3LGTA

Y162a/h198p double mutant of degs-deltapdz protease
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
181
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPAGQTITQGIISATGNFLQTDASINPGNSGGALVNSLGELMGINTLSGIGFAIPFQLATKIMDKLIRDGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 43
structure length 181
sequence length 215
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgtA02
1RXPA 2P59A 3H7OA 1FUJA 3A87A 1ZMJA 1CQQA 1OP0A 1C4U2 3SHAH 3LT3A 5FHTA 2NU3E 1J14A 5BPEA 2Y6TA 2TIOA 3MH5A 2XBVA 3GY5A 1FJSA 1YC0A 1BJUA 1C1TA 3SU6A 5B6OA 2F9BH 1GJ4H 4IN2A 1UHBA 1EB2A 2OP9A 2QF3A 1GCTC 2W3KA 1TFXA 1QQUA 4JMYA 3EA8A 1BBRH 1BMMH 1O2WA 2FEQH 1GL0E 2ZG0H 1MAYA 2ZIQH 3RXIA 1HV7A 3T62A 2OTVA 2AIQA 1Y5BT 4MDSA 1C5XB 1QA0A 3A86A 2UWLA 1GHYH 2ODPA 1G32B 2PUQH 5DPAA 1ZRBA 4K8BA 1TNHA 1Z8IB 4RKOB 1QHRB 2HPPH 4FUFA 5LGOA 1VCPA 2YNBA 2IN2A 4AN7A 1AQ7A 4J2YB 4CRBA 3PWCA 4NFFA 1P02A 5JBTA 1NM6A 2UUYA 4FUBA 1C5SA 1OP2A 1DM4B 4BNRA 1BUIA 5FPYA 1HAXB 1C1QA 1LKAA 2C8WB 4WMFA 1D4PB 2XBXA 1LKBA 3SJOA 1K1OA 3DFLA 2G52A 5E0GA 2BD5A 1NN6A 4DJZB 2Z6BD 5EW1H 2OUAA 3P6ZB 1Q3XA 1BB0B 1ANCA 1XKAC 5AHGH 2KAIA 4Y76A 1K1IA 5LPFA 1ETRH 3A82A 3A7ZA 1GHWH 3GCOA 4A1XA 4HTCH 3ESTA 2B7DH 5GCHG 4JZDH 4ABIA 3AW0A 1ZLRA 1GHVH 4HFPB 1BMAA 3PTBA 4X0WU 2FODA 1PJPA 2ZHQH 1C1NA 2OC7A 3MU0A 1SPJA 1BIOA 3UOUA 1TGBA 4MNVA 1U6QA 5E8EH 5A09A 3ELAH 1QTFA 2WV4A 1BBRK 2GCTB 3KEEA 4OGYA 1S0RA 1LTOA 2EI7A 1C5YB 1YPJH 1VJ9U 2NU2E 4UFGH 1TRYA 1GBJA 1IAUA 2Z94A 3RXSA 4FVBA 4NZLA 2P94A 4GCHG 1Z6JH 2UUJB 1CHGA 1H8DH 3C1KA 4ZKSU 3AW1A 3VB4A 1BOQA 1LVBA 2CV3A 3S7HB 1TALA 3M5LA 5JB9S 1UTLM 3RXMA 2RDLA 4UONA 3FVFB 5C2ZA 1RRKA 2C4FH 4J1YA 1AHTH 5SGAE 2AGEX 3PV4A 1YPMH 4KKDA 1CHOF 1XXFA 2D1JA 2AEIH 1QFKH 2BMGB 3TJNA 1BDAA 1A0LA 1F5KU 2HVXA 1MBQA 3TJVA 3LC3A 1VITH 7ESTE 1P12E 1XMNB 2J4IA 4ISOA 2DE8A 2FLBH 4WF8A 1O2MA 2GD4B 3BTQE 4B74A 4WMDA 3ENSB 3RXQA 1DVAH 5ETXA 2WUBA 5C1XA 5IYTA 1P11E 3KQBA 1W0ZU 2O8TA 2ZTXA 3QGNB 2FOBA 1BMNH 1SHHB 2ZU2A 1FN8A 4ASHA 3LH1A 4B2BA 2A45B 1GHBG 4IMQA 5K7RA 4FU7A 1ELCA 1L2EA 3ZZCA 1UK3A 1TQ7B 1O2HA 1S85A 2Z9KA 2WYJA 1V2TT 3RXBA 5EPNA 4CRAA 1JXPA 1TNIA 3SU5A 1D3PB 2ODQA 2NU0E 4XFQA 1KXAA 1MTUA 3T5FH 2HLCA 4A7IB 2AGIX 3VB5A 3RXDA 2JH0D 4CH8B 1K1NA 4K1EA 1EXFA 1O39A 2FP7B 3ZVDA 5E2OA 4MTBA 2VVCA 4KGAA 5FCKA 1UMAH 3BIUH 3BEUA 2W3IA 4I8KA 2FDAA 1O3IA 1QA7A 1D9IA 1SGFA 1T8OA 2D8WA 1J8AA 2GMTC 1F7ZA 3RXUA 4BXWA 3OSYA 3SV9A 4UFFH 1UCYE 5DP3A 5JYIA 3TPIZ 1SC8U 2ZI2H 4D76A 1LQDB 2P93A 4UFEH 1CGHA 1BHXB 1AVGH 1AE8H 1P0SH 3WY8A 2VIQA 2QCYA 2V35A 3U8TH 5F6MA 1AD8H 1OP8A 2BXUH 3VB7A 1CHOG 3ZZAA 3M5NA 4JZFH 5HM9A 1CVWH 3NKKA 3U8RH 1LDTT 1MQ5A 2FOGA 2QXJA 3SNDA 3ZVGA 1DOJA 1RTKA 1GMCF 1AZ8A 1MMJN 1YCPK 2A0QB 1TPPA 2F9VA 3PMHB 2PKAB 1YM0A 4X6OA 1IOEA 2A4QA 1N1LA 1RGQA 1Z71A 4X1PU 1FY5A 4XBBA 3OU0A 1UVOA 3HPTB 4NWKA 3GY4A 4X8SH 3TJUA 1FIWA 1GJ9B 1DS2E 1WTGH 4Z6AH 1XUGA 1P04A 4AG2A 1UK2A 1OS8A 1O31A 2J2UA 1GI5A 1TB6H 3DHKH 1DT2A 4AG1A 2UWPA 5LPRA 4MG3A 3SN8A 5HMAA 4CH2B 1GVKB 2R3YA 3N7OA 1SGPE 5C1YA 1Y3XA 5GDSH 1B7XB 5I25A 1O0DH 2TPIZ 6GCHG 2ZDNA 2C93B 1TGCA 4FUIA 3MNSA 1AMHA 2ZGHA 1ANBA 4DW2U 4PROA 4KELA 1LPKB 4WXVA 5TCAA 3UQOA 3BTFE 4JYUH 1KXEA 2JETB 3LONA 4BTTB 2DUCA 1T8MA 4ZUHA 1MH0A 1EQ9A 4NCYA 1QBOA 2BB4A 1C5UA 3BIVH 2SGQE 3M7UA 1P3CA 1HBTH 4X1RU 3UWIA 3GCHB 3GCNA 1IQKA 1ESTA 2VIVA 1PQ7A 3GDVA 4UEHH 1YYY1 5EPYA 1JRSA 4JZEH 3LGTA 5DP7A 1NZQH 3O8RA 2FI5E 1D3TB 1ZMNA 1BJVA 3K6YA 1O2GH 4WXIA 2CF9H 1GHAF 4Q7YA 2OQUA 1YPLH 3P70B 1NU7B 1YPKH 1O2KA 4IC6A 2PTNA 1HIAA 3AAUA 2FTLE 2Z9JA 4NWLA 2QV1A 1F92A 4O03A 2B0FA 4DIIH 1VCQA 3MO9A 4XE4A 2BLWA 3RMNH 1VZQH 3GY3A 1DXWA 1IQMA 3EA7A 1UTQA 1ZHRA 4YZUA 1Y5AT 1ZSLA 1W14U 4HI3A 1GJCB 1FN6A 3ITIA 4ISNA 4D9RA 3AASA 1V2VT 2SNWA 1AB9C 3M3VA 2Y5FA 1CGJE 1TRNA 1T7CA 5A0CA 2AMPA 4AX9H 4I8GA 2GCHG 3MU5A 3NWUA 1FAKH 3RXGA 1TMTH 3UTUH 3ZZDA 1EX3A 1TMBH 3UUZA 1LO6A 1N6XA 1A5IA 1TMUH 4WWYA 1XX9A 1BMLA 1LHGH 1TNLA 3SUEA 3D65E 2Y5HA 3BTTE 1RTLA 1K1PA 1S83A 1O2SA 2ANWA 3RXCA 4MNWA 1S82A 2TGAA 4F49A 1NFUA 2Y81A 4Y8ZA 3LJOA 4WVPE 1AKSB 1K21H 5C5OA 1BTWA 5BRRE 4CBOA 4ZKRU 3A8CA 2PKAA 2H9EH 2Y5GA 1C4Y2 2ZDVH 4Y8XA 1C1VH 4KTUA 4ZH8A 3MTYA 2BDAA 5IDKA 1GDNA 3Q76A 4O3UA 2NWNA 2BZ6H 1G3CA 2B5TB 3Q00A 1O2OA 1QL8A 1SSXA 4U2WA 1GGDC 3QTVH 3TGIE 1C1OA 2GV7A 2AS9A 2ZTZA 1DANH 1NESE 2WPKS 4AFQA 3U8OH 4LXBH 1MBMA 2BQ7B 1EP6A 3TK9A 4DY7B 1P57B 2PLXA 1A5HA 1O3EA 1ZSJA 2OBOA 3S69A 4OS1A 3T26A 1AVXA 3HK3B 3KF2A 1SGDE 1GDQA 1SGQE 5TCCA 3E0PB 3RC5A 1NO9H 1OWJA 1MKXK 2FZZA 1UTMA 2AH4X 3A89A 4GPGA 1YGCH 1BHXF 1GHZA 4XSKU 4E06H 2ZDMA 2ANMH 5C1UA 1O2XA 1SI5H 2FOMB 1L0ZA 3RLWH 2H5CA 5L2ZH 1D6RA 1TABE 2VIWA 1XUIA 1V2OT 2Y7XA 1P2IA 1P8VC 1DSTA 2GDDA 2VVVA 1HAIH 2QN5T 3RXOA 1G30B 1TNGA 1NPMA 3RU4T 3Q3XA 3GYLB 3K9XB 1A5GH 1T4VH 5T6DA 1UTNA 1KLIH 8GCHF 2BY9X 1RTFB 1L4ZA 1ABIH 1IQHA 2OD3B 1J9CH 4MNXA 1TX7A 1CGIE 1LQEA 4ZHAA 1A46H 1O2UA 2OCVB 1T31A 1GI1A 3ZZBA 4MQAA 1GPZA 1Y3YA 2BY8X 3K65B 1UTJA 1TWXB 3KCGH 3LDXH 2WINI 2GTBA 2WPIS 2J94A 3MFJA 1VCWA 3GY6A 5A0BA 1Z8RA 2A2XH 2CXVA 4O9VA 4BAOB 3E91A 4F4OC 3VGCC 1T8LA 4I8LA 1FY8E 3QGJA 4GCHF 1OPHB 1C2MA 3ZZ7A 3GY2A 5HYOA 1IQGA 3TU7H 2G5NA 1AN1E 2JKHA 1CA0B 1RS0A 1WU1A 1XUJA 1O3LA 1LHEH 3RXRA 3ATMA 1VR1H 3A8DA 1JIRA 1HJAC 1BBRE 2Y82A 2ZZUH 4AOQA 3MU4A 1MU8B 1GI6A 1O5GH 4Y79A 3HKIB 1ESAA 2A7CA 4X6PA 4INHA 1F0UA 3SV6A 1HPGA 1W7XH 4I32A 3EE0B 4A92A 1O3FA 2BY5X 1E0FD 1IQFA 1V3XA 1LCYA 1BRUP 1V2JT 3RXLA 3A8AA 1RIWC 1PFXC 3LH3A 1QY6A 3V12A 1GBFA 5ESBA 4VGCC 1Z6EA 2BLQA 4TPYA 3HK6B 1H4WA 4ABDA 1SB1H 2XC5A 3M7TA 1C2JA 1ELEE 3F68H 1GMCG 4H42U 4QT8C 1W13U 2H2ZA 3SUDA 2WUCA 3SO3A 1WBGB 3O8CA 4BXSA 5C3NA 2ZFRH 2CMYA 1TBRH 1W0YH 4OS4A 5DP6A 1A0JA 3FP7E 1N8OC 4FU9A 4U30A 3RM2H 1DDJA 4ZXYH 4BAMB 3UR6A 2THFB 1GDUA 3U9AH 1GJ6A 1O32A 2BDBA 2XTTB 3F9GA 3ZV9A 2A7HA 4TY7A 3GY7A 3TJOA 2GGVB 1PPCE 4NA9H 2ALPA 2BVXH 4OS7A 1GMDG 2LPRA 1EATA 3W94A 3U69H 1ELFA 4Y7AA 1KXBA 1YPHE 3FFGA 3BG4B 4IN1A 3TLOA 1HGTH 2STAE 1TNKA 1F2SE 3BTDE 1GVLA 1Z1JA 1NS3A 1C2LA 1C1WH 1TOCB 4JYTA 1XKBC 3VPKA 1AU8A 3SGQE 2BX4A 1V2MT 2BYAX 2WPJS 4FUJA 3NUMA 1FXYA 1PYTD 1ZJDA 4E7RG 1SQTA 1EKBB 3MMGA 1ZR0A 4X1NU 3OTJE 1BRBE 1EPTB 3P92A 1UVTH 4ESTE 2ZEBA 2BTCE 2BLOA 1ZHMA 2SGPE 1O3MA 1ZTJA 2Y80A 1FY4A 4ABHA 2ANYA 1JIMA 5JBBS 1MAXA 1DE7H 4NA8A 3GISB 5FBIA 1C5ZB 3T29A 4BTUB 3P8NA 1O3GA 1EPTC 3VXEH 4NG9H 2H9TH 1UJ1A 2XWAA 3U1JB 2XW9A 1S84A 3SNEA 3IITA 3QUMP 2FOAA 3CENA 3ODFA 1FDPA 2AIPA 1ELDE 2A1DB 2GDEH 1O5EH 2C8XB 1HB0B 2AFQB 1C5WB 1V2LT 4OS6A 4Y0YE 1B0EA 3EYDA 1K2I1 3TH2H 5JB8S 1P03A 1ZMLA 1OKXA 1G2MA 3I78A 3RXTA 3JZ1B 1O3HA 1PPEE 1SHYA 1O2VA 1A4WH 1L1NA 1JBUH 2PGQB 3BG4C 3PMAB 3QWCH 4BAKB 2XCFA 2P16A 1V2KT 1B0FA 1T4UH 1YCPH 5DK1A 1TA2A 1GMDF 2FS9A 2HRVA 1O5CB 1GJ7B 1A2CH 2ZFSA 5EU8A 1GJ5H 3UWJH 2ZFTA 2ZQ2A 2HNTC 1QNJA 1K28D 1S81A 1BRAA 4HGCA 2BD8A 2V3OH 3KQCA 4X2YA 2AGGX 1X7AC 1TBQH 2BDCA 1LVOA 5EXLA 1UCYH 3URCA 2ZDAH 2RA0A 1ESBA 5LH8A 1TPSA 1W12U 5EQQA 3PTNA 1O3NA 1AKSA 1HAGE 3PO1B 2Z9GA 1GBKA 4MLFB 1MTNB 1WQSA 1K9OE 2BY7X 2OLGA 1MTSA 1BITA 2HALA 1O37A 2QYIA 1C2IA 3BTGE 3FP6E 3I77A 2FYRA 3MU1A 1SLUB 1CA8B 5F03A 2VU8E 4IMZA 1Y3WA 4YOIA 3SJ9A 1NROH 3FZZA 1EZUC 2UUFB 4Y7BA 1NRPH 4Y0ZE 1ELTA 3MNCA 2H5DA 2FESH 1UVPA 2GVFA 1IQLA 3MNXA 4XBCA 3QLPH 1LMWB 3RXPA 1W3CA 3OX7U 3RMMH 1GBMA 2R3UA 1TGTA 1XUFA 2G5VA 2SGDE 5T6FA 2R2MB 3RM0H 5I46H 3ZVBA 3TNTA 1H8IH 3NXPA 3NPSA 3LJJA 3SV2H 3EAJA 3URDA 5EG4A 5HM2A 1W2KH 3F1SB 2EI8A 1H1BA 1O38A 2I6QA 2ZA5A 1EPTA 4Z0KA 1V2RT 1AWFH 1TPAE 2PW8H 1THRH 1UTPA 1FPHH 4B2AA 1AFEH 1CO7E 1MD7A 3Q3YA 1C2HA 1QJ1B 2OC1A 2BM2A 1MZDA 1ZGVA 2ZF0H 5A8XA 4X6NA 2EEKA 1EAIA 8LPRA 1H9LB 4H6SB 2ZCKP 4JYVH 2H1UA 2W5EA 3LGUA 1HXFH 3S9CA 1E34B 2ZFQH 1TGNA 3B23B 1EZQA 3MH7A 1YLDA 1C5RA 3M3SA 1C2DA 4Q2KA 3T2NA 1A1RA 3KN2A 1YKTA 3QTOH 2P8OC 1O3CA 1OWEA 1O5DH 2FOEA 5E2PA 2QF0A 2YOLA 1BCUH 2P3TB 2ZDKA 4AGJA 1FONA 1MKWH 3STJA 4BANB 1AUTC 1C1UH 2Z3DA 3B9FH 4NIVA 1GG6B 2YNAA 1NFYA 2Y7ZA 3RDZA 2HNTE 4X2WA 2G51A 4INLA 3VEQB 4AYVB 3LKWA 1ZZZA 1XUHA 3SU0A 1GBBA 4ABEA 2BD2A 4KTSA 1QB6A 4IW4E 3SV8A 3SJIA 4AB8A 1HAVA 1QJ7B 5T3HA 1C2GA 2UWOA 1A0HB 1J16A 1FY3A 1P01A 1VGCC 4B73A 4B2CA 5C67A 4NIWA 1QIXB 1VITG 3H5CB 2ZQ1A 5C5NA 5AFZH 4GVUA 4H6TA 1D3QB 5C20A 3CS0A 3ZZ5A 1LHCH 2WPHS 3SBKA 4Y10E 4DCDA 2BDYA 1AE5A 1IQJA 5JPMH 1FV9A 3BTHE 4D7FA 4UDWH 4CREA 3SGAE 1WSSH 1YF4A 1DXPA 4GUXA 1GI7B 1MTVA 1O5BB 2EC9H 5L6NH 5J4SA 2G4UA 1SGCA 6CHAC 1EASA 3DUXH 4WH6A 1EZSC 3ZZ3A 5EODA 4CR5A 6LPRA 1JWTA 4AORA 1YCPM 2STBE 9LPRA 3SOSA 2TGDA 1SLXB 2CJIA 1H9IE 1K1LA 4Y6DA 4OS5A 4E05H 3T25A 5E0JA 2ZDLA 1CT4E 1SR5C 4I8HA 2GZ8A 3D23A 4DG4A 1UO6A 4UE7H 1TNJA 1HYLA 4U32A 3U98H 2HPQH 1D6WA 2HWLB 1QB9A 2Z9IA 1PQAA 4YT6H 1O2IA 2GCTC 1E37B 4K60A 1SOZA 4K8YA 2ZHEH 2CHAB 3RXKA 3BTEE 3A88A 2FM2A 4X8VH 2ZNKH 5EQRA 2RA3A 2ILNA 3QZRA 4K1TA 3TIUA 3MH6A 1QB1A 1A3EH 1EZXC 1V2ST 2BD4A 1BRCE 1FI8A 1UTKA 3DT0H 3U1IB 1XUKA 2XYAA 1DX5M 1DUEA 1JMOH 2PR3A 4X8UH 3UR9A 1TQ0B 3ZYDA 1AVWA 4YT7H 3A7XA 3STIA 1O2LA 3E0NB 2NU4E 4KP0A 1TAWA 3KQDA 1O2QA 3MWIU 4SGAE 4GHTA 2PHBA 5G4BA 2DE9A 2QA9E 1V2UT 3FAOA 2V0BA 1DWDH 3BN9A 3RUOA 3ZVAA 1INCA 2A5KA 2FYQA 4FUCA 2D2DA 5GXPA 5FPTA 1S6HA 3GICB 1GBEA 4A1VA 3LU9B 4MPXA 1MTWA 5GJ4B 3OYPA 1ZHPA 2BY6X 1Q2WA 1HAOH 1O3PB 1FQ3A 4Y8YA 1GI8B 3ZZ4A 1P2NA 4E7NA 5A8ZA 1G9IE 1UCYK 1J15A 1C5MD 3JZ2B 4WY3A 2VIPA 1JOUB 1P06A 2BVRH 3PYHA 1PPGE 2F9PA 4ZKNU 3EA9A 4ABBA 2BDGA 3S0NA 3MYWA 2AERH 2A5IA 1C2FA 1PPHE 1DLEA 4GLYA 3SU4A 5GCHF 4ABAA 1ZRKA 3BG8A 5FX6A 3M35A 1AI8H 2VWLA 1GG6C 3BEIB 4DVAU 1O3OA 2PKSC 5GWZA 1RIWB 3QO6A 1EP5A 4A1TA 1ELAA 5K0HA 4B76A 2XXLA 1O3DA 5CMXH 3RXJA 1ETSH 4XBDA 3SZNA 4FUEA 5DP9A 2BVSH 3SQHE 1SGTA 2EA3A 1TYNA 2ZHFH 3KIDU 1ZGIA 1HJAB 4TWWA 4D8NA 1C1RA 2P8OB 3A7VA 5FPSA 2W7UA 1C5NH 3P8OA 1AWHB 2C3SA 1FZZA 4MPUA 1AIXH 2I6SA 1TOMH 2FOHA 1SMFE 1Z1IA 3AVZA 2VNTA 4JCNA 4HZHA 1EAXA 2V3HH 4DGJA 1ZTKA 2FTMA 2VWNA 2CHAC 4RN6A 3I29A 4JK5A 1TA6A 4X8TH 5FCRA 5FX5A 5AFYH 3DD2H 2WPLS 4AFZA 2A4OA 1OWIA 1HAYB 1KXCA 1SLWB 4ZHMU 1QL7A 1Y3VA 1ELVA 3SORA 2TRMA 1MD8A 3P8GA 4FUHA 2P95A 1ID5H 3GYMA 3TNSA 1EAWA 2HGTH 1AZZA 2BDIA 2XWBI 1WQVH 3SU1A 3ZYEA 2BHGA 4I8JA 1MCTA 1EOJA 2GP9B 2SGEE 1TBZH 1TGSZ 2QXIA 1SGRE 2F83A 3ZV8A 1GBIA 2FXRA 2ZWLH 1XM1A 1KIGH 3ZZ9A 1TX6A 2XRCA 1Q31A 1AFQB 1TPOA 3L33A 1P2JA 1V2NT 4CBNA 2FOCA 2D26C 1AO5A 4IS5A 3ATIA 1FMGA 2PSYA 5DP5A 1UVUH 2XC4A 3BTWE 1SQAA 3RC4A 2EI6A 1DSUA 2F91A 3S7KB 4ABGA 1IQEA 5AVDA 2R2WU 1QCPA 3ZVEA 2ZGBH 1O5AB 2IOTA 2O8MA 1W10U 3RU4E 3E90B 1DY8A 4O3TA 1Y3UA 1LHDH 3RU4D 1QRXA 2BX3A 2XCNA 1XVOA 3SW2B 2WPMS 3MOCA 2KAIB 2RG3A 3P8FA 3TITA 1SGEE 2FMJA 4X1SU 3VB6A 1ABJH 3MNBA 1C1SA 2G8TA 1NC6A 1HAHH 1BTZA 1ARBA 2A32A 2A2QH 4I33A 1NFXA 1C5TA 1FPCH 1C1MA 1BTUA 3HGNA 1N6YA 1O2TA 2P3FH 5JBAS 2QY0B 1P05A 3RLYH 1G36A 1L4DA 1RD3B 4TWYA 4U01A 1FAXA 2CN0H 1GJAB 1C5VA 4DT7B 2XNIA 3E1XB 1F0SA 4AYYB 5L30H 3MU8A 1G3BA 2J9NA 1MCVA 6ESTA 1NRNH 3QX5H 1ZSKA 2ULLA 4KTCA 1OWKA 2J92A 4BOHA 3S9AA 4TPIZ 1BTYA 4YOGA 1EOLA 1DICA 1ANEA 1SQOA 2JH5D 1SLVB 3DA9B 3MO3A 1G3DA 2F9NA 3BF6H 1MUEB 4IC5A 2O8UA 2FIRH 1L1JA 2HOBA 4TY6A 1XVMA 1UK4A 2FO9A 3R0FA 3SNBA 1EB1H 3SU2A 4WMEA 3LGIA 3P17H 1GMHF 4BAHB 3IWMA 3SI4H 4Q7ZA 4CHAC 3ZZ8A 5T6GA 1ZPZA 2FI4E 2Q6GA 1QRWA 2BQ6B 1WAYB 3LOXA 3TK5A 1WV7H 1CT2E 4UD9H 3RMLH 2GT7A 8KME2 1GI0A 2BD9A 3EDXB 2LNCA 3HATH 3TGKE 1O2ZA 3Q3KA 4ZROA 3UNQA 2ZGCA 3LPRA 1P2QA 1KTSB 4FU8A 2V6NA 5H4IB 2O8WA 2FX6A 2ZU1A 1ZPBA 1VITF 1DY9A 2ZU3A 1HFDA 2W26A 1C2KA 5LPEA 1F0RA 2BDHA 1HAPH 4DOQA 2BQWB 3K6ZA 4IGDA 1HCGA 3PLPA 4MPWA 1NFWA 1GWAA 3PO1C 4D7GA 1C5PA 1V2PT 3SU3A 2R9PA 3CP7A 2ESTE 4I7YH 2C90B 2OC8A 1GVZA 3GY8A 3ODDA 2A31A 4ISLA 2CGAA 4NA7A 3RXFA 3V7TA 1GJDB 4YLUA 3RXEA 3A84A 3UIRA 1Z7KA 2ZGXH 1A61H 2GCHF 1W7GH 4K1SA 3TH3H 2R0LA 4CHAB 3H7TA 2Q6DA 4BTIB 3PMBB 4DURA 1WUNH 2C8YB 1DITH 4FUGA 1MU6B 3M37A 4VGCB 9ESTA 2PTCE 2SFAA 1OXGA 1TX8A 4I31A 1OYQA 2A7JA 1GCTB 2ZECA 2FX4A 2H6MA 4YM9A 3MHWU 1SOTA 1V6DA 3M61U 3SUFA 2ZHDA 1QRZA 2A4GA 1CA0C 1E36B 1AUJA 1GI2A 4RSPA 2A4RA 3M5OA 4GHQA 1T32A 3VGCB 1P10A 1VJAU 5A0AE 4TYDA 1LVMA 5PTPA 2ZPSA 3W95A 2VH0A 2QXGA 1E38B 1WTHD 1E35B 3T28A 1QGFA 5ESTE 1C9TA 1YP9A 2G4TA 1PPFE 3SNCA 2QAAA 1SGIB 4CRGA 3PMJA 3E3TA 4K3JA 1A7SA 2VJ1A 3AAVA 2ZU4A 2XBWA 2FS8A 1HIAB 1QBVH 1ZYOA 4B75A 1ETTH 5EW2H 3O8BA 1P2KA 3V13A 3TH4H 1O30A 3QK1A 1BT7A 2PSXA 5ABWA 2H9HA 3FANA 6GCHF 2NU1E 2UUKB 2VGCB 1G2LA 1O2JA 1P3EA 3RP2A 4A6LA 2Q6FA 3O8DA 4ISHH 1V2QT 1C4V2 1BTHH 1KY9A 5EQSA 1G3EA 5TJXA 3VB3A 3FZDA 2VINA 4YESB 1Y59T 1GBCA 4SGBE 2O8LA 3SJKA 1SVPA 1GBAA 2AYWA 2B8OH 1DWEH 1O3JA 5CHAB 5DG6A 3L3TA 4GSOA 3SHCH 1S5SA 4ZAEA 1QR3E 1HAZB 1HAVB 1GHXH 3GDSA 3R3GB 1BA8B 1O3KA 2PFEA 3C27B 3VFEA 4K69A 2BLVA 2TBSA 1GBLA 5GPIB 2TGPZ 3RC6A 4AFSA 1BTXA 1PPZA 2ZO3H 2XBYA 4ZMAH 1C1PA 1TRMA 3SI3H 3KGPA 1HNEE 2BOKA 1DWCH 1NY22 5JBCS 4THNH 4AB9A 4B1TA 5CHAC 1O34A 4WH8A 1P2OA 4A5TS 2J38A 1C2EA 3MH4A 2QC2A 1HRTH 2Z3CA 1ARCA 4DIHH 2ZFPH 4NSYA 1NTPA 1C5QA 3QZQA 1EUFA 2JETC 2VIDA 3PWBA 2GKVE 2ZFFH 1NRQH 3A85A 2ODYB 5GIBA 1ZOMA 1QBNA 3E6PH 3BV9B 1A3BH 3PROA 5F8XA 3LC5A 3V0XA 2WV5A 2SGFE 1UTOA 1KDQA 5DO4H 1DLKB 4OGXA 4Q80A 3HKJB 1HUTH 3BTKE 1O2NA 3GOVB 3SQEE 1O33A 2WYGA 3UREA 2R0KA 2B9LA 3UY9A 3SJ8A 1SGNE 1GGDB 3EQ0H 2ZKSA 1LHFH 1XXDA 3GDUA 1GJBB 1O5FH 4NFEA 3F6UH 2G81E 2ANKH 1CBWC 1CU1A 1LPZB 1Z8GA 4NGAH 3KL6A 2ZPRA 1PQ8A 1O3BA 4R8TB 5HGGA 2ZGJA 5DP4A 3TVJB 1THPB 1PYTC 3F9EA 4Y11E 3ATWA 4LK4A 1FLEE 2VVUA 1ANDA 3E8LA 1SGFG 1MQ6A 1OSSA 4YOJA 1NU9A 5FAHA 3ZVFA 1K1JA 1OX1A 3LIWA 1ZTLA 2F9OA 3B8JA 1CE5A 3RXAA 5L2YH 3KQEA 1THSH 2QXHA 1DUAA 7GCHG 1YPHC 2AMQA 4CRDA 5A2MH 2VB0A 3M36A 2AMDA 2PGBB 2ZCHP 2GX4A 8GCHG 3BEFB 5J4QA 4O97A 3S9BA 1L1GA 4NIXA 5HXFA 3A8BA 5EXMA 1ZJKA 6CHAB 2GMTB 1AB9B 1M9UA 3F9FA 2CF8H 2GT8A 5AF9H 1AGJA 1SFIA 2J95A 4YO9A 1HDTH 3UNRA 4H4FA 1O2RA 4B71A 1Y5UT 4D9QA 1MTNC 2Z9LA 4NZQA 2QIQA 1ELBA 5FBEA 4AGKA 1IQNA 4FXGH 1KYNA 5EGMA 3LGWA 1GI3A 1S0QA 3PB1E 4K2YA 1N8OB 1OYTH 1KLJH 4ABFA 1SGYE 1VGCB 3M3TA 1C5LH 1PQ5A 5DJ7A 4OS2A 4YTAA 3LGYA 3UQVA 1BZXE 1SBWA 3A83A 3GCHC 4IBLH 3MI4A 1PPBH 2Z7FE 4K5ZA 1O35A 1K1MA 2Z3EA 4M7GA 1LPGB 3OY5U 1AY6H 1TE0A 1TIOA 4XOJA 1OWHA 1GBDA 4BAQB 1QL9A 3ATKA 7LPRA 3OY6U 2ALVA 1QJ6B 2RCEA 1HLTH 5E0HA 7GCHF 1P9UA 5CE1A 2ZU5A 2ZP0H 5DKMA 3LGVA 2SGAA 2TGTA 1BQYA 4X2VA 1GI4A 3SUGA 2BOHB 1SFQB 2QGRA 4FVDA 1DWBH 2PV9B 3QN7A 1O36A 2OQ5A 1HXEH 1O2PA 2VWOA 4XDEA 1T8NA 1LVYA 3NK8A 4FUDA 3MO6A 5EOKA 2VWMA 1NRRH 1MKWK 2W7SA 3ATLA 4X6MA 3BTME 2ZHWH 1S6FA 4WJG2 1CT0E 1UVSH 1GHBF 3BSQA 4LOYH 1KLTA 4JZ1A 4ZHLU 1ELGA 1O3AA 3DFJA 2SNVA 1FIZA 3EGKH 1JRTA 3KNXA 3PLKA 1EJMA 1KSNA 2A5AA 1P09A 4MPVA 2O9QA 3A80A 4CRFA 1RJXB 1NRSH 3ZVCA 1IQIA 1YLCA 2IJOB 5A8YA 2OXSA 3NCLA 1CBWB 1TLDA 1HJ9A 4MVNA 1EJAA 5F8TA 4RKJB 3T27A 2PWXA 1ZPCA 2P3UB 1F5LA 5JDUB 5F8ZA 1W11U 2GV6A 2BD3A 1RFNA 1C9PA 4Q7XA 3G01A 4INKA 1SL3A 2PKSB 1P9SA 1WCZA 1KDQB 4JK6A 1J17T 2FWWA 2OBQA 1GMHG 4YLQH 1UHBB 3M7QA 3CS7A 2XC0A 2VH6A 1EJNA 3V3MA 1KTTB 2FI3E 3PLBA 1KXDA 2G00A 4ZXXH 3UFAA 3VXFH 3A7TA 1DPOA 4LZ4B 4ABJA 2ZPQA 1MKXH 1W8BH 1YPGH 1GI9B 4CRCA 3IG6B 1WYKA 2GZ9A 2ZCLP 1GHAG 2BZAA 3UPEA 2J34A 3FP8E 3GCTG 3RXHA 4ZKOU 4LZ1H 1IHTH 2K1QA 1FY1A 4ISIH 1YBWA 2FLRH 1TONA 1GJ8B 3E16B 3A81A 1EAUA 2ASUB 1QQ4A 4R0IA 1GBTA 1P2MA 3KHVA 2Q1JA 4UFDH 3D62A 2C8ZB 3NZIA 1D3DB 3RXVA 3SNAA 1QURH 3F9HA 1DFPA 3TGJE 5EXNA 3M5MA 4AZ2B 4Y71A 4GAWA 2BD7A 4NIYA 1AFQC 7KMEH 4NSVA 2VGCC 1IHSH 2JH6D 3K2UA 3L6PA 1K22H 1V2WT 3QDZB 2PUXB 1GBHA 2IPHA 2FOFA 1MZAA 2HNTF 3UOPA 3A7YA 1KXFA 5DP8A 3SGBE 1NT1A 2F9UA 3Q77A 2ZC9H 1Y8TA 1WOFA 3TK6A 1H9HE 2OINA 4MNYA 4AFUA 5FXLA 2ZTYA 3ZZ6A 3GCTF 4X1QU 2M5TA 1ORFA 1F5RA 3P95A 4JZIA 1GL1A 1SG8B 1YPEH 1OWDA 4X2XA 1F0TA 8ESTE 3D49H 2VIOA 3A7WA 1O2YA 3SV7A 3HGPA 3PM3A 2OC0A 1Z8JB 2G55A 5DGJA 1HJ8A 1CSOE 1G37A 1OOKB 3RMOH 3UNSA 2F3CE 2BXTH 1ACBE 1GCDA 2GZ7A 1BTPA 2FPZA 4CR9A 1C5OH 1B5GH 1FNIA
chains in the Genus database with same CATH superfamily
1RXPA 2P59A 3H7OA 1FUJA 3A87A 2LP6A 1ZMJA 1CQQA 1OP0A 1C4U2 3SHAH 3LT3A 5FHTA 2NU3E 1J14A 5BPEA 2Y6TA 2TIOA 3MH5A 2XBVA 3GY5A 4ACBA 1FJSA 1YC0A 1BJUA 1C1TA 3SU6A 5B6OA 2F9BH 1GJ4H 4IN2A 1UHBA 1EB2A 2OP9A 2QF3A 1GCTC 2W3KA 1TFXA 1QQUA 4JMYA 3EA8A 1BBRH 1BMMH 1O2WA 2JDID 2FEQH 1GL0E 2ZG0H 1MAYA 2ZIQH 3RXIA 1HV7A 3T62A 2OTVA 2AIQA 1Y5BT 4MDSA 1C5XB 1QA0A 3A86A 2UWLA 1GHYH 2ODPA 1G32B 2PUQH 5DPAA 1ZRBA 4K8BA 5IK2D 1TNHA 1Z8IB 4RKOB 1QHRB 2HPPH 4FUFA 5LGOA 1VCPA 2YNBA 2IN2A 4AN7A 1AQ7A 4J2YB 4CRBA 3PWCA 4NFFA 1P02A 5JBTA 1NM6A 2UUYA 3N7EA 4FUBA 1C5SA 5GNDA 1OP2A 1DM4B 4BNRA 1BUIA 5FPYA 1HAXB 1C1QA 1LKAA 2C8WB 4WMFA 1D4PB 2XBXA 1LKBA 3SJOA 1K1OA 3DFLA 2G52A 5E0GA 3WW7A 2BD5A 1NN6A 4DJZB 2Z6BD 5EW1H 2OUAA 3P6ZB 1Q3XA 1BB0B 1ANCA 1XKAC 5AHGH 2KAIA 4Y76A 1K1IA 5LPFA 4TSFD 2CK3D 4F48B 1ETRH 3A82A 3A7ZA 1GHWH 3GCOA 4A1XA 4HTCH 2VBCA 3ESTA 2B7DH 5GCHG 4JZDH 4ABIA 3AW0A 1ZLRA 1GHVH 4HFPB 1BMAA 3PTBA 4X0WU 2FODA 1PJPA 2ZHQH 1C1NA 2OC7A 3MU0A 1SPJA 1BIOA 3UOUA 1TGBA 4MNVA 1U6QA 5E8EH 5A09A 3ELAH 1QTFA 3OFND 2WV4A 1BBRK 2GCTB 3KEEA 4OGYA 1S0RA 1LTOA 2EI7A 2HLDD 1C5YB 1YPJH 1VJ9U 3PRDA 2NU2E 4UFGH 1TRYA 1GBJA 1IAUA 2Z94A 3RXSA 4FVBA 4NZLA 2P94A 4GCHG 1Z6JH 3F3BA 2UUJB 1CHGA 1H8DH 3C1KA 4ZKSU 3AW1A 3VB4A 1BOQA 1LVBA 2CV3A 3S7HB 1TALA 3M5LA 5JB9S 1UTLM 3RXMA 2RDLA 4UONA 3FVFB 5C2ZA 1RRKA 2C4FH 4J1YA 1AHTH 5SGAE 2AGEX 3PV4A 1YPMH 4KKDA 1CHOF 1XXFA 2D1JA 2AEIH 1QFKH 2BMGB 3TJNA 1BDAA 3KYFA 1A0LA 1F5KU 2HVXA 1MBQA 3TJVA 3LC3A 1VITH 7ESTE 1P12E 1XMNB 2J4IA 4ISOA 2DE8A 2FLBH 4WF8A 1O2MA 2GD4B 3BTQE 4B74A 4WMDA 3ENSB 3RXQA 1DVAH 5ETXA 2WUBA 5C1XA 5IYTA 1P11E 3KQBA 1W0ZU 2O8TA 2ZTXA 3QGNB 2FOBA 1BMNH 1SHHB 2ZU2A 1FN8A 4ASHA 3LH1A 4B2BA 2A45B 1GHBG 4IMQA 5K7RA 4FU7A 1ELCA 1L2EA 2WSSD 3ZZCA 1UK3A 1TQ7B 1O2HA 1S85A 2Z9KA 3U28C 4B6FA 2WYJA 1V2TT 3RXBA 5EPNA 4CRAA 1JXPA 1TNIA 3SU5A 1D3PB 2ODQA 2NU0E 4XFQA 1KXAA 1MTUA 3T5FH 2HLCA 4A7IB 2AGIX 3VB5A 3RXDA 2JH0D 4CH8B 1K1NA 4K1EA 1EXFA 1O39A 2FP7B 4Q63A 5E2OA 4MTBA 3ZVDA 4RI0A 2VVCA 4KGAA 5FCKA 1UMAH 3BIUH 3BEUA 2W3IA 4I8KA 2FDAA 1O3IA 1QA7A 1D9IA 1SGFA 1T8OA 3OEHD 2D8WA 1J8AA 2GMTC 1F7ZA 3RXUA 4BXWA 1MABB 3OSYA 3SV9A 4UFFH 1UCYE 5DP3A 5JYIA 3TPIZ 1SC8U 2ZI2H 4D76A 3N99A 1LQDB 2P93A 4UFEH 1CGHA 1BHXB 2L6OA 1AVGH 1AE8H 1P0SH 3WY8A 2VIQA 2QCYA 2V35A 3U8TH 5F6MA 1AD8H 1OP8A 2BXUH 3VB7A 1CHOG 3ZZAA 3M5NA 4JZFH 5HM9A 1CVWH 3NKKA 3U8RH 2YMSC 1LDTT 1MQ5A 2FOGA 2QXJA 4OM9A 3SNDA 3ZVGA 1DOJA 1RTKA 1GMCF 1AZ8A 1MMJN 1YCPK 2A0QB 1TPPA 2F9VA 3PMHB 2PKAB 1YM0A 4X6OA 3GS9A 1IOEA 2A4QA 1N1LA 1RGQA 1Z71A 4X1PU 1FY5A 4XBBA 3OU0A 1KMHB 1UVOA 3HPTB 4NWKA 3GY4A 1E1QD 4X8SH 3TJUA 1FIWA 1GJ9B 1DS2E 1WTGH 4Z6AH 1XUGA 1P04A 3F2HA 4AG2A 1UK2A 1OS8A 1O31A 2J2UA 1GI5A 1TB6H 3DHKH 1DT2A 4AG1A 2UWPA 5LPRA 4MG3A 3SN8A 5HMAA 4CH2B 1GVKB 2R3YA 3N7OA 1SGPE 5C1YA 1Y3XA 5GDSH 1B7XB 5I25A 1O0DH 2TPIZ 6GCHG 2ZDNA 2C93B 1TGCA 4FUIA 3MNSA 1AMHA 2ZGHA 1ANBA 4DW2U 4PROA 4KELA 3FN8A 1LPKB 4WXVA 5TCAA 3UQOA 3BTFE 4JYUH 1KXEA 2JETB 3LONA 4BTTB 2DUCA 1T8MA 4ZUHA 1MH0A 1EQ9A 4NCYA 1QBOA 2BB4A 1C5UA 3BIVH 2SGQE 2XNDD 1P3CA 1HBTH 3M7UA 4X1RU 3UWIA 3GCHB 3GCNA 1IQKA 1ESTA 2VIVA 1PQ7A 3GDVA 4UEHH 1YYY1 5EPYA 1JRSA 4JZEH 3LGTA 5DP7A 1NZQH 3O8RA 2FI5E 1D3TB 1ZMNA 1BJVA 3K6YA 1O2GH 4WXIA 2CF9H 1GHAF 4Q7YA 2OQUA 1YPLH 3P70B 1NU7B 1YPKH 1O2KA 4IC6A 2PTNA 1HIAA 3AAUA 2FTLE 2Z9JA 4NWLA 2QV1A 1F92A 4O03A 2B0FA 4DIIH 1VCQA 3MO9A 4XE4A 2BLWA 3RMNH 1VZQH 3GY3A 1DXWA 1IQMA 3EA7A 1UTQA 1ZHRA 4YZUA 1Y5AT 1ZSLA 1W14U 4HI3A 1GJCB 1FN6A 3ITIA 4ISNA 4D9RA 3AASA 1V2VT 2SNWA 1AB9C 3M3VA 2Y5FA 1CGJE 1TRNA 1T7CA 1W0KD 5A0CA 2AMPA 2WHXA 4AX9H 4I8GA 2GCHG 3MU5A 3NWUA 1FAKH 5C17A 3RXGA 1TMTH 3UTUH 3ZZDA 1EX3A 1TMBH 3UUZA 1LO6A 1N6XA 3OTPA 1A5IA 5C94A 1TMUH 4WWYA 2KCOA 1XX9A 3DSGA 1BMLA 1LHGH 1TNLA 3SUEA 3D65E 2Y5HA 3BTTE 1RTLA 1K1PA 1S83A 1O2SA 2ANWA 3RXCA 4MNWA 1S82A 2TGAA 4F49A 1NFUA 2Y81A 4Y8ZA 3LJOA 4WVPE 1AKSB 1K21H 5C5OA 1BTWA 5BRRE 4CBOA 4ZKRU 3A8CA 2PKAA 2H9EH 2Y5GA 1C4Y2 2ZDVH 4Y8XA 2V3MA 1C1VH 4KTUA 4ZH8A 2WZQA 3MTYA 2BDAA 5IDKA 1GDNA 3Q76A 4O3UA 2NWNA 2BZ6H 1G3CA 4DT4A 2B5TB 3Q00A 1O2OA 1QL8A 1SSXA 4U2WA 1GGDC 3QTVH 3TGIE 1C1OA 2GV7A 2AS9A 2ZTZA 3DSPA 1DANH 1NESE 2WPKS 3OAAD 4AFQA 3U8OH 4LXBH 1MBMA 2BQ7B 5EIYA 1EP6A 2KCAA 3TK9A 4DY7B 1NBMD 1P57B 2PLXA 1A5HA 1O3EA 1ZSJA 2OBOA 3S69A 4OS1A 4FETA 3T26A 1AVXA 3HK3B 3KF2A 1SGDE 1GDQA 1SGQE 5TCCA 3E0PB 3RC5A 5F53A 5EJZA 3AK5A 1NO9H 1OWJA 1MKXK 2FZZA 1UTMA 2AH4X 3A89A 4GPGA 3DSOA 1YGCH 1BHXF 1GHZA 4XSKU 4E06H 2ZDMA 2ANMH 5C1UA 1O2XA 2RDEA 1SI5H 2FOMB 1L0ZA 3RLWH 2H5CA 5L2ZH 1D6RA 1TABE 2VIWA 1XUIA 1V2OT 1WDIA 5HIZA 3PRBA 2Y7XA 1P2IA 1P8VC 1DSTA 2GDDA 2VVVA 1HAIH 2QN5T 3RXOA 1G30B 1TNGA 1NPMA 3RU4T 3Q3XA 3GYLB 3K9XB 1A5GH 1T4VH 5T6DA 1SKYE 1UTNA 1KLIH 8GCHF 2BY9X 1RTFB 3H09A 1L4ZA 1ABIH 1IQHA 2OD3B 1J9CH 4MNXA 1TX7A 1CGIE 1LQEA 4ZHAA 1A46H 1O2UA 3FOAA 2OCVB 1T31A 1GI1A 3ZZBA 4MQAA 1GPZA 1Y3YA 2BY8X 3K65B 1UTJA 1TWXB 3KCGH 3LDXH 2WINI 2GTBA 2WPIS 2J94A 3MFJA 1VCWA 3GY6A 5A0BA 2KCYA 1Z8RA 2A2XH 2CXVA 4O9VA 2K0QA 4BAOB 3E91A 4F4OC 3VGCC 1YWUA 1T8LA 4I8LA 1FY8E 3QGJA 4GCHF 1OPHB 1C2MA 3ZZ7A 3GY2A 5HYOA 1IQGA 3EE7A 3TU7H 2G5NA 1AN1E 2JKHA 2QF4A 1CA0B 1RS0A 1WU1A 1XUJA 3SZEA 1O3LA 1LHEH 3RXRA 3ATMA 1VR1H 3A8DA 1JIRA 1HJAC 1BBRE 2Y82A 2ZZUH 4AOQA 3MU4A 1MU8B 1GI6A 1O5GH 4Y79A 3HKIB 1ESAA 2A7CA 4X6PA 4INHA 1F0UA 3SV6A 1HPGA 1W7XH 4I32A 3EE0B 4A92A 1O3FA 2BY5X 5CDFE 1E0FD 1IQFA 1V3XA 1LCYA 1BRUP 1V2JT 3RXLA 3A8AA 1RIWC 1PFXC 3LH3A 1QY6A 2EY4C 3V12A 1GBFA 5ESBA 4VGCC 1Z6EA 2BLQA 4TPYA 3HK6B 1H4WA 4ABDA 1SB1H 2XC5A 3M7TA 1C2JA 1ELEE 3F68H 1GMCG 4H42U 4QT8C 1W13U 2H2ZA 3SUDA 3VG8A 2WUCA 3SO3A 1WBGB 3O8CA 4BXSA 5C3NA 2ZFRH 2CMYA 1TBRH 1W0YH 4OS4A 5DP6A 1A0JA 3FP7E 1N8OC 4FU9A 4U30A 3RM2H 1DDJA 4ZXYH 4BAMB 3UR6A 2THFB 1GDUA 3U9AH 1GJ6A 1O32A 2BDBA 2XTTB 3F9GA 3ZV9A 2A7HA 4TY7A 3GY7A 3TJOA 2GGVB 1PPCE 4NA9H 2QE7D 2ALPA 2BVXH 4OS7A 1GMDG 2LPRA 1EATA 3W94A 3U69H 1ELFA 4Y7AA 1KXBA 1YPHE 3FFGA 2KR7A 3BG4B 4IN1A 3TLOA 1HGTH 2STAE 1TNKA 1F2SE 3BTDE 1GVLA 1Z1JA 4M9FA 1NS3A 1C2LA 1C1WH 1TOCB 4JYTA 1XKBC 3VPKA 1AU8A 3SGQE 2BX4A 1V2MT 2BYAX 2WPJS 2J98B 4FUJA 3NUMA 1FXYA 1PYTD 1ZJDA 4E7RG 1SQTA 1EKBB 3MMGA 1ZR0A 1YLNA 4X1NU 3OTJE 1BRBE 1EPTB 3P92A 1UVTH 4ESTE 2ZEBA 2BTCE 2BLOA 1ZHMA 2SGPE 1O3MA 1ZTJA 2Y80A 1FY4A 4ABHA 2ANYA 1JIMA 5JBBS 1MAXA 1DE7H 4NA8A 3GISB 5FBIA 1C5ZB 3T29A 4BTUB 3P8NA 1O3GA 1EPTC 3VXEH 4NG9H 2H9TH 1UJ1A 2XWAA 3U1JB 2XW9A 1S84A 3SNEA 3IITA 3QUMP 2FOAA 4Q4LA 2YMSD 3CENA 3ODFA 1FDPA 2AIPA 1ELDE 3PV5A 2A1DB 2GDEH 1O5EH 3MQKC 2C8XB 1HB0B 2AFQB 1C5WB 4ZCNA 1V2LT 4OS6A 4Y0YE 1B0EA 3EYDA 1K2I1 3TH2H 5JB8S 1P03A 1ZMLA 1OKXA 1G2MA 3I78A 3RXTA 3JZ1B 1O3HA 1PPEE 1SHYA 1O2VA 1A4WH 1L1NA 1JBUH 2M2AA 2PGQB 3BG4C 3PMAB 3QWCH 4BAKB 2XCFA 2P16A 1V2KT 1B0FA 1T4UH 1YCPH 5DK1A 1TA2A 1GMDF 2FS9A 2HRVA 1O5CB 1GJ7B 1A2CH 2ZFSA 5EU8A 1GJ5H 3UWJH 2ZFTA 2ZQ2A 3N7DA 2HNTC 1QNJA 1K28D 1S81A 1BRAA 4HGCA 4FOUC 2BD8A 2V3OH 3KQCA 4X2YA 2AGGX 1X7AC 1TBQH 2BDCA 1LVOA 5EXLA 1UCYH 3URCA 2ZDAH 2RA0A 1ESBA 5LH8A 1TPSA 1W12U 5EQQA 3PTNA 1O3NA 1AKSA 1HAGE 3PO1B 2Z9GA 1GBKA 4MLFB 1MTNB 1WQSA 1K9OE 2BY7X 2OLGA 1MTSA 1BITA 2HALA 1O37A 2QYIA 1C2IA 3BTGE 3FP6E 3I77A 2FYRA 3MU1A 1SLUB 1CA8B 5F03A 2VU8E 4IMZA 1Y3WA 4YOIA 3SJ9A 1NROH 3FZZA 1EZUC 2UUFB 4Y7BA 1NRPH 4Y0ZE 1ELTA 1W0JD 3MNCA 1FX0B 2H5DA 2FESH 1UVPA 2GVFA 1IQLA 3MNXA 2HVYB 4XBCA 3QLPH 1LMWB 3RXPA 1W3CA 3OX7U 3RMMH 1GBMA 2R3UA 1TGTA 1XUFA 2G5VA 2SGDE 5T6FA 2R2MB 3RM0H 5I46H 3ZVBA 3TNTA 1H8IH 3NXPA 3NPSA 3LJJA 3SV2H 3EAJA 3URDA 5EG4A 5HM2A 1W2KH 3F1SB 2EI8A 1H1BA 1O38A 2I6QA 2ZA5A 1EPTA 4Z0KA 1V2RT 1AWFH 1TPAE 2PW8H 1THRH 1UTPA 1FPHH 4B2AA 4TT3D 1AFEH 1CO7E 1MD7A 3Q3YA 1C2HA 1QJ1B 2OC1A 2BM2A 3UB0A 1MZDA 1ZGVA 2ZF0H 5A8XA 4X6NA 2EEKA 1EAIA 8LPRA 1H9LB 4H6SB 2ZCKP 4JYVH 2H1UA 2W5EA 3LGUA 1HXFH 3S9CA 1E34B 2ZFQH 1TGNA 2WV9A 1EZQA 3B23B 3MH7A 1YLDA 1C5RA 3M3SA 1C2DA 4Q2KA 3T2NA 1A1RA 3KN2A 1YKTA 3QTOH 2P8OC 1O3CA 1OWEA 1O5DH 2FOEA 5E2PA 2QF0A 2YOLA 1BCUH 2P3TB 2ZDKA 4AGJA 1FONA 1MKWH 3STJA 4BANB 1AUTC 1C1UH 2Z3DA 3B9FH 1S6LA 4NIVA 1GG6B 2YNAA 1NFYA 2Y7ZA 3FKSD 3RDZA 2HNTE 4X2WA 2G51A 4INLA 3VEQB 2GJGA 4AYVB 3LKWA 1ZZZA 1XUHA 3SU0A 1GBBA 4ABEA 2BD2A 3WWFA 4KTSA 1QB6A 4IW4E 3SV8A 3SJIA 4AB8A 1HAVA 1QJ7B 5T3HA 1C2GA 2UWOA 1A0HB 1J16A 1FY3A 1P01A 1VGCC 4B73A 4B2CA 5C67A 4NIWA 1QIXB 1VITG 3H5CB 2ZQ1A 5C5NA 5AFZH 4GVUA 4H6TA 1D3QB 5C20A 3CS0A 3ZZ5A 1LHCH 2WPHS 3SBKA 4Y10E 4DCDA 2BDYA 1AE5A 1IQJA 5JPMH 1UW7A 1FV9A 3BTHE 4D7FA 4UDWH 4CREA 3SGAE 1WSSH 1YF4A 1DXPA 4GUXA 1GI7B 1COWD 1MTVA 1O5BB 2EC9H 5L6NH 3FO8D 2G4UA 5J4SA 1SGCA 6CHAC 1EASA 3DUXH 4WH6A 1EZSC 3ZZ3A 5EODA 4CR5A 6LPRA 1JWTA 4AORA 1YCPM 2STBE 4F55A 9LPRA 3SOSA 2TGDA 1SLXB 2CJIA 1H9IE 1K1LA 4Y6DA 4OS5A 4E05H 4YXWD 3T25A 5E0JA 2ZDLA 1CT4E 1SR5C 4I8HA 3F2GA 2GZ8A 3D23A 4DG4A 1UO6A 4UE7H 5CHBA 1TNJA 1HYLA 4U32A 3U98H 2HPQH 1D6WA 2HWLB 1QB9A 2Z9IA 1PQAA 4YT6H 1O2IA 2GCTC 1E37B 4K60A 1SOZA 4K8YA 2ZHEH 2V7QD 2CHAB 3RXKA 3BTEE 3A88A 5EJLA 2FM2A 4X8VH 2ZNKH 5EQRA 1BMFD 2RA3A 2ILNA 3QZRA 4K1TA 3TIUA 3MH6A 1QB1A 1A3EH 2K8IA 1EZXC 1V2ST 2BD4A 1BRCE 1FI8A 1UTKA 3DT0H 3U1IB 1XUKA 2XYAA 1DX5M 1DUEA 1JMOH 1EFRD 1QZ8A 2PR3A 4X8UH 3UR9A 1TQ0B 3ZYDA 1AVWA 4YT7H 3A7XA 3STIA 1O2LA 3E0NB 2NU4E 4KP0A 1TAWA 3KQDA 1VKYA 1O2QA 3MWIU 4SGAE 4GHTA 3OEED 2PHBA 2JJ2D 5G4BA 2DE9A 2QA9E 1V2UT 3FAOA 2V0BA 1DWDH 3BN9A 3RUOA 3ZVAA 1K0HA 1INCA 2A5KA 2FYQA 4FUCA 2D2DA 5GXPA 5FPTA 1S6HA 3GICB 1GBEA 4A1VA 3LU9B 4MPXA 1MTWA 5GJ4B 3OYPA 1ZHPA 2BY6X 1Q2WA 1HAOH 1O3PB 1FQ3A 4Y8YA 1GI8B 3ZZ4A 2J5UA 1P2NA 4E7NA 5A8ZA 1G9IE 1UCYK 1J15A 1C5MD 3JZ2B 4WY3A 2VIPA 5HKKD 1JOUB 1P06A 2BVRH 3PYHA 1PPGE 2F9PA 4ZKNU 4P00A 3EA9A 4ABBA 2BDGA 3S0NA 3MYWA 2AERH 2A5IA 1C2FA 1PPHE 1DLEA 4GLYA 3SU4A 5GCHF 4ABAA 1ZRKA 3BG8A 5FX6A 5T1VA 3M35A 1AI8H 2RFKC 5B6LA 2VWLA 1GG6C 3BEIB 4DVAU 1O3OA 2PKSC 5GWZA 2QF5A 1RIWB 3QO6A 1EP5A 4A1TA 1ELAA 5K0HA 4B76A 2XXLA 2JIZD 4Z1MD 1O3DA 5CMXH 3RXJA 1ETSH 4XBDA 3SZNA 4FUEA 5DP9A 2BVSH 3SQHE 1SGTA 2EA3A 1TYNA 2ZHFH 3KIDU 1ZGIA 1HJAB 4TWWA 4D8NA 1C1RA 2P8OB 3A7VA 2L74A 5FPSA 2W7UA 1C5NH 3P8OA 1AWHB 2C3SA 2XOKD 1FZZA 4MPUA 1AIXH 2I6SA 1TOMH 3DCLA 2FOHA 1SMFE 1Z1IA 3AVZA 2VNTA 4JCNA 4HZHA 1EAXA 2V3HH 4DGJA 1ZTKA 2FTMA 2VWNA 2CHAC 4RN6A 3I29A 4JK5A 1TA6A 4X8TH 5FCRA 5FX5A 5AFYH 3DD2H 2WPLS 4AFZA 2A4OA 1OWIA 1HAYB 1KXCA 1SLWB 2EQNA 4ZHMU 1QL7A 1Y3VA 1ELVA 3SORA 2TRMA 1MD8A 3P8GA 4FUHA 2P95A 1ID5H 3GYMA 3TNSA 1EAWA 2HGTH 1AZZA 2BDIA 2XWBI 1WQVH 3SU1A 3ZYEA 2BHGA 4I8JA 1MCTA 1EOJA 2GP9B 2SGEE 1TBZH 1TGSZ 2QXIA 2J97A 1SGRE 2F83A 3ZV8A 1GBIA 2FXRA 2ZWLH 1XM1A 1KIGH 3ZZ9A 1TX6A 3PV2A 1Q31A 2XRCA 1AFQB 1TPOA 3L33A 1P2JA 1V2NT 4CBNA 2FOCA 2D26C 4ASUD 1AO5A 4IS5A 3ZIAD 3ATIA 1FMGA 2PSYA 5DP5A 1UVUH 2PP6A 2XC4A 3BTWE 1SQAA 3RC4A 2EI6A 1DSUA 2F91A 3S7KB 4ABGA 1IQEA 5AVDA 2R2WU 1QCPA 4RT0A 3ZVEA 2ZGBH 1O5AB 2IOTA 2O8MA 1W10U 3RU4E 1E79D 3E90B 1DY8A 4O3TA 1Y3UA 1LHDH 3RU4D 1QRXA 2BX3A 2XCNA 1XVOA 3SW2B 2WPMS 3MOCA 2KAIB 2RG3A 3P8FA 3TITA 1SGEE 2FMJA 4X1SU 3KYGA 3VB6A 1ABJH 3MNBA 1C1SA 2G8TA 1NC6A 1HAHH 1BTZA 1ARBA 2A32A 2A2QH 4I33A 1NFXA 5EJ1A 1C5TA 1FPCH 1C1MA 2KM0A 1BTUA 3HGNA 1N6YA 1O2TA 2P3FH 5JBAS 2QY0B 1P05A 3RLYH 2KZ4A 1G36A 1L4DA 1RD3B 4TWYA 4U01A 1FAXA 2CN0H 1GJAB 1C5VA 4DT7B 2XNIA 3E1XB 1F0SA 4AYYB 5L30H 3MU8A 1G3BA 2J9NA 1MCVA 6ESTA 1NRNH 3QX5H 1ZSKA 2ULLA 2W6ID 4KTCA 1OWKA 2J92A 4BOHA 3S9AA 4TPIZ 1BTYA 4YOGA 1EOLA 1DICA 1ANEA 1SQOA 2JH5D 1SLVB 3DA9B 3MO3A 1G3DA 2F9NA 3BF6H 1MUEB 4IC5A 2O8UA 2FIRH 1L1JA 2HOBA 4TY6A 1XVMA 3KQ5A 1UK4A 2FO9A 3R0FA 3SNBA 1EB1H 3SU2A 4WMEA 3LGIA 3P17H 1GMHF 4BAHB 2KX4A 3IWMA 4Q7ZA 3SI4H 3ZZ8A 4CHAC 3F2FA 5T6GA 1ZPZA 2FI4E 2Q6GA 1QRWA 2BQ6B 1WAYB 3LOXA 3TK5A 1WV7H 1CT2E 4UD9H 3RMLH 4B6EA 2GT7A 8KME2 1GI0A 2BD9A 3EDXB 2LNCA 3HATH 3TGKE 1O2ZA 3Q3KA 4ZROA 1OHHD 3UNQA 2ZGCA 3LPRA 3SYJA 1P2QA 1KTSB 4FU8A 2V6NA 5H4IB 2O8WA 2FX6A 2ZU1A 1ZPBA 1VITF 1DY9A 2ZU3A 1HFDA 2W26A 1C2KA 5LPEA 1F0RA 2BDHA 1HAPH 4DOQA 2BQWB 3K6ZA 4IGDA 1HCGA 3PLPA 4MPWA 1NFWA 1GWAA 3PO1C 4D7GA 1YY3A 1C5PA 1V2PT 3SU3A 2R9PA 3CP7A 2ESTE 4I7YH 2C90B 2OC8A 1GVZA 3GY8A 3ODDA 2A31A 4ISLA 2CGAA 4NA7A 3RXFA 3V7TA 1GJDB 4YLUA 3RXEA 3A84A 3UIRA 1Z7KA 5HIYA 2ZGXH 1A61H 2GCHF 1W7GH 4K1SA 3TH3H 2R0LA 4CHAB 3H7TA 2Q6DA 4BTIB 3PMBB 4DURA 1WUNH 2C8YB 1DITH 4FUGA 1MU6B 3M37A 4VGCB 9ESTA 2PTCE 2SFAA 1OXGA 1TX8A 4I31A 1OYQA 2A7JA 1GCTB 2ZECA 2FX4A 2H6MA 4YM9A 3MHWU 2F4LA 1SOTA 1V6DA 3M61U 3SUFA 2ZHDA 1QRZA 2A4GA 1CA0C 1E36B 1AUJA 1GI2A 4RSPA 2A4RA 3M5OA 4GHQA 1T32A 3VGCB 1P10A 1VJAU 5A0AE 4TYDA 1LVMA 5PTPA 2ZPSA 3W95A 2VH0A 2QXGA 1E38B 1WTHD 1E35B 3T28A 1QGFA 5ESTE 1C9TA 1YP9A 2G4TA 1PPFE 3SNCA 2QAAA 1SGIB 4CRGA 3PMJA 3E3TA 4K3JA 1A7SA 2VJ1A 3AAVA 2ZU4A 2XBWA 2FS8A 1HIAB 1QBVH 2WPDD 3CNRA 1ZYOA 4B75A 1ETTH 5EW2H 3O8BA 1P2KA 3V13A 3TH4H 1O30A 3QK1A 1BT7A 2PSXA 5ABWA 2H9HA 3FANA 6GCHF 2NU1E 2UUKB 2VGCB 1G2LA 1O2JA 1P3EA 3RP2A 4A6LA 2Q6FA 3O8DA 4ISHH 1V2QT 1C4V2 1BTHH 1KY9A 5EQSA 1G3EA 5TJXA 3VB3A 3FZDA 2VINA 5KGOA 4YESB 1Y59T 1GBCA 4SGBE 2W6JD 2O8LA 3SJKA 1SVPA 1GBAA 4AC9A 1H8ED 2AYWA 2B8OH 1DWEH 1O3JA 5CHAB 5DG6A 3L3TA 4GSOA 3SHCH 1S5SA 4ZAEA 1QR3E 1HAZB 1HAVB 1GHXH 3GDSA 3R3GB 1BA8B 1O3KA 2PFEA 3C27B 3VFEA 4K69A 2JJ1D 2BLVA 2TBSA 1GBLA 5GPIB 2TGPZ 3RC6A 4AFSA 1BTXA 1PPZA 2ZO3H 2XBYA 4ZMAH 1C1PA 1TRMA 3SI3H 3KGPA 1HNEE 2BOKA 1DWCH 1NY22 4RT1A 5JBCS 4THNH 4AB9A 4B1TA 3NRLA 5CHAC 1O34A 4WH8A 1P2OA 4A5TS 2J38A 1C2EA 3MH4A 1WXRA 2QC2A 1HRTH 2Z3CA 1ARCA 4DIHH 2ZFPH 4NSYA 1NTPA 1C5QA 3QZQA 1EUFA 2OK5A 2JETC 2VIDA 3PWBA 2GKVE 2ZFFH 1NRQH 3A85A 2ODYB 5GIBA 1ZOMA 1QBNA 3E6PH 3BV9B 1A3BH 3PROA 5F8XA 3LC5A 3V0XA 2WV5A 2SGFE 1UTOA 1KDQA 5DO4H 1DLKB 4OGXA 4Q80A 3HKJB 1HUTH 3BTKE 3F0PA 1O2NA 1H8HD 3GOVB 3SQEE 1O33A 2WYGA 3UREA 2R0KA 2B9LA 3UY9A 3SJ8A 1SGNE 1GGDB 3EQ0H 2ZKSA 1LHFH 1XXDA 3GDUA 1GJBB 1O5FH 4NFEA 3F6UH 2G81E 2ANKH 1CBWC 1CU1A 1LPZB 1Z8GA 1SQRA 4NGAH 3KL6A 2ZPRA 1PQ8A 1O3BA 4R8TB 3F0OA 5HGGA 2ZGJA 5DP4A 3TVJB 1THPB 1PYTC 3F9EA 4Y11E 3ATWA 4LK4A 4P02A 1FLEE 2VVUA 1ANDA 3E8LA 1SGFG 1MQ6A 1OSSA 4YOJA 1NU9A 2YMSB 5FAHA 3ZVFA 1K1JA 1OX1A 3LIWA 1ZTLA 2F9OA 3B8JA 1CE5A 3RXAA 5L2YH 3KQEA 1THSH 2QXHA 1DUAA 7GCHG 1YPHC 2AMQA 4CRDA 3W1EA 5A2MH 2VB0A 3M36A 2AMDA 2PGBB 2ZCHP 2GX4A 4HG6A 8GCHG 2KCPA 3BEFB 5J4QA 4O97A 3S9BA 1L1GA 4NIXA 5HXFA 3A8BA 5EXMA 1ZJKA 6CHAB 2GMTB 1AB9B 1M9UA 3F9FA 1NBME 1E1RD 2CF8H 2GT8A 5AF9H 1AGJA 1SFIA 2J95A 4YO9A 1HDTH 3UNRA 4H4FA 1O2RA 4B71A 1Y5UT 4D9QA 1MTNC 2Z9LA 5C0UA 4NZQA 2QIQA 1ELBA 5FBEA 4AGKA 1IQNA 4FXGH 1KYNA 5EGMA 3LGWA 1GI3A 1S0QA 3PB1E 4K2YA 1N8OB 1OYTH 3UAIC 1KLJH 4ABFA 1SGYE 1VGCB 3M3TA 1C5LH 1PQ5A 5DJ7A 4OS2A 4YTAA 3LGYA 3UQVA 1BZXE 1SBWA 3A83A 3GCHC 4IBLH 3MI4A 1PPBH 2Z7FE 4K5ZA 1O35A 1K1MA 2Z3EA 4M7GA 1LPGB 3OY5U 1AY6H 1TE0A 1TIOA 4XOJA 1OWHA 1GBDA 4BAQB 1QL9A 4ACAA 3ATKA 7LPRA 3OY6U 2ALVA 1QJ6B 2RCEA 1HLTH 5E0HA 7GCHF 1P9UA 5CE1A 2ZU5A 2ZP0H 5DKMA 3LGVA 2SGAA 2TGTA 1BQYA 4X2VA 1GI4A 3SUGA 2BOHB 1SFQB 2QGRA 4FVDA 1DWBH 2PV9B 3QN7A 1O36A 2OQ5A 1HXEH 1O2PA 2VWOA 4XDEA 1T8NA 1LVYA 3NK8A 4FUDA 3MO6A 5DN6D 5EOKA 2VWMA 1NRRH 1MKWK 3OE7D 2W7SA 3ATLA 4X6MA 3BTME 2ZHWH 1S6FA 4WJG2 1CT0E 5FL7D 1UVSH 1GHBF 3BSQA 4LOYH 1KLTA 4JZ1A 4ZHLU 1ELGA 1O3AA 3DFJA 2SNVA 4XD7D 1FIZA 3EGKH 1JRTA 3KNXA 3PLKA 1EJMA 1KSNA 2A5AA 1P09A 4MPVA 2O9QA 3A80A 4CRFA 1RJXB 1NRSH 3ZVCA 1IQIA 1YLCA 2IJOB 5A8YA 2OXSA 3NCLA 1CBWB 1TLDA 1HJ9A 4MVNA 1EJAA 5F8TA 4RKJB 3T27A 2PWXA 1ZPCA 2P3UB 1F5LA 5JDUB 5F8ZA 1W11U 2GV6A 2BD3A 1RFNA 1C9PA 4XRNA 4Q7XA 3G01A 4INKA 1SL3A 2PKSB 1P9SA 1WCZA 1KDQB 5KECA 4JK6A 1J17T 2FWWA 5KEDA 2OBQA 1GMHG 3WWBA 4YLQH 1UHBB 3M7QA 3CS7A 2XC0A 2VH6A 1EJNA 2IJD1 1KTTB 3V3MA 2FI3E 3PLBA 1KXDA 2G00A 2AHME 4ZXXH 3UFAA 3VXFH 3A7TA 5DSFA 1DPOA 4LZ4B 4ABJA 2ZPQA 1MKXH 1W8BH 1YPGH 1GI9B 4CRCA 3IG6B 1WYKA 2GZ9A 2LELA 2ZCLP 1GHAG 2BZAA 3UPEA 2J34A 3FP8E 3GCTG 3RXHA 4ZKOU 4LZ1H 1IHTH 2K1QA 1FY1A 4ISIH 1YBWA 5C0TA 2FLRH 1TONA 1GJ8B 3E16B 3A81A 1EAUA 2ASUB 1QQ4A 4R0IA 1GBTA 1P2MA 3KHVA 2Q1JA 4UFDH 3D62A 2C8ZB 3NZIA 1D3DB 3RXVA 3SNAA 1QURH 3F9HA 1DFPA 3TGJE 5EXNA 3M5MA 4AZ2B 4Y71A 4GAWA 2BD7A 4NIYA 1AFQC 7KMEH 4NSVA 2VGCC 1IHSH 2JH6D 3K2UA 3L6PA 1K22H 1V2WT 2F43B 3QDZB 2PUXB 1GBHA 2IPHA 2FOFA 1MZAA 2HNTF 3UOPA 3A7YA 2J98A 1KXFA 5DP8A 3SGBE 1NT1A 2F9UA 3Q77A 2ZC9H 1Y8TA 2IPQX 1WOFA 3TK6A 1H9HE 2OINA 4MNYA 4I86A 4AFUA 5FXLA 2ZTYA 3ZZ6A 2KFWA 3GCTF 4X1QU 2M5TA 1ORFA 1F5RA 3P95A 4JZIA 1GL1A 1SG8B 1YPEH 1OWDA 4X2XA 1F0TA 8ESTE 3D49H 2VIOA 3A7WA 1O2YA 3SV7A 3HGPA 3PM3A 2OC0A 1Z8JB 2G55A 5DGJA 1HJ8A 1CSOE 1G37A 1OOKB 3RMOH 3UNSA 2F3CE 2BXTH 1ACBE 1GCDA 2GZ7A 1BTPA 2FPZA 4CR9A 1C5OH 1B5GH 1FNIA
chains in the Genus database with same CATH topology
1RXPA 2P59A 3H7OA 1FUJA 3A87A 1ZMJA 1CQQA 1OP0A 1C4U2 3SHAH 3LT3A 5FHTA 2NU3E 1J14A 5BPEA 2Y6TA 2TIOA 3MH5A 2XBVA 3GY5A 1FJSA 1YC0A 1BJUA 1C1TA 3SU6A 5B6OA 2F9BH 1GJ4H 4IN2A 1UHBA 1EB2A 2OP9A 2QF3A 1GCTC 2W3KA 1TFXA 1QQUA 4JMYA 3EA8A 1BBRH 1BMMH 1O2WA 2FEQH 1GL0E 2ZG0H 1MAYA 2ZIQH 3RXIA 1HV7A 3T62A 2OTVA 2AIQA 1Y5BT 4MDSA 1C5XB 1QA0A 3A86A 2UWLA 1GHYH 2ODPA 1G32B 2PUQH 5DPAA 1ZRBA 4K8BA 1TNHA 1Z8IB 4RKOB 1QHRB 2HPPH 4FUFA 5LGOA 1VCPA 2YNBA 2IN2A 4AN7A 1AQ7A 4J2YB 4CRBA 3PWCA 4NFFA 1P02A 5JBTA 1NM6A 2UUYA 4FUBA 1C5SA 1OP2A 1DM4B 4BNRA 1BUIA 5FPYA 1HAXB 1C1QA 1LKAA 2C8WB 4WMFA 1D4PB 2XBXA 1LKBA 3SJOA 1K1OA 3DFLA 2G52A 5E0GA 2BD5A 1NN6A 4DJZB 2Z6BD 5EW1H 2OUAA 3P6ZB 1Q3XA 1BB0B 1ANCA 1XKAC 5AHGH 2KAIA 4Y76A 1K1IA 5LPFA 1ETRH 3A82A 3A7ZA 1GHWH 3GCOA 4A1XA 4HTCH 3ESTA 2B7DH 5GCHG 4JZDH 4ABIA 3AW0A 1ZLRA 1GHVH 4HFPB 1BMAA 3PTBA 4X0WU 2FODA 1PJPA 2ZHQH 1C1NA 2OC7A 3MU0A 1SPJA 1BIOA 3UOUA 1TGBA 4MNVA 1U6QA 5E8EH 5A09A 3ELAH 1QTFA 2WV4A 1BBRK 2GCTB 3KEEA 4OGYA 1S0RA 1LTOA 2EI7A 1C5YB 1YPJH 1VJ9U 2NU2E 4UFGH 1TRYA 1GBJA 1IAUA 2Z94A 3RXSA 4FVBA 4NZLA 2P94A 4GCHG 1Z6JH 2UUJB 1CHGA 1H8DH 3C1KA 4ZKSU 3AW1A 3VB4A 1BOQA 1LVBA 2CV3A 3S7HB 1TALA 3M5LA 5JB9S 1UTLM 3RXMA 2RDLA 4UONA 3FVFB 5C2ZA 1RRKA 2C4FH 4J1YA 1AHTH 5SGAE 2AGEX 3PV4A 1YPMH 4KKDA 1CHOF 1XXFA 2D1JA 2AEIH 1QFKH 2BMGB 3TJNA 1BDAA 1A0LA 1F5KU 2HVXA 1MBQA 3TJVA 3LC3A 1VITH 7ESTE 1P12E 1XMNB 2J4IA 4ISOA 2DE8A 2FLBH 4WF8A 1O2MA 2GD4B 3BTQE 4B74A 4WMDA 3ENSB 3RXQA 1DVAH 5ETXA 2WUBA 5C1XA 5IYTA 1P11E 3KQBA 1W0ZU 2O8TA 2ZTXA 3QGNB 2FOBA 1BMNH 1SHHB 2ZU2A 1FN8A 4ASHA 3LH1A 4B2BA 2A45B 1GHBG 4IMQA 5K7RA 4FU7A 1ELCA 1L2EA 3ZZCA 1UK3A 1TQ7B 1O2HA 1S85A 2Z9KA 2WYJA 1V2TT 3RXBA 5EPNA 4CRAA 1JXPA 1TNIA 3SU5A 1D3PB 2ODQA 2NU0E 4XFQA 1KXAA 1MTUA 3T5FH 2HLCA 4A7IB 2AGIX 3VB5A 3RXDA 2JH0D 4CH8B 1K1NA 4K1EA 1EXFA 1O39A 2FP7B 3ZVDA 5E2OA 4MTBA 2VVCA 4KGAA 5FCKA 1UMAH 3BIUH 3BEUA 2W3IA 4I8KA 2FDAA 1O3IA 1QA7A 1D9IA 1SGFA 1T8OA 2D8WA 1J8AA 2GMTC 1F7ZA 3RXUA 4BXWA 3OSYA 3SV9A 4UFFH 1UCYE 5DP3A 5JYIA 3TPIZ 1SC8U 2ZI2H 4D76A 1LQDB 2P93A 4UFEH 1CGHA 1BHXB 1AVGH 1AE8H 1P0SH 3WY8A 2VIQA 2QCYA 2V35A 3U8TH 5F6MA 1AD8H 1OP8A 2BXUH 3VB7A 1CHOG 3ZZAA 3M5NA 4JZFH 5HM9A 1CVWH 3NKKA 3U8RH 1LDTT 1MQ5A 2FOGA 2QXJA 3SNDA 3ZVGA 1DOJA 1RTKA 1GMCF 1AZ8A 1MMJN 1YCPK 2A0QB 1TPPA 2F9VA 3PMHB 2PKAB 1YM0A 4X6OA 1IOEA 2A4QA 1N1LA 1RGQA 1Z71A 4X1PU 1FY5A 4XBBA 3OU0A 1UVOA 3HPTB 4NWKA 3GY4A 4X8SH 3TJUA 1FIWA 1GJ9B 1DS2E 1WTGH 4Z6AH 1XUGA 1P04A 4AG2A 1UK2A 1OS8A 1O31A 2J2UA 1GI5A 1TB6H 3DHKH 1DT2A 4AG1A 2UWPA 5LPRA 4MG3A 3SN8A 5HMAA 4CH2B 1GVKB 2R3YA 3N7OA 1SGPE 5C1YA 1Y3XA 5GDSH 1B7XB 5I25A 1O0DH 2TPIZ 6GCHG 2ZDNA 2C93B 1TGCA 4FUIA 3MNSA 1AMHA 2ZGHA 1ANBA 4DW2U 4PROA 4KELA 1LPKB 4WXVA 5TCAA 3UQOA 3BTFE 4JYUH 1KXEA 2JETB 3LONA 4BTTB 2DUCA 1T8MA 4ZUHA 1MH0A 1EQ9A 4NCYA 1QBOA 2BB4A 1C5UA 3BIVH 2SGQE 3M7UA 1P3CA 1HBTH 4X1RU 3UWIA 3GCHB 3GCNA 1IQKA 1ESTA 2VIVA 1PQ7A 3GDVA 4UEHH 1YYY1 5EPYA 1JRSA 4JZEH 3LGTA 5DP7A 1NZQH 3O8RA 2FI5E 1D3TB 1ZMNA 1BJVA 3K6YA 1O2GH 4WXIA 2CF9H 1GHAF 4Q7YA 2OQUA 1YPLH 3P70B 1NU7B 1YPKH 1O2KA 4IC6A 2PTNA 1HIAA 3AAUA 2FTLE 2Z9JA 4NWLA 2QV1A 1F92A 4O03A 2B0FA 4DIIH 1VCQA 3MO9A 4XE4A 2BLWA 3RMNH 1VZQH 3GY3A 1DXWA 1IQMA 3EA7A 1UTQA 1ZHRA 4YZUA 1Y5AT 1ZSLA 1W14U 4HI3A 1GJCB 1FN6A 3ITIA 4ISNA 4D9RA 3AASA 1V2VT 2SNWA 1AB9C 3M3VA 2Y5FA 1CGJE 1TRNA 1T7CA 5A0CA 2AMPA 4AX9H 4I8GA 2GCHG 3MU5A 3NWUA 1FAKH 3RXGA 1TMTH 3UTUH 3ZZDA 1EX3A 1TMBH 3UUZA 1LO6A 1N6XA 1A5IA 1TMUH 4WWYA 1XX9A 1BMLA 1LHGH 1TNLA 3SUEA 3D65E 2Y5HA 3BTTE 1RTLA 1K1PA 1S83A 1O2SA 2ANWA 3RXCA 4MNWA 1S82A 2TGAA 4F49A 1NFUA 2Y81A 4Y8ZA 3LJOA 4WVPE 1AKSB 1K21H 5C5OA 1BTWA 5BRRE 4CBOA 4ZKRU 3A8CA 2PKAA 2H9EH 2Y5GA 1C4Y2 2ZDVH 4Y8XA 1C1VH 4KTUA 4ZH8A 3MTYA 2BDAA 5IDKA 1GDNA 3Q76A 4O3UA 2NWNA 2BZ6H 1G3CA 2B5TB 3Q00A 1O2OA 1QL8A 1SSXA 4U2WA 1GGDC 3QTVH 3TGIE 1C1OA 2GV7A 2AS9A 2ZTZA 1DANH 1NESE 2WPKS 4AFQA 3U8OH 4LXBH 1MBMA 2BQ7B 1EP6A 3TK9A 4DY7B 1P57B 2PLXA 1A5HA 1O3EA 1ZSJA 2OBOA 3S69A 4OS1A 3T26A 1AVXA 3HK3B 3KF2A 1SGDE 1GDQA 1SGQE 5TCCA 3E0PB 3RC5A 1NO9H 1OWJA 1MKXK 2FZZA 1UTMA 2AH4X 3A89A 4GPGA 1YGCH 1BHXF 1GHZA 4XSKU 4E06H 2ZDMA 2ANMH 5C1UA 1O2XA 1SI5H 2FOMB 1L0ZA 3RLWH 2H5CA 5L2ZH 1D6RA 1TABE 2VIWA 1XUIA 1V2OT 2Y7XA 1P2IA 1P8VC 1DSTA 2GDDA 2VVVA 1HAIH 2QN5T 3RXOA 1G30B 1TNGA 1NPMA 3RU4T 3Q3XA 3GYLB 3K9XB 1A5GH 1T4VH 5T6DA 1UTNA 1KLIH 8GCHF 2BY9X 1RTFB 1L4ZA 1ABIH 1IQHA 2OD3B 1J9CH 4MNXA 1TX7A 1CGIE 1LQEA 4ZHAA 1A46H 1O2UA 2OCVB 1T31A 1GI1A 3ZZBA 4MQAA 1GPZA 1Y3YA 2BY8X 3K65B 1UTJA 1TWXB 3KCGH 3LDXH 2WINI 2GTBA 2WPIS 2J94A 3MFJA 1VCWA 3GY6A 5A0BA 1Z8RA 2A2XH 2CXVA 4O9VA 4BAOB 3E91A 4F4OC 3VGCC 1T8LA 4I8LA 1FY8E 3QGJA 4GCHF 1OPHB 1C2MA 3ZZ7A 3GY2A 5HYOA 1IQGA 3TU7H 2G5NA 1AN1E 2JKHA 1CA0B 1RS0A 1WU1A 1XUJA 1O3LA 1LHEH 3RXRA 3ATMA 1VR1H 3A8DA 1JIRA 1HJAC 1BBRE 2Y82A 2ZZUH 4AOQA 3MU4A 1MU8B 1GI6A 1O5GH 4Y79A 3HKIB 1ESAA 2A7CA 4X6PA 4INHA 1F0UA 3SV6A 1HPGA 1W7XH 4I32A 3EE0B 4A92A 1O3FA 2BY5X 1E0FD 1IQFA 1V3XA 1LCYA 1BRUP 1V2JT 3RXLA 3A8AA 1RIWC 1PFXC 3LH3A 1QY6A 3V12A 1GBFA 5ESBA 4VGCC 1Z6EA 2BLQA 4TPYA 3HK6B 1H4WA 4ABDA 1SB1H 2XC5A 3M7TA 1C2JA 1ELEE 3F68H 1GMCG 4H42U 4QT8C 1W13U 2H2ZA 3SUDA 2WUCA 3SO3A 1WBGB 3O8CA 4BXSA 5C3NA 2ZFRH 2CMYA 1TBRH 1W0YH 4OS4A 5DP6A 1A0JA 3FP7E 1N8OC 4FU9A 4U30A 3RM2H 1DDJA 4ZXYH 4BAMB 3UR6A 2THFB 1GDUA 3U9AH 1GJ6A 1O32A 2BDBA 2XTTB 3F9GA 3ZV9A 2A7HA 4TY7A 3GY7A 3TJOA 2GGVB 1PPCE 4NA9H 2ALPA 2BVXH 4OS7A 1GMDG 2LPRA 1EATA 3W94A 3U69H 1ELFA 4Y7AA 1KXBA 1YPHE 3FFGA 3BG4B 4IN1A 3TLOA 1HGTH 2STAE 1TNKA 1F2SE 3BTDE 1GVLA 1Z1JA 1NS3A 1C2LA 1C1WH 1TOCB 4JYTA 1XKBC 3VPKA 1AU8A 3SGQE 2BX4A 1V2MT 2BYAX 2WPJS 4FUJA 3NUMA 1FXYA 1PYTD 1ZJDA 4E7RG 1SQTA 1EKBB 3MMGA 1ZR0A 4X1NU 3OTJE 1BRBE 1EPTB 3P92A 1UVTH 4ESTE 2ZEBA 2BTCE 2BLOA 1ZHMA 2SGPE 1O3MA 1ZTJA 2Y80A 1FY4A 4ABHA 2ANYA 1JIMA 5JBBS 1MAXA 1DE7H 4NA8A 3GISB 5FBIA 1C5ZB 3T29A 4BTUB 3P8NA 1O3GA 1EPTC 3VXEH 4NG9H 2H9TH 1UJ1A 2XWAA 3U1JB 2XW9A 1S84A 3SNEA 3IITA 3QUMP 2FOAA 3CENA 3ODFA 1FDPA 2AIPA 1ELDE 2A1DB 2GDEH 1O5EH 2C8XB 1HB0B 2AFQB 1C5WB 1V2LT 4OS6A 4Y0YE 1B0EA 3EYDA 1K2I1 3TH2H 5JB8S 1P03A 1ZMLA 1OKXA 1G2MA 3I78A 3RXTA 3JZ1B 1O3HA 1PPEE 1SHYA 1O2VA 1A4WH 1L1NA 1JBUH 2PGQB 3BG4C 3PMAB 3QWCH 4BAKB 2XCFA 2P16A 1V2KT 1B0FA 1T4UH 1YCPH 5DK1A 1TA2A 1GMDF 2FS9A 2HRVA 1O5CB 1GJ7B 1A2CH 2ZFSA 5EU8A 1GJ5H 3UWJH 2ZFTA 2ZQ2A 2HNTC 1QNJA 1K28D 1S81A 1BRAA 4HGCA 2BD8A 2V3OH 3KQCA 4X2YA 2AGGX 1X7AC 1TBQH 2BDCA 1LVOA 5EXLA 1UCYH 3URCA 2ZDAH 2RA0A 1ESBA 5LH8A 1TPSA 1W12U 5EQQA 3PTNA 1O3NA 1AKSA 1HAGE 3PO1B 2Z9GA 1GBKA 4MLFB 1MTNB 1WQSA 1K9OE 2BY7X 2OLGA 1MTSA 1BITA 2HALA 1O37A 2QYIA 1C2IA 3BTGE 3FP6E 3I77A 2FYRA 3MU1A 1SLUB 1CA8B 5F03A 2VU8E 4IMZA 1Y3WA 4YOIA 3SJ9A 1NROH 3FZZA 1EZUC 2UUFB 4Y7BA 1NRPH 4Y0ZE 1ELTA 3MNCA 2H5DA 2FESH 1UVPA 2GVFA 1IQLA 3MNXA 4XBCA 3QLPH 1LMWB 3RXPA 1W3CA 3OX7U 3RMMH 1GBMA 2R3UA 1TGTA 1XUFA 2G5VA 2SGDE 5T6FA 2R2MB 3RM0H 5I46H 3ZVBA 3TNTA 1H8IH 3NXPA 3NPSA 3LJJA 3SV2H 3EAJA 3URDA 5EG4A 5HM2A 1W2KH 3F1SB 2EI8A 1H1BA 1O38A 2I6QA 2ZA5A 1EPTA 4Z0KA 1V2RT 1AWFH 1TPAE 2PW8H 1THRH 1UTPA 1FPHH 4B2AA 1AFEH 1CO7E 1MD7A 3Q3YA 1C2HA 1QJ1B 2OC1A 2BM2A 1MZDA 1ZGVA 2ZF0H 5A8XA 4X6NA 2EEKA 1EAIA 8LPRA 1H9LB 4H6SB 2ZCKP 4JYVH 2H1UA 2W5EA 3LGUA 1HXFH 3S9CA 1E34B 2ZFQH 1TGNA 3B23B 1EZQA 3MH7A 1YLDA 1C5RA 3M3SA 1C2DA 4Q2KA 3T2NA 1A1RA 3KN2A 1YKTA 3QTOH 2P8OC 1O3CA 1OWEA 1O5DH 2FOEA 5E2PA 2QF0A 2YOLA 1BCUH 2P3TB 2ZDKA 4AGJA 1FONA 1MKWH 3STJA 4BANB 1AUTC 1C1UH 2Z3DA 3B9FH 4NIVA 1GG6B 2YNAA 1NFYA 2Y7ZA 3RDZA 2HNTE 4X2WA 2G51A 4INLA 3VEQB 4AYVB 3LKWA 1ZZZA 1XUHA 3SU0A 1GBBA 4ABEA 2BD2A 4KTSA 1QB6A 4IW4E 3SV8A 3SJIA 4AB8A 1HAVA 1QJ7B 5T3HA 1C2GA 2UWOA 1A0HB 1J16A 1FY3A 1P01A 1VGCC 4B73A 4B2CA 5C67A 4NIWA 1QIXB 1VITG 3H5CB 2ZQ1A 5C5NA 5AFZH 4GVUA 4H6TA 1D3QB 5C20A 3CS0A 3ZZ5A 1LHCH 2WPHS 3SBKA 4Y10E 4DCDA 2BDYA 1AE5A 1IQJA 5JPMH