQBA 2EBEA 3P3DA 4LF4F 1S76D 3IAM9 3PKMA 1XR5A 3MMAB 2UUCF 3AQOA 3SSRA 1QLNA 2DT9A 2N4CA 5T14A 1IKVB 4JV2A 1H6KX 3THPA 4TXSA 5L1LA 3VWSA 4FF1A 2IYGA 1L3TA 2JVRA 4IYQA 4F50A 2NR0A 1PC4A 1FRJA 4F26A 1N56A 5KG1A 3VZHA 2R7RA 3CE8A 1P8GA 4LSNA 3GYXB 1K1QA 3G96A 4EBCA 5MAOA 1TVRA 1HR0F 3MFIA 1HNZF 3DN9A 2A18A 3OR1B 3I32A 1JK9B 2KG0A 4ZVFA 3IN5A 4LSLA 3C66A 3THTA 1P1LA 2VC1A 5K5MA 4OI4A 4HVZA 1R3NA 4F25A 2C2EA 3GV5B 4NYZA 3UD4P 2OD6A 5A8KA 4F2RA 1FVSA 5AXLA 1JLAA 2ZH3A 3THVA 2V5HG 1H7WA 3CF5Q 5L38A 4QWCA 5KFKA 2OPSB 1IBMF 2M9KA 4JV0A 3R1HA 1Q4RA 5IT4A 2HHQA 2IRXA 3AA8A 3CCLS 2ASJA 3OPKA 3BSAA 5IWAF 5D4NA 2Y1IA 3V4IA 1RT6B 1FK9B 3CIZA 4WK1A 3BGUA 5AXNA 3MR5A 4B9MA 1LXJA 1ZBTA 3M2RB 1R8AA 1IJEB 2CJAA 7FDRA 2A3JA 2CVEA 4PPZA 1J5OA 2PIIA 1X5OA 2MYFA 1N5VA 2KT3A 4C8NA 3DGPA 2J6TA 1XERA 4OI6A 5E33A 4RU2A 2MB0B 1M90T 2OD4A 1S4FA 1HFEL 2KI2A 1H0HB 2X1GA 2UV8A 1FO1A 2DIUA 5B0FA 1DAXA 1ZM9A 2YKAA 4OZNA 1RDRA 2LQJA 2MKSA 4TQSA 2VODA 4KO0A 4I7FA 4X4QA 1NJIT 4K4UA 3AB2B 3DOMA 1L3SA 2FJBB 1BD6A 4O3OA 1RTDB 4DL2A 2VBZA 3PR4A 5J2NA 3T1YF 4ECSA 2IM2A 1WACA 3DRXA 4ZP6A 1SJ4P 2DITA 3PKYA 1X5SA 1KQSR 3M6XA 2M52A 4L3NA 2NSBA 4R5PB 4D3HA 3VTIA 3D54A 1VS3A 2XMVA 1KQGB 1ZH5A 6FD1A 3JTOA 1F5AA 2DNMA 2MKCA 4OV1A 3BEGB 2YVSA 1V3SA 3VQSA 4MAKA 4QYZJ 4ZVHA 4PWUA 1ZZFA 2F8EX 4DR1F 2EWHA 3DLGB 1HBMA 3VR1A 1DHMA 4DR4F 1TKDA 2EFNA 4YP3A 4IQMA 1Q8BA 2ZUGA 4IQXA 1U24A 3BN4A 4J9KA 3E8OA 3V4MA 3M2VB 3KNGA 2WONB 3W2VA 2CQ3A 3MM9A 1FEHA 2CJKA 1LXNA 3KLIA 2EI5A 3DOLA 4H4MB 1FESA 1XTZA 2BQUA 4DV2F 2HS3A 5B09A 1P9QC 5EX3A 2U1AA 2W7AA 2Q6BA 4K5RA 2XZWA 4CO3A 3OHAA 3BREA 4B3MF 1YITS 3T5KA 3LWMA 5IQQA 2OFHX 4HL9A 4WE1B 3HMJG 1NEEA 1HPZA 3RB0A 1D1UA 2GGPA 2VQFF 3RRGA 1HWJA 4TY8B 1TAUA 2LDIA 2M2BA 2HHTA 2UVVA 1JJ4A 1HQEB 4RW6A 2ZH2A 2DR9A 5CYMA 3HHLD 4KKOA 2IBOA 2B4OA 2X51A 1NJXA 3QLHB 2C3YA 4C11B 2F4VF 3LAKA 2YKNA 3O5TB 3QGGA 3PJWA 1RAJA 4WTYA 1RT1B 2EK6A 5CYJA 3UCZP 1B0PA 1FCAA 4G1IA 1DFDA 3LANA 2JWNA 4YUDA 1IM4A 4X4TA 3MFHA 2W9AA 4ICLA 1Z2LA 2VFTA 2Z8QA 1XN9A 2ZNZA 5F0WA 4PQUA 4KGMA 3PW7A 3TA0A 1ZM4A 3IRXA 4O3QA 2ERRA 1AUDA 2KN4A 2AJ1A 4YB1P