3LH1A

Q191a mutant of the degs-deltapdz
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
199
Chain Sequence
b'STDETPASYNLAVRRAAPAVVNVYNRGLLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPLGQTITQGIISATGRIGLNPTGRQNFLATDASINHGNSGGALVNSLGELMGINTLSPEGIGFAIPFQLATKIMDKLIRDGRVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 41
structure length 199
sequence length 217
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lh1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lh1A02
5E8EH 1WQVH 1AB9B 2Y5GA 2IOTA 1P09A 2GZ8A 2NU3E 1BMMH 1FY3A 5A0CA 1T7CA 1GL1A 3SU5A 1O3GA 2G8TA 2FOFA 3GISB 3MTYA 3RXEA 1YKTA 2BM2A 2OQUA 3T5FH 1WAYB 2ANWA 4E05H 1BOQA 1OWDA 2FTLE 1DLEA 4KTCA 3NK8A 4DJZB 3MMGA 1TE0A 3MWIU 1WTGH 2Q1JA 4NWKA 4CRDA 1QL9A 3DA9B 1TRNA 1ABIH 4FUGA 1QFKH 1EOJA 2QY0B 5JBTA 3W95A 1ZSLA 1SGTA 4R8TB 3U98H 9LPRA 3M61U 1GHYH 1SQOA 2Z6BD 1NY22 4DCDA 2AGEX 2ZF0H 4NFFA 2AYWA 1PQAA 1FMGA 3FZZA 3ELAH 1BTUA 5TCCA 7ESTE 2ZU3A 1ESTA 3HKJB 3PLKA 3RLWH 1LPZB 3EA8A 1C4V2 1BBRK 1EAIA 1O3HA 3R3GB 3UNRA 1CA0C 3I78A 5E2OA 1GJ7B 2TGDA 2H5DA 2ZCLP 1P2JA 1DOJA 1MBQA 3UNQA 3E0NB 2FPZA 1YPKH 2P16A 1QBNA 2BD8A 5JBAS 2O8MA 1SFQB 4HI3A 4Y8YA 2PSYA 3JZ2B 2ALVA 1HJAB 4M7GA 4ISNA 1DWCH 1KLIH 1LDTT 2VGCC 3MH7A 1HIAB 3RDZA 2Q6DA 1H8DH 1G37A 4MPXA 2BY5X 2NWNA 4NZQA 2PTNA 2C8XB 1XVMA 1GHBF 1ELGA 1EZXC 1TOMH 2OBQA 1ZJDA 1V2ST 1E37B 3LT3A 2GDDA 4CRAA 3S9CA 5EXMA 2A7JA 2FS8A 5GPIB 7LPRA 3L3TA 3O8RA 4OS6A 1ARBA 1P12E 2DE8A 2WUBA 1P2QA 5FHTA 5DK1A 1VITF 1UVUH 1A3EH 3UNSA 2PR3A 1UCYH 5JYIA 1LVYA 2STAE 4NG9H 4D9QA 1EUFA 1FIWA 2GX4A 1ELDE 3LJOA 1O2KA 2ZTYA 2BDAA 1BA8B 3TK6A 1TYNA 4GLYA 5FX6A 1BMAA 4JZEH 1SOZA 1V2QT 2BD7A 4BOHA 1P11E 2G5VA 2H6MA 4KGAA 4A7IB 1K28D 3P8FA 1BHXB 2VIVA 4IBLH 4H4FA 1FV9A 1GBLA 2BXUH 1GBAA 1GBIA 1UTNA 5IDKA 1GHAG 4X1PU 1V2UT 1BTWA 4HZHA 5L30H 2OD3B 1O2IA 3ATWA 3OYPA 1KXBA 4K69A 3CENA 3KHVA 2C8WB 2H9TH 2XRCA 2VH0A 3S7KB 3PTNA 5A8ZA 2Z9IA 3QZRA 1Y5BT 1ARCA 1ZRKA 4KKDA 1F5RA 1HYLA 1O3LA 3A83A 1HBTH 1K1LA 1TWXB 3T29A 5IYTA 5BRRE 1TBRH 4UD9H 2P59A 4UE7H 1O5AB 2BY6X 1ETSH 1WU1A 5L2YH 5E0HA 2BXTH 4QT8C 2FOHA 1AFEH 1CT0E 2B5TB 2BOKA 3SGAE 1QTFA 1CVWH 1DUEA 1EPTA 2F91A 3GDUA 3UUZA 1C2JA 3RXJA 1EQ9A 1QQ4A 2VGCB 3RMLH 2FYRA 3BG8A 5E0JA 1ETRH 4JMYA 1EJAA 4K1EA 3LIWA 1AQ7A 2GVFA 1PQ7A 2GMTC 1AVXA 1MKWK 4NCYA 1DT2A 1O2XA 1QL8A 1VITH 3RP2A 2ZWLH 1XUJA 5F6MA 1HJ9A 2FM2A 3NZIA 1MKWH 1BTYA 3DFLA 1ACBE 1KDQA 3P17H 1G36A 4IN2A 2XC5A 1J14A 2VWNA 1GHWH 3ZZBA 2QCYA 4Q7ZA 4NA7A 4KTUA 1JXPA 1V2NT 3TGIE 3ZVFA 4I32A 1GI1A 1AVWA 2CHAC 1Z8RA 2CV3A 2SFAA 3S69A 1TNJA 1NS3A 3GY2A 1H1BA 3F6UH 3PM3A 1EP5A 2BDIA 2ZDKA 1AWFH 1FAKH 1L2EA 3T2NA 1AKSA 4YZUA 2ZFSA 2QXJA 2F9VA 5AFZH 4Y0ZE 5E2PA 1GI6A 2NU2E 4IMQA 1TA6A 3FVFB 3QTOH 2NU4E 1W11U 1AI8H 1LVOA 1NRPH 1P0SH 3EDXB 3PMHB 4NFEA 2ZDLA 1FJSA 5EOKA 3IWMA 1SI5H 4OS4A 1CHGA 1GDQA 4WMDA 2VVCA 3RLYH 2ZGHA 1GHBG 2HWLB 1CGJE 1GBCA 1OKXA 2SNVA 2FX4A 1HNEE 1O2MA 3NKKA 4BXWA 3TJOA 4BTIB 3EA9A 1THRH 1Z8GA 1ELAA 4IMZA 4IW4E 2ZGXH 1NRQH 4AFUA 2WPKS 4HTCH 3BIVH 4DIHH 3P8NA 2FP7B 3A84A 3QGNB 1O3MA 4ZUHA 1GI8B 1A7SA 1O31A 2ZU5A 5EXNA 3UR6A 3RUOA 3E0PB 1TGCA 1CU1A 1K1NA 2FOEA 1O3JA 1HLTH 1O2VA 5AFYH 2P94A 3LKWA 1SOTA 4ISLA 1DSTA 2H2ZA 1HXEH 2OC0A 1TNIA 3BTFE 4XOJA 1CA8B 2FWWA 3URDA 1BHXF 2GMTB 4AYYB 2UUYA 4ABGA 3FP8E 3UWIA 1BB0B 1GMHF 1A5IA 1ZMNA 4ABFA 2ZNKH 4ZXXH 3LH1A 2ZFFH 5GJ4B 3RM0H 1C2MA 4K8BA 2FIRH 3AAVA 1K1JA 3LC5A 1J17T 2HRVA 2ZTXA 3U9AH 1BTXA 2PHBA 1HAVB 2EC9H 1O5FH 3T28A 4TYDA 2BDGA 4E06H 1HCGA 4NSYA 4X8TH 1DPOA 2R9PA 3TJVA 1HV7A 1IQIA 3RXPA 3QK1A 2FOCA 1UK4A 4CH8B 1QBOA 1O2YA 1XXDA 3RMOH 2YNBA 1O34A 2BQ7B 4NA8A 2BLQA 3V3MA 3PYHA 2OTVA 3RXAA 3RXSA 3A7YA 1C5TA 3HGPA 4B76A 1OPHB 5T6GA 1IQJA 1UVPA 3T26A 3VB6A 1O2GH 1NFYA 2AFQB 3D62A 3E6PH 5K7RA 1J16A 1TOCB 1MU8B 3SQEE 2CGAA 3M36A 5EW1H 3SJ8A 1YGCH 4GHQA 3ZZ7A 2P93A 1RS0A 3HPTB 4ZKRU 1ZGVA 2TPIZ 1AO5A 3UQVA 4B1TA 1O37A 1JBUH 1DM4B 1GMCF 1W0YH 2QXHA 1AUTC 5H4IB 1LVBA 3EGKH 3K9XB 2J92A 2Z9JA 1K9OE 3F9HA 1D3TB 1LTOA 5F03A 1O0DH 5EODA 3KQEA 2QF3A 3LU9B 1GJAB 3OTJE 1TA2A 1GL0E 3GDVA 4FUFA 3T25A 4VGCC 2H5CA 1EPTC 5A2MH 4I33A 2XW9A 1KXFA 1YC0A 1W3CA 1V2VT 5EW2H 1ZMJA 3TJUA 1V2PT 4UFFH 2OP9A 5DPAA 1AHTH 1FIZA 4JZ1A 1BJUA 3QLPH 2ZG0H 4FUCA 4LOYH 1O32A 4FU9A 1EASA 3HK3B 1C5XB 4OGXA 4AYVB 1Q2WA 4MDSA 1GBKA 2W3IA 3LGIA 1FN8A 2Z9KA 3SNAA 2HLCA 2XBVA 1ELBA 1F7ZA 1RIWC 3BTME 3M35A 1D3DB 1T8NA 1SHYA 5JPMH 2PTCE 1OYQA 3UPEA 1GI0A 4BAHB 1VCWA 1YM0A 4IGDA 2F9NA 3PMBB 5JB9S 1BCUH 2EI6A 1C5SA 3KCGH 1Y3UA 1T4VH 3CS0A 1AB9C 3D23A 2FX6A 5HM9A 1GMHG 1YCPK 1OSSA 1MD8A 1UTOA 1EX3A 1O3OA 1EKBB 1J15A 3K65B 3K2UA 1AZZA 4E7RG 1UK3A 3U8RH 2BMGB 4K8YA 1YCPH 2HNTC 1AD8H 3SJOA 3B8JA 1SB1H 1ANBA 2TBSA 1YF4A 1DLKB 4MPVA 2ZFTA 1BBRE 1GCTB 5DP7A 3SGBE 1MCVA 3A82A 1KXAA 1GJ6A 1RXPA 1BRBE 3QUMP 3BTWE 1THSH 3PLPA 4XSKU 3U8OH 4VGCB 1TQ0B 4OGYA 3TU7H 1RJXB 3MU4A 1B0EA 1EPTB 2STBE 2ZFRH 2O8LA 2ZA5A 1FQ3A 1DWBH 1YPHC 4AB9A 4YO9A 2FLBH 2ZZUH 3MI4A 3UOPA 3A88A 1C2GA 1S0QA 2ZFPH 1EJMA 1ELCA 1O3FA 3KGPA 1A3BH 2ODPA 1GJ5H 4AG2A 1MBMA 3SOSA 3ZZ5A 4GAWA 2BOHB 1GBFA 1KDQB 2VINA 4WJG2 2ZDVH 3UREA 3BG4C 2BDYA 1PQ8A 1P3CA 3VGCC 1L1NA 4FVDA 1P2NA 3ZV8A 2ZTZA 3DD2H 1S0RA 1SGDE 1W2KH 3W94A 4THNH 2BB4A 3LONA 4RKJB 4U01A 1P2MA 1MUEB 1W13U 2WPMS 1FI8A 2A7CA 1IHSH 4ZROA 2BYAX 1MTUA 1RIWB 1TBZH 4JYTA 2FS9A 3Q00A 3ATLA 4FUEA 1HPGA 4Q80A 3SNBA 2ANYA 2FOAA 3NCLA 3N7OA 3AW0A 4TY7A 1SBWA 2ZCKP 2ZHQH 3PLBA 1EZUC 2A5AA 3F68H 3ODDA 4D7GA 2F83A 1MD7A 2G4TA 3KQBA 1AU8A 2VIWA 3OX7U 2J38A 5T6FA 3SNDA 2ZC9H 2RA0A 4IC5A 4NIWA 4XDEA 1O3NA 1O2OA 3LGVA 4SGBE 1HAVA 2VVUA 4RSPA 2QC2A 1FY1A 1WQSA 4U30A 3EAJA 2WPHS 5DO4H 1JIRA 2AGGX 4MLFB 2BVRH 4LZ1H 1O2SA 3ATMA 3OU0A 2XC4A 5E0GA 1SGPE 4DOQA 4MG3A 5FPSA 2AMQA 3PWBA 1GBTA 2BDBA 5AF9H 5FCKA 2QIQA 1LMWB 4YLUA 4AZ2B 2WYGA 1GWAA 3ZZAA 1JRTA 3ATIA 4YOGA 3SW2B 2R2WU 2XCNA 3S9BA 2D8WA 4BTTB 3MNCA 3QZQA 2BD3A 2GCHG 4JCNA 5EU8A 1ZTJA 3UQOA 1YBWA 2AEIH 1ZYOA 2XBWA 3OY5U 1AWHB 2I6SA 1LVMA 4YESB 4DGJA 4WMFA 4WY3A 1IQFA 4K1TA 1AE5A 1OWEA 2ZIQH 4MPUA 4X1QU 1KY9A 2PFEA 1C5PA 3M3TA 4FUBA 2FI5E 2SGDE 3SHAH 3RXQA 2G5NA 1CT2E 1DXWA 2F9OA 1N6YA 3H7TA 1EAUA 3EQ0H 2SGQE 2G81E 1KLJH 1QHRB 1O33A 1O3KA 3BG4B 4ZXYH 1PPCE 3RXMA 3VGCB 3TGKE 1BBRH 1OWKA 2Q6GA 1C5MD 3MNBA 2FODA 3PROA 4MNWA 1MZDA 1QA7A 3G01A 2SGFE 3SHCH 4AOQA 1O5GH 3OSYA 1G32B 1GBEA 1T8MA 1PPZA 1K21H 1SGQE 1D9IA 1J9CH 2BLOA 2R0LA 1JRSA 1SGNE 3GICB 1CT4E 2GD4B 3KL6A 4NWLA 1O5BB 3BEUA 2OC8A 3PMJA 1C5UA 1GI2A 1KTSB 1PYTC 3ZVEA 1Y59T 2ZHDA 3M3SA 1MMJN 1YPEH 1AMHA 3MYWA 3KEEA 2A4GA 3TJNA 2P8OB 1L4ZA 2O8UA 2ZDNA 2ANMH 4DIIH 1FN6A 2K1QA 2EI7A 1V2KT 3A7ZA 3C27B 4BAKB 2G52A 5HMAA 2PSXA 2CF8H 1B0FA 7KMEH 1P05A 2QYIA 3RXFA 2P3UB 3L33A 1V2RT 4CRFA 1ZPZA 1SGFA 3GY7A 1K2I1 1Z6JH 3LC3A 5CMXH 3SU4A 1EZQA 2ALPA 4Y10E 2BZ6H 3RMMH 4YTAA 1OWIA 3M3VA 5FX5A 1FY5A 1IQLA 3M7UA 3SUFA 1RGQA 1KIGH 1A5GH 4FU8A 4ZKOU 1W8BH 5F8XA 4INHA 5L6NH 1P8VC 1TABE 2BD9A 2LPRA 3PMAB 2BX4A 2SGEE 1O3BA 4WH6A 5A8YA 2Z3CA 4X8VH 2OC7A 3GY3A 4O9VA 1A0LA 1PJPA 2FEQH 2RG3A 1AE8H 1O2NA 4AFZA 2P95A 1C1SA 2PGQB 8KME2 2HNTF 1UTKA 3VFEA 5A0AE 2JETB 1G2LA 1LQDB 1W14U 4ABBA 1MZAA 4CRBA 1DY9A 3LH3A 8GCHG 1ZMLA 2UWPA 3IG6B 3ESTA 1C1VH 1SGIB 2ANKH 4AFQA 2HPPH 1E0FD 1GDUA 3C1KA 2CF9H 3H5CB 4F49A 2A4OA 3E16B 1IQGA 4Y8XA 1Z8JB 3P70B 1EB2A 2EEKA 1WV7H 1HAIH 3NXPA 1GBJA 4WF8A 4A5TS 1SGFG 3MU1A 1IOEA 1VCPA 3M5MA 4J2YB 2WPLS 3RXKA 4I8GA 2GGVB 2XBYA 2Y80A 4MNVA 3ZZ9A 1D3QB 6ESTA 1NU7B 4Q7YA 2BVSH 5LGOA 1P02A 1VJ9U 4FUIA 1C5NH 1LQEA 1V2LT 2A31A 1HB0B 4CRGA 3ZZDA 2XWBI 2AIPA 3KNXA 4ZHAA 1ELEE 4E7NA 2WUCA 4I31A 5FBIA 1DY8A 1O38A 2ZQ2A 1GI7B 1BTZA 5EGMA 2QXGA 1HGTH 1YPMH 1VCQA 1LCYA 4X1NU 4AG1A 2AIQA 5GWZA 4O97A 1ZPBA 1Z7KA 1SQAA 1MTWA 4ZKNU 3PTBA 2D1JA 2J9NA 3BIUH 1O5DH 1ELFA 3MNSA 3RC5A 4MTBA 2A1DB 3SU1A 2B8OH 1HAYB 1ETTH 5FPTA 1H8IH 1MQ5A 5HYOA 2RA3A 3RMNH 1TX7A 2BX3A 2PUQH 3GOVB 3Q3YA 4OS2A 1CSOE 3VPKA 2VIOA 3ZVAA 1EXFA 1GGDC 3RXIA 1SLXB 1T4UH 2ZFQH 4YM9A 1XMNB 3DT0H 1K1OA 2TGAA 4A6LA 3E3TA 3SORA 1CGIE 1C2EA 1ESAA 2PV9B 3GCTG 3QTVH 4X6NA 5JBBS 1QB9A 2PKSB 1Y3WA 8LPRA 1LHCH 5DP4A 2OXSA 1LHGH 1W0ZU 1PPFE 1QRWA 2BD2A 1A2CH 5DP5A 2ZI2H 4MNXA 2WINI 3VB3A 3ENSB 2J4IA 1TGSZ 1BJVA 1AY6H 3AVZA 5GXPA 4CR9A 1A0JA 1FAXA 2HALA 1C1WH 2BZAA 1BZXE 3JZ1B 4KP0A 4YOIA 4DVAU 1PPGE 2BLVA 4D7FA 3B9FH 2GCTB 2OBOA 2JH6D 2BD4A 2XCFA 1ANCA 4IN1A 4WVPE 2ZEBA 1OYTH 1YPGH 2BQWB 3RC6A 2FDAA 4Y7BA 2GDEH 1UMAH 5EPNA 1D4PB 1DE7H 4FUDA 1GI5A 3SU2A 4YLQH 1J8AA 1NTPA 5LPRA 1A46H 2AMDA 5I46H 3KN2A 1ORFA 3SGQE 3TITA 2PW8H 3VEQB 1VJAU 1ZPCA 2XXLA 1NM6A 4BAOB 3NWUA 1O2UA 2Z94A 4KELA 3ZYEA 4H6TA 1LKAA 5L2ZH 1K1MA 3ZVBA 3F9GA 5FPYA 2O8WA 1ZGIA 5AHGH 1BMLA 2VIQA 2ZU2A 3SNEA 1ZZZA 4Y11E 4YOJA 4D76A 4Y6DA 2FZZA 2Z3EA 1ID5H 4FUJA 4K3JA 2A5KA 1E36B 4XE4A 3EA7A 2ZHFH 3MO6A 3SUEA 1GGDB 1CE5A 1O2LA 3FP6E 2JH5D 1IQMA 5EPYA 1GPZA 4FVBA 1IQEA 3SZNA 4X1RU 1ZOMA 4Y79A 4CH2B 1P9UA 2VWMA 2M5TA 4TWWA 4WH8A 5FCRA 3MU5A 4ASHA 1GCTC 2ODQA 3RM2H 3SJ9A 3UWJH 1L1JA 3V12A 1KXEA 1TPAE 2TGPZ 2AS9A 3TLOA 3A7WA 1SLUB 2UWLA 1O2TA 1B5GH 1Y8TA 5TCAA 3S7HB 1PPHE 1V3XA 1NRNH 1TBQH 1QJ7B 4X2XA 1O3IA 4WMEA 2TRMA 1WYKA 4DG4A 4FUHA 3DUXH 1MU6B 4ISHH 4DURA 1AFQC 1C5WB 1NROH 1SC8U 3RC4A 3PB1E 4A1XA 2ZDMA 1TNLA 1YLDA 2Y81A 1UTQA 2ZHEH 2PUXB 2THFB 3HKIB 1OXGA 2FI4E 1ESBA 1OP2A 2J94A 1ZTKA 3BEFB 4I8LA 4ZHLU 4ABAA 3SJIA 4CRCA 7GCHG 3GDSA 1PYTD 2GCHF 2PKAB 5DP6A 3VB7A 3ZZCA 1Z1JA 1V2TT 3STIA 3LDXH 1WTHD 2PLXA 2B9LA 2GV6A 2YNAA 3AASA 4X2YA 1CGHA 3Q77A 1P04A 1WUNH 1ZHRA 2WPIS 4CR5A 5EQSA 1GI3A 3PO1B 3Q76A 2WPJS 5C5NA 1P2IA 1YPLH 4D9RA 4GVUA 5PTPA 3TK5A 4I8KA 1U6QA 3SV7A 1S5SA 1XKAC 1NT1A 5LPEA 1ZJKA 4Y8ZA 1O2ZA 5HM2A 4HGCA 5J4QA 3LPRA 1LPGB 1H4WA 4BANB 2V6NA 1ABJH 3K6ZA 2F9UA 2B0FA 1NFUA 1HAGE 1GVLA 2RDLA 3LOXA 1KLTA 2C8ZB 2Z9GA 5ESBA 3BTEE 3ITIA 3MOCA 1LPKB 3RXOA 1MKXK 1C5QA 2Z3DA 1BQYA 2FMJA 2BY7X 5EG4A 1BRUP 1HAXB 5ESTE 2ZU4A 1FPCH 3O8DA 1E34B 1W7XH 1WBGB 3I29A 1MKXH 1A1RA 1QURH 1GJ8B 2OQ5A 1N1LA 2ODYB 3BTTE 1N6XA 3VXFH 1DFPA 2ZU1A 5DG6A 3BSQA 1TMTH 2OCVB 3PV4A 3D65E 3UOUA 1O5CB 4ZHMU 1BTPA 3QWCH 4GCHF 1ELTA 2TIOA 1ZHMA 1GBHA 1GI4A 3DFJA 1UTMA 1AFQB 5JB8S 1P57B 1FXYA 3S0NA 1BDAA 1NFWA 3BTKE 4AB8A 1Y3XA 1O35A 4WXIA 3ZYDA 3BTQE 5FAHA 2V3OH 2BLWA 1XUGA 2J2UA 4JK5A 1L4DA 2ZGCA 2OINA 1H9HE 4Q2KA 3PWCA 2AGIX 5LPFA 1QQUA 4UDWH 5CE1A 1TPSA 1JWTA 1GHZA 5DGJA 1SHHB 2VH6A 4X1SU 2C8YB 4ESTE 4UFDH 4DT7B 2V0BA 5BPEA 6GCHG 4LZ4B 1GHXH 1SQTA 2SGPE 3A81A 2VIDA 4B73A 3UIRA 1CBWB 5F8ZA 1SG8B 1XM1A 2QGRA 2XNIA 4NZLA 3O8CA 1IHTH 1BT7A 1QRXA 2W7UA 1G3DA 2A2XH 2JH0D 3LGYA 2ZPSA 1XVOA 1F0RA 1NZQH 1YLCA 2P8OC 3GCHC 2G55A 4D8NA 4INKA 1EAXA 3E8LA 1MTSA 3A86A 2HPQH 1O30A 5F8TA 1EOLA 3R0FA 3GYMA 3MU8A 1EP6A 2ESTE 4O03A 1H9LB 2D26C 3H7OA 2G00A 3CP7A 3ATKA 8GCHF 4RN6A 1O3DA 1YYY1 2WV4A 1O2WA 3A8CA 2UUJB 3TH2H 2FO9A 3CS7A 4KTSA 1VZQH 1C1MA 1OP0A 3GCNA 3QDZB 1Z71A 4ABIA 1EZSC 3I77A 3U8TH 1A0HB 1G3CA 1QJ1B 4I8JA 2ASUB 3UR9A 3T27A 2NU1E 1T8OA 1XKBC 1DWEH 2F3CE 3TGJE 1OS8A 1LKBA 3WY8A 2Y7XA 1C1TA 2BHGA 2ILNA 1F0SA 2OC1A 1Z6EA 3SU3A 2IJOB 1S6HA 1C5OH 3GY6A 1KXCA 1TFXA 1RFNA 1BRAA 1F0TA 2JETC 3GY4A 1C5ZB 2D2DA 1HJ8A 1N8OC 1XUFA 1GVZA 1QNJA 4OS7A 3P6ZB 3BTDE 1OP8A 4I8HA 2QN5T 1RD3B 2P3FH 3V13A 1MAYA 1D6RA 2ZQ1A 3RXGA 1TRYA 1GMDF 1O5EH 1PPEE 1ZHPA 3LJJA 1DUAA 2VWOA 1AN1E 4LK4A 2GKVE 1Q31A 1Z8IB 3RXUA 8ESTE 1PFXC 1V2OT 3RU4E 1KXDA 4ZH8A 3STJA 9ESTA 3A85A 4NIXA 1EJNA 1TRMA 1K1IA 3ZV9A 5HXFA 4BXSA 1QB1A 4Y7AA 4GCHG 3TNTA 1FONA 3GCHB 4J1YA 5A09A 1XUKA 3FZDA 2W7SA 3UTUH 1SGCA 1C4U2 2HNTE 3A89A 3FFGA 3A7TA 3RXHA 2BQ6B 4BTUB 3GCTF 5TJXA 1C4Y2 1NPMA 2PKAA 1MTVA 2NU0E 5GCHF 1F5KU 1UCYK 1F2SE 3P8OA 1HAHH 1TGNA 4TWYA 4X2VA 2O8TA 2BY8X 4FU7A 3ZVCA 1BITA 2PGBB 2ZECA 1LHEH 4ISOA 5DJ7A 1G3BA 1YPHE 1GCDA 1QL7A 4F4OC 1K1PA 5DP3A 1GJ9B 3MH5A 1W12U 2BD5A 1SMFE 2TGTA 3DHKH 3ODFA 2FOMB 5CHAC 1GG6C 2H9HA 4B2BA 1QRZA 2VB0A 2ZCHP 1CHOG 3MO9A 4A1VA 3ZZ3A 1JMOH 2V3HH 1GJBB 1DANH 3URCA 1KTTB 4R0IA 2XBXA 2ZGJA 3ZZ8A 2BDCA 1QIXB 2PKSC 5ABWA 1N8OB 1DXPA 5EQQA 3FAOA 1A4WH 3MHWU 3SUGA 3F9EA 1DS2E 4LXBH 1C5RA 1BRCE 4X8UH 1T32A 1GBMA 3SV8A 1NFXA 1G30B 1GHVH 2KAIA 1CA0B 1QBVH 1LHDH 3AW1A 1HRTH 2BDHA 3Q3KA 1FY4A 2W5EA 2C90B 1OOKB 1HAOH 1D6WA 1RTKA 1C1NA 5C1UA 1YP9A 1GI9B 2VU8E 5EQRA 4K1SA 1P06A 4U32A 4MNYA 2FESH 2A7HA 1PPBH 3MNXA 3IITA 1C2FA 2O9QA 1MAXA 1DICA 1QY6A 3MO3A 4B2CA 2GCTC 1AUJA 4YT6H 4CBNA 1F0UA 1V6DA 3KQCA 1O3PB 3UFAA 5HGGA 1S85A 3SU6A 4NIVA 5DKMA 5C2ZA 6LPRA 1P01A 4BAQB 2Y7ZA 1QJ6B 1TQ7B 2GZ9A 4OS1A 1UJ1A 2G4UA 3RU4D 1M9UA 1SGEE 3EE0B 3U69H 3A7XA 4BNRA 3QX5H 1GBBA 1Y3VA 1C1UH 4Y0YE 3GYLB 4AORA 1S81A 1GMDG 3F9FA 1XXFA 3P92A 1KYNA 2C4FH 1B7XB 5FXLA 3SNCA 1UHBB 3M5NA 4B75A 1A61H 1W7GH 1THPB 1JOUB 1TX8A 3A8DA 2ZP0H 3AAUA 1XUHA 4K5ZA 3QGJA 3MFJA 2ZPRA 4AX9H 5CHAB 1GG6B 2IN2A 1TONA 3BEIB 2B7DH 2J95A 1AZ8A 3E91A 3SJKA 2VNTA 1Y3YA 3HGNA 3LGTA 5C5OA 1ZSKA 4JK6A 2CMYA 2C3SA 1TNKA 2W26A 4GUXA 2ULLA 4JZFH 3L6PA 4JZIA 1DDJA 2GT7A 7GCHF 1T31A 1SGRE 3UY9A 2EI8A 5ETXA 4X6MA 5T6DA 5GCHG 1TPOA 1UTLM 2A2QH 1C2DA 1C1PA 1SPJA 1CQQA 3GY5A 1ANEA 2DE9A 4TPIZ 5AVDA 1VITG 2FXRA 2IPHA 5B6OA 1HDTH 3SV9A 4MQAA 4K2YA 1UO6A 1P10A 2SNWA 2P3TB 5JDUB 1O3AA 1NO9H 1QGFA 3QN7A 2RCEA 2JKHA 3FP7E 3SN8A 1MH0A 4NSVA 3P8GA 1Z1IA 4XBDA 3RXVA 1TX6A 1GVKB 1TMUH 1HXFH 1MTNC 3ZZ4A 1E38B 4ISIH 1NRSH 1BIOA 1W10U 1IQHA 1BUIA 1C9PA 3LGUA 4ZKSU 2XC0A 1IAUA 1GJCB 4U2WA 4XBCA 2Y5HA 3SI3H 3K6YA 4H6SB 2CJIA 4X6OA 4ZMAH 1UVSH 4JYVH 5LH8A 3ZVDA 3E1XB 1NESE 2ZDAH 1FZZA 3E90B 4B74A 3HATH 4CREA 3RU4T 3U1IB 3TH4H 1QR3E 1P3EA 2OLGA 1IQNA 3KF2A 4HFPB 3BF6H 4X0WU 3GCOA 1P2OA 1BTHH 2VVVA 4XFQA 3TK9A 2R2MB 2CHAB 3A87A 2Z7FE 4SGAE 4TY6A 3RXRA 1C2LA 3RXTA 3PO1C 4NIYA 1SGYE 1XX9A 3B23B 4ABHA 1V2MT 2AH4X 1NN6A 3LGWA 1TGTA 4WWYA 1HIAA 1NU9A 3RXDA 1ELVA 3TPIZ 1VGCC 1NRRH 3SBKA 3TVJB 1TGBA 3P95A 1DWDH 3MH6A 2GZ7A 1WSSH 1FPHH 3ZZ6A 1MCTA 4XBBA 2A4QA 1SL3A 3NUMA 1FUJA 1G3EA 2G51A 5G4BA 3SUDA 3MU0A 5K0HA 3T62A 1O2HA 2QF0A 1G9IE 1SFIA 2H1UA 6CHAC 1E35B 2J34A 3VB5A 3KIDU 2OUAA 5C3NA 3A8BA 4X6PA 4A1TA 4DW2U 3M5OA 4UFGH 2ZPQA 1AVGH 2ZKSA 4Z0KA 1O2JA 1TMBH 1EB1H 1RRKA 3SV6A 1TNHA 1P2KA 3M7TA 2GT8A 1JIMA 1TIOA 3BTGE 4UONA 4GHTA 2R3YA 3D49H 1UVTH 1V2JT 6GCHF 3NPSA 1TPPA 2GTBA 4Y76A 2BTCE 2WV5A 4Z6AH 1OWJA 2VIPA 5C20A 2HOBA 4IC6A 5T3HA 2CXVA 1Y5AT 2XWAA 1UTJA 3ZVGA 5SGAE 2R0KA 1DX5M 4YT7H 2DUCA 4GPGA 5I25A 1MTNB 2FI3E 4X2WA 4ABEA 1D3PB 3BTHE 2Y82A 2A5IA 1OX1A 2LNCA 4H42U 1SR5C 2F9BH 2QXIA 2QAAA 3FANA 1S83A 4K60A 1GDNA 1HAZB 1LO6A 3BN9A 3SV2H 3SU0A 2FOGA 3KQDA 5J4SA 4B2AA 4DY7B 2XYAA 4NA9H 1FDPA 2YOLA 3M7QA 3Q3XA 3TH3H 2QA9E 1O39A 2BVXH 2FOBA 2XTTB 1FLEE 2W3KA 2A0QB 3RXCA 3F1SB 1O2PA 3A8AA 2Q6FA 4BAMB 3M37A 2AMPA 4ABJA 1C2HA 4OS5A 3RXBA 4AGKA 4B71A 1ANDA 4NGAH 2EA3A 2UUFB 5GIBA 1UTPA 2R3UA 4CBOA 1O3CA 1C2KA 2HVXA 2FTMA 2A45B 1CBWC 2V35A 1WOFA 2GV7A 1QCPA 1YCPM 1FY8E 1HFDA 1Y5UT 1VGCB 2Y5FA 1C2IA 2Z9LA 2QV1A 5FBEA 5C1YA 1C1OA 4AGJA 1O3EA 5A0BA 1UK2A 4FXGH 3VXEH 1P9SA 1SLWB 2VWLA 1HUTH 4I7YH 1GJ4H 1C9TA 4CHAC 3VB4A 1RTFB 1RTLA 1T8LA 2Y6TA 6CHAB 4A92A 1H9IE 1ZRBA 4PROA 2HGTH 1SSXA 1O2QA 4RKOB 1L1GA 2A32A 2CN0H 3EYDA 3V0XA 3RXLA 3A7VA 1EAWA 1GBDA 1EATA 3SI4H 1AIXH 1GJDB 4TPYA 2BY9X 1QA0A 1S6FA 1PQ5A 5C1XA 2ZGBH 2ZO3H 4INLA 1HAPH 1O36A 1UHBA 2AERH 5EXLA 2WYJA 2C93B 1MQ6A 4GSOA 2KAIB 1QB6A 1TAWA 1G2MA 1TNGA 1ZTLA 1TLDA 3TIUA 3SQHE 2F9PA 4UEHH 2GP9B 1ZLRA 4MVNA 1BMNH 1YPJH 2PWXA 3OY6U 1C1RA 1P03A 1CO7E 1F92A 1TB6H 4JZDH 3BV9B 3U1JB 3HK6B 1X7AC 1OWHA 1SVPA 2FLRH 2H9EH 1FNIA 1S84A 3S9AA 3SO3A 1WCZA 5C67A 4O3UA 2A4RA 4X8SH 3A80A 4UFEH 1IQKA 1NC6A 1UVOA 1L0ZA 4AFSA 1Q3XA 1KSNA 1AGJA 1V2WT 1XUIA 2SGAA 4JYUH 1GMCG 4WXVA 1UCYE 2FYQA 4IS5A 4Y71A 2ZHWH 4Q7XA 5A8XA 4MPWA 1SLVB 2UUKB 3MH4A 4O3TA 1A5HA 1DVAH 1HJAC 1C5LH 1ZR0A 3O8BA 1TALA 1INCA 3M5LA 1AKSB 1CHOF 5JBCS 5GDSH 3TNSA 2I6QA 1F5LA 4AN7A 1C5VA 1ZSJA 2UWOA 1GHAF 1DSUA 5DP9A 4ZAEA 4CHAB 1LHFH 1K22H 1S82A 1VR1H 1C1QA 1O2RA 1DITH 3GY8A 4ABDA 2VJ1A 3V7TA 1C5YB 3QO6A 5DP8A
chains in the Genus database with same CATH superfamily
5E8EH 1WQVH 1AB9B 2Y5GA 2IOTA 1P09A 2GZ8A 2NU3E 2F4LA 1BMMH 1FY3A 5A0CA 1T7CA 1GL1A 3SU5A 1O3GA 2G8TA 2FOFA 3GISB 3MTYA 3RXEA 1YKTA 4B6EA 2BM2A 2OQUA 3T5FH 1WAYB 2ANWA 4E05H 1BOQA 1OWDA 2FTLE 1DLEA 4KTCA 3NK8A 4DJZB 3MMGA 1TE0A 3MWIU 1WTGH 2Q1JA 4NWKA 4CRDA 1QL9A 3DA9B 1TRNA 1ABIH 4FUGA 1QFKH 1EOJA 2QY0B 5JBTA 3W95A 1ZSLA 1SGTA 4R8TB 3U98H 9LPRA 3M61U 1GHYH 1SQOA 2Z6BD 1NY22 4DCDA 2AGEX 2ZF0H 4NFFA 2AYWA 1COWD 1PQAA 2JJ2D 1FMGA 3FZZA 3ELAH 1BTUA 5TCCA 7ESTE 2ZU3A 1ESTA 3HKJB 3PLKA 3RLWH 1WXRA 1LPZB 3EA8A 1C4V2 1BBRK 1EAIA 1O3HA 3R3GB 3UNRA 1CA0C 3I78A 5E2OA 1GJ7B 2TGDA 2YMSC 2H5DA 2ZCLP 1YY3A 1P2JA 1DOJA 1MBQA 3UNQA 3E0NB 2FPZA 3FO8D 1YPKH 2P16A 1QBNA 2BD8A 5JBAS 2O8MA 1SFQB 4HI3A 4Y8YA 2PSYA 3JZ2B 2ALVA 1HJAB 4M7GA 4ISNA 1DWCH 1KLIH 1LDTT 2VGCC 4HG6A 2EY4C 3MH7A 1HIAB 3RDZA 2Q6DA 1H8DH 1G37A 4MPXA 2BY5X 2NWNA 4NZQA 2PTNA 2C8XB 1XVMA 1GHBF 1ELGA 1EZXC 1TOMH 2OBQA 1ZJDA 1V2ST 1E37B 3LT3A 2GDDA 4CRAA 3S9CA 4XRNA 5EXMA 2A7JA 2FS8A 2LELA 5GPIB 7LPRA 3L3TA 3O8RA 4OS6A 1ARBA 1P12E 2DE8A 2WUBA 1P2QA 5FHTA 5DK1A 1VITF 1UVUH 1A3EH 3UNSA 2PR3A 1UCYH 5JYIA 1LVYA 2STAE 4NG9H 1QZ8A 4D9QA 1EUFA 1FIWA 2GX4A 1ELDE 3LJOA 5GNDA 1O2KA 2ZTYA 2BDAA 2GJGA 1BA8B 3TK6A 1TYNA 4GLYA 5FX6A 1BMAA 2F43B 4JZEH 1SOZA 1V2QT 2BD7A 4BOHA 1P11E 2G5VA 2H6MA 4KGAA 4A7IB 1K28D 3P8FA 2AHME 1BHXB 2VIVA 4IBLH 4OM9A 4H4FA 1FV9A 1GBLA 2BXUH 1H8HD 4FETA 1GBAA 1GBIA 1UTNA 5IDKA 1GHAG 2WPDD 4X1PU 2W6JD 1V2UT 1BTWA 4HZHA 5L30H 1K0HA 2OD3B 1O2IA 3ATWA 3OYPA 1KXBA 1UW7A 4K69A 3CENA 3KHVA 2C8WB 1YWUA 2H9TH 2XRCA 2VH0A 3S7KB 3PTNA 5A8ZA 2Z9IA 5C0TA 3QZRA 1Y5BT 1ARCA 1ZRKA 4KKDA 1F5RA 1HYLA 1O3LA 3A83A 1HBTH 2YMSB 1K1LA 1TWXB 3T29A 5IYTA 5BRRE 1TBRH 4UD9H 2P59A 4UE7H 1O5AB 3MQKC 2BY6X 1ETSH 5CHBA 1WU1A 5L2YH 5E0HA 2BXTH 4QT8C 5F53A 2FOHA 3AK5A 1AFEH 1CT0E 2B5TB 2BOKA 3SGAE 1QTFA 1SQRA 1CVWH 1DUEA 1EPTA 2F91A 3GDUA 3UUZA 1C2JA 3RXJA 1EQ9A 1QQ4A 2VGCB 3RMLH 2FYRA 3BG8A 5E0JA 1ETRH 4JMYA 1EJAA 4K1EA 3LIWA 1AQ7A 2GVFA 1PQ7A 2GMTC 1AVXA 1MKWK 4NCYA 1DT2A 1O2XA 1QL8A 1VITH 3RP2A 2ZWLH 1XUJA 5F6MA 1HJ9A 2FM2A 3NZIA 1MKWH 1BTYA 3DFLA 1ACBE 1KDQA 3P17H 1G36A 4IN2A 2XC5A 1J14A 2VWNA 1GHWH 3ZZBA 2QCYA 4Q7ZA 4NA7A 4KTUA 1JXPA 1V2NT 3TGIE 3ZVFA 4I32A 1GI1A 1AVWA 2CHAC 1Z8RA 2CV3A 2SFAA 3S69A 1TNJA 1NS3A 3GY2A 1H1BA 3F6UH 3PM3A 1EP5A 2BDIA 2ZDKA 1AWFH 1FAKH 1L2EA 3T2NA 1AKSA 4YZUA 2ZFSA 2J5UA 2QXJA 2F9VA 5AFZH 4Y0ZE 5E2PA 1GI6A 3KYFA 2NU2E 4IMQA 1TA6A 3FVFB 3QTOH 2NU4E 1W11U 1AI8H 1LVOA 1NRPH 1P0SH 3EDXB 3PMHB 4NFEA 2ZDLA 1FJSA 5EOKA 3IWMA 1SI5H 4OS4A 1CHGA 1GDQA 4WMDA 2VVCA 3RLYH 2ZGHA 1GHBG 2HWLB 1CGJE 1S6LA 1GBCA 1OKXA 2SNVA 2FX4A 1EFRD 1HNEE 1O2MA 3NKKA 4BXWA 3TJOA 4BTIB 3EA9A 4F48B 1THRH 1Z8GA 1ELAA 4IMZA 3SZEA 4IW4E 2ZGXH 4TSFD 1NRQH 4AFUA 2WPKS 4HTCH 3BIVH 4DIHH 3P8NA 2FP7B 3A84A 3QGNB 1O3MA 4ZUHA 1GI8B 1A7SA 3N7EA 1O31A 2ZU5A 5EXNA 1WDIA 3UR6A 3RUOA 3OE7D 1E1RD 1YLNA 3E0PB 1TGCA 1CU1A 1K1NA 2FOEA 1O3JA 2J97A 1HLTH 1O2VA 5AFYH 2P94A 1NBME 3LKWA 1SOTA 4ISLA 1DSTA 2H2ZA 1HXEH 2OC0A 1TNIA 3BTFE 4XOJA 1CA8B 2FWWA 3URDA 1BHXF 2GMTB 4AYYB 2UUYA 4ABGA 3FP8E 3UWIA 1BB0B 1GMHF 1A5IA 1ZMNA 4ABFA 2ZNKH 4ZXXH 3LH1A 5HKKD 2ZFFH 5GJ4B 3RM0H 1C2MA 4K8BA 2FIRH 3AAVA 3DSPA 1K1JA 3LC5A 1J17T 2HRVA 2ZTXA 3U9AH 1BTXA 2PHBA 1HAVB 2EC9H 1O5FH 3T28A 4TYDA 2BDGA 4E06H 1HCGA 4NSYA 4X8TH 3N7DA 1DPOA 5IK2D 2R9PA 3TJVA 1HV7A 1IQIA 1MABB 3RXPA 3QK1A 2FOCA 2WV9A 1UK4A 4CH8B 1QBOA 1O2YA 2QF4A 3FKSD 1XXDA 3RMOH 2YNBA 1O34A 2BQ7B 4NA8A 4Q63A 2BLQA 3V3MA 3PYHA 2OTVA 3RXAA 3RXSA 3A7YA 1C5TA 3HGPA 4B76A 1OPHB 5T6GA 1IQJA 1UVPA 3T26A 3VB6A 1O2GH 1NFYA 2AFQB 3D62A 3E6PH 4ASUD 5K7RA 1J16A 1TOCB 1MU8B 3SQEE 2CGAA 3M36A 5EW1H 3SJ8A 1YGCH 4GHQA 3ZZ7A 2P93A 1RS0A 3HPTB 4ZKRU 1ZGVA 2TPIZ 1AO5A 3UQVA 4B1TA 1O37A 1JBUH 1DM4B 1GMCF 4RT0A 1W0YH 4FOUC 2QXHA 1AUTC 5H4IB 1LVBA 3EGKH 3K9XB 2J92A 2Z9JA 1K9OE 3F9HA 2K0QA 1D3TB 1LTOA 5F03A 1O0DH 5EODA 3KQEA 2QF3A 3LU9B 1GJAB 3OTJE 1TA2A 1GL0E 3GDVA 4FUFA 3T25A 4VGCC 2H5CA 1EPTC 5A2MH 4I33A 3DSOA 2XW9A 1KXFA 1YC0A 1W3CA 1V2VT 5EW2H 1ZMJA 3TJUA 1V2PT 1BMFD 4UFFH 2OP9A 5DPAA 1AHTH 1FIZA 4JZ1A 1BJUA 3QLPH 2ZG0H 4FUCA 4LOYH 1O32A 4FU9A 1EASA 1NBMD 3HK3B 1C5XB 4OGXA 4AYVB 1Q2WA 4MDSA 1GBKA 2W3IA 3LGIA 1FN8A 2Z9KA 3SNAA 2HLCA 2XBVA 1ELBA 5EJLA 1F7ZA 1RIWC 3BTME 3M35A 1D3DB 1T8NA 1SHYA 2IJD1 5JPMH 2PTCE 1OYQA 3UPEA 1GI0A 4BAHB 1VCWA 1YM0A 4IGDA 2F9NA 2IPQX 3PMBB 5JB9S 1BCUH 2EI6A 1C5SA 3KCGH 3U28C 1Y3UA 1T4VH 3CS0A 1VKYA 4AC9A 1AB9C 3D23A 2FX6A 5HM9A 1GMHG 1YCPK 1OSSA 1MD8A 1UTOA 1EX3A 1O3OA 1EKBB 1J15A 3K65B 3K2UA 1AZZA 4E7RG 1UK3A 3U8RH 2BMGB 4K8YA 1YCPH 2HNTC 1AD8H 3SJOA 3B8JA 1SB1H 1ANBA 2TBSA 1YF4A 1DLKB 4MPVA 2ZFTA 1BBRE 1GCTB 5DP7A 2KFWA 3SGBE 2KR7A 1MCVA 3A82A 1KXAA 1GJ6A 2KZ4A 1RXPA 1BRBE 3QUMP 3BTWE 5HIZA 1THSH 3UAIC 3PLPA 4XSKU 3U8OH 4VGCB 1TQ0B 4OGYA 3TU7H 1RJXB 3MU4A 1B0EA 1EPTB 2STBE 2ZFRH 2O8LA 2ZA5A 1FQ3A 5HIYA 1DWBH 1YPHC 4AB9A 4YO9A 2FLBH 2ZZUH 3MI4A 3UOPA 3A88A 1C2GA 1S0QA 2ZFPH 1EJMA 1ELCA 1O3FA 3KGPA 1A3BH 2ODPA 1GJ5H 4AG2A 1MBMA 3SOSA 3ZZ5A 4GAWA 2BOHB 1GBFA 3WWFA 1KDQB 2VINA 4WJG2 2ZDVH 3UREA 3BG4C 2BDYA 1PQ8A 1P3CA 3VGCC 1L1NA 4FVDA 1P2NA 3ZV8A 2ZTZA 3DD2H 1S0RA 1SGDE 1W2KH 3W94A 4THNH 2BB4A 3LONA 4RKJB 4U01A 1P2MA 1MUEB 1W13U 2WPMS 3F3BA 1FI8A 2A7CA 1IHSH 4ZROA 2BYAX 1MTUA 1RIWB 1TBZH 2L6OA 4JYTA 2FS9A 3Q00A 3ATLA 4FUEA 1HPGA 4Q80A 3SNBA 2ANYA 1SKYE 2FOAA 3NCLA 3N7OA 3AW0A 4TY7A 1SBWA 2ZCKP 2ZHQH 3PLBA 1EZUC 2A5AA 3F68H 3ODDA 4D7GA 2F83A 1MD7A 2G4TA 2JIZD 3KQBA 1AU8A 2VIWA 3OX7U 2J38A 5T6FA 3SNDA 2ZC9H 2RA0A 4IC5A 4NIWA 4XDEA 1O3NA 1O2OA 3LGVA 4SGBE 1HAVA 2VVUA 4RSPA 2QC2A 1FY1A 1WQSA 4U30A 3EAJA 2WPHS 5DO4H 4ZCNA 1JIRA 2AGGX 4MLFB 2BVRH 4LZ1H 2KM0A 1O2SA 3ATMA 1KMHB 3OU0A 2XC4A 5E0GA 1SGPE 4DOQA 4MG3A 5FPSA 2AMQA 3PWBA 1GBTA 2BDBA 5AF9H 5FCKA 2KX4A 2QIQA 1LMWB 2K8IA 4YLUA 4AZ2B 2WYGA 1GWAA 3ZZAA 1JRTA 3ATIA 4YOGA 3SW2B 2R2WU 2XCNA 3S9BA 2D8WA 4BTTB 3MNCA 3QZQA 2BD3A 2GCHG 4JCNA 5EU8A 1ZTJA 3UQOA 1YBWA 2XOKD 2AEIH 1ZYOA 2XBWA 3OY5U 1AWHB 2I6SA 1LVMA 4YESB 4DGJA 4WMFA 4WY3A 1IQFA 4K1TA 1AE5A 1OWEA 2ZIQH 4MPUA 4X1QU 1KY9A 2PFEA 1C5PA 3M3TA 4FUBA 2FI5E 2SGDE 3SHAH 3RXQA 2G5NA 1CT2E 2KCAA 1DXWA 2F9OA 1N6YA 3H7TA 1EAUA 3EQ0H 2SGQE 2G81E 1KLJH 5FL7D 1QHRB 1O33A 1O3KA 3BG4B 4ZXYH 1PPCE 3RXMA 3VGCB 2VBCA 5CDFE 1BBRH 3TGKE 4XD7D 1OWKA 2Q6GA 1C5MD 3MNBA 2FODA 3PROA 4MNWA 1MZDA 1QA7A 3G01A 2SGFE 3DCLA 3SHCH 4AOQA 1O5GH 3OSYA 1G32B 1GBEA 1T8MA 1PPZA 1K21H 1SGQE 1D9IA 1J9CH 2BLOA 2R0LA 1JRSA 1SGNE 3GICB 1CT4E 2GD4B 3KL6A 4NWLA 1O5BB 3BEUA 3H09A 2OC8A 3PMJA 1C5UA 1GI2A 1KTSB 1PYTC 3ZVEA 1Y59T 2ZHDA 3M3SA 1MMJN 1YPEH 1AMHA 3MYWA 3KEEA 4Q4LA 2A4GA 3TJNA 2P8OB 1L4ZA 4P00A 2O8UA 2ZDNA 2ANMH 4DIIH 3OTPA 1FN6A 2K1QA 2EI7A 1V2KT 3A7ZA 3C27B 4BAKB 2G52A 5HMAA 2PSXA 2CF8H 1B0FA 7KMEH 1P05A 2QYIA 3RXFA 2P3UB 3L33A 1V2RT 4CRFA 1ZPZA 1SGFA 3GY7A 1K2I1 1Z6JH 3LC3A 5CMXH 3SU4A 2JDID 1EZQA 2ALPA 4Y10E 2BZ6H 3RMMH 4YTAA 1OWIA 3M3VA 2KCYA 5FX5A 1FY5A 1IQLA 3M7UA 3SUFA 1RGQA 1KIGH 1A5GH 4FU8A 4ZKOU 1W8BH 5F8XA 4INHA 5L6NH 1P8VC 1TABE 2BD9A 2LPRA 3PMAB 2BX4A 3PV5A 2SGEE 1O3BA 4WH6A 5A8YA 2Z3CA 4X8VH 2OC7A 3GY3A 4O9VA 1A0LA 1PJPA 2FEQH 2RG3A 1AE8H 1O2NA 4AFZA 2P95A 1C1SA 2PGQB 8KME2 2HNTF 1UTKA 3VFEA 5A0AE 2JETB 1G2LA 1LQDB 1W14U 4ABBA 1MZAA 4CRBA 1DY9A 3LH3A 8GCHG 1ZMLA 2UWPA 3IG6B 3ESTA 1C1VH 1SGIB 2ANKH 4AFQA 2HPPH 1E0FD 1GDUA 3C1KA 2CF9H 3H5CB 4F49A 2A4OA 3E16B 1IQGA 4Y8XA 1Z8JB 3P70B 1EB2A 2EEKA 1WV7H 1HAIH 3NXPA 1GBJA 2J98A 4WF8A 4A5TS 1SGFG 3MU1A 1IOEA 1VCPA 1W0JD 3M5MA 4J2YB 2WPLS 3RXKA 4I8GA 2GGVB 2XBYA 2Y80A 4MNVA 3ZZ9A 1D3QB 6ESTA 1NU7B 4Q7YA 2BVSH 5LGOA 1P02A 1VJ9U 4FUIA 1C5NH 1LQEA 1V2LT 2A31A 1HB0B 4CRGA 3ZZDA 2XWBI 2AIPA 3KNXA 4ZHAA 1ELEE 4E7NA 2WUCA 4I31A 3FN8A 5FBIA 1DY8A 1O38A 2ZQ2A 1GI7B 1BTZA 5EGMA 2QXGA 1HGTH 1YPMH 1VCQA 1LCYA 4X1NU 4RT1A 4AG1A 2AIQA 5GWZA 4O97A 1ZPBA 1Z7KA 4TT3D 1SQAA 1MTWA 4ZKNU 3PTBA 2D1JA 2J9NA 3BIUH 1O5DH 1ELFA 3MNSA 3RC5A 4MTBA 2A1DB 3SU1A 2B8OH 1HAYB 1ETTH 5FPTA 1H8IH 1MQ5A 5HYOA 2RA3A 3RMNH 1TX7A 2BX3A 2PUQH 3GOVB 4Z1MD 3Q3YA 4OS2A 1CSOE 3VPKA 2VIOA 3ZVAA 1EXFA 1GGDC 3RXIA 1SLXB 1T4UH 2ZFQH 4YM9A 1XMNB 3DT0H 1K1OA 2TGAA 4A6LA 1W0KD 3E3TA 3PRDA 3SORA 1CGIE 1C2EA 1ESAA 2PV9B 3GCTG 3QTVH 4X6NA 5JBBS 1QB9A 2PKSB 1Y3WA 8LPRA 1LHCH 5C94A 5DP4A 2OXSA 1LHGH 1W0ZU 1PPFE 1QRWA 2BD2A 1A2CH 5DP5A 3F2GA 2ZI2H 4MNXA 2WINI 3VB3A 3ENSB 2J4IA 1TGSZ 1BJVA 1AY6H 3AVZA 5GXPA 4CR9A 1A0JA 1FAXA 2HALA 1C1WH 1H8ED 2BZAA 1BZXE 3JZ1B 4KP0A 4YOIA 4DVAU 3CNRA 1PPGE 2BLVA 4D7FA 3B9FH 4B6FA 2GCTB 2OBOA 2JH6D 2BD4A 2XCFA 1ANCA 4IN1A 4WVPE 2ZEBA 1OYTH 1YPGH 2BQWB 3RC6A 2FDAA 4Y7BA 2GDEH 1UMAH 5EPNA 1D4PB 1DE7H 4FUDA 1GI5A 3SU2A 4YLQH 1J8AA 1NTPA 5LPRA 1A46H 2AMDA 5I46H 2WZQA 3KN2A 1ORFA 3SGQE 3TITA 3FOAA 2PW8H 3VEQB 1VJAU 1ZPCA 2XXLA 1NM6A 4BAOB 3NWUA 1O2UA 2Z94A 4KELA 3ZYEA 4H6TA 1LKAA 5L2ZH 1K1MA 3ZVBA 3OEHD 3F9GA 5FPYA 2O8WA 1ZGIA 5AHGH 1BMLA 2VIQA 2ZU2A 3SNEA 1ZZZA 4Y11E 4YOJA 4D76A 4Y6DA 2FZZA 2Z3EA 1ID5H 4FUJA 4K3JA 2A5KA 2RDEA 1E36B 2WHXA 4XE4A 3EA7A 2ZHFH 3MO6A 3SUEA 1GGDB 1CE5A 1O2LA 3FP6E 2JH5D 1IQMA 5EPYA 1GPZA 4FVBA 1IQEA 3SZNA 4X1RU 1ZOMA 4Y79A 4CH2B 1P9UA 2VWMA 2M5TA 4TWWA 4WH8A 5FCRA 3MU5A 4ASHA 1GCTC 2ODQA 3RM2H 3GS9A 3SJ9A 3UWJH 1L1JA 3V12A 1KXEA 2QF5A 1TPAE 2TGPZ 2AS9A 3TLOA 3A7WA 1SLUB 2UWLA 1O2TA 1B5GH 1Y8TA 5TCAA 3S7HB 1PPHE 1V3XA 2YMSD 1NRNH 1TBQH 1QJ7B 4X2XA 1O3IA 4WMEA 2TRMA 1WYKA 4DG4A 4FUHA 3DUXH 1MU6B 4ISHH 4DURA 1AFQC 1C5WB 1NROH 1SC8U 3RC4A 3PB1E 4A1XA 2ZDMA 4I86A 1TNLA 1YLDA 2Y81A 3UB0A 1UTQA 2ZHEH 2PUXB 2THFB 3HKIB 1OHHD 1OXGA 2FI4E 1ESBA 1OP2A 2J94A 1ZTKA 3BEFB 4I8LA 4ZHLU 4ABAA 3SJIA 4CRCA 7GCHG 3GDSA 1PYTD 2GCHF 2PKAB 5DP6A 3VB7A 3ZZCA 1Z1JA 1V2TT 3STIA 3LDXH 1WTHD 2PLXA 2B9LA 2GV6A 2YNAA 3AASA 3F0OA 4X2YA 1CGHA 3EE7A 3Q77A 1P04A 1WUNH 1ZHRA 2WPIS 2L74A 5EQSA 4CR5A 1GI3A 3PO1B 3Q76A 2WPJS 5C5NA 1P2IA 1YPLH 4D9RA 4GVUA 5PTPA 3TK5A 4I8KA 3WWBA 1U6QA 3SV7A 1S5SA 1XKAC 1NT1A 5LPEA 1ZJKA 4Y8ZA 1O2ZA 5HM2A 4HGCA 5J4QA 3LPRA 1LPGB 1H4WA 4BANB 2V6NA 1ABJH 3K6ZA 2F9UA 2B0FA 1NFUA 1HAGE 1GVLA 2RDLA 3LOXA 1KLTA 2C8ZB 2Z9GA 5ESBA 3BTEE 3ITIA 3MOCA 1LPKB 3RXOA 1MKXK 1C5QA 2Z3DA 1BQYA 2FMJA 2BY7X 5EG4A 1BRUP 1HAXB 5ESTE 2ZU4A 1FPCH 3O8DA 1E34B 1W7XH 1WBGB 3I29A 1MKXH 1A1RA 1QURH 1GJ8B 2OQ5A 1N1LA 2ODYB 3BTTE 2HVYB 1N6XA 3VXFH 1DFPA 2ZU1A 5DG6A 3BSQA 1TMTH 2OCVB 3PV4A 3D65E 4RI0A 3UOUA 1O5CB 4ZHMU 1BTPA 3QWCH 4GCHF 1ELTA 2TIOA 1ZHMA 1GBHA 2J98B 1GI4A 2V7QD 3DFJA 1UTMA 1AFQB 5JB8S 1P57B 1FXYA 3S0NA 1BDAA 1NFWA 3BTKE 4AB8A 1Y3XA 1O35A 4WXIA 3ZYDA 3BTQE 5FAHA 2V3OH 2BLWA 1XUGA 2J2UA 4JK5A 1L4DA 2ZGCA 2OINA 1H9HE 4Q2KA 3PWCA 5KEDA 2AGIX 5LPFA 1QQUA 4UDWH 5CE1A 1TPSA 1JWTA 1GHZA 5DGJA 1SHHB 2VH6A 4X1SU 2C8YB 4ESTE 4UFDH 4DT7B 2V0BA 5BPEA 6GCHG 4LZ4B 1GHXH 1SQTA 2SGPE 3A81A 2VIDA 4B73A 3UIRA 1CBWB 5F8ZA 1SG8B 1XM1A 2QGRA 2XNIA 4NZLA 3O8CA 1IHTH 3F2HA 1BT7A 1QRXA 2W7UA 1G3DA 2A2XH 2JH0D 3LGYA 2ZPSA 1XVOA 1F0RA 1NZQH 1YLCA 2P8OC 3GCHC 2G55A 4D8NA 4INKA 1EAXA 3E8LA 1MTSA 3A86A 2HPQH 1O30A 5F8TA 1EOLA 3R0FA 4P02A 3N99A 3GYMA 3MU8A 1EP6A 2ESTE 4O03A 3W1EA 1H9LB 2D26C 3H7OA 2G00A 3CP7A 3ATKA 8GCHF 4RN6A 1O3DA 1YYY1 5B6LA 2WV4A 1O2WA 3A8CA 2UUJB 3TH2H 2FO9A 3CS7A 4KTSA 1VZQH 1C1MA 1OP0A 3GCNA 3QDZB 1Z71A 4ABIA 1EZSC 3I77A 3U8TH 1A0HB 1G3CA 1QJ1B 4I8JA 2ASUB 3UR9A 3T27A 2NU1E 1T8OA 1XKBC 5C17A 1DWEH 2F3CE 3TGJE 1OS8A 1LKBA 3WY8A 2CK3D 2Y7XA 1C1TA 2BHGA 2ILNA 1F0SA 2OC1A 1Z6EA 3SU3A 4ACAA 2IJOB 1S6HA 1C5OH 3GY6A 1KXCA 1TFXA 1RFNA 1BRAA 1F0TA 2JETC 3GY4A 1C5ZB 2D2DA 1HJ8A 1N8OC 1XUFA 1GVZA 1QNJA 4OS7A 3P6ZB 3BTDE 1OP8A 3PV2A 4I8HA 2QN5T 1RD3B 2P3FH 3V13A 1MAYA 1D6RA 2ZQ1A 3RXGA 1TRYA 1GMDF 1O5EH 1PPEE 1ZHPA 3LJJA 1DUAA 2VWOA 1AN1E 4LK4A 2GKVE 1Q31A 1Z8IB 3RXUA 8ESTE 1PFXC 1V2OT 3RU4E 1KXDA 4ZH8A 3STJA 9ESTA 3A85A 4NIXA 1EJNA 1TRMA 1K1IA 3ZV9A 5HXFA 4BXSA 1QB1A 4Y7AA 4GCHG 3TNTA 1FONA 3GCHB 4J1YA 5A09A 1XUKA 3FZDA 2W7SA 3UTUH 1SGCA 1C4U2 2HNTE 3A89A 3FFGA 3A7TA 3RXHA 2BQ6B 4BTUB 3GCTF 5TJXA 1C4Y2 1NPMA 2PKAA 1MTVA 2NU0E 5GCHF 1F5KU 1UCYK 1F2SE 3P8OA 1HAHH 1TGNA 4TWYA 4X2VA 2O8TA 5T1VA 2BY8X 4FU7A 3ZVCA 5EIYA 1BITA 5DSFA 2PGBB 2ZECA 1LHEH 4ISOA 5DJ7A 1G3BA 1YPHE 1GCDA 1QL7A 4F4OC 1K1PA 5DP3A 1GJ9B 3MH5A 1W12U 2BD5A 1SMFE 2TGTA 3DHKH 3ODFA 2FOMB 5CHAC 1GG6C 2H9HA 4B2BA 3F0PA 1QRZA 2VB0A 2ZCHP 1CHOG 3MO9A 4A1VA 3ZZ3A 1JMOH 2V3HH 1GJBB 1DANH 3URCA 1KTTB 4R0IA 2XBXA 2ZGJA 3ZZ8A 2BDCA 1QIXB 2PKSC 5ABWA 1N8OB 1DXPA 5EQQA 3FAOA 1A4WH 3MHWU 3SUGA 3F9EA 1DS2E 4LXBH 1E1QD 1C5RA 1BRCE 4X8UH 1T32A 1GBMA 3SV8A 1NFXA 1G30B 1GHVH 2KAIA 1CA0B 1QBVH 1LHDH 3AW1A 1HRTH 2BDHA 3Q3KA 1FY4A 2W5EA 2C90B 1OOKB 1HAOH 1D6WA 1RTKA 1C1NA 5C1UA 1YP9A 1GI9B 2VU8E 5EQRA 4K1SA 1P06A 4U32A 4MNYA 2FESH 4DT4A 2A7HA 1PPBH 3MNXA 3IITA 1C2FA 2O9QA 1MAXA 1DICA 1QY6A 3MO3A 4B2CA 2GCTC 1AUJA 4YT6H 4CBNA 1F0UA 1V6DA 3KQCA 1O3PB 3UFAA 5HGGA 1S85A 3SU6A 4NIVA 5DKMA 5C2ZA 6LPRA 1P01A 4BAQB 2Y7ZA 1QJ6B 1TQ7B 2GZ9A 4OS1A 1UJ1A 2G4UA 3RU4D 1M9UA 1SGEE 3EE0B 3U69H 3A7XA 4BNRA 5EJZA 3QX5H 1GBBA 1Y3VA 1C1UH 3OEED 3GYLB 4Y0YE 4AORA 1S81A 1GMDG 3KYGA 3F9FA 1XXFA 3P92A 1KYNA 2C4FH 1B7XB 5FXLA 3SNCA 1UHBB 3M5NA 4B75A 1A61H 1W7GH 1THPB 1JOUB 1TX8A 2HLDD 3A8DA 2ZP0H 5EJ1A 2WSSD 3AAUA 1XUHA 4K5ZA 3QGJA 3MFJA 2ZPRA 3F2FA 5CHAB 1GG6B 4AX9H 2IN2A 1TONA 3BEIB 2B7DH 2J95A 1AZ8A 3E91A 3SJKA 2VNTA 1Y3YA 3HGNA 3LGTA 5C5OA 1ZSKA 4JK6A 2CMYA 2C3SA 1TNKA 2W26A 4GUXA 2ULLA 4JZFH 3L6PA 4JZIA 1DDJA 2GT7A 7GCHF 1T31A 1SGRE 3UY9A 2EI8A 5ETXA 4X6MA 5T6DA 5GCHG 2LP6A 1TPOA 1UTLM 2A2QH 1C2DA 1C1PA 1SPJA 1CQQA 3GY5A 3SYJA 2OK5A 1ANEA 2DE9A 4TPIZ 5AVDA 1VITG 2FXRA 2IPHA 5B6OA 1HDTH 3SV9A 4MQAA 4K2YA 2KCPA 1UO6A 1P10A 2SNWA 2P3TB 5JDUB 1O3AA 1NO9H 1QGFA 3QN7A 2RCEA 2JKHA 3FP7E 3SN8A 1MH0A 4NSVA 3P8GA 1Z1IA 4XBDA 3RXVA 1TX6A 1GVKB 1TMUH 1HXFH 1MTNC 3ZZ4A 1E38B 4ISIH 1NRSH 1BIOA 1W10U 1IQHA 1BUIA 1C9PA 3LGUA 4ZKSU 2XC0A 1IAUA 1GJCB 2W6ID 4U2WA 2Y5HA 4XBCA 3SI3H 3K6YA 4H6SB 2CJIA 4X6OA 4ZMAH 2QE7D 1UVSH 4JYVH 5LH8A 3ZVDA 3E1XB 5KGOA 1NESE 2ZDAH 2XNDD 1FZZA 3E90B 4B74A 3HATH 4CREA 3RU4T 3U1IB 3TH4H 1QR3E 3OFND 1P3EA 2OLGA 1IQNA 3KF2A 4HFPB 3OAAD 3BF6H 4X0WU 3GCOA 1P2OA 1BTHH 2VVVA 4XFQA 3TK9A 2R2MB 2CHAB 3WW7A 3A87A 2Z7FE 4SGAE 4TY6A 3RXRA 1C2LA 3RXTA 3PO1C 4NIYA 1SGYE 1XX9A 3B23B 4ABHA 1V2MT 2AH4X 1NN6A 3LGWA 1TGTA 4WWYA 1HIAA 1NU9A 3RXDA 1ELVA 3TPIZ 1VGCC 1NRRH 3SBKA 3TVJB 1TGBA 3P95A 1DWDH 3MH6A 2GZ7A 1WSSH 1FPHH 3ZZ6A 1MCTA 4XBBA 2A4QA 1SL3A 3NUMA 1FUJA 1G3EA 2G51A 5G4BA 3SUDA 3MU0A 5DN6D 5K0HA 3T62A 1O2HA 2QF0A 1G9IE 1SFIA 2H1UA 6CHAC 1E35B 2J34A 3VB5A 3KIDU 1FX0B 2OUAA 5C3NA 3A8BA 4X6PA 4A1TA 4DW2U 3M5OA 4UFGH 2ZPQA 1AVGH 2ZKSA 4Z0KA 1O2JA 1TMBH 1EB1H 1RRKA 3SV6A 1TNHA 1P2KA 3M7TA 2GT8A 1JIMA 1TIOA 3BTGE 4UONA 2V3MA 4GHTA 4M9FA 2R3YA 3D49H 1UVTH 1V2JT 6GCHF 3NPSA 1TPPA 3NRLA 2GTBA 4Y76A 2BTCE 2WV5A 4Z6AH 1OWJA 2VIPA 5C20A 2HOBA 4IC6A 5T3HA 2CXVA 1Y5AT 2XWAA 1UTJA 3ZVGA 5SGAE 2R0KA 1DX5M 4YT7H 2DUCA 4GPGA 5I25A 1MTNB 2FI3E 4X2WA 4ABEA 3KQ5A 1D3PB 3BTHE 2Y82A 2A5IA 1OX1A 2LNCA 4H42U 1SR5C 2F9BH 2QXIA 2QAAA 3FANA 1S83A 4K60A 1GDNA 1HAZB 1LO6A 3BN9A 3SV2H 3SU0A 5C0UA 2FOGA 3KQDA 2RFKC 5J4SA 4B2AA 4DY7B 2XYAA 4NA9H 1E79D 1FDPA 2YOLA 3M7QA 3Q3XA 3TH3H 2QA9E 1O39A 2BVXH 2FOBA 2XTTB 1FLEE 2W3KA 2A0QB 3RXCA 3F1SB 1O2PA 3A8AA 2Q6FA 4BAMB 3M37A 2AMPA 4ABJA 1C2HA 4OS5A 3RXBA 4AGKA 4B71A 1ANDA 3VG8A 4NGAH 2EA3A 2UUFB 5GIBA 1UTPA 2R3UA 4CBOA 1O3CA 1C2KA 2HVXA 2FTMA 2A45B 1CBWC 2V35A 1WOFA 2GV7A 1QCPA 1YCPM 1FY8E 1HFDA 1Y5UT 1VGCB 2Y5FA 3DSGA 1C2IA 2Z9LA 2QV1A 5FBEA 5C1YA 1C1OA 4AGJA 1O3EA 5A0BA 1UK2A 4FXGH 3VXEH 1P9SA 1SLWB 2VWLA 1HUTH 4I7YH 1GJ4H 1C9TA 4CHAC 2PP6A 1RTFB 1RTLA 3VB4A 1T8LA 2Y6TA 2M2AA 6CHAB 4A92A 3ZIAD 1H9IE 1ZRBA 4PROA 2HGTH 1SSXA 1O2QA 4RKOB 1L1GA 2A32A 2CN0H 3EYDA 3V0XA 3RXLA 3A7VA 1EAWA 1GBDA 1EATA 3SI4H 1AIXH 1GJDB 4TPYA 2BY9X 2EQNA 1QA0A 1S6FA 4F55A 1PQ5A 5C1XA 2ZGBH 2ZO3H 4INLA 1HAPH 1O36A 1UHBA 2AERH 5EXLA 2WYJA 2C93B 1MQ6A 4GSOA 2KAIB 1QB6A 1TAWA 1G2MA 1TNGA 1ZTLA 1TLDA 3TIUA 3SQHE 2F9PA 4UEHH 2GP9B 1ZLRA 4MVNA 1BMNH 1YPJH 2JJ1D 2PWXA 3OY6U 1C1RA 1P03A 1CO7E 1F92A 1TB6H 4JZDH 3BV9B 3U1JB 3HK6B 1X7AC 3PRBA 1OWHA 1SVPA 2FLRH 2H9EH 1FNIA 1S84A 3S9AA 2KCOA 3SO3A 4ACBA 1WCZA 5C67A 4O3UA 2A4RA 4X8SH 3A80A 4UFEH 1IQKA 1NC6A 1UVOA 1L0ZA 4AFSA 1Q3XA 1KSNA 5KECA 4YXWD 1AGJA 1V2WT 1XUIA 2SGAA 4JYUH 1GMCG 4WXVA 1UCYE 2FYQA 4IS5A 4Y71A 2ZHWH 4Q7XA 5A8XA 4MPWA 1SLVB 2UUKB 3MH4A 4O3TA 1A5HA 1DVAH 1HJAC 1C5LH 1ZR0A 3O8BA 1TALA 1INCA 3M5LA 1AKSB 1CHOF 5JBCS 5GDSH 3TNSA 2I6QA 1F5LA 4AN7A 1C5VA 1ZSJA 2UWOA 1GHAF 1DSUA 5DP9A 4ZAEA 4CHAB 1LHFH 1K22H 1S82A 1VR1H 1C1QA 1O2RA 1DITH 3GY8A 4ABDA 2VJ1A 3V7TA 1C5YB 3QO6A 5DP8A
chains in the Genus database with same CATH topology
5E8EH 1WQVH 1AB9B 2Y5GA 2IOTA 1P09A 2GZ8A 2NU3E 1BMMH 1FY3A 5A0CA 1T7CA 1GL1A 3SU5A 1O3GA 2G8TA 2FOFA 3GISB 3MTYA 3RXEA 1YKTA 2BM2A 2OQUA 3T5FH 1WAYB 2ANWA 4E05H 1BOQA 1OWDA 2FTLE 1DLEA 4KTCA 3NK8A 4DJZB 3MMGA 1TE0A 3MWIU 1WTGH 2Q1JA 4NWKA 4CRDA 1QL9A 3DA9B 1TRNA 1ABIH 4FUGA 1QFKH 1EOJA 2QY0B 5JBTA 3W95A 1ZSLA 1SGTA 4R8TB 3U98H 9LPRA 3M61U 1GHYH 1SQOA 2Z6BD 1NY22 4DCDA 2AGEX 2ZF0H 4NFFA 2AYWA 1PQAA 1FMGA 3FZZA 3ELAH 1BTUA 5TCCA 7ESTE 2ZU3A 1ESTA 3HKJB 3PLKA 3RLWH 1LPZB 3EA8A 1C4V2 1BBRK 1EAIA 1O3HA 3R3GB 3UNRA 1CA0C 3I78A 5E2OA 1GJ7B 2TGDA 2H5DA 2ZCLP 1P2JA 1DOJA 1MBQA 3UNQA 3E0NB 2FPZA 1YPKH 2P16A 1QBNA 2BD8A 5JBAS 2O8MA 1SFQB 4HI3A 4Y8YA 2PSYA 3JZ2B 2ALVA 1HJAB 4M7GA 4ISNA 1DWCH 1KLIH 1LDTT 2VGCC 3MH7A 1HIAB 3RDZA 2Q6DA 1H8DH 1G37A 4MPXA 2BY5X 2NWNA 4NZQA 2PTNA 2C8XB 1XVMA 1GHBF 1ELGA 1EZXC 1TOMH 2OBQA 1ZJDA 1V2ST 1E37B 3LT3A 2GDDA 4CRAA 3S9CA 5EXMA 2A7JA 2FS8A 5GPIB 7LPRA 3L3TA 3O8RA 4OS6A 1ARBA 1P12E 2DE8A 2WUBA 1P2QA 5FHTA 5DK1A 1VITF 1UVUH 1A3EH 3UNSA 2PR3A 1UCYH 5JYIA 1LVYA 2STAE 4NG9H 4D9QA 1EUFA 1FIWA 2GX4A 1ELDE 3LJOA 1O2KA 2ZTYA 2BDAA 1BA8B 3TK6A 1TYNA 4GLYA 5FX6A 1BMAA 4JZEH 1SOZA 1V2QT 2BD7A 4BOHA 1P11E 2G5VA 2H6MA 4KGAA 4A7IB 1K28D 3P8FA 1BHXB 2VIVA 4IBLH 4H4FA 1FV9A 1GBLA 2BXUH 1GBAA 1GBIA 1UTNA 5IDKA 1GHAG 4X1PU 1V2UT 1BTWA 4HZHA 5L30H 2OD3B 1O2IA 3ATWA 3OYPA 1KXBA 4K69A 3CENA 3KHVA 2C8WB 2H9TH 2XRCA 2VH0A 3S7KB 3PTNA 5A8ZA 2Z9IA 3QZRA 1Y5BT 1ARCA 1ZRKA 4KKDA 1F5RA 1HYLA 1O3LA 3A83A 1HBTH 1K1LA 1TWXB 3T29A 5IYTA 5BRRE 1TBRH 4UD9H 2P59A 4UE7H 1O5AB 2BY6X 1ETSH 1WU1A 5L2YH 5E0HA 2BXTH 4QT8C 2FOHA 1AFEH 1CT0E 2B5TB 2BOKA 3SGAE 1QTFA 1CVWH 1DUEA 1EPTA 2F91A 3GDUA 3UUZA 1C2JA 3RXJA 1EQ9A 1QQ4A 2VGCB 3RMLH 2FYRA 3BG8A 5E0JA 1ETRH 4JMYA 1EJAA 4K1EA 3LIWA 1AQ7A 2GVFA 1PQ7A 2GMTC 1AVXA 1MKWK 4NCYA 1DT2A 1O2XA 1QL8A 1VITH 3RP2A 2ZWLH 1XUJA 5F6MA 1HJ9A 2FM2A 3NZIA 1MKWH 1BTYA 3DFLA 1ACBE 1KDQA 3P17H 1G36A 4IN2A 2XC5A 1J14A 2VWNA 1GHWH 3ZZBA 2QCYA 4Q7ZA 4NA7A 4KTUA 1JXPA 1V2NT 3TGIE 3ZVFA 4I32A 1GI1A 1AVWA 2CHAC 1Z8RA 2CV3A 2SFAA 3S69A 1TNJA 1NS3A 3GY2A 1H1BA 3F6UH 3PM3A 1EP5A 2BDIA 2ZDKA 1AWFH 1FAKH 1L2EA 3T2NA 1AKSA 4YZUA 2ZFSA 2QXJA 2F9VA 5AFZH 4Y0ZE 5E2PA 1GI6A 2NU2E 4IMQA 1TA6A 3FVFB 3QTOH 2NU4E 1W11U 1AI8H 1LVOA 1NRPH 1P0SH 3EDXB 3PMHB 4NFEA 2ZDLA 1FJSA 5EOKA 3IWMA 1SI5H 4OS4A 1CHGA 1GDQA 4WMDA 2VVCA 3RLYH 2ZGHA 1GHBG 2HWLB 1CGJE 1GBCA 1OKXA 2SNVA 2FX4A 1HNEE 1O2MA 3NKKA 4BXWA 3TJOA 4BTIB 3EA9A 1THRH 1Z8GA 1ELAA 4IMZA 4IW4E 2ZGXH 1NRQH 4AFUA 2WPKS 4HTCH 3BIVH 4DIHH 3P8NA 2FP7B 3A84A 3QGNB 1O3MA 4ZUHA 1GI8B 1A7SA 1O31A 2ZU5A 5EXNA 3UR6A 3RUOA 3E0PB 1TGCA 1CU1A 1K1NA 2FOEA 1O3JA 1HLTH 1O2VA 5AFYH 2P94A 3LKWA 1SOTA 4ISLA 1DSTA 2H2ZA 1HXEH 2OC0A 1TNIA 3BTFE 4XOJA 1CA8B 2FWWA 3URDA 1BHXF 2GMTB 4AYYB 2UUYA 4ABGA 3FP8E 3UWIA 1BB0B 1GMHF 1A5IA 1ZMNA 4ABFA 2ZNKH 4ZXXH 3LH1A 2ZFFH 5GJ4B 3RM0H 1C2MA 4K8BA 2FIRH 3AAVA 1K1JA 3LC5A 1J17T 2HRVA 2ZTXA 3U9AH 1BTXA 2PHBA 1HAVB 2EC9H 1O5FH 3T28A 4TYDA 2BDGA 4E06H 1HCGA 4NSYA 4X8TH 1DPOA 2R9PA 3TJVA 1HV7A 1IQIA 3RXPA 3QK1A 2FOCA 1UK4A 4CH8B 1QBOA 1O2YA 1XXDA 3RMOH 2YNBA 1O34A 2BQ7B 4NA8A 2BLQA 3V3MA 3PYHA 2OTVA 3RXAA 3RXSA 3A7YA 1C5TA 3HGPA 4B76A 1OPHB 5T6GA 1IQJA 1UVPA 3T26A 3VB6A 1O2GH 1NFYA 2AFQB 3D62A 3E6PH 5K7RA 1J16A 1TOCB 1MU8B 3SQEE 2CGAA 3M36A 5EW1H 3SJ8A 1YGCH 4GHQA 3ZZ7A 2P93A 1RS0A 3HPTB 4ZKRU 1ZGVA 2TPIZ 1AO5A 3UQVA 4B1TA 1O37A 1JBUH 1DM4B 1GMCF 1W0YH 2QXHA 1AUTC 5H4IB 1LVBA 3EGKH 3K9XB 2J92A 2Z9JA 1K9OE 3F9HA 1D3TB 1LTOA 5F03A 1O0DH 5EODA 3KQEA 2QF3A 3LU9B 1GJAB 3OTJE 1TA2A 1GL0E 3GDVA 4FUFA 3T25A 4VGCC 2H5CA 1EPTC 5A2MH 4I33A 2XW9A 1KXFA 1YC0A 1W3CA 1V2VT 5EW2H 1ZMJA 3TJUA 1V2PT 4UFFH 2OP9A 5DPAA 1AHTH 1FIZA 4JZ1A 1BJUA 3QLPH 2ZG0H 4FUCA 4LOYH 1O32A 4FU9A 1EASA 3HK3B 1C5XB 4OGXA 4AYVB 1Q2WA 4MDSA 1GBKA 2W3IA 3LGIA 1FN8A 2Z9KA 3SNAA 2HLCA 2XBVA 1ELBA 1F7ZA 1RIWC 3BTME 3M35A 1D3DB 1T8NA 1SHYA 5JPMH 2PTCE 1OYQA 3UPEA 1GI0A 4BAHB 1VCWA 1YM0A 4IGDA 2F9NA 3PMBB 5JB9S 1BCUH 2EI6A 1C5SA 3KCGH 1Y3UA 1T4VH 3CS0A 1AB9C 3D23A 2FX6A 5HM9A 1GMHG 1YCPK 1OSSA 1MD8A 1UTOA 1EX3A 1O3OA 1EKBB 1J15A 3K65B 3K2UA 1AZZA 4E7RG 1UK3A 3U8RH 2BMGB 4K8YA 1YCPH 2HNTC 1AD8H 3SJOA 3B8JA 1SB1H 1ANBA 2TBSA 1YF4A 1DLKB 4MPVA 2ZFTA 1BBRE 1GCTB 5DP7A 3SGBE 1MCVA 3A82A 1KXAA 1GJ6A 1RXPA 1BRBE 3QUMP 3BTWE 1THSH 3PLPA 4XSKU 3U8OH 4VGCB 1TQ0B 4OGYA 3TU7H 1RJXB 3MU4A 1B0EA 1EPTB 2STBE 2ZFRH 2O8LA 2ZA5A 1FQ3A 1DWBH 1YPHC 4AB9A 4YO9A 2FLBH 2ZZUH 3MI4A 3UOPA 3A88A 1C2GA 1S0QA 2ZFPH 1EJMA 1ELCA 1O3FA 3KGPA 1A3BH 2ODPA 1GJ5H 4AG2A 1MBMA 3SOSA 3ZZ5A 4GAWA 2BOHB 1GBFA 1KDQB 2VINA 4WJG2 2ZDVH 3UREA 3BG4C 2BDYA 1PQ8A 1P3CA 3VGCC 1L1NA 4FVDA 1P2NA 3ZV8A 2ZTZA 3DD2H 1S0RA 1SGDE 1W2KH 3W94A 4THNH 2BB4A 3LONA 4RKJB 4U01A 1P2MA 1MUEB 1W13U 2WPMS 1FI8A 2A7CA 1IHSH 4ZROA 2BYAX 1MTUA 1RIWB 1TBZH 4JYTA 2FS9A 3Q00A 3ATLA 4FUEA 1HPGA 4Q80A 3SNBA 2ANYA 2FOAA 3NCLA 3N7OA 3AW0A 4TY7A 1SBWA 2ZCKP 2ZHQH 3PLBA 1EZUC 2A5AA 3F68H 3ODDA 4D7GA 2F83A 1MD7A 2G4TA 3KQBA 1AU8A 2VIWA 3OX7U 2J38A 5T6FA 3SNDA 2ZC9H 2RA0A 4IC5A 4NIWA 4XDEA 1O3NA 1O2OA 3LGVA 4SGBE 1HAVA 2VVUA 4RSPA 2QC2A 1FY1A 1WQSA 4U30A 3EAJA 2WPHS 5DO4H 1JIRA 2AGGX 4MLFB 2BVRH 4LZ1H 1O2SA 3ATMA 3OU0A 2XC4A 5E0GA 1SGPE 4DOQA 4MG3A 5FPSA 2AMQA 3PWBA 1GBTA 2BDBA 5AF9H 5FCKA 2QIQA 1LMWB 4YLUA 4AZ2B 2WYGA 1GWAA 3ZZAA 1JRTA 3ATIA 4YOGA 3SW2B 2R2WU 2XCNA 3S9BA 2D8WA 4BTTB 3MNCA 3QZQA 2BD3A 2GCHG 4JCNA 5EU8A 1ZTJA 3UQOA 1YBWA 2AEIH 1ZYOA 2XBWA 3OY5U 1AWHB 2I6SA 1LVMA 4YESB 4DGJA 4WMFA 4WY3A 1IQFA 4K1TA 1AE5A 1OWEA 2ZIQH 4MPUA 4X1QU 1KY9A 2PFEA 1C5PA 3M3TA 4FUBA 2FI5E 2SGDE 3SHAH 3RXQA 2G5NA 1CT2E 1DXWA 2F9OA 1N6YA 3H7TA 1EAUA 3EQ0H 2SGQE 2G81E 1KLJH 1QHRB 1O33A 1O3KA 3BG4B 4ZXYH 1PPCE 3RXMA 3VGCB 3TGKE 1BBRH 1OWKA 2Q6GA 1C5MD 3MNBA 2FODA 3PROA 4MNWA 1MZDA 1QA7A 3G01A 2SGFE 3SHCH 4AOQA 1O5GH 3OSYA 1G32B 1GBEA 1T8MA 1PPZA 1K21H 1SGQE 1D9IA 1J9CH 2BLOA 2R0LA 1JRSA 1SGNE 3GICB 1CT4E 2GD4B 3KL6A 4NWLA 1O5BB 3BEUA 2OC8A 3PMJA 1C5UA 1GI2A 1KTSB 1PYTC 3ZVEA 1Y59T 2ZHDA 3M3SA 1MMJN 1YPEH 1AMHA 3MYWA 3KEEA 2A4GA 3TJNA 2P8OB 1L4ZA 2O8UA 2ZDNA 2ANMH 4DIIH 1FN6A 2K1QA 2EI7A 1V2KT 3A7ZA 3C27B 4BAKB 2G52A 5HMAA 2PSXA 2CF8H 1B0FA 7KMEH 1P05A 2QYIA 3RXFA 2P3UB 3L33A 1V2RT 4CRFA 1ZPZA 1SGFA 3GY7A 1K2I1 1Z6JH 3LC3A 5CMXH 3SU4A 1EZQA 2ALPA 4Y10E 2BZ6H 3RMMH 4YTAA 1OWIA 3M3VA 5FX5A 1FY5A 1IQLA 3M7UA 3SUFA 1RGQA 1KIGH 1A5GH 4FU8A 4ZKOU 1W8BH 5F8XA 4INHA 5L6NH 1P8VC 1TABE 2BD9A 2LPRA 3PMAB 2BX4A 2SGEE 1O3BA 4WH6A 5A8YA 2Z3CA 4X8VH 2OC7A 3GY3A 4O9VA 1A0LA 1PJPA 2FEQH 2RG3A 1AE8H 1O2NA 4AFZA 2P95A 1C1SA 2PGQB 8KME2 2HNTF 1UTKA 3VFEA 5A0AE 2JETB 1G2LA 1LQDB 1W14U 4ABBA 1MZAA 4CRBA 1DY9A 3LH3A 8GCHG 1ZMLA 2UWPA 3IG6B 3ESTA 1C1VH 1SGIB 2ANKH 4AFQA 2HPPH 1E0FD 1GDUA 3C1KA 2CF9H 3H5CB 4F49A 2A4OA 3E16B 1IQGA 4Y8XA 1Z8JB 3P70B 1EB2A 2EEKA 1WV7H 1HAIH 3NXPA 1GBJA 4WF8A 4A5TS 1SGFG 3MU1A 1IOEA 1VCPA 3M5MA 4J2YB 2WPLS 3RXKA 4I8GA 2GGVB 2XBYA 2Y80A 4MNVA 3ZZ9A 1D3QB 6ESTA 1NU7B 4Q7YA 2BVSH 5LGOA 1P02A 1VJ9U 4FUIA 1C5NH 1LQEA 1V2LT 2A31A 1HB0B 4CRGA 3ZZDA 2XWBI 2AIPA 3KNXA 4ZHAA 1ELEE 4E7NA 2WUCA 4I31A 5FBIA 1DY8A 1O38A 2ZQ2A 1GI7B 1BTZA 5EGMA 2QXGA 1HGTH 1YPMH 1VCQA 1LCYA 4X1NU 4AG1A 2AIQA 5GWZA 4O97A 1ZPBA 1Z7KA 1SQAA 1MTWA 4ZKNU 3PTBA 2D1JA 2J9NA 3BIUH 1O5DH 1ELFA 3MNSA 3RC5A 4MTBA 2A1DB 3SU1A 2B8OH 1HAYB 1ETTH 5FPTA 1H8IH 1MQ5A 5HYOA 2RA3A 3RMNH 1TX7A 2BX3A 2PUQH 3GOVB 3Q3YA 4OS2A 1CSOE 3VPKA 2VIOA 3ZVAA 1EXFA 1GGDC 3RXIA 1SLXB 1T4UH 2ZFQH 4YM9A 1XMNB 3DT0H 1K1OA 2TGAA 4A6LA 3E3TA 3SORA 1CGIE 1C2EA 1ESAA 2PV9B 3GCTG 3QTVH 4X6NA 5JBBS 1QB9A 2PKSB 1Y3WA 8LPRA 1LHCH 5DP4A 2OXSA 1LHGH 1W0ZU 1PPFE 1QRWA 2BD2A 1A2CH 5DP5A 2ZI2H 4MNXA 2WINI 3VB3A 3ENSB 2J4IA 1TGSZ 1BJVA 1AY6H 3AVZA 5GXPA 4CR9A 1A0JA 1FAXA 2HALA 1C1WH 2BZAA 1BZXE 3JZ1B 4KP0A 4YOIA 4DVAU 1PPGE 2BLVA 4D7FA 3B9FH 2GCTB 2OBOA 2JH6D 2BD4A 2XCFA 1ANCA 4IN1A 4WVPE 2ZEBA 1OYTH 1YPGH 2BQWB 3RC6A