3LGOA

Structure of gse1p, member of the gse/ego complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
140
Chain Sequence
LHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNSVNNLKMMSLLIKDKWSEDENDTHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SLM4
publication title Structural conservation of components in the amino acid sensing branch of the TOR pathway in yeast and mammals.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 26
structure length 140
sequence length 155
ec nomenclature
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3lgoA01
1PRQA 2HZ5A 2JKGA 2ZL1A 1D1JA 3MSHA 5FDSA 1VEUA 1VETA 2JKFA 3CPTA 4X1LA 1J3WA 4FTXA 3U4LP 2ACGA 2PRFA 3NECA 1PNEA 3NULA 1FIKA 1G5UA 2E8JA 5EM0A 1SZVA 3L9KA 1Y4OA 3D9YA 4X1MA 2BTFP 1HLUP 5EV0A 2ZL1B 1CQAA 3LEQA 4FUWA 1K0KA 3T1QB 1CF0A 1ACFA 1VETB 1PFLA 3T1RA 3CPTB 3T1XA 1SKOA 2VK3A 1A0KA 3KYEA 1Z09A 4QWOA 5EM1A 3T12B 5FEFA 1AWIA 4X25A 2PAVP 1VEUB 1CJFA 3T1SA 2PBDP 3CHWP 1F2KA 1YPRA 3MS6A 4ESPA 4D60A 1FILA 3DAVA 2V8FA 3L7HA 2V8CA 5FEGA 5EVEA 3LGOA 1SKOB 2B95A 3UB5P
chains in the Genus database with same CATH superfamily
1PRQA 1NZUA 5HAQA 1IKGA 4R1GA 2VGKA 3LY4A 4U3TA 5FDSA 3BQAA 5L09A 3ZNYA 5L2FA 1PWDA 3G35A 5FAOA 4LV0A 1FSWA 3PHYA 1E3UA 4X1LA 4OLDA 1EROA 4GCZA 3U4LP 2JN7A 4S2MA 4HY8A 3W4OA 2O0YA 3SH7A 3UE6A 1WE4A 1SZVA 4R3BA 2XLNA 5TBMA 1GSXA 1MBLA 1E25A 4G3WA 3IF5A 5J4EA 2HJ9C 1HLUP 1YLYA 1BLCA 1L0EA 2QKPA 2P08A 3IX3A 4QD4A 3G6OA 3KSFA 3NC8A 5CGWA 1VETB 3PBSA 3H7WA 4NXFA 1T1CA 2PT7A 1OJGA 3BFDA 1K25A 1LL9A 2GX5A 1SKOA 2VK3A 3V3RA 1V9YA 3I7JA 3ZCZA 1IYOA 4S2NA 2AVXA 3T4SA 4NXEA 2XGNA 3VP2A 5HDSA 2YKHA 2WYXA 3OLOA 2EWWA 2DMWA 2HP9A 3LIDA 3GTCA 4ZAMA 1MKMA 4FCFA 2P04A 3FPWA 2Q0OA 4P87A 2ZMFA 4AFIA 1G28A 3FPVA 5GHXA 4YFMA 3RXWA 3P09A 2J3TD 4HBTA 4HJ6A 5C5KA 3WS0A 2VZWA 3MBZA 3O3VA 5F6AA 2ZL1A 3F1NB 2ZD8A 3B3XA 2Y2PA 1OT6A 2XFTA 2O9AA 1W79A 2GDNA 3IX8A 3CPTA 5FL3A 2QJ5A 5HARA 3DWZA 4Y5FA 4DF6A 1WYCA 5L8MA 1DJAA 4R4SA 3EGXC 3N4IA 2OLVA 2H0YA 4HH2A 4XT2B 4EQ1A 2W1TA 2EA9A 2L1MA 2G7UA 2V2FF 4UEYA 1GSWA 1G68A 4KUKA 1IKIA 4EEPA 1KE3A 5G18A 5FQQA 3N8LA 2CC1A 2ZC5B 2JKTM 2ZM8A 4KQOA 3A3EA 4Y0UA 1DY6A 4Y7PA 3OPPA 2L0WA 1S4RA 5D3OA 3IF6C 3GV9A 1Y54A 3LICA 1OTAA 4U0TA 2L4RA 4QY5A 3B47A 1JNUA 3UB7A 2EXBA 1LL5A 2KX6A 4HJ4A 3M6HA 5KSHA 1KVLA 1JWZA 3BFCA 3WS2A 4KZ4A 4Y0OA 3HUOA 1M6KA 2J80A 3D72A 3E4QA 3T4KA 4JGOA 2R9WA 4KUOA 4PM6A 4B9OA 3D3OA 1RGZA 3U2AA 4E3NA 3E98A 1ESIA 1KGGA 1MC0A 1K55A 4H6JB 5HPIA 3CI6A 2FFYA 5HW3A 1IFQA 2P9VA 4JBFA 2ZQDA 4ID4A 1QMEA 2WGWB 4WMCA 5U47A 2JKFA 2VKSA 2HJEA 3M2KA 5EVIA 4NKPA 5CTMA 1TDLA 4N1XA 2J9OA 3N8SA 1JWVA 3MQQA 4DDSA 5DF9A 1KOUA 1FIKA 1TDGA 1H8YA 1CI9A 3C2WA 4KENB 3G4PA 1TEMA 3KYQA 2V20A 1OJ5A 1PYYA 2DCFA 3Q7VA 3VP1A 1M40A 4KQQA 1HTZA 5EPHA 5AVEA 3GVBA 4GDNA 1LI9A 5DF7A 5FATA 3PXPA 3NDGA 3WRZA 3RXXA 1NRJA 1PFLA 3T1RA 3UPOA 3OPHA 2O9CA 3ISGA 4DE1A 2Y59A 3OPLA 3UDXA 3A3IA 1ONGA 4K91A 4E6XA 1PW1A 3MKEA 3A3FA 3BY8A 3TW8A 4HP4A 3UMDA 3E0YA 4ESPA 1PI4A 2JCHA 4IVKA 1GA0A 3N8RA 4WZ5C 4HI4A 5EVID 3L7HA 2Y2KA 4HQAA 5F5YA 2VEAA 5HWWA 1YKDA 1KE0A 2H0TA 3W4PA 3NOUC 2G2WA 3DTEA 4JF6A 4CLCA 3LCEA 2VV7A 1NLYA 2V0WA 4K08A 3SS5A 3VSLA 2PU4A 1N9NA 3V67A 4HBUA 1ES5A 1F98A 4XXRA 2JC7A 3VP4A 5DJUA 2RCXA 5HPFA 3MXQA 5F1GA 1K57C 3LR3A 4WUJA 3QP1A 1JVJA 4GZBA 3E2KA 3UB8A 1MWRA 2WZZA 3EQUA 4XUZA 2ACGA 2W1RA 3A0VA 4X6TA 3NOTC 3GMWA 5FQIA 3L9KA 2XA7S 3IWQA 4IHQA 4JLFA 1XPBA 4WZ4A 2HP6A 4EW7A 1TVFA 4S2OA 4F3LA 2ZQ7A 4Q0HA 4P0MA 2ZMAA 2Y2IA 4PM9A 3EGDC 5G4YA 1I2WA 4LRXC 3FG8A 3O5YA 1XP4A 4CLCD 3H9WA 1MY8A 4OPZA 2WK0A 4L9FA 2XK1A 1AWIA 4EETB 4S2JA 4DKIA 5TBMB 2Y2QA 1MKIA 3CUEA 3QP5A 1W63M 2HDSA 4RVAA 3RH8B 4F94A 1EI5A 3ZVTA 2HDUA 2XA7M 4E3LA 5I5LA 3PBRA 5CTNA 2OV5A 2WKRA 3H7WB 4QJGA 4EV4A 3TOIA 2QJ7A 1SKOB 3LFVA 2JKRI 4G3VA 3V3SA 1DJBA 4MDZA 4OOYA 3LIBA 1Z6FA 4NXGA 5KSCA 3HUMA 1UWNX 2BG1A 4EQIA 2YKFA 1YLJA 5A90A 1JTDA 1KDWA 3UO9A 2IWDA 4UA6A 1SHVA 1YLZA 3PBQA 1CEFA 2VX8A 2UV0E 3H82A 4GOGA 3HJKA 3NECA 4BBVA 5HAPA 3IHAA 5FI2A 3TE8A 4OQ0A 5HFOA 3S7OA 5I94A 3CLOA 3Q82A 4LRYC 2P74A 1XGIA 2Y2NA 4GKUA 5AQBA 2ZLYA 4R23A 2ZL1B 3G34A 3LEQA 4LCMA 5HX9A 4Q0IA 3MFXA 4R6LA 2WGIA 1ACFA 2GNXA 2V9AA 2O99A 3CITA 4HJ3A 1IYSA 5K5BA 1RP5A 1AXBA 3CPTB 1FSYA 2ZBBA 3CMZA 3LY3A 4B4XA 1NLZA 2HGVA 2EFXA 5EE8A 3VOZA 1ZTUA 3MF0A 1NRFA 4X25A 3EWKA 4Z1WA 2WKQA 2PBDP 4P6ZS 2W1TB 5CHUA 2VJWA 1F9IA 5CGXA 5FAPA 1K56D 1LI0A 1MZUA 3FZCA 4DDYA 2Y2JA 4JGRA 4ETXA 4GDBA 4HEFA 2WGVA 3WS1A 1BUEA 5FQMA 4QY6A 2W3HA 3CZDA 5HAIA 4MN6A 2H10A 3C7UA 3NY4A 3PAGA 4E3JA 3IH8A 1P9WA 2Y2OA 1H8MA 1G6AA 4GW9A 4HP9A 3CWFA 4RX3A 4E6WA 1FR6A 2XRNA 3LI9A 3PBTA 3PR6A 1I5QA 4M4XA 1PWGA 3W4QA 4Q0JA 2VGJA 4FH2A 1GHMA 4IUKA 1OTBA 2ZQ9A 4P6ZM 3OZHA 2W27A 4GNUA 4IBXA 4KG5A 4PAUA 1YLWA 2Q9MA 4JGPA 4OPRA 1D06A 4OONA 3T4JA 5F69A 4MEZA 1JTGA 2P9VB 3UE0A 1NXYA 4LFUA 1MWTA 5E2GA 3IWIA 5EVIB 2Z6CA 3UN7A 1BSGA 3MZDA 2M7VA 1LHYA 3HLEA 1SDEA 1WYBA 1Z09A 5AQAA 3BECA 4MBFA 1UWPX 4ZRRA 3FC7A 3DBAA 1ESUA 3NOPC 2PAVP 4B4ZA 1VEUB 3KSHA 3MQOA 5G4ZA 4GD8A 3KX0X 5KZHA 4B93A 4G3KA 2XEPA 3Q7VB 1FCNA 1T18A 2E8IA 4R3AA 2HDQA 5FEGA 1CK3A 4E3KA 4N9KA 2Y2LA 3IS2A 2Y2HA 5DKLA 3IF6A 4ZJ1A 1I2SA 2A24A 3LO7A 1SKFA 2JHEA 3HL9A 3DW0A 4LV2A 1LLBA 1SCWA 4S2LA 3V5MA 3OOVA 1N4OA 4E3OA 5M19A 5TFQA 3A3DA 3NHQA 4WM9A 3NULA 3AGFA 5TR7A 4IBRA 4OKPA 5A8BA 1DP8A 1ZC2A 4CLCB 2JKTI 1L3LA 3VV4A 3GR2A 1ZKJA 5CEBA 3P01A 1K0KA 2PD8A 4WYYA 3KSGA 4MLLA 4Y17A 3UNWA 2FH5A 3HLBA 2FZ0A 4JXWA 3F1OA 1YQSA 2QYBA 4I39A 4HIAA 4QWOA 3G2YA 1XFQA 3JVVA 3MKFA 3NDEA 3R4KA 2Y2MA 4I3AA 4ME4A 3LR0A 4RX2A 5BOHA 4F3LB 3UB6A 3R7WA 2B02A 1XJ4A 3KYZA 2D02A 3FYZA 4X55A 4EBLA 3QP2A 4GD6A 1W5DA 4ETZA 2WAFA 1TS6A 3QNCA 5EOEA 3MXRA 2PD7A 2JKGA 1T19A 3HREA 5MC7A 4RQ9A 5EFWA 3IBRA 1GHIA 3ZVWA 4MN5A 4Z9QA 2QMIA 1K54C 3F1PA 3FKVA 4EU0A 2W3FA 2PHYA 3HVFA 3S7NA 4WZ5A 3VFHA 3PAEA 3BQ8A 2PRFA 3SS4A 3ZG8B 1S4SA 1H3QA 3C4OA 4R70A 5HSQA 1IELA 3IXHA 1E4DA 1NYMA 2PYRA 1K57A 2DNSA 1P0ZA 1VHMA 5HDCA 2I9VA 3W2ZA 3LEZA 4BJPA 5LBRA 3CG5A 2OLUA 1IYPA 4OPQA 1EWZA 4FOFA 1LSVA 3ZHHA 3VE3A 3H82B 3RTYA 3IQAA 2Z6DA 5FQ9A 4YOFA 1EW0A 1YSPA 5EUAA 3LR5A 5EM1A 1GA9A 4DE3A 1YMSA 3HUNA 1F2KA 1S1ZA 2WAEA 1ERMA 1N9LA 4D60A 4KZ3A 1Q2QA 5HL6A 4YINA 3NBLA 3QNBA 4I3JA 2V8CA 3IT9A 3BFFA 4ZJ2A 2IWCA 5EVEA 3LGOA 4IUHA 2EWVA 2Z2LB 5CHMA 1XA7A 2ZC7A 2W3DA 2Q9NA 5IU1A 3IX4A 4JXVA 4EERA 3WS5A 4OQGA 4N92A 2EFUA 2FFFB 2OAQ1 4X56A 3QP4A 3DTIA 4E04A 3MR0A 3T4QA 2KLIA 3JYIA 2XDMA 5HDDA 2ZC4B 1H5XA 5CEDA 3BY9A 3C4PA 4EUZA 3P98A 5FDHA 3UDFA 2KOIA 3PBNA 1MPLA 2EXAA 4WN5A 3AGDA 1OTEA 4JF4A 2J3WA 2ZMVA 3WS4A 1CF0A 3N7WA 2M1CA 4R3JA 3IHBA 4XUXA 4X69A 4MNRA 3Q07A 3HLCA 4BMWA 2OWJA 1GCEA 5L10A 1KGFA 1TS0A 3BYDA 2G2UA 3D4FA 3IH9A 1IOUA 2P7JA 4OOLA 3S4XA 2Y91A 3A0RA 3JPUA 4KZAA 1S67L 4UHUA 2VLGA 4IEDA 4O0PA 5E2EA 3TRCA 4EBPA 3NI9A 1NWZA 1OMEA 3K2NA 3VFFA 1JWPA 1NY0A 2NUTC 4E3IA 1K6SA 4DMZA 3ULFA 5E2FA 3JVUA 4LV3A 3UB5P 1O7EA 2HZ5A 5DFXA 1P97A 1VQQA 2HDRA 2ZQAA 4WEJA 2K31A 3FV7A 1P9RA 2MJ6A 4Y15A 2WUQA 1GHPA 4HHDA 2DRWA 1J3WA 1XA1A 4FTXA 3DTKA 2XSSA 4JPMA 3FKWA 1YT4A 2PBYA 3PBOA 5DF8A 1ZG4A 3OC2A 3Q81A 1NYYA 2E8JA 3C7VA 3BJNA 4HH3A 3IWOA 3M2JA 1K56A 3IS2B 3O87A 4S2KA 3W8KA 3IF6B 3EQVA 3UPNA 4BBTA 1RCJA 4WF0A 1CQAA 2A24B 1YLPA 4Y13A 1ES4A 1PW8A 4DXCA 3FWLA 4R4RA 5CERA 3ZGAB 3VP0A 3ZG9B 3MXSA 1OT9A 4OOMA 1W7FA 5CX7A 1A0KA 1L0FA 2XD5A 3T50A 4JXGA 3G30A 4UA7A 4GLQA 2J9PA 3OCNA 1S0WA 5GHYA 1YMXA 2XROA 1ONHA 2VA0A 2EX6A 2OOLA 2CMNA 1LSXA 3VMAA 4ARZA 2BASA 2KDKA 3UMEA 3QP8A 4JF5A 5J3WA 5DKKA 4S2PA 2X02A 3Q1FA 3F1OB 4DN0A 1L2SA 1ES3A 4KZ8A 3HLWA 2XH9A 2B5RA 2I72A 4FH4A 1LL8A 3CUEC 3E4PA 2Y8HA 4RYEA 1KVMA 1HVBA 4O8GA 3SZTA 3BLSA 4GJ4A 3LI8A 3DTMA 3R7WB 3MQ0A 3E4OA 4OPYA 5AQ7A 4R38A 5FQKA 1BLPA 3LIAA 5CRFA 2ZM0A 4X1MA 2ZC3B 4KG2A 1HZOA 3EEHA 1G6OA 3ITAA 2Y79A 1DJCA 1T1AA 1L0DA 5GHZA 1DRMA 4DRTA 3T1XA 3F1PB 4HNBA 3BRMA 3BFGA 4QU3A 4KZ9A 2GZAA 2HPBA 2QWSA 1BZAA 3E2LA 4BL3A 4RA7A 1OTDA 3T12B 4OQHA 3HLDA 3OPRA 3HCYA 5FEFA 1BLHA 4WLAA 3CJMA 2VV6A 1PZOA 1PIOA 3LIEA 3MFDA 3UB9A 3SOIA 3VOYA 1HD8A 4A5RA 1OPXA 4EUVA 2B95A 4JKTA 5FASA 1NJ4A 2XQZA 4FD8A 4DXBA 4II7A 4QPRA 4PM7A 3WWXA 1BYWA 4M3KA 2Y55A 2ZOIA 4PMAA 4PPRA 3VE4A 1BT5A 3MMHA 1MXOA 3O86A 2X71A 5JYOA 4DE0A 4WL9A 1ES2A 1KDSA 3ZFZA 1OTIA 3IXBA 5EM0A 4KG6A 3ZG5A 5TJJA 3BM6A 5KMWA 4GHIA 4O01A 4BBUA 3MZEA 3C5AA 5GLBA 4BQMA 3T1QB 5F1FA 1CEGA 2IA2A 1SDNA 1K54A 2OWHA 1VM1A 5CECA 2HF6A 4QHCA 2PYPA 1DP6A 4QB8A 5M1AA 5EVLA 5CGSA 1E3UD 4WELA 1MWUA 5DFYA 5A91A 4PM8A 4ZBEA 3TSGA 3C30A 3C8CA 5TGFA 3GSGA 1K38A 4UA9A 1FQGA 5F68A 4CPKA 2GJ3A 4BWIA 4NK3A 4GN2A 3GDIA 3MS6A 1O07A 1PZPA 2HP5A 4LENA 1QMFA 4N9LA 3ZQ5A 4CLCE 4GS9A 2J3TC 2WKIA 1STZA 1XXMA 2J8YA 4DE2A 3SS3A 3B42A 5KIZA 3DWKA 2UWXA 4KQDA 4H8RA 3S7QA 3V39A 1TS7A 1FOFA 3K3DA 1KE4A 2A49A 1XFNA 4U0XA 1T1BA 3G2ZA 1DP9A 3VP3A 1TS8A 4I5SA 4LRZE 2WADA 3QP6A 4P6BA 3K3CA 3TJZC 1ODVA 5FI6A 2XFSA 2QZ6A 4C3QA 3NJAA 4KQRA 5EECA 3GRJA 4S2NC 5GL9A 4I3IA 1YSQA 1YM1A 4HESA 5EV0A 4LGWA 2WKPA 4OLGA 3G32A 4CQHA 2OAP1 4NETA 5GLAA 5FAQA 5HZHA 2A3UA 5AJGA 3M6BA 2V0UA 4UAAA 1H0MA 2PR6A 1ERQA 3LR4A 1L0GA 4PM5A 1XJ2A 3KYEA 3IBJA 2C5WB 2XR0A 2JBFA 4UQIS 2EX2A 1FCMA 2INWA 2IWBA 4KZ5A 3CHWP 2M7UA 4CJNA 3UE1A 2QHKA 4IJGA 2J7VA 4DJ2A 1MWSA 3MZFA 5IT5A 3T4OA 5AQ9A 3A3JA 3PYPA 4EEUA 4EESA 3BLMA 1BULA 3HLFA 5E2HA 1VEUA 2PR5A 4BLMA 1N9BA 1K6RA 1XKZA 3A0SA 4MBHA 1VB6A 2QPNA 2WZXA 1VETA 4C75A 5IHVA 3ZYTA 1H8ZA 1Q2PA 4KZ6A 5A92A 2XF3A 1NZOA 3GECA 5AVFA 2V1AA 4YNRA 1UGUA 4Y3IA 3LYXA 2K2NA 3AGEA 4UQIM 2LB5A 4WBGA 5A93A 1G5UA 3RJUA 1LT0A 4OH0A 4ARZB 4OP5A 5F82A 3D9YA 1XJ3A 2HV1A 1S66L 5FA7A 5DJTA 5F83A 2D01A 3MJQA 5HL1A 1TF1A 3SH9A 4PKYA 3BEBA 1K4EA 4WMCD 4EXOA 3G31A 5CXWA 2ZQ8A 1D7EA 4OP8A 2VV8A 1PWCA 3TG9A 3SW1A 4MMNA 4OQIA 3F1NA 1K55C 4K0XA 1F5MA 2K7SA 4Q8IA 1FCOA 1XGJA 5GLCA 1CJFA 1V9ZA 4C6YA 4LCLA 1FR1A 4B88A 5EVIC 3N6IA 4NXBA 3DAVA 1W63Q 3V50A 2X01A 1KGEA 2V8FA 3ICYA 3BWLA 4X53A 3VSKA 4WEKA 2EX8A 2Y4AA 4XT2A 2ZC6B 3CAXA 3B33A 2Z2MB 4OVDA 3VOLA 1D1JA 1GSVA 1YAXA 1IYQA 1N9OA 3HLGA 2WKHA 3C38A 2RL3A 1Y28A 3ZDJA 3BFEA 2H28A 5E43A 3NIAA 5EOOA 3ITBA 2A2LA 4PKYG 2W3EA 1BLSA 5J7EA 3EOIA 1PNEA 3KSIA 3LUQA 5GLDA 1S1YA 2B18A 4S2IA 1K4FA 4ZTKA 3IXDA 4K0WA 1XX2A 3S7PA 2OSUA 3PTEA 4LPZA 3GQZA 2ZQCA 3UY6A 4Y2FA 3ZG7B 3S22A 1LSWA 2JE5A 4HOIA 3EEAA 3WRTA 1BTLA 2H5SA 4P85A 4CLCC 4GB7A 4BL2A 1YLTA 5HWVA 4H6JA 4JGQA 1IEMA 5FI7A 2ZM2A 5FSRA 2WGWA 4E3MA 2C6WB 3OBFA 2ZOHA 4GHIB 4MCWA 3HJIA 5L07A 5DTTA 3UE3A 1YPRA 5HWTA 3UDIA 4R0QA 1FILA 4LLOB 4NG2A 5DVAA 1RGYA 5M18A 3T4TA 1W8YA 4IVIA 3RFBA 3OCLA 4KZ7A 4I38A 4JXSA 4YWZA 2R9XA 4MBKA 3MSHA 1X0OA 4EWFA 1S6RA 2XD1A 3LIFA 3ZNTA 1XJ6A 3KO6A 4O7DA 2WKEA 3ZG0A 4X68A 2JKRM 4BD0A 1ZG6A 3P7NA 4N1HA 1W8QA 5HD5A 4GS9B 2V1ZA 3QHYA 4BENA 3IXGA 1Y4OA 1TD5A 2VGLS 4KZBA 1U60A 2BTFP 2PU2A 1CI8A 5DTSA 4LV1A 4FUWA 2PDRA 5HD3A 3S1YA 4MN7A 1WA9A 1J9MA 5JYPA 4NEED 4D2OA 1ZHHB 4L9EA 5J8XA 5CHJA 2Y2GA 1ALQA 3O88A 3UPPA 2NUPC 4Y0TA 2BLSA 4PHTA 3BW6A 2EX9A 1C3BA 5FQJA 4ZDXA 1PI5A 2O9BA 3T1SA 2ZJ9A 2V1BA 2R78A 4FSFA 4L9GA 3SH8A 4BD1A 3Q7ZA 2LB9A 4ZJ3A 3HBRA 2W0NA 4DJ3A 3NCKA 3T4LA 2VGLM 4EBNA 2W3GA 5IS1A 4L0LA 5DTKA
chains in the Genus database with same CATH topology
1PRQA 2HZ5A 2JKGA 2ZL1A 1D1JA 3MSHA 5FDSA 1VEUA 1VETA 2JKFA 3CPTA 4X1LA 1J3WA 4FTXA 3U4LP 2ACGA 2PRFA 3NECA 1PNEA 3NULA 1FIKA 1G5UA 2E8JA 5EM0A 1SZVA 3L9KA 1Y4OA 3D9YA 4X1MA 2BTFP 1HLUP 5EV0A 2ZL1B 1CQAA 3LEQA 4FUWA 1K0KA 3T1QB 1CF0A 1ACFA 1VETB 1PFLA 3T1RA 3CPTB 3T1XA 1SKOA 2VK3A 1A0KA 3KYEA 1Z09A 4QWOA 5EM1A 3T12B 5FEFA 1AWIA 4X25A 2PAVP 1VEUB 1CJFA 3T1SA 2PBDP 3CHWP 1F2KA 1YPRA 3MS6A 4ESPA 4D60A 1FILA 3DAVA 2V8FA 3L7HA 2V8CA 5FEGA 5EVEA 3LGOA 1SKOB 2B95A 3UB5P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRQ A;  2HZ5 A;  2JKG A;  2ZL1 A;  1D1J A;  3MSH A;  5FDS A;  1VEU A;  1VET A;  2JKF A;  3CPT A;  4X1L A;  1J3W A;  4FTX A;  3U4L P;  2ACG A;  2PRF A;  3NEC A;  1PNE A;  3NUL A;  1FIK A;  1G5U A;  2E8J A;  5EM0 A;  1SZV A;  3L9K A;  1Y4O A;  3D9Y A;  4X1M A;  2BTF P;  1HLU P;  5EV0 A;  2ZL1 B;  1CQA A;  3LEQ A;  4FUW A;  1K0K A;  3T1Q B;  1CF0 A;  1ACF A;  1VET B;  1PFL A;  3T1R A;  3CPT B;  3T1X A;  1SKO A;  2VK3 A;  1A0K A;  3KYE A;  1Z09 A;  4QWO A;  5EM1 A;  3T12 B;  5FEF A;  1AWI A;  4X25 A;  2PAV P;  1VEU B;  1CJF A;  3T1S A;  2PBD P;  3CHW P;  1F2K A;  1YPR A;  3MS6 A;  4ESP A;  4D60 A;  1FIL A;  3DAV A;  2V8F A;  3L7H A;  2V8C A;  5FEG A;  5EVE A;  3LGO A;  1SKO B;  2B95 A;  3UB5 P; 
#chains in the Genus database with same CATH topology
 1PRQ A;  1NZU A;  5HAQ A;  1IKG A;  4R1G A;  2VGK A;  3LY4 A;  4U3T A;  5FDS A;  3BQA A;  5L09 A;  3ZNY A;  5L2F A;  1PWD A;  3G35 A;  5FAO A;  4LV0 A;  1FSW A;  3PHY A;  1E3U A;  4X1L A;  4OLD A;  1ERO A;  4GCZ A;  3U4L P;  2JN7 A;  4S2M A;  4HY8 A;  3W4O A;  2O0Y A;  3SH7 A;  3UE6 A;  1WE4 A;  1SZV A;  4R3B A;  2XLN A;  5TBM A;  1GSX A;  1MBL A;  1E25 A;  4G3W A;  3IF5 A;  5J4E A;  2HJ9 C;  1HLU P;  1YLY A;  1BLC A;  1L0E A;  2QKP A;  2P08 A;  3IX3 A;  4QD4 A;  3G6O A;  3KSF A;  3NC8 A;  5CGW A;  1VET B;  3PBS A;  3H7W A;  4NXF A;  1T1C A;  2PT7 A;  1OJG A;  3BFD A;  1K25 A;  1LL9 A;  2GX5 A;  1SKO A;  2VK3 A;  3V3R A;  1V9Y A;  3I7J A;  3ZCZ A;  1IYO A;  4S2N A;  2AVX A;  3T4S A;  4NXE A;  2XGN A;  3VP2 A;  5HDS A;  2YKH A;  2WYX A;  3OLO A;  2EWW A;  2DMW A;  2HP9 A;  3LID A;  3GTC A;  4ZAM A;  1MKM A;  4FCF A;  2P04 A;  3FPW A;  2Q0O A;  4P87 A;  2ZMF A;  4AFI A;  1G28 A;  3FPV A;  5GHX A;  4YFM A;  3RXW A;  3P09 A;  2J3T D;  4HBT A;  4HJ6 A;  5C5K A;  3WS0 A;  2VZW A;  3MBZ A;  3O3V A;  5F6A A;  2ZL1 A;  3F1N B;  2ZD8 A;  3B3X A;  2Y2P A;  1OT6 A;  2XFT A;  2O9A A;  1W79 A;  2GDN A;  3IX8 A;  3CPT A;  5FL3 A;  2QJ5 A;  5HAR A;  3DWZ A;  4Y5F A;  4DF6 A;  1WYC A;  5L8M A;  1DJA A;  4R4S A;  3EGX C;  3N4I A;  2OLV A;  2H0Y A;  4HH2 A;  4XT2 B;  4EQ1 A;  2W1T A;  2EA9 A;  2L1M A;  2G7U A;  2V2F F;  4UEY A;  1GSW A;  1G68 A;  4KUK A;  1IKI A;  4EEP A;  1KE3 A;  5G18 A;  5FQQ A;  3N8L A;  2CC1 A;  2ZC5 B;  2JKT M;  2ZM8 A;  4KQO A;  3A3E A;  4Y0U A;  1DY6 A;  4Y7P A;  3OPP A;  2L0W A;  1S4R A;  5D3O A;  3IF6 C;  3GV9 A;  1Y54 A;  3LIC A;  1OTA A;  4U0T A;  2L4R A;  4QY5 A;  3B47 A;  1JNU A;  3UB7 A;  2EXB A;  1LL5 A;  2KX6 A;  4HJ4 A;  3M6H A;  5KSH A;  1KVL A;  1JWZ A;  3BFC A;  3WS2 A;  4KZ4 A;  4Y0O A;  3HUO A;  1M6K A;  2J80 A;  3D72 A;  3E4Q A;  3T4K A;  4JGO A;  2R9W A;  4KUO A;  4PM6 A;  4B9O A;  3D3O A;  1RGZ A;  3U2A A;  4E3N A;  3E98 A;  1ESI A;  1KGG A;  1MC0 A;  1K55 A;  4H6J B;  5HPI A;  3CI6 A;  2FFY A;  5HW3 A;  1IFQ A;  2P9V A;  4JBF A;  2ZQD A;  4ID4 A;  1QME A;  2WGW B;  4WMC A;  5U47 A;  2JKF A;  2VKS A;  2HJE A;  3M2K A;  5EVI A;  4NKP A;  5CTM A;  1TDL A;  4N1X A;  2J9O A;  3N8S A;  1JWV A;  3MQQ A;  4DDS A;  5DF9 A;  1KOU A;  1FIK A;  1TDG A;  1H8Y A;  1CI9 A;  3C2W A;  4KEN B;  3G4P A;  1TEM A;  3KYQ A;  2V20 A;  1OJ5 A;  1PYY A;  2DCF A;  3Q7V A;  3VP1 A;  1M40 A;  4KQQ A;  1HTZ A;  5EPH A;  5AVE A;  3GVB A;  4GDN A;  1LI9 A;  5DF7 A;  5FAT A;  3PXP A;  3NDG A;  3WRZ A;  3RXX A;  1NRJ A;  1PFL A;  3T1R A;  3UPO A;  3OPH A;  2O9C A;  3ISG A;  4DE1 A;  2Y59 A;  3OPL A;  3UDX A;  3A3I A;  1ONG A;  4K91 A;  4E6X A;  1PW1 A;  3MKE A;  3A3F A;  3BY8 A;  3TW8 A;  4HP4 A;  3UMD A;  3E0Y A;  4ESP A;  1PI4 A;  2JCH A;  4IVK A;  1GA0 A;  3N8R A;  4WZ5 C;  4HI4 A;  5EVI D;  3L7H A;  2Y2K A;  4HQA A;  5F5Y A;  2VEA A;  5HWW A;  1YKD A;  1KE0 A;  2H0T A;  3W4P A;  3NOU C;  2G2W A;  3DTE A;  4JF6 A;  4CLC A;  3LCE A;  2VV7 A;  1NLY A;  2V0W A;  4K08 A;  3SS5 A;  3VSL A;  2PU4 A;  1N9N A;  3V67 A;  4HBU A;  1ES5 A;  1F98 A;  4XXR A;  2JC7 A;  3VP4 A;  5DJU A;  2RCX A;  5HPF A;  3MXQ A;  5F1G A;  1K57 C;  3LR3 A;  4WUJ A;  3QP1 A;  1JVJ A;  4GZB A;  3E2K A;  3UB8 A;  1MWR A;  2WZZ A;  3EQU A;  4XUZ A;  2ACG A;  2W1R A;  3A0V A;  4X6T A;  3NOT C;  3GMW A;  5FQI A;  3L9K A;  2XA7 S;  3IWQ A;  4IHQ A;  4JLF A;  1XPB A;  4WZ4 A;  2HP6 A;  4EW7 A;  1TVF A;  4S2O A;  4F3L A;  2ZQ7 A;  4Q0H A;  4P0M A;  2ZMA A;  2Y2I A;  4PM9 A;  3EGD C;  5G4Y A;  1I2W A;  4LRX C;  3FG8 A;  3O5Y A;  1XP4 A;  4CLC D;  3H9W A;  1MY8 A;  4OPZ A;  2WK0 A;  4L9F A;  2XK1 A;  1AWI A;  4EET B;  4S2J A;  4DKI A;  5TBM B;  2Y2Q A;  1MKI A;  3CUE A;  3QP5 A;  1W63 M;  2HDS A;  4RVA A;  3RH8 B;  4F94 A;  1EI5 A;  3ZVT A;  2HDU A;  2XA7 M;  4E3L A;  5I5L A;  3PBR A;  5CTN A;  2OV5 A;  2WKR A;  3H7W B;  4QJG A;  4EV4 A;  3TOI A;  2QJ7 A;  1SKO B;  3LFV A;  2JKR I;  4G3V A;  3V3S A;  1DJB A;  4MDZ A;  4OOY A;  3LIB A;  1Z6F A;  4NXG A;  5KSC A;  3HUM A;  1UWN X;  2BG1 A;  4EQI A;  2YKF A;  1YLJ A;  5A90 A;  1JTD A;  1KDW A;  3UO9 A;  2IWD A;  4UA6 A;  1SHV A;  1YLZ A;  3PBQ A;  1CEF A;  2VX8 A;  2UV0 E;  3H82 A;  4GOG A;  3HJK A;  3NEC A;  4BBV A;  5HAP A;  3IHA A;  5FI2 A;  3TE8 A;  4OQ0 A;  5HFO A;  3S7O A;  5I94 A;  3CLO A;  3Q82 A;  4LRY C;  2P74 A;  1XGI A;  2Y2N A;  4GKU A;  5AQB A;  2ZLY A;  4R23 A;  2ZL1 B;  3G34 A;  3LEQ A;  4LCM A;  5HX9 A;  4Q0I A;  3MFX A;  4R6L A;  2WGI A;  1ACF A;  2GNX A;  2V9A A;  2O99 A;  3CIT A;  4HJ3 A;  1IYS A;  5K5B A;  1RP5 A;  1AXB A;  3CPT B;  1FSY A;  2ZBB A;  3CMZ A;  3LY3 A;  4B4X A;  1NLZ A;  2HGV A;  2EFX A;  5EE8 A;  3VOZ A;  1ZTU A;  3MF0 A;  1NRF A;  4X25 A;  3EWK A;  4Z1W A;  2WKQ A;  2PBD P;  4P6Z S;  2W1T B;  5CHU A;  2VJW A;  1F9I A;  5CGX A;  5FAP A;  1K56 D;  1LI0 A;  1MZU A;  3FZC A;  4DDY A;  2Y2J A;  4JGR A;  4ETX A;  4GDB A;  4HEF A;  2WGV A;  3WS1 A;  1BUE A;  5FQM A;  4QY6 A;  2W3H A;  3CZD A;  5HAI A;  4MN6 A;  2H10 A;  3C7U A;  3NY4 A;  3PAG A;  4E3J A;  3IH8 A;  1P9W A;  2Y2O A;  1H8M A;  1G6A A;  4GW9 A;  4HP9 A;  3CWF A;  4RX3 A;  4E6W A;  1FR6 A;  2XRN A;  3LI9 A;  3PBT A;  3PR6 A;  1I5Q A;  4M4X A;  1PWG A;  3W4Q A;  4Q0J A;  2VGJ A;  4FH2 A;  1GHM A;  4IUK A;  1OTB A;  2ZQ9 A;  4P6Z M;  3OZH A;  2W27 A;  4GNU A;  4IBX A;  4KG5 A;  4PAU A;  1YLW A;  2Q9M A;  4JGP A;  4OPR A;  1D06 A;  4OON A;  3T4J A;  5F69 A;  4MEZ A;  1JTG A;  2P9V B;  3UE0 A;  1NXY A;  4LFU A;  1MWT A;  5E2G A;  3IWI A;  5EVI B;  2Z6C A;  3UN7 A;  1BSG A;  3MZD A;  2M7V A;  1LHY A;  3HLE A;  1SDE A;  1WYB A;  1Z09 A;  5AQA A;  3BEC A;  4MBF A;  1UWP X;  4ZRR A;  3FC7 A;  3DBA A;  1ESU A;  3NOP C;  2PAV P;  4B4Z A;  1VEU B;  3KSH A;  3MQO A;  5G4Z A;  4GD8 A;  3KX0 X;  5KZH A;  4B93 A;  4G3K A;  2XEP A;  3Q7V B;  1FCN A;  1T18 A;  2E8I A;  4R3A A;  2HDQ A;  5FEG A;  1CK3 A;  4E3K A;  4N9K A;  2Y2L A;  3IS2 A;  2Y2H A;  5DKL A;  3IF6 A;  4ZJ1 A;  1I2S A;  2A24 A;  3LO7 A;  1SKF A;  2JHE A;  3HL9 A;  3DW0 A;  4LV2 A;  1LLB A;  1SCW A;  4S2L A;  3V5M A;  3OOV A;  1N4O A;  4E3O A;  5M19 A;  5TFQ A;  3A3D A;  3NHQ A;  4WM9 A;  3NUL A;  3AGF A;  5TR7 A;  4IBR A;  4OKP A;  5A8B A;  1DP8 A;  1ZC2 A;  4CLC B;  2JKT I;  1L3L A;  3VV4 A;  3GR2 A;  1ZKJ A;  5CEB A;  3P01 A;  1K0K A;  2PD8 A;  4WYY A;  3KSG A;  4MLL A;  4Y17 A;  3UNW A;  2FH5 A;  3HLB A;  2FZ0 A;  4JXW A;  3F1O A;  1YQS A;  2QYB A;  4I39 A;  4HIA A;  4QWO A;  3G2Y A;  1XFQ A;  3JVV A;  3MKF A;  3NDE A;  3R4K A;  2Y2M A;  4I3A A;  4ME4 A;  3LR0 A;  4RX2 A;  5BOH A;  4F3L B;  3UB6 A;  3R7W A;  2B02 A;  1XJ4 A;  3KYZ A;  2D02 A;  3FYZ A;  4X55 A;  4EBL A;  3QP2 A;  4GD6 A;  1W5D A;  4ETZ A;  2WAF A;  1TS6 A;  3QNC A;  5EOE A;  3MXR A;  2PD7 A;  2JKG A;  1T19 A;  3HRE A;  5MC7 A;  4RQ9 A;  5EFW A;  3IBR A;  1GHI A;  3ZVW A;  4MN5 A;  4Z9Q A;  2QMI A;  1K54 C;  3F1P A;  3FKV A;  4EU0 A;  2W3F A;  2PHY A;  3HVF A;  3S7N A;  4WZ5 A;  3VFH A;  3PAE A;  3BQ8 A;  2PRF A;  3SS4 A;  3ZG8 B;  1S4S A;  1H3Q A;  3C4O A;  4R70 A;  5HSQ A;  1IEL A;  3IXH A;  1E4D A;  1NYM A;  2PYR A;  1K57 A;  2DNS A;  1P0Z A;  1VHM A;  5HDC A;  2I9V A;  3W2Z A;  3LEZ A;  4BJP A;  5LBR A;  3CG5 A;  2OLU A;  1IYP A;  4OPQ A;  1EWZ A;  4FOF A;  1LSV A;  3ZHH A;  3VE3 A;  3H82 B;  3RTY A;  3IQA A;  2Z6D A;  5FQ9 A;  4YOF A;  1EW0 A;  1YSP A;  5EUA A;  3LR5 A;  5EM1 A;  1GA9 A;  4DE3 A;  1YMS A;  3HUN A;  1F2K A;  1S1Z A;  2WAE A;  1ERM A;  1N9L A;  4D60 A;  4KZ3 A;  1Q2Q A;  5HL6 A;  4YIN A;  3NBL A;  3QNB A;  4I3J A;  2V8C A;  3IT9 A;  3BFF A;  4ZJ2 A;  2IWC A;  5EVE A;  3LGO A;  4IUH A;  2EWV A;  2Z2L B;  5CHM A;  1XA7 A;  2ZC7 A;  2W3D A;  2Q9N A;  5IU1 A;  3IX4 A;  4JXV A;  4EER A;  3WS5 A;  4OQG A;  4N92 A;  2EFU A;  2FFF B;  2OAQ 1;  4X56 A;  3QP4 A;  3DTI A;  4E04 A;  3MR0 A;  3T4Q A;  2KLI A;  3JYI A;  2XDM A;  5HDD A;  2ZC4 B;  1H5X A;  5CED A;  3BY9 A;  3C4P A;  4EUZ A;  3P98 A;  5FDH A;  3UDF A;  2KOI A;  3PBN A;  1MPL A;  2EXA A;  4WN5 A;  3AGD A;  1OTE A;  4JF4 A;  2J3W A;  2ZMV A;  3WS4 A;  1CF0 A;  3N7W A;  2M1C A;  4R3J A;  3IHB A;  4XUX A;  4X69 A;  4MNR A;  3Q07 A;  3HLC A;  4BMW A;  2OWJ A;  1GCE A;  5L10 A;  1KGF A;  1TS0 A;  3BYD A;  2G2U A;  3D4F A;  3IH9 A;  1IOU A;  2P7J A;  4OOL A;  3S4X A;  2Y91 A;  3A0R A;  3JPU A;  4KZA A;  1S67 L;  4UHU A;  2VLG A;  4IED A;  4O0P A;  5E2E A;  3TRC A;  4EBP A;  3NI9 A;  1NWZ A;  1OME A;  3K2N A;  3VFF A;  1JWP A;  1NY0 A;  2NUT C;  4E3I A;  1K6S A;  4DMZ A;  3ULF A;  5E2F A;  3JVU A;  4LV3 A;  3UB5 P;  1O7E A;  2HZ5 A;  5DFX A;  1P97 A;  1VQQ A;  2HDR A;  2ZQA A;  4WEJ A;  2K31 A;  3FV7 A;  1P9R A;  2MJ6 A;  4Y15 A;  2WUQ A;  1GHP A;  4HHD A;  2DRW A;  1J3W A;  1XA1 A;  4FTX A;  3DTK A;  2XSS A;  4JPM A;  3FKW A;  1YT4 A;  2PBY A;  3PBO A;  5DF8 A;  1ZG4 A;  3OC2 A;  3Q81 A;  1NYY A;  2E8J A;  3C7V A;  3BJN A;  4HH3 A;  3IWO A;  3M2J A;  1K56 A;  3IS2 B;  3O87 A;  4S2K A;  3W8K A;  3IF6 B;  3EQV A;  3UPN A;  4BBT A;  1RCJ A;  4WF0 A;  1CQA A;  2A24 B;  1YLP A;  4Y13 A;  1ES4 A;  1PW8 A;  4DXC A;  3FWL A;  4R4R A;  5CER A;  3ZGA B;  3VP0 A;  3ZG9 B;  3MXS A;  1OT9 A;  4OOM A;  1W7F A;  5CX7 A;  1A0K A;  1L0F A;  2XD5 A;  3T50 A;  4JXG A;  3G30 A;  4UA7 A;  4GLQ A;  2J9P A;  3OCN A;  1S0W A;  5GHY A;  1YMX A;  2XRO A;  1ONH A;  2VA0 A;  2EX6 A;  2OOL A;  2CMN A;  1LSX A;  3VMA A;  4ARZ A;  2BAS A;  2KDK A;  3UME A;  3QP8 A;  4JF5 A;  5J3W A;  5DKK A;  4S2P A;  2X02 A;  3Q1F A;  3F1O B;  4DN0 A;  1L2S A;  1ES3 A;  4KZ8 A;  3HLW A;  2XH9 A;  2B5R A;  2I72 A;  4FH4 A;  1LL8 A;  3CUE C;  3E4P A;  2Y8H A;  4RYE A;  1KVM A;  1HVB A;  4O8G A;  3SZT A;  3BLS A;  4GJ4 A;  3LI8 A;  3DTM A;  3R7W B;  3MQ0 A;  3E4O A;  4OPY A;  5AQ7 A;  4R38 A;  5FQK A;  1BLP A;  3LIA A;  5CRF A;  2ZM0 A;  4X1M A;  2ZC3 B;  4KG2 A;  1HZO A;  3EEH A;  1G6O A;  3ITA A;  2Y79 A;  1DJC A;  1T1A A;  1L0D A;  5GHZ A;  1DRM A;  4DRT A;  3T1X A;  3F1P B;  4HNB A;  3BRM A;  3BFG A;  4QU3 A;  4KZ9 A;  2GZA A;  2HPB A;  2QWS A;  1BZA A;  3E2L A;  4BL3 A;  4RA7 A;  1OTD A;  3T12 B;  4OQH A;  3HLD A;  3OPR A;  3HCY A;  5FEF A;  1BLH A;  4WLA A;  3CJM A;  2VV6 A;  1PZO A;  1PIO A;  3LIE A;  3MFD A;  3UB9 A;  3SOI A;  3VOY A;  1HD8 A;  4A5R A;  1OPX A;  4EUV A;  2B95 A;  4JKT A;  5FAS A;  1NJ4 A;  2XQZ A;  4FD8 A;  4DXB A;  4II7 A;  4QPR A;  4PM7 A;  3WWX A;  1BYW A;  4M3K A;  2Y55 A;  2ZOI A;  4PMA A;  4PPR A;  3VE4 A;  1BT5 A;  3MMH A;  1MXO A;  3O86 A;  2X71 A;  5JYO A;  4DE0 A;  4WL9 A;  1ES2 A;  1KDS A;  3ZFZ A;  1OTI A;  3IXB A;  5EM0 A;  4KG6 A;  3ZG5 A;  5TJJ A;  3BM6 A;  5KMW A;  4GHI A;  4O01 A;  4BBU A;  3MZE A;  3C5A A;  5GLB A;  4BQM A;  3T1Q B;  5F1F A;  1CEG A;  2IA2 A;  1SDN A;  1K54 A;  2OWH A;  1VM1 A;  5CEC A;  2HF6 A;  4QHC A;  2PYP A;  1DP6 A;  4QB8 A;  5M1A A;  5EVL A;  5CGS A;  1E3U D;  4WEL A;  1MWU A;  5DFY A;  5A91 A;  4PM8 A;  4ZBE A;  3TSG A;  3C30 A;  3C8C A;  5TGF A;  3GSG A;  1K38 A;  4UA9 A;  1FQG A;  5F68 A;  4CPK A;  2GJ3 A;  4BWI A;  4NK3 A;  4GN2 A;  3GDI A;  3MS6 A;  1O07 A;  1PZP A;  2HP5 A;  4LEN A;  1QMF A;  4N9L A;  3ZQ5 A;  4CLC E;  4GS9 A;  2J3T C;  2WKI A;  1STZ A;  1XXM A;  2J8Y A;  4DE2 A;  3SS3 A;  3B42 A;  5KIZ A;  3DWK A;  2UWX A;  4KQD A;  4H8R A;  3S7Q A;  3V39 A;  1TS7 A;  1FOF A;  3K3D A;  1KE4 A;  2A49 A;  1XFN A;  4U0X A;  1T1B A;  3G2Z A;  1DP9 A;  3VP3 A;  1TS8 A;  4I5S A;  4LRZ E;  2WAD A;  3QP6 A;  4P6B A;  3K3C A;  3TJZ C;  1ODV A;  5FI6 A;  2XFS A;  2QZ6 A;  4C3Q A;  3NJA A;  4KQR A;  5EEC A;  3GRJ A;  4S2N C;  5GL9 A;  4I3I A;  1YSQ A;  1YM1 A;  4HES A;  5EV0 A;  4LGW A;  2WKP A;  4OLG A;  3G32 A;  4CQH A;  2OAP 1;  4NET A;  5GLA A;  5FAQ A;  5HZH A;  2A3U A;  5AJG A;  3M6B A;  2V0U A;  4UAA A;  1H0M A;  2PR6 A;  1ERQ A;  3LR4 A;  1L0G A;  4PM5 A;  1XJ2 A;  3KYE A;  3IBJ A;  2C5W B;  2XR0 A;  2JBF A;  4UQI S;  2EX2 A;  1FCM A;  2INW A;  2IWB A;  4KZ5 A;  3CHW P;  2M7U A;  4CJN A;  3UE1 A;  2QHK A;  4IJG A;  2J7V A;  4DJ2 A;  1MWS A;  3MZF A;  5IT5 A;  3T4O A;  5AQ9 A;  3A3J A;  3PYP A;  4EEU A;  4EES A;  3BLM A;  1BUL A;  3HLF A;  5E2H A;  1VEU A;  2PR5 A;  4BLM A;  1N9B A;  1K6R A;  1XKZ A;  3A0S A;  4MBH A;  1VB6 A;  2QPN A;  2WZX A;  1VET A;  4C75 A;  5IHV A;  3ZYT A;  1H8Z A;  1Q2P A;  4KZ6 A;  5A92 A;  2XF3 A;  1NZO A;  3GEC A;  5AVF A;  2V1A A;  4YNR A;  1UGU A;  4Y3I A;  3LYX A;  2K2N A;  3AGE A;  4UQI M;  2LB5 A;  4WBG A;  5A93 A;  1G5U A;  3RJU A;  1LT0 A;  4OH0 A;  4ARZ B;  4OP5 A;  5F82 A;  3D9Y A;  1XJ3 A;  2HV1 A;  1S66 L;  5FA7 A;  5DJT A;  5F83 A;  2D01 A;  3MJQ A;  5HL1 A;  1TF1 A;  3SH9 A;  4PKY A;  3BEB A;  1K4E A;  4WMC D;  4EXO A;  3G31 A;  5CXW A;  2ZQ8 A;  1D7E A;  4OP8 A;  2VV8 A;  1PWC A;  3TG9 A;  3SW1 A;  4MMN A;  4OQI A;  3F1N A;  1K55 C;  4K0X A;  1F5M A;  2K7S A;  4Q8I A;  1FCO A;  1XGJ A;  5GLC A;  1CJF A;  1V9Z A;  4C6Y A;  4LCL A;  1FR1 A;  4B88 A;  5EVI C;  3N6I A;  4NXB A;  3DAV A;  1W63 Q;  3V50 A;  2X01 A;  1KGE A;  2V8F A;  3ICY A;  3BWL A;  4X53 A;  3VSK A;  4WEK A;  2EX8 A;  2Y4A A;  4XT2 A;  2ZC6 B;  3CAX A;  3B33 A;  2Z2M B;  4OVD A;  3VOL A;  1D1J A;  1GSV A;  1YAX A;  1IYQ A;  1N9O A;  3HLG A;  2WKH A;  3C38 A;  2RL3 A;  1Y28 A;  3ZDJ A;  3BFE A;  2H28 A;  5E43 A;  3NIA A;  5EOO A;  3ITB A;  2A2L A;  4PKY G;  2W3E A;  1BLS A;  5J7E A;  3EOI A;  1PNE A;  3KSI A;  3LUQ A;  5GLD A;  1S1Y A;  2B18 A;  4S2I A;  1K4F A;  4ZTK A;  3IXD A;  4K0W A;  1XX2 A;  3S7P A;  2OSU A;  3PTE A;  4LPZ A;  3GQZ A;  2ZQC A;  3UY6 A;  4Y2F A;  3ZG7 B;  3S22 A;  1LSW A;  2JE5 A;  4HOI A;  3EEA A;  3WRT A;  1BTL A;  2H5S A;  4P85 A;  4CLC C;  4GB7 A;  4BL2 A;  1YLT A;  5HWV A;  4H6J A;  4JGQ A;  1IEM A;  5FI7 A;  2ZM2 A;  5FSR A;  2WGW A;  4E3M A;  2C6W B;  3OBF A;  2ZOH A;  4GHI B;  4MCW A;  3HJI A;  5L07 A;  5DTT A;  3UE3 A;  1YPR A;  5HWT A;  3UDI A;  4R0Q A;  1FIL A;  4LLO B;  4NG2 A;  5DVA A;  1RGY A;  5M18 A;  3T4T A;  1W8Y A;  4IVI A;  3RFB A;  3OCL A;  4KZ7 A;  4I38 A;  4JXS A;  4YWZ A;  2R9X A;  4MBK A;  3MSH A;  1X0O A;  4EWF A;  1S6R A;  2XD1 A;  3LIF A;  3ZNT A;  1XJ6 A;  3KO6 A;  4O7D A;  2WKE A;  3ZG0 A;  4X68 A;  2JKR M;  4BD0 A;  1ZG6 A;  3P7N A;  4N1H A;  1W8Q A;  5HD5 A;  4GS9 B;  2V1Z A;  3QHY A;  4BEN A;  3IXG A;  1Y4O A;  1TD5 A;  2VGL S;  4KZB A;  1U60 A;  2BTF P;  2PU2 A;  1CI8 A;  5DTS A;  4LV1 A;  4FUW A;  2PDR A;  5HD3 A;  3S1Y A;  4MN7 A;  1WA9 A;  1J9M A;  5JYP A;  4NEE D;  4D2O A;  1ZHH B;  4L9E A;  5J8X A;  5CHJ A;  2Y2G A;  1ALQ A;  3O88 A;  3UPP A;  2NUP C;  4Y0T A;  2BLS A;  4PHT A;  3BW6 A;  2EX9 A;  1C3B A;  5FQJ A;  4ZDX A;  1PI5 A;  2O9B A;  3T1S A;  2ZJ9 A;  2V1B A;  2R78 A;  4FSF A;  4L9G A;  3SH8 A;  4BD1 A;  3Q7Z A;  2LB9 A;  4ZJ3 A;  3HBR A;  2W0N A;  4DJ3 A;  3NCK A;  3T4L A;  2VGL M;  4EBN A;  2W3G A;  5IS1 A;  4L0L A;  5DTK A; 
#chains in the Genus database with same CATH homology
 1PRQ A;  2HZ5 A;  2JKG A;  2ZL1 A;  1D1J A;  3MSH A;  5FDS A;  1VEU A;  1VET A;  2JKF A;  3CPT A;  4X1L A;  1J3W A;  4FTX A;  3U4L P;  2ACG A;  2PRF A;  3NEC A;  1PNE A;  3NUL A;  1FIK A;  1G5U A;  2E8J A;  5EM0 A;  1SZV A;  3L9K A;  1Y4O A;  3D9Y A;  4X1M A;  2BTF P;  1HLU P;  5EV0 A;  2ZL1 B;  1CQA A;  3LEQ A;  4FUW A;  1K0K A;  3T1Q B;  1CF0 A;  1ACF A;  1VET B;  1PFL A;  3T1R A;  3CPT B;  3T1X A;  1SKO A;  2VK3 A;  1A0K A;  3KYE A;  1Z09 A;  4QWO A;  5EM1 A;  3T12 B;  5FEF A;  1AWI A;  4X25 A;  2PAV P;  1VEU B;  1CJF A;  3T1S A;  2PBD P;  3CHW P;  1F2K A;  1YPR A;  3MS6 A;  4ESP A;  4D60 A;  1FIL A;  3DAV A;  2V8F A;  3L7H A;  2V8C A;  5FEG A;  5EVE A;  3LGO A;  1SKO B;  2B95 A;  3UB5 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...