3LGOA

Structure of gse1p, member of the gse/ego complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
140
Chain Sequence
LHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNSVNNLKMMSLLIKDKWSEDENDTHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural conservation of components in the amino acid sensing branch of the TOR pathway in yeast and mammals.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein SLM4
total genus 26
structure length 140
sequence length 155
ec nomenclature
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3lgoA01
3NECA 3MS6A 4ESPA 1FIKA 1PNEA 1AWIA 2VK3A 4FUWA 3T1SA 1CF0A 1HLUP 3L7HA 3LEQA 1F2KA 4X1LA 5FEFA 2ACGA 1PRQA 1VEUA 3L9KA 4QWOA 3CPTB 3NULA 5EM0A 4FTXA 2JKGA 3U4LP 1CQAA 4X1MA 1Z09A 2V8CA 4X25A 1VETB 2ZL1B 1G5UA 1K0KA 2ZL1A 3T1RA 3T1XA 3KYEA 1SKOB 1ACFA 1VETA 2BTFP 3T1QB 5FEGA 3T12B 3UB5P 1VEUB 2HZ5A 2V8FA 2PAVP 3CPTA 1J3WA 1CJFA 1Y4OA 1YPRA 2PRFA 2JKFA 3D9YA 3DAVA 1PFLA 1D1JA 1SZVA 3LGOA 3MSHA 5FDSA 5EM1A 2B95A 3CHWP 1A0KA 5EV0A 1FILA 4D60A 1SKOA 2PBDP 5EVEA 2E8JA
chains in the Genus database with same CATH superfamily
3HJKA 3VMAA 1DY6A 4KZ4A 1T1BA 3V3RA 3CZDA 3MKEA 4JF5A 4I3JA 4Y17A 1MPLA 3OZHA 2Z2MB 5FQIA 5HWVA 3OPPA 4X68A 3Q7VB 2A49A 3IF6C 4EQIA 4OQGA 2PD7A 1GHPA 4OLDA 1VEUA 2OOLA 3QP8A 4HBTA 4WELA 5CX7A 1P9WA 4MLLA 3B33A 3BJNA 1W8QA 1FCNA 3OPLA 3KSIA 1MWSA 5DVAA 1EI5A 1XX2A 4GOGA 1PFLA 3ZG9B 5F1GA 1GA0A 3BEBA 2ZQAA 3HREA 3V39A 5CEBA 2ZC7A 4H8RA 5FAOA 4KG2A 3UE6A 2W3DA 4GZBA 2V1AA 3KSGA 4I38A 1GSVA 5EE8A 5M19A 1FR6A 3F1OB 2KLIA 2FFFB 1JWPA 5FQMA 4ESPA 1CEGA 2GDNA 5EPHA 3V5MA 1GSWA 1P97A 1WYCA 3CITA 4WL9A 1E3UA 1G5UA 5FSRA 2NUTC 2O99A 3EEHA 3GMWA 4JF4A 3GTCA 4L9GA 4MNRA 1BLHA 3LIDA 1TEMA 3B47A 2QJ7A 3W8KA 4K91A 2V1BA 5DFYA 2VGLS 3E4PA 2KX6A 2ZQ7A 1X0OA 1ES2A 3FV7A 2L1MA 1MZUA 3UDIA 5FL3A 4WMCA 4G3VA 4WZ5C 4OH0A 1C3BA 3M2KA 1U60A 4QY5A 4GCZA 5EM1A 5EV0A 3ZQ5A 4FSFA 2UV0E 4KENB 4MN6A 2P04A 5AQ9A 2JHEA 4CQHA 4DF6A 3EQVA 5HARA 1PZPA 1CQAA 1ERMA 1DP6A 4FH4A 5HFOA 2OWJA 4C6YA 4MBHA 2XF3A 4PM5A 2RCXA 1XFQA 4DDSA 4Y0TA 3NJAA 2Y2IA 2HP9A 3SS3A 3CPTB 2JKTM 5AQAA 4AFIA 2Q0OA 4O7DA 1FCOA 2V9AA 2WAEA 1KGFA 2XD5A 4Z1WA 3HUMA 4P6ZM 3F1PA 3LY3A 1SKOA 1MKMA 3NI9A 3S7NA 2VV8A 2H0TA 5CGSA 3HJIA 3ZNYA 3UE3A 4GLQA 1VETA 2Y2PA 4KUKA 4BENA 4R23A 4LGWA 1QMFA 2JKFA 1WYBA 1GHIA 4DE3A 4ZDXA 2B5RA 4GHIB 4GB7A 3HVFA 1OJGA 4GDNA 1JNUA 1YKDA 4LV2A 3IH8A 5HWTA 3IF6A 1XA1A 1E3UD 3HLFA 4N1HA 1GSXA 3WWXA 1ZG4A 5HX9A 1LL8A 4JLFA 1G28A 3IWOA 1XGJA 3A3EA 2ZQ8A 4LRZE 3N8SA 1H0MA 2VX8A 3O88A 4PM9A 3VP1A 1H8ZA 3N7WA 1IOUA 2XA7S 1XJ3A 3F1NB 2R78A 1OT6A 3UPNA 5CGWA 1OTDA 4WLAA 2ZC6B 4C75A 4I3AA 1H8YA 3GQZA 3MSHA 3GECA 3HLGA 2PT7A 3SH7A 1H3QA 4MN7A 1BLCA 2P74A 1LL5A 4QU3A 3NC8A 1HZOA 2W0NA 2J8YA 4LCMA 2R9WA 2V2FF 1MWRA 3QP4A 5HPFA 2X02A 3IWIA 4JGPA 2ZMAA 4NG2A 2XEPA 5D3OA 4NXEA 2O9BA 1SDEA 2OAQ1 4PM7A 4KQDA 2RL3A 4PM8A 2WKHA 2A24B 4Y3IA 4EERA 5GHZA 1MKIA 4NXFA 3IT9A 2CMNA 3NHQA 3N8RA 5A92A 1FIKA 3LICA 1F2KA 4QWOA 1K38A 3K3DA 1V9YA 1S1YA 3MF0A 4UA7A 2EWVA 5DKLA 3V67A 5IHVA 2PU2A 3ULFA 1PWGA 1LI0A 3C5AA 5HZHA 3DWKA 4LRYC 4NETA 4EWFA 5F6AA 4ID4A 4X1MA 4IHQA 1ONHA 5MC7A 3MR0A 5EOEA 4R70A 3U2AA 3E2KA 1NRFA 4GHIA 1KGGA 3B3XA 3ZG0A 2VKSA 4NKPA 4FUWA 4BLMA 1WE4A 2HDRA 4JBFA 2B02A 3FPWA 4FTXA 3Q82A 1N9OA 4E6WA 1LSWA 4FCFA 3ICYA 3WS5A 4OQ0A 4ZAMA 1KVLA 2DCFA 2W1RA 3IX8A 2EFXA 3UB7A 3VP3A 4OOLA 1V9ZA 2VK3A 1T19A 4DDYA 5IU1A 3UMEA 4KZ6A 2CC1A 3IF5A 2QHKA 3EQUA 2Y2OA 4GW9A 3ZGAB 1G68A 5G4ZA 3HLCA 1ZG6A 1P0ZA 3O87A 3IXBA 1ALQA 2G2WA 3GV9A 4R3AA 2BLSA 5L10A 4WN5A 4Y7PA 3JYIA 1DJAA 1LSXA 3WS0A 2J3TD 5AVFA 2VLGA 2HDQA 4X56A 3UMDA 3TW8A 3EGXC 5CHUA 4E3LA 4PAUA 3RTYA 5G4YA 2ACGA 3F1OA 3L9KA 4E3NA 3U4LP 1IYOA 2BTFP 3BRMA 2Q9MA 4OPQA 3CPTA 2P9VB 3PAEA 1CI8A 2W3HA 4OOMA 2PBDP 1TDGA 4KZ7A 3DWZA 1LT0A 2IA2A 2Z6DA 5C5KA 4EW7A 4G3KA 3TOIA 3LI9A 2KOIA 4UQIM 2GZAA 3P01A 3LIFA 5F82A 2ZQ9A 1IEMA 4JF6A 4CLCB 2QPNA 5EVEA 4O01A 2J7VA 1XA7A 4QJGA 4ZJ3A 5IT5A 2M7UA 4X69A 5E2GA 1YQSA 4HI4A 2ZQCA 4ZRRA 1K25A 3OC2A 3UE1A 5F5YA 2HP5A 2XFTA 5EM0A 2HV1A 4GNUA 1NY0A 1Z6FA 2D01A 3LIAA 1UWPX 1S6RA 4EV4A 3UB5P 1N4OA 1TS0A 5FATA 1K57C 3R4KA 2J9PA 5L8MA 5J7EA 1E25A 5GL9A 3H7WB 4DKIA 2Q9NA 3FPVA 1ZHHB 1NXYA 2HJEA 3G30A 1Y54A 1MY8A 3DW0A 3QP6A 4MDZA 4OP8A 1HTZA 1KDSA 1ESIA 3MXSA 4H6JA 2XROA 5HAPA 1ODVA 4IBRA 2Y2GA 5A93A 3C38A 4RYEA 5HAIA 1FR1A 2QWSA 4HY8A 4X55A 4N1XA 1IYQA 3N6IA 1FSYA 2Y55A 3T50A 3R7WB 4LFUA 3BFCA 4NEED 3IXHA 1I5QA 3UY6A 3IXGA 2WZXA 2PD8A 5HDCA 4B4ZA 2E8JA 2FFYA 1H5XA 2WGIA 4P0MA 1EW0A 4HHDA 4N92A 4OQIA 2ZOHA 3LI8A 4MBFA 5GHXA 1WA9A 3G6OA 2ZL1B 2JBFA 2XDMA 3IXDA 3A3JA 4EUZA 4EBPA 5I94A 2V8FA 4KQQA 4HJ4A 4UHUA 3LGOA 2QKPA 4IEDA 2PBYA 3WS2A 5E2FA 4ARZA 3BLMA 3MQQA 3QNBA 5DTTA 4DXCA 2WKEA 4PMAA 5U47A 3W2ZA 1ACFA 2LB5A 4L9FA 2Y2MA 3ITBA 1L0DA 5HWWA 3OCLA 3RFBA 3LO7A 1I2SA 4E3MA 3FKWA 2ZJ9A 4U0XA 3H82B 2V1ZA 3K3CA 4S2JA 5GLDA 1K55A 1D06A 1L0FA 1KE3A 3HL9A 4DJ2A 3OPHA 4PHTA 3SH9A 2W3GA 3LIBA 1K4FA 3CHWP 4K0XA 1K4EA 2GX5A 4XUZA 1T1CA 2O9AA 1K57A 1XP4A 3DTKA 1MC0A 3PBQA 3A0RA 4LPZA 3LR3A 3DAVA 3FKVA 2VEAA 2LB9A 2E8IA 2WGWA 4XUXA 2VGKA 3UPPA 1A0KA 3MBZA 2ZC4B 4NXGA 1E4DA 4MEZA 3ZG8B 5KZHA 5IS1A 3A3DA 4EUVA 1IYSA 4O8GA 1BT5A 1DJCA 1K54C 3VOLA 2JE5A 5A91A 2Y59A 3M6HA 3WRZA 3UDXA 5EVIA 3KSHA 5HL1A 4JGRA 4DN0A 4WYYA 4HQAA 3FYZA 1IKIA 1TVFA 2OSUA 1PW1A 2ZC3B 4GN2A 4P6ZS 4DE1A 3V50A 3P7NA 5FEGA 3BYDA 3T12B 2L4RA 4Q0HA 4IUHA 3I7JA 2Y2HA 3HLEA 4HH3A 4KG6A 4JPMA 5EFWA 3CAXA 4KG5A 5EVID 1W5DA 2JKGA 2EX2A 3WRTA 2K2NA 4FOFA 5K5BA 2PYRA 2XQZA 3CUEA 1PW8A 3IWQA 2JKRI 3EWKA 3OLOA 5KMWA 2H28A 2OAP1 3HLWA 1K56A 5CEDA 5TBMA 4DJ3A 2JN7A 5JYOA 4PM6A 1UGUA 2A2LA 3UB9A 2HGVA 3E98A 2WKIA 5GLCA 1S1ZA 2HJ9C 2GNXA 3LR0A 1ZC2A 1F98A 5CRFA 4C3QA 1KE4A 5J8XA 1K56D 4U3TA 5M1AA 3W4QA 5HDDA 4P6BA 4HP4A 4IUKA 4GD6A 3QP5A 4CLCE 4DRTA 5DF9A 5HL6A 4GKUA 3IX4A 2XA7M 3D3OA 1BTLA 1KOUA 4RX3A 2I9VA 2Y2KA 1YM1A 4E3OA 5E43A 3NY4A 4RQ9A 3T4OA 1K55C 1VQQA 1XXMA 3GSGA 4QPRA 4OKPA 3ZFZA 4ZTKA 4EXOA 1L2SA 4OOYA 2VJWA 1YT4A 4GS9A 4E3JA 3MKFA 3NDEA 2R9XA 2Z2LB 3VSKA 4WUJA 4R0QA 3ZG5A 4FD8A 5HD5A 2PRFA 1Y4OA 3C7UA 3HUNA 1GHMA 1YLZA 1XKZA 3KYZA 3JPUA 2WGVA 3FZCA 4OP5A 1LI9A 1DRMA 2Y4AA 4S2KA 4XXRA 4KZ5A 3NOPC 4MMNA 3UPOA 4S2NA 4JXSA 3G34A 5FAPA 3BWLA 1TDLA 1RP5A 2WADA 5KSCA 1J3WA 3MFDA 4EETB 1QMEA 4PKYG 5GLBA 3CJMA 4IBXA 3ZNTA 1N9BA 3TE8A 1LL9A 1TS8A 1IKGA 3MJQA 3SS4A 2QMIA 3UE0A 1YMSA 1NLYA 3GR2A 3LFVA 4JGOA 3S7QA 1CEFA 2Z6CA 2HZ5A 1H8MA 1EWZA 2QJ5A 1Q2QA 3C7VA 4HP9A 1FILA 3IH9A 3M2JA 2BG1A 5CGXA 1XJ4A 1OJ5A 2J80A 3T4QA 4CLCC 5F1FA 5CECA 3VE3A 3PR6A 3H82A 2XD1A 4QD4A 1NJ4A 2M1CA 1CJFA 2ZMFA 3HLDA 4DMZA 3S7OA 3PBRA 1SDNA 3T4LA 3EEAA 4MN5A 5HAQA 4Y0UA 2XR0A 4HEFA 5DF7A 3IBJA 5CTNA 5TBMB 5DFXA 4WMCD 1OPXA 4XT2B 3TRCA 3IQAA 4S2PA 1HVBA 2ZC5B 3RXWA 4Z9QA 1LSVA 4BD1A 3LEZA 4YWZA 1EROA 4Y2FA 3DTIA 1HLUP 4WEJA 3C2WA 1VM1A 1VETB 2XGNA 1W63M 5G18A 4Y5FA 4K08A 2DMWA 1FOFA 2X01A 3P09A 4UEYA 3PXPA 3ZCZA 3T4JA 1TF1A 5L2FA 3SS5A 4Y15A 5CERA 3TG9A 4WM9A 1M6KA 5AJGA 3TJZC 4I5SA 1VHMA 4R4RA 3W4PA 2IWDA 3UNWA 3N8LA 3JVVA 4UA6A 3BECA 4RVAA 3AGDA 3DTMA 4IVIA 2Y8HA 4JGQA 2P7JA 3Q7VA 4S2OA 3LCEA 3NOTC 2OLVA 5JYPA 3G32A 4X53A 3IBRA 4B4XA 4LCLA 4QHCA 1TS7A 3VOYA 1FQGA 2VGLM 1PWCA 3UB6A 1YSPA 4ME4A 2I72A 2DRWA 4B88A 5FDHA 3SOIA 4KQOA 3QNCA 3CMZA 3PBSA 1JVJA 4F94A 2EA9A 3AGEA 2G7UA 4ZJ1A 4MCWA 3CWFA 3F1PB 3E2LA 3OBFA 1NLZA 4LV0A 1BULA 1CF0A 2VZWA 3O3VA 1XJ6A 4YNRA 4F3LA 2HP6A 3ZYTA 1S4SA 3C4OA 4P85A 4BD0A 3MXRA 3WS1A 4R6LA 3D4FA 1SZVA 5EVLA 5M18A 4S2IA 2EFUA 2IWBA 2WAFA 2VGJA 4BBUA 2ZMVA 3OCNA 1ZKJA 4K0WA 4IJGA 3BFEA 1CI9A 3S7PA 2MJ6A 4PKYA 5AVEA 1KGEA 4UAAA 3NDGA 4LLOB 1YAXA 1HD8A 3UDFA 2ZM8A 3S1YA 3IX3A 4LV3A 1NZUA 2L0WA 3E4QA 2VV6A 3H9WA 5FEFA 1PI4A 5FI2A 1LLBA 2PR5A 1W8YA 4PPRA 1S66L 4CJNA 4EU0A 5I5LA 1JWZA 5J3WA 3B42A 2NUPC 1IFQA 3A0SA 5TJJA 1SCWA 4QY6A 2OV5A 2QZ6A 3Q1FA 1L3LA 1PI5A 1TD5A 1CK3A 3VP0A 2A24A 1ONGA 1XGIA 3VSLA 1NYYA 3NOUC 4QB8A 1BUEA 1KVMA 2HDUA 5LBRA 1G6AA 2Y2LA 3BW6A 4NXBA 4GS9B 4E3KA 4JXWA 4KZBA 3VP2A 5CHJA 1XJ2A 3UB8A 3MMHA 3MQ0A 1S67L 3BQ8A 3T1XA 2ZOIA 1ESUA 3HCYA 2XK1A 2ZM2A 2HF6A 2HPBA 5CTMA 4DE2A 1BYWA 2PR6A 5FDSA 1G6OA 3MZDA 3Q7ZA 2Y91A 3RH8B 1RCJA 1UWNX 4UA9A 1KDWA 1YLTA 4U0TA 3VE4A 3WS4A 1W7FA 5HD3A 5L07A 2WK0A 4IVKA 2PU4A 1NWZA 3BLSA 5HW3A 3IF6B 4DE0A 3ISGA 4S2MA 4OPRA 4A5RA 1O07A 5FI7A 3N4IA 4L0LA 3EGDC 1AWIA 4BQMA 4F3LB 4WF0A 4N9KA 2J9OA 5FQQA 3KO6A 4GD8A 4JXGA 1GA9A 3KYEA 2EXBA 4D2OA 1OTAA 4EBNA 2J3WA 3D72A 1I2WA 1J9MA 3C4PA 4ETZA 1W79A 1YMXA 4L9EA 1JTGA 3NECA 3W4OA 4BBVA 1FSWA 1Q2PA 3ITAA 4R3JA 5CXWA 2JCHA 4EQ1A 3RJUA 3VFFA 4R4SA 4LV1A 4II7A 1JWVA 2EX8A 3IS2B 1DJBA 5F83A 1YPRA 4LRXC 3PAGA 4EEUA 4E3IA 1N9LA 4XT2A 1NYMA 5HDSA 3FC7A 4EEPA 5TR7A 4GDBA 1XPBA 2K7SA 4ZJ2A 1N9NA 2W3FA 3FG8A 2W3EA 1STZA 5TFQA 4YFMA 5DF8A 3ZVTA 1W63Q 2B95A 3OPRA 2FZ0A 2ZQDA 3Q81A 4M3KA 1PNEA 5DTSA 1YLPA 3ZHHA 4RA7A 5J4EA 2EXAA 3CUEC 1K6SA 3IHBA 1YLJA 1MXOA 3S4XA 4HJ6A 1YLYA 1IELA 1MWTA 2WUQA 2V20A 3DBAA 3MZFA 5HPIA 2KDKA 5L09A 4X6TA 3QHYA 4WEKA 3R7WA 2W1TA 4R38A 3BFFA 5A8BA 2D02A 2PAVP 4HJ3A 1L0GA 4OPYA 1OTBA 3UO9A 3BY9A 1BLSA 4FH2A 3MXQA 4CLCD 2XSSA 2EWWA 3BFDA 5GLAA 4HIAA 5KSHA 3G31A 1NZOA 1ZTUA 3QP1A 2BASA 2UWXA 3E0YA 4P87A 1ES4A 2VV7A 4X25A 2A3UA 3PBTA 3SZTA 4Y13A 4R1GA 4R3BA 2V0UA 3SH8A 1VEUB 2PHYA 3LUQA 3T4TA 4JKTA 3PYPA 4CLCA 3CG5A 1LHYA 3BY8A 3MFXA 2H10A 4BWIA 2H5SA 3GDIA 4KQRA 4KZ9A 1S4RA 1PIOA 4OONA 1K6RA 3PHYA 5E2EA 1K0KA 2ZL1A 1NRJA 4JXVA 2QYBA 4KZ3A 2K31A 3SW1A 3ZG7B 3JVUA 4KUOA 3E4OA 4ARZB 1GCEA 2IWCA 2XH9A 4Q0IA 3H7WA 1SKFA 1SHVA 2OLUA 4BL3A 4N9LA 5E2HA 5FQJA 5TGFA 4I39A 3KX0X 4E6XA 4KZ8A 3HLBA 3KYQA 5AQ7A 3PBNA 2O9CA 5FQKA 3MZEA 4YINA 3QP2A 3G4PA 3PTEA 1VB6A 2WZZA 5FQ9A 4X1LA 3MQOA 2Y79A 3GRJA 5HSQA 2ZD8A 2O0YA 5FI6A 3T1RA 5EOOA 3G2YA 4S2LA 1P9RA 5BOHA 4RX2A 3A0VA 2EX9A 2HDSA 3VP4A 1MWUA 3GVBA 5EUAA 2P9VA 3LR5A 4WZ4A 3BQAA 3C8CA 1RGYA 3V3SA 2EX6A 2WKRA 4YOFA 1Y28A 1YSQA 3LIEA 1ES3A 4KZAA 2C5WB 5EECA 4HBUA 3D9YA 5DKKA 3K2NA 4UQIS 3VV4A 2YKHA 2WGWB 1DP8A 4OLGA 4HOIA 3TSGA 3S22A 5CHMA 3P98A 2WKQA 1F9IA 3T4SA 3DTEA 2W1TB 4O0PA 3O5YA 3FWLA 1YLWA 4DXBA 5AQBA 2AVXA 2PDRA 3HUOA 1M40A 2WYXA 3ZVWA 1FCMA 1T18A 3G2ZA 3NULA 3VOZA 3T4KA 3AGFA 2J3TC 4M4XA 1O7EA 1BZAA 2W27A 3T1SA 2G2UA 3LEQA 4EBLA 2X71A 5FAQA 2DNSA 2C6WB 3LYXA 3T1QB 5DJUA 3IHAA 1D1JA 5F68A 3NIAA 4Y0OA 5KIZA 4HH2A 4I3IA 5DTKA 4H6JB 1OTIA 3M6BA 4BL2A 5GHYA 2PYPA 4BBTA 2Y2JA 3G35A 2V8CA 1PYYA 3BFGA 3NCKA 2XFSA 1SKOB 5FA7A 1ERQA 3C30A 1S0WA 4EESA 3NBLA 3RXXA 1BLPA 1PWDA 5EVIB 1AXBA 4OQHA 3MS6A 5A90A 3IS2A 4Q8IA 2OWHA 3VFHA 1L0EA 3KSFA 4CPKA 2B18A 1KE0A 3Q07A 3UN7A 1D7EA 1OT9A 2GJ3A 4HNBA 4ZBEA 3BM6A 3EOIA 2ZLYA 4D60A 4B9OA 1RGZA 1DP9A 1OMEA 1JTDA 1K54A 1BSGA 5EVIC 4WBGA 2ZM0A 3ZDJA 4NK3A 3LY4A 4GJ4A 3CI6A 2JKTI 3A3FA 4B93A 3F1NA 2INWA 5FASA 1F5MA 2XRNA 2ZBBA 3LR4A 2M7VA 2Y2QA 2XLNA 4OPZA 1IYPA 1PRQA 1OTEA 2H0YA 3PBOA 1Z09A 5F69A 4HESA 1XFNA 4G3WA 2JC7A 3HBRA 4E04A 2WKPA 4ETXA 1TS6A 2YKFA 2Y2NA 4MBKA 4S2NC 4WZ5A 1ES5A 3L7HA 4BMWA 4Q0JA 1T1AA 2V0WA 2JKRM 2P08A 2VA0A 3A3IA 4LENA 3O86A 3CLOA 4BJPA 1PZOA 4OVDA 3OOVA 2FH5A 1MBLA 5DJTA
chains in the Genus database with same CATH topology
3NECA 3MS6A 4ESPA 1FIKA 1PNEA 1AWIA 2VK3A 4FUWA 3T1SA 1CF0A 1HLUP 3L7HA 3LEQA 1F2KA 4X1LA 5FEFA 2ACGA 1PRQA 1VEUA 3L9KA 4QWOA 3CPTB 3NULA 5EM0A 4FTXA 2JKGA 3U4LP 1CQAA 4X1MA 1Z09A 2V8CA 4X25A 1VETB 2ZL1B 1G5UA 1K0KA 2ZL1A 3T1RA 3T1XA 3KYEA 1SKOB 1ACFA 1VETA 2BTFP 3T1QB 5FEGA 3T12B 3UB5P 1VEUB 2HZ5A 2V8FA 2PAVP 3CPTA 1J3WA 1CJFA 1Y4OA 1YPRA 2PRFA 2JKFA 3D9YA 3DAVA 1PFLA 1D1JA 1SZVA 3LGOA 3MSHA 5FDSA 5EM1A 2B95A 3CHWP 1A0KA 5EV0A 1FILA 4D60A 1SKOA 2PBDP 5EVEA 2E8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEC A;  3MS6 A;  4ESP A;  1FIK A;  1PNE A;  1AWI A;  2VK3 A;  4FUW A;  3T1S A;  1CF0 A;  1HLU P;  3L7H A;  3LEQ A;  1F2K A;  4X1L A;  5FEF A;  2ACG A;  1PRQ A;  1VEU A;  3L9K A;  4QWO A;  3CPT B;  3NUL A;  5EM0 A;  4FTX A;  2JKG A;  3U4L P;  1CQA A;  4X1M A;  1Z09 A;  2V8C A;  4X25 A;  1VET B;  2ZL1 B;  1G5U A;  1K0K A;  2ZL1 A;  3T1R A;  3T1X A;  3KYE A;  1SKO B;  1ACF A;  1VET A;  2BTF P;  3T1Q B;  5FEG A;  3T12 B;  3UB5 P;  1VEU B;  2HZ5 A;  2V8F A;  2PAV P;  3CPT A;  1J3W A;  1CJF A;  1Y4O A;  1YPR A;  2PRF A;  2JKF A;  3D9Y A;  3DAV A;  1PFL A;  1D1J A;  1SZV A;  3LGO A;  3MSH A;  5FDS A;  5EM1 A;  2B95 A;  3CHW P;  1A0K A;  5EV0 A;  1FIL A;  4D60 A;  1SKO A;  2PBD P;  5EVE A;  2E8J A; 
#chains in the Genus database with same CATH topology
 3HJK A;  3VMA A;  1DY6 A;  4KZ4 A;  1T1B A;  3V3R A;  3CZD A;  3MKE A;  4JF5 A;  4I3J A;  4Y17 A;  1MPL A;  3OZH A;  2Z2M B;  5FQI A;  5HWV A;  3OPP A;  4X68 A;  3Q7V B;  2A49 A;  3IF6 C;  4EQI A;  4OQG A;  2PD7 A;  1GHP A;  4OLD A;  1VEU A;  2OOL A;  3QP8 A;  4HBT A;  4WEL A;  5CX7 A;  1P9W A;  4MLL A;  3B33 A;  3BJN A;  1W8Q A;  1FCN A;  3OPL A;  3KSI A;  1MWS A;  5DVA A;  1EI5 A;  1XX2 A;  4GOG A;  1PFL A;  3ZG9 B;  5F1G A;  1GA0 A;  3BEB A;  2ZQA A;  3HRE A;  3V39 A;  5CEB A;  2ZC7 A;  4H8R A;  5FAO A;  4KG2 A;  3UE6 A;  2W3D A;  4GZB A;  2V1A A;  3KSG A;  4I38 A;  1GSV A;  5EE8 A;  5M19 A;  1FR6 A;  3F1O B;  2KLI A;  2FFF B;  1JWP A;  5FQM A;  4ESP A;  1CEG A;  2GDN A;  5EPH A;  3V5M A;  1GSW A;  1P97 A;  1WYC A;  3CIT A;  4WL9 A;  1E3U A;  1G5U A;  5FSR A;  2NUT C;  2O99 A;  3EEH A;  3GMW A;  4JF4 A;  3GTC A;  4L9G A;  4MNR A;  1BLH A;  3LID A;  1TEM A;  3B47 A;  2QJ7 A;  3W8K A;  4K91 A;  2V1B A;  5DFY A;  2VGL S;  3E4P A;  2KX6 A;  2ZQ7 A;  1X0O A;  1ES2 A;  3FV7 A;  2L1M A;  1MZU A;  3UDI A;  5FL3 A;  4WMC A;  4G3V A;  4WZ5 C;  4OH0 A;  1C3B A;  3M2K A;  1U60 A;  4QY5 A;  4GCZ A;  5EM1 A;  5EV0 A;  3ZQ5 A;  4FSF A;  2UV0 E;  4KEN B;  4MN6 A;  2P04 A;  5AQ9 A;  2JHE A;  4CQH A;  4DF6 A;  3EQV A;  5HAR A;  1PZP A;  1CQA A;  1ERM A;  1DP6 A;  4FH4 A;  5HFO A;  2OWJ A;  4C6Y A;  4MBH A;  2XF3 A;  4PM5 A;  2RCX A;  1XFQ A;  4DDS A;  4Y0T A;  3NJA A;  2Y2I A;  2HP9 A;  3SS3 A;  3CPT B;  2JKT M;  5AQA A;  4AFI A;  2Q0O A;  4O7D A;  1FCO A;  2V9A A;  2WAE A;  1KGF A;  2XD5 A;  4Z1W A;  3HUM A;  4P6Z M;  3F1P A;  3LY3 A;  1SKO A;  1MKM A;  3NI9 A;  3S7N A;  2VV8 A;  2H0T A;  5CGS A;  3HJI A;  3ZNY A;  3UE3 A;  4GLQ A;  1VET A;  2Y2P A;  4KUK A;  4BEN A;  4R23 A;  4LGW A;  1QMF A;  2JKF A;  1WYB A;  1GHI A;  4DE3 A;  4ZDX A;  2B5R A;  4GHI B;  4GB7 A;  3HVF A;  1OJG A;  4GDN A;  1JNU A;  1YKD A;  4LV2 A;  3IH8 A;  5HWT A;  3IF6 A;  1XA1 A;  1E3U D;  3HLF A;  4N1H A;  1GSX A;  3WWX A;  1ZG4 A;  5HX9 A;  1LL8 A;  4JLF A;  1G28 A;  3IWO A;  1XGJ A;  3A3E A;  2ZQ8 A;  4LRZ E;  3N8S A;  1H0M A;  2VX8 A;  3O88 A;  4PM9 A;  3VP1 A;  1H8Z A;  3N7W A;  1IOU A;  2XA7 S;  1XJ3 A;  3F1N B;  2R78 A;  1OT6 A;  3UPN A;  5CGW A;  1OTD A;  4WLA A;  2ZC6 B;  4C75 A;  4I3A A;  1H8Y A;  3GQZ A;  3MSH A;  3GEC A;  3HLG A;  2PT7 A;  3SH7 A;  1H3Q A;  4MN7 A;  1BLC A;  2P74 A;  1LL5 A;  4QU3 A;  3NC8 A;  1HZO A;  2W0N A;  2J8Y A;  4LCM A;  2R9W A;  2V2F F;  1MWR A;  3QP4 A;  5HPF A;  2X02 A;  3IWI A;  4JGP A;  2ZMA A;  4NG2 A;  2XEP A;  5D3O A;  4NXE A;  2O9B A;  1SDE A;  2OAQ 1;  4PM7 A;  4KQD A;  2RL3 A;  4PM8 A;  2WKH A;  2A24 B;  4Y3I A;  4EER A;  5GHZ A;  1MKI A;  4NXF A;  3IT9 A;  2CMN A;  3NHQ A;  3N8R A;  5A92 A;  1FIK A;  3LIC A;  1F2K A;  4QWO A;  1K38 A;  3K3D A;  1V9Y A;  1S1Y A;  3MF0 A;  4UA7 A;  2EWV A;  5DKL A;  3V67 A;  5IHV A;  2PU2 A;  3ULF A;  1PWG A;  1LI0 A;  3C5A A;  5HZH A;  3DWK A;  4LRY C;  4NET A;  4EWF A;  5F6A A;  4ID4 A;  4X1M A;  4IHQ A;  1ONH A;  5MC7 A;  3MR0 A;  5EOE A;  4R70 A;  3U2A A;  3E2K A;  1NRF A;  4GHI A;  1KGG A;  3B3X A;  3ZG0 A;  2VKS A;  4NKP A;  4FUW A;  4BLM A;  1WE4 A;  2HDR A;  4JBF A;  2B02 A;  3FPW A;  4FTX A;  3Q82 A;  1N9O A;  4E6W A;  1LSW A;  4FCF A;  3ICY A;  3WS5 A;  4OQ0 A;  4ZAM A;  1KVL A;  2DCF A;  2W1R A;  3IX8 A;  2EFX A;  3UB7 A;  3VP3 A;  4OOL A;  1V9Z A;  2VK3 A;  1T19 A;  4DDY A;  5IU1 A;  3UME A;  4KZ6 A;  2CC1 A;  3IF5 A;  2QHK A;  3EQU A;  2Y2O A;  4GW9 A;  3ZGA B;  1G68 A;  5G4Z A;  3HLC A;  1ZG6 A;  1P0Z A;  3O87 A;  3IXB A;  1ALQ A;  2G2W A;  3GV9 A;  4R3A A;  2BLS A;  5L10 A;  4WN5 A;  4Y7P A;  3JYI A;  1DJA A;  1LSX A;  3WS0 A;  2J3T D;  5AVF A;  2VLG A;  2HDQ A;  4X56 A;  3UMD A;  3TW8 A;  3EGX C;  5CHU A;  4E3L A;  4PAU A;  3RTY A;  5G4Y A;  2ACG A;  3F1O A;  3L9K A;  4E3N A;  3U4L P;  1IYO A;  2BTF P;  3BRM A;  2Q9M A;  4OPQ A;  3CPT A;  2P9V B;  3PAE A;  1CI8 A;  2W3H A;  4OOM A;  2PBD P;  1TDG A;  4KZ7 A;  3DWZ A;  1LT0 A;  2IA2 A;  2Z6D A;  5C5K A;  4EW7 A;  4G3K A;  3TOI A;  3LI9 A;  2KOI A;  4UQI M;  2GZA A;  3P01 A;  3LIF A;  5F82 A;  2ZQ9 A;  1IEM A;  4JF6 A;  4CLC B;  2QPN A;  5EVE A;  4O01 A;  2J7V A;  1XA7 A;  4QJG A;  4ZJ3 A;  5IT5 A;  2M7U A;  4X69 A;  5E2G A;  1YQS A;  4HI4 A;  2ZQC A;  4ZRR A;  1K25 A;  3OC2 A;  3UE1 A;  5F5Y A;  2HP5 A;  2XFT A;  5EM0 A;  2HV1 A;  4GNU A;  1NY0 A;  1Z6F A;  2D01 A;  3LIA A;  1UWP X;  1S6R A;  4EV4 A;  3UB5 P;  1N4O A;  1TS0 A;  5FAT A;  1K57 C;  3R4K A;  2J9P A;  5L8M A;  5J7E A;  1E25 A;  5GL9 A;  3H7W B;  4DKI A;  2Q9N A;  3FPV A;  1ZHH B;  1NXY A;  2HJE A;  3G30 A;  1Y54 A;  1MY8 A;  3DW0 A;  3QP6 A;  4MDZ A;  4OP8 A;  1HTZ A;  1KDS A;  1ESI A;  3MXS A;  4H6J A;  2XRO A;  5HAP A;  1ODV A;  4IBR A;  2Y2G A;  5A93 A;  3C38 A;  4RYE A;  5HAI A;  1FR1 A;  2QWS A;  4HY8 A;  4X55 A;  4N1X A;  1IYQ A;  3N6I A;  1FSY A;  2Y55 A;  3T50 A;  3R7W B;  4LFU A;  3BFC A;  4NEE D;  3IXH A;  1I5Q A;  3UY6 A;  3IXG A;  2WZX A;  2PD8 A;  5HDC A;  4B4Z A;  2E8J A;  2FFY A;  1H5X A;  2WGI A;  4P0M A;  1EW0 A;  4HHD A;  4N92 A;  4OQI A;  2ZOH A;  3LI8 A;  4MBF A;  5GHX A;  1WA9 A;  3G6O A;  2ZL1 B;  2JBF A;  2XDM A;  3IXD A;  3A3J A;  4EUZ A;  4EBP A;  5I94 A;  2V8F A;  4KQQ A;  4HJ4 A;  4UHU A;  3LGO A;  2QKP A;  4IED A;  2PBY A;  3WS2 A;  5E2F A;  4ARZ A;  3BLM A;  3MQQ A;  3QNB A;  5DTT A;  4DXC A;  2WKE A;  4PMA A;  5U47 A;  3W2Z A;  1ACF A;  2LB5 A;  4L9F A;  2Y2M A;  3ITB A;  1L0D A;  5HWW A;  3OCL A;  3RFB A;  3LO7 A;  1I2S A;  4E3M A;  3FKW A;  2ZJ9 A;  4U0X A;  3H82 B;  2V1Z A;  3K3C A;  4S2J A;  5GLD A;  1K55 A;  1D06 A;  1L0F A;  1KE3 A;  3HL9 A;  4DJ2 A;  3OPH A;  4PHT A;  3SH9 A;  2W3G A;  3LIB A;  1K4F A;  3CHW P;  4K0X A;  1K4E A;  2GX5 A;  4XUZ A;  1T1C A;  2O9A A;  1K57 A;  1XP4 A;  3DTK A;  1MC0 A;  3PBQ A;  3A0R A;  4LPZ A;  3LR3 A;  3DAV A;  3FKV A;  2VEA A;  2LB9 A;  2E8I A;  2WGW A;  4XUX A;  2VGK A;  3UPP A;  1A0K A;  3MBZ A;  2ZC4 B;  4NXG A;  1E4D A;  4MEZ A;  3ZG8 B;  5KZH A;  5IS1 A;  3A3D A;  4EUV A;  1IYS A;  4O8G A;  1BT5 A;  1DJC A;  1K54 C;  3VOL A;  2JE5 A;  5A91 A;  2Y59 A;  3M6H A;  3WRZ A;  3UDX A;  5EVI A;  3KSH A;  5HL1 A;  4JGR A;  4DN0 A;  4WYY A;  4HQA A;  3FYZ A;  1IKI A;  1TVF A;  2OSU A;  1PW1 A;  2ZC3 B;  4GN2 A;  4P6Z S;  4DE1 A;  3V50 A;  3P7N A;  5FEG A;  3BYD A;  3T12 B;  2L4R A;  4Q0H A;  4IUH A;  3I7J A;  2Y2H A;  3HLE A;  4HH3 A;  4KG6 A;  4JPM A;  5EFW A;  3CAX A;  4KG5 A;  5EVI D;  1W5D A;  2JKG A;  2EX2 A;  3WRT A;  2K2N A;  4FOF A;  5K5B A;  2PYR A;  2XQZ A;  3CUE A;  1PW8 A;  3IWQ A;  2JKR I;  3EWK A;  3OLO A;  5KMW A;  2H28 A;  2OAP 1;  3HLW A;  1K56 A;  5CED A;  5TBM A;  4DJ3 A;  2JN7 A;  5JYO A;  4PM6 A;  1UGU A;  2A2L A;  3UB9 A;  2HGV A;  3E98 A;  2WKI A;  5GLC A;  1S1Z A;  2HJ9 C;  2GNX A;  3LR0 A;  1ZC2 A;  1F98 A;  5CRF A;  4C3Q A;  1KE4 A;  5J8X A;  1K56 D;  4U3T A;  5M1A A;  3W4Q A;  5HDD A;  4P6B A;  4HP4 A;  4IUK A;  4GD6 A;  3QP5 A;  4CLC E;  4DRT A;  5DF9 A;  5HL6 A;  4GKU A;  3IX4 A;  2XA7 M;  3D3O A;  1BTL A;  1KOU A;  4RX3 A;  2I9V A;  2Y2K A;  1YM1 A;  4E3O A;  5E43 A;  3NY4 A;  4RQ9 A;  3T4O A;  1K55 C;  1VQQ A;  1XXM A;  3GSG A;  4QPR A;  4OKP A;  3ZFZ A;  4ZTK A;  4EXO A;  1L2S A;  4OOY A;  2VJW A;  1YT4 A;  4GS9 A;  4E3J A;  3MKF A;  3NDE A;  2R9X A;  2Z2L B;  3VSK A;  4WUJ A;  4R0Q A;  3ZG5 A;  4FD8 A;  5HD5 A;  2PRF A;  1Y4O A;  3C7U A;  3HUN A;  1GHM A;  1YLZ A;  1XKZ A;  3KYZ A;  3JPU A;  2WGV A;  3FZC A;  4OP5 A;  1LI9 A;  1DRM A;  2Y4A A;  4S2K A;  4XXR A;  4KZ5 A;  3NOP C;  4MMN A;  3UPO A;  4S2N A;  4JXS A;  3G34 A;  5FAP A;  3BWL A;  1TDL A;  1RP5 A;  2WAD A;  5KSC A;  1J3W A;  3MFD A;  4EET B;  1QME A;  4PKY G;  5GLB A;  3CJM A;  4IBX A;  3ZNT A;  1N9B A;  3TE8 A;  1LL9 A;  1TS8 A;  1IKG A;  3MJQ A;  3SS4 A;  2QMI A;  3UE0 A;  1YMS A;  1NLY A;  3GR2 A;  3LFV A;  4JGO A;  3S7Q A;  1CEF A;  2Z6C A;  2HZ5 A;  1H8M A;  1EWZ A;  2QJ5 A;  1Q2Q A;  3C7V A;  4HP9 A;  1FIL A;  3IH9 A;  3M2J A;  2BG1 A;  5CGX A;  1XJ4 A;  1OJ5 A;  2J80 A;  3T4Q A;  4CLC C;  5F1F A;  5CEC A;  3VE3 A;  3PR6 A;  3H82 A;  2XD1 A;  4QD4 A;  1NJ4 A;  2M1C A;  1CJF A;  2ZMF A;  3HLD A;  4DMZ A;  3S7O A;  3PBR A;  1SDN A;  3T4L A;  3EEA A;  4MN5 A;  5HAQ A;  4Y0U A;  2XR0 A;  4HEF A;  5DF7 A;  3IBJ A;  5CTN A;  5TBM B;  5DFX A;  4WMC D;  1OPX A;  4XT2 B;  3TRC A;  3IQA A;  4S2P A;  1HVB A;  2ZC5 B;  3RXW A;  4Z9Q A;  1LSV A;  4BD1 A;  3LEZ A;  4YWZ A;  1ERO A;  4Y2F A;  3DTI A;  1HLU P;  4WEJ A;  3C2W A;  1VM1 A;  1VET B;  2XGN A;  1W63 M;  5G18 A;  4Y5F A;  4K08 A;  2DMW A;  1FOF A;  2X01 A;  3P09 A;  4UEY A;  3PXP A;  3ZCZ A;  3T4J A;  1TF1 A;  5L2F A;  3SS5 A;  4Y15 A;  5CER A;  3TG9 A;  4WM9 A;  1M6K A;  5AJG A;  3TJZ C;  4I5S A;  1VHM A;  4R4R A;  3W4P A;  2IWD A;  3UNW A;  3N8L A;  3JVV A;  4UA6 A;  3BEC A;  4RVA A;  3AGD A;  3DTM A;  4IVI A;  2Y8H A;  4JGQ A;  2P7J A;  3Q7V A;  4S2O A;  3LCE A;  3NOT C;  2OLV A;  5JYP A;  3G32 A;  4X53 A;  3IBR A;  4B4X A;  4LCL A;  4QHC A;  1TS7 A;  3VOY A;  1FQG A;  2VGL M;  1PWC A;  3UB6 A;  1YSP A;  4ME4 A;  2I72 A;  2DRW A;  4B88 A;  5FDH A;  3SOI A;  4KQO A;  3QNC A;  3CMZ A;  3PBS A;  1JVJ A;  4F94 A;  2EA9 A;  3AGE A;  2G7U A;  4ZJ1 A;  4MCW A;  3CWF A;  3F1P B;  3E2L A;  3OBF A;  1NLZ A;  4LV0 A;  1BUL A;  1CF0 A;  2VZW A;  3O3V A;  1XJ6 A;  4YNR A;  4F3L A;  2HP6 A;  3ZYT A;  1S4S A;  3C4O A;  4P85 A;  4BD0 A;  3MXR A;  3WS1 A;  4R6L A;  3D4F A;  1SZV A;  5EVL A;  5M18 A;  4S2I A;  2EFU A;  2IWB A;  2WAF A;  2VGJ A;  4BBU A;  2ZMV A;  3OCN A;  1ZKJ A;  4K0W A;  4IJG A;  3BFE A;  1CI9 A;  3S7P A;  2MJ6 A;  4PKY A;  5AVE A;  1KGE A;  4UAA A;  3NDG A;  4LLO B;  1YAX A;  1HD8 A;  3UDF A;  2ZM8 A;  3S1Y A;  3IX3 A;  4LV3 A;  1NZU A;  2L0W A;  3E4Q A;  2VV6 A;  3H9W A;  5FEF A;  1PI4 A;  5FI2 A;  1LLB A;  2PR5 A;  1W8Y A;  4PPR A;  1S66 L;  4CJN A;  4EU0 A;  5I5L A;  1JWZ A;  5J3W A;  3B42 A;  2NUP C;  1IFQ A;  3A0S A;  5TJJ A;  1SCW A;  4QY6 A;  2OV5 A;  2QZ6 A;  3Q1F A;  1L3L A;  1PI5 A;  1TD5 A;  1CK3 A;  3VP0 A;  2A24 A;  1ONG A;  1XGI A;  3VSL A;  1NYY A;  3NOU C;  4QB8 A;  1BUE A;  1KVM A;  2HDU A;  5LBR A;  1G6A A;  2Y2L A;  3BW6 A;  4NXB A;  4GS9 B;  4E3K A;  4JXW A;  4KZB A;  3VP2 A;  5CHJ A;  1XJ2 A;  3UB8 A;  3MMH A;  3MQ0 A;  1S67 L;  3BQ8 A;  3T1X A;  2ZOI A;  1ESU A;  3HCY A;  2XK1 A;  2ZM2 A;  2HF6 A;  2HPB A;  5CTM A;  4DE2 A;  1BYW A;  2PR6 A;  5FDS A;  1G6O A;  3MZD A;  3Q7Z A;  2Y91 A;  3RH8 B;  1RCJ A;  1UWN X;  4UA9 A;  1KDW A;  1YLT A;  4U0T A;  3VE4 A;  3WS4 A;  1W7F A;  5HD3 A;  5L07 A;  2WK0 A;  4IVK A;  2PU4 A;  1NWZ A;  3BLS A;  5HW3 A;  3IF6 B;  4DE0 A;  3ISG A;  4S2M A;  4OPR A;  4A5R A;  1O07 A;  5FI7 A;  3N4I A;  4L0L A;  3EGD C;  1AWI A;  4BQM A;  4F3L B;  4WF0 A;  4N9K A;  2J9O A;  5FQQ A;  3KO6 A;  4GD8 A;  4JXG A;  1GA9 A;  3KYE A;  2EXB A;  4D2O A;  1OTA A;  4EBN A;  2J3W A;  3D72 A;  1I2W A;  1J9M A;  3C4P A;  4ETZ A;  1W79 A;  1YMX A;  4L9E A;  1JTG A;  3NEC A;  3W4O A;  4BBV A;  1FSW A;  1Q2P A;  3ITA A;  4R3J A;  5CXW A;  2JCH A;  4EQ1 A;  3RJU A;  3VFF A;  4R4S A;  4LV1 A;  4II7 A;  1JWV A;  2EX8 A;  3IS2 B;  1DJB A;  5F83 A;  1YPR A;  4LRX C;  3PAG A;  4EEU A;  4E3I A;  1N9L A;  4XT2 A;  1NYM A;  5HDS A;  3FC7 A;  4EEP A;  5TR7 A;  4GDB A;  1XPB A;  2K7S A;  4ZJ2 A;  1N9N A;  2W3F A;  3FG8 A;  2W3E A;  1STZ A;  5TFQ A;  4YFM A;  5DF8 A;  3ZVT A;  1W63 Q;  2B95 A;  3OPR A;  2FZ0 A;  2ZQD A;  3Q81 A;  4M3K A;  1PNE A;  5DTS A;  1YLP A;  3ZHH A;  4RA7 A;  5J4E A;  2EXA A;  3CUE C;  1K6S A;  3IHB A;  1YLJ A;  1MXO A;  3S4X A;  4HJ6 A;  1YLY A;  1IEL A;  1MWT A;  2WUQ A;  2V20 A;  3DBA A;  3MZF A;  5HPI A;  2KDK A;  5L09 A;  4X6T A;  3QHY A;  4WEK A;  3R7W A;  2W1T A;  4R38 A;  3BFF A;  5A8B A;  2D02 A;  2PAV P;  4HJ3 A;  1L0G A;  4OPY A;  1OTB A;  3UO9 A;  3BY9 A;  1BLS A;  4FH2 A;  3MXQ A;  4CLC D;  2XSS A;  2EWW A;  3BFD A;  5GLA A;  4HIA A;  5KSH A;  3G31 A;  1NZO A;  1ZTU A;  3QP1 A;  2BAS A;  2UWX A;  3E0Y A;  4P87 A;  1ES4 A;  2VV7 A;  4X25 A;  2A3U A;  3PBT A;  3SZT A;  4Y13 A;  4R1G A;  4R3B A;  2V0U A;  3SH8 A;  1VEU B;  2PHY A;  3LUQ A;  3T4T A;  4JKT A;  3PYP A;  4CLC A;  3CG5 A;  1LHY A;  3BY8 A;  3MFX A;  2H10 A;  4BWI A;  2H5S A;  3GDI A;  4KQR A;  4KZ9 A;  1S4R A;  1PIO A;  4OON A;  1K6R A;  3PHY A;  5E2E A;  1K0K A;  2ZL1 A;  1NRJ A;  4JXV A;  2QYB A;  4KZ3 A;  2K31 A;  3SW1 A;  3ZG7 B;  3JVU A;  4KUO A;  3E4O A;  4ARZ B;  1GCE A;  2IWC A;  2XH9 A;  4Q0I A;  3H7W A;  1SKF A;  1SHV A;  2OLU A;  4BL3 A;  4N9L A;  5E2H A;  5FQJ A;  5TGF A;  4I39 A;  3KX0 X;  4E6X A;  4KZ8 A;  3HLB A;  3KYQ A;  5AQ7 A;  3PBN A;  2O9C A;  5FQK A;  3MZE A;  4YIN A;  3QP2 A;  3G4P A;  3PTE A;  1VB6 A;  2WZZ A;  5FQ9 A;  4X1L A;  3MQO A;  2Y79 A;  3GRJ A;  5HSQ A;  2ZD8 A;  2O0Y A;  5FI6 A;  3T1R A;  5EOO A;  3G2Y A;  4S2L A;  1P9R A;  5BOH A;  4RX2 A;  3A0V A;  2EX9 A;  2HDS A;  3VP4 A;  1MWU A;  3GVB A;  5EUA A;  2P9V A;  3LR5 A;  4WZ4 A;  3BQA A;  3C8C A;  1RGY A;  3V3S A;  2EX6 A;  2WKR A;  4YOF A;  1Y28 A;  1YSQ A;  3LIE A;  1ES3 A;  4KZA A;  2C5W B;  5EEC A;  4HBU A;  3D9Y A;  5DKK A;  3K2N A;  4UQI S;  3VV4 A;  2YKH A;  2WGW B;  1DP8 A;  4OLG A;  4HOI A;  3TSG A;  3S22 A;  5CHM A;  3P98 A;  2WKQ A;  1F9I A;  3T4S A;  3DTE A;  2W1T B;  4O0P A;  3O5Y A;  3FWL A;  1YLW A;  4DXB A;  5AQB A;  2AVX A;  2PDR A;  3HUO A;  1M40 A;  2WYX A;  3ZVW A;  1FCM A;  1T18 A;  3G2Z A;  3NUL A;  3VOZ A;  3T4K A;  3AGF A;  2J3T C;  4M4X A;  1O7E A;  1BZA A;  2W27 A;  3T1S A;  2G2U A;  3LEQ A;  4EBL A;  2X71 A;  5FAQ A;  2DNS A;  2C6W B;  3LYX A;  3T1Q B;  5DJU A;  3IHA A;  1D1J A;  5F68 A;  3NIA A;  4Y0O A;  5KIZ A;  4HH2 A;  4I3I A;  5DTK A;  4H6J B;  1OTI A;  3M6B A;  4BL2 A;  5GHY A;  2PYP A;  4BBT A;  2Y2J A;  3G35 A;  2V8C A;  1PYY A;  3BFG A;  3NCK A;  2XFS A;  1SKO B;  5FA7 A;  1ERQ A;  3C30 A;  1S0W A;  4EES A;  3NBL A;  3RXX A;  1BLP A;  1PWD A;  5EVI B;  1AXB A;  4OQH A;  3MS6 A;  5A90 A;  3IS2 A;  4Q8I A;  2OWH A;  3VFH A;  1L0E A;  3KSF A;  4CPK A;  2B18 A;  1KE0 A;  3Q07 A;  3UN7 A;  1D7E A;  1OT9 A;  2GJ3 A;  4HNB A;  4ZBE A;  3BM6 A;  3EOI A;  2ZLY A;  4D60 A;  4B9O A;  1RGZ A;  1DP9 A;  1OME A;  1JTD A;  1K54 A;  1BSG A;  5EVI C;  4WBG A;  2ZM0 A;  3ZDJ A;  4NK3 A;  3LY4 A;  4GJ4 A;  3CI6 A;  2JKT I;  3A3F A;  4B93 A;  3F1N A;  2INW A;  5FAS A;  1F5M A;  2XRN A;  2ZBB A;  3LR4 A;  2M7V A;  2Y2Q A;  2XLN A;  4OPZ A;  1IYP A;  1PRQ A;  1OTE A;  2H0Y A;  3PBO A;  1Z09 A;  5F69 A;  4HES A;  1XFN A;  4G3W A;  2JC7 A;  3HBR A;  4E04 A;  2WKP A;  4ETX A;  1TS6 A;  2YKF A;  2Y2N A;  4MBK A;  4S2N C;  4WZ5 A;  1ES5 A;  3L7H A;  4BMW A;  4Q0J A;  1T1A A;  2V0W A;  2JKR M;  2P08 A;  2VA0 A;  3A3I A;  4LEN A;  3O86 A;  3CLO A;  4BJP A;  1PZO A;  4OVD A;  3OOV A;  2FH5 A;  1MBL A;  5DJT A; 
#chains in the Genus database with same CATH homology
 3NEC A;  3MS6 A;  4ESP A;  1FIK A;  1PNE A;  1AWI A;  2VK3 A;  4FUW A;  3T1S A;  1CF0 A;  1HLU P;  3L7H A;  3LEQ A;  1F2K A;  4X1L A;  5FEF A;  2ACG A;  1PRQ A;  1VEU A;  3L9K A;  4QWO A;  3CPT B;  3NUL A;  5EM0 A;  4FTX A;  2JKG A;  3U4L P;  1CQA A;  4X1M A;  1Z09 A;  2V8C A;  4X25 A;  1VET B;  2ZL1 B;  1G5U A;  1K0K A;  2ZL1 A;  3T1R A;  3T1X A;  3KYE A;  1SKO B;  1ACF A;  1VET A;  2BTF P;  3T1Q B;  5FEG A;  3T12 B;  3UB5 P;  1VEU B;  2HZ5 A;  2V8F A;  2PAV P;  3CPT A;  1J3W A;  1CJF A;  1Y4O A;  1YPR A;  2PRF A;  2JKF A;  3D9Y A;  3DAV A;  1PFL A;  1D1J A;  1SZV A;  3LGO A;  3MSH A;  5FDS A;  5EM1 A;  2B95 A;  3CHW P;  1A0K A;  5EV0 A;  1FIL A;  4D60 A;  1SKO A;  2PBD P;  5EVE A;  2E8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...