3LH1A

Q191a mutant of the degs-deltapdz
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
199
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRGLLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPLGQTITQGIISATGRIGLNPTGRQNFLATDASINHGNSGGALVNSLGELMGINTLSPEGIGFAIPFQLATKIMDKLIRDGRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 41
structure length 199
sequence length 217
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lh1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lh1A02
5AFZH 2A5KA 1IQKA 3T27A 1AUJA 1RS0A 1O2KA 3AASA 2ULLA 1EASA 2ZWLH 1XMNB 4B1TA 3LOXA 5FBIA 3QGJA 3NK8A 4XBCA 4CHAC 2ZCKP 5TCAA 2XWBI 2FOCA 4K69A 1DS2E 1TNGA 2AERH 1DWDH 1L4ZA 3A85A 1C1PA 4Q7ZA 1TBRH 3RXLA 3E16B 1VCPA 3EAJA 2KAIA 1MKWH 4MDSA 4FU8A 1GBAA 2HPPH 1GMDG 3D23A 1SGFA 1EB2A 1QHRB 2A7HA 3ODDA 1NRNH 3PM3A 3O8DA 3SV6A 3SU1A 3KGPA 5AF9H 3BG4B 1LPGB 2TPIZ 1MKXK 1EUFA 1RGQA 2PUXB 4MVNA 1TRMA 3A82A 1UTOA 2O8LA 2ZGJA 1V2UT 1ABIH 2ODYB 3Q3XA 3RXPA 1DWBH 2CGAA 1ZPBA 3K65B 5IYTA 4CRAA 2J9NA 1NFWA 1GHZA 1Y5UT 1P2QA 4O97A 1THSH 1QFKH 3VB6A 3GYMA 3GY2A 1GHBG 1FLEE 3A7YA 1YLDA 1EP5A 1RTFB 1CA8B 1GJDB 4QT8C 3C1KA 1NZQH 2AS9A 1T31A 1PJPA 1WUNH 2HGTH 3PYHA 2WV5A 4YT6H 2R2MB 5JPMH 4IN2A 1Y8TA 1AD8H 2NU1E 4WXIA 1AVXA 1EX3A 1EXFA 1O5CB 2GKVE 4IC6A 4WMEA 3U69H 3GCHC 2F9NA 5L2YH 1SOZA 4AN7A 1K1NA 4ASHA 2H1UA 1YPJH 1WTHD 2J92A 2EEKA 4FU7A 3KQBA 1AVWA 1F5LA 1H8IH 1J15A 1O36A 5HYOA 1AY6H 3JZ1B 2FYQA 4UFFH 1SSXA 1YKTA 1Z8IB 1TMUH 1MTNC 5DPAA 3GDUA 3KQDA 3MNXA 1BUIA 5SGAE 1EZQA 3HK6B 1ELGA 4ABFA 2ASUB 3M3TA 4KTSA 2ZO3H 2BD2A 1LVOA 1Z6EA 5CMXH 3LPRA 3RUOA 4OS7A 2C8XB 3BTWE 1FY3A 2FZZA 2Z7FE 1S5SA 4XE4A 5EXLA 1P2IA 4NGAH 1GJ6A 2CMYA 3STJA 1TALA 1N8OC 2ZDNA 2ZCHP 3TIUA 1GG6B 1YCPK 4MNYA 5L2ZH 3A7TA 3P8OA 1WCZA 2B5TB 2ZDLA 3ZZCA 3TJNA 1Z71A 1EJNA 2QAAA 1BJUA 4BAHB 2OC8A 1ETRH 1LQEA 1C5RA 3RLWH 1J8AA 1PPEE 3UNQA 1NU9A 4UFEH 1NO9H 2GDDA 2FOMB 3TGJE 3MHWU 7LPRA 1TE0A 5K7RA 1F5KU 1TNJA 2XRCA 3A8DA 1KTTB 3RP2A 2Z94A 1C1NA 1GI4A 4UFGH 3QWCH 1O2XA 2VIOA 1KLJH 2UWOA 3SORA 4NIWA 2GX4A 4LOYH 2BDYA 1AE5A 3SNBA 1XUGA 1DSUA 2FOFA 1QBNA 3E3TA 2AMQA 5LGOA 4LZ4B 1DX5M 1OP0A 1Y3UA 5C3NA 1CGIE 3SGBE 2RA3A 1C2EA 3T5FH 4Q7XA 2PTNA 1QB6A 2OBOA 3ENSB 5A8XA 5HGGA 2AEIH 3F9GA 1YPHC 1W13U 4NIXA 5FHTA 1K9OE 2V35A 1TPOA 1TBZH 5DK1A 3PMJA 3ZZDA 1MCVA 1SLWB 2F9UA 5DP3A 1P0SH 4RKJB 1HFDA 2I6SA 1OYTH 1AE8H 3M5OA 4Y11E 2EA3A 3BTDE 3GCTF 1XXFA 2ANWA 2BDAA 1DITH 2P16A 3SQEE 3GDVA 4MNXA 2XBVA 1ZPZA 2OCVB 3A88A 1TGBA 2BB4A 3KQEA 2ZU5A 4JZ1A 1GBKA 2QC2A 1AWHB 4A1XA 2Z9LA 3S9AA 2GT7A 2ZDKA 1K2I1 2XBWA 1YLCA 3UR6A 1TPAE 2H9EH 4FUGA 4CREA 3MH4A 1O39A 4THNH 1HIAA 1RIWB 5CE1A 4YM9A 1QA7A 2BTCE 3B23B 1FIZA 4OS4A 1CA0B 4SGBE 2WPKS 2Z3EA 2IPHA 1V2JT 4HTCH 4CBNA 2ZC9H 3CP7A 1ESTA 2ANKH 1UK3A 1B5GH 1XVMA 1O30A 5B6OA 4I8HA 2UUJB 1W11U 3ZZ9A 3SGAE 1SGEE 1C1QA 1ELAA 4O9VA 1AU8A 1Y5BT 2DE8A 2Z9KA 2UUYA 4ABGA 1L2EA 2ESTE 2GTBA 2G4UA 3Q76A 2BQ6B 1TAWA 2XYAA 3CENA 1ANCA 4AFZA 2ODPA 2ZFSA 1LHFH 2JETB 3RXOA 1HXEH 3L33A 1GMHF 3S0NA 4J1YA 4O3TA 1PQ5A 1FZZA 3IITA 1PPHE 1WQVH 1UTNA 3A7WA 2WPMS 1OPHB 1YBWA 4ABBA 5J4SA 1O3IA 4I8KA 4ZMAH 1TX8A 1HAVB 1OWHA 5HM9A 1TGCA 2PUQH 2FX6A 4E05H 1DWEH 4X8TH 3GY5A 2EI7A 1EPTA 1P10A 3ITIA 1T32A 4F49A 3DT0H 4AYVB 3SJ9A 1V2VT 2BX4A 2BY6X 5F8XA 2Z9GA 2W3IA 2IJOB 1O2HA 1HPGA 1GBLA 4IMQA 3VXFH 3U98H 1C1OA 1OSSA 3R0FA 4WH6A 3VGCC 3S7KB 5FPSA 5C20A 1C5YB 2FTMA 3PMHB 6GCHF 1O3LA 3RXSA 1OYQA 2F9OA 3PO1C 1O35A 4OGXA 1YCPM 2OLGA 5AHGH 5JB9S 2PR3A 4A6LA 1C9PA 2B7DH 4IC5A 2AGIX 1YGCH 1SGTA 1L0ZA 1Q31A 4ABAA 4NSYA 1V2LT 1AN1E 1K22H 1TFXA 5GWZA 4Q7YA 1GBIA 1A5GH 1Z1JA 1AFQC 1CBWB 2UUKB 2FYRA 4CR9A 1O5EH 4BOHA 4X8VH 1QJ6B 3PLKA 3SGQE 3WY8A 2TRMA 1WQSA 2FXRA 3M7UA 2G8TA 3N7OA 2B8OH 2BQWB 1O2IA 1ZGIA 3ZVBA 3D49H 1XUKA 3NWUA 4Y7AA 1LKAA 1WTGH 2QXGA 1FAKH 1YYY1 3EA9A 3K2UA 1AZ8A 3QZRA 1O5DH 1EAWA 1ZHPA 2Y5FA 2A1DB 4HFPB 3JZ2B 5LPRA 1C1RA 4DVAU 4CHAB 3RXRA 4DIHH 4LXBH 1W12U 2VH6A 4TYDA 1DOJA 2GV6A 2WINI 1UHBA 1ZMNA 3OTJE 1BTWA 1EQ9A 1L1JA 4Y6DA 3ZZ3A 2XC5A 7ESTE 2K1QA 2Q1JA 1THPB 1GMCF 1GVZA 1Y5AT 1O2TA 5LPEA 1DFPA 3Q77A 3C27B 4WY3A 2GMTB 1SQAA 4MLFB 1GHXH 1AIXH 9ESTA 1S0QA 1VZQH 1JBUH 3M36A 1JIMA 1EB1H 1GI9B 1SLVB 2ZGXH 1O2VA 3BTHE 4ZKOU 1DM4B 3AVZA 4I8LA 1UMAH 3TNSA 3A80A 1KDQA 5T6GA 2QYIA 3M3VA 2OQUA 2LNCA 3O8RA 3FAOA 1NU7B 3SU4A 2J34A 4ZROA 1WYKA 1SB1H 1HJAC 2FLRH 2HWLB 2A2QH 3M3SA 2QXIA 4LK4A 2JH0D 1SQOA 3SQHE 1P9SA 1QB9A 4Z0KA 2WV4A 5ESTE 1GJ8B 2R2WU 3M5NA 1A0JA 5FXLA 3SJKA 4OS2A 2ZHQH 4GCHG 1D9IA 1FJSA 1AKSA 1O3DA 3SU6A 1C4Y2 2ZP0H 4RN6A 3T62A 3MYWA 2P8OC 2P93A 2C3SA 3I29A 4ISHH 2ZDMA 4K3JA 2FX4A 1XUIA 3GCOA 1T8NA 4H4FA 1ZTJA 3EA7A 2G5VA 3A8AA 4X2VA 2G00A 2Y82A 1OP2A 2Z9JA 1P57B 3VB7A 2HNTC 2VGCC 1TA6A 1C1TA 8LPRA 3QGNB 1MTWA 3RMMH 1C5MD 2PKAA 2FIRH 1P04A 2CHAB 1BRUP 3BEUA 1G2LA 4ISNA 1E0FD 2QGRA 5DGJA 4FUJA 1Z8GA 1D3PB 4Y71A 3RXBA 2PFEA 1TGSZ 1FV9A 4U30A 2GVFA 1CU1A 4A92A 3IG6B 1H9HE 1UCYH 2NWNA 4U01A 9LPRA 3GICB 1A5IA 4DT7B 3MU8A 2SGQE 1UTJA 4GHQA 4UONA 3FZZA 2W26A 2OC1A 4UEHH 4YT7H 1P06A 3F6UH 1C1SA 1IQHA 3UIRA 1V2MT 1J16A 1AQ7A 2RCEA 3KEEA 1MQ5A 2BY7X 4OS6A 5TJXA 4X2XA 1GWAA 5EODA 4AFQA 2VINA 4D9QA 1O3NA 1O3MA 3RXCA 1GJ9B 5GCHG 1C2GA 1DANH 2TGDA 4X1NU 1ESBA 3VXEH 2HALA 3LGIA 2NU2E 2AGGX 1CE5A 2VU8E 1C5TA 4CRFA 1S84A 3PV4A 1P05A 1QL9A 3NKKA 1TA2A 4E06H 5LH8A 3MH6A 3NCLA 1T4UH 2GZ7A 4Q2KA 1CGJE 4Y7BA 1QCPA 1OKXA 3BTGE 4TY6A 2ZA5A 5DP4A 1SGIB 2TGPZ 2BVSH 4XBBA 3A8CA 2ZFTA 3NXPA 3UOPA 1E37B 2ZHFH 1EZXC 3SU2A 1TRNA 2W3KA 4A1VA 1L4DA 3GY7A 3P6ZB 1Y3VA 2P94A 2Y80A 3ZZ8A 2C8YB 2VVVA 1PFXC 1LHGH 3SNCA 1V2KT 1OWIA 1QIXB 2R0LA 2A7CA 2ILNA 4JYUH 3MU4A 3P92A 2BD4A 1UK4A 1NESE 1SMFE 5E2OA 1DY8A 3O8BA 1ZHRA 2BMGB 3OYPA 4LZ1H 5EG4A 1YF4A 1MTVA 2F9BH 8KME2 2ZGBH 3A83A 4MNVA 2B0FA 3TGIE 1BHXB 1Q3XA 1EKBB 2TIOA 1O3FA 3HATH 1PQ8A 1UTKA 6CHAB 1C5NH 4SGAE 1KLTA 1T4VH 4DGJA 3ZZAA 1EPTC 3M35A 3RC5A 1Z6JH 2ZPQA 1Z8RA 3HGPA 3AW1A 4I8GA 2VJ1A 3UWIA 4MG3A 2OD3B 1AZZA 3F68H 3M5LA 1PYTD 1K21H 1FAXA 1TNHA 3UWJH 5K0HA 4XDEA 2PTCE 1Y3WA 4CH2B 2QF0A 2VWOA 3ATMA 3D65E 3UR9A 2FOEA 3QDZB 1BIOA 1O31A 1YPHE 7GCHG 1GDUA 3HPTB 2V3OH 2SGPE 3B8JA 1BA8B 1CHOF 2ZTZA 4BNRA 3UQOA 1KXDA 1W3CA 4YLUA 1YPGH 4MTBA 3A84A 5GPIB 1GBHA 1S83A 1GCDA 4X8UH 1ETSH 2FESH 2BX3A 3P8GA 4H6TA 4NFEA 1PPBH 3DA9B 1H9LB 4WWYA 3RXIA 2QF3A 1S6HA 1G9IE 3HKIB 4YESB 1NPMA 2WPLS 1EZUC 3V13A 1SG8B 2GT8A 1WAYB 1LPKB 2PGBB 1PPCE 3IWMA 1TONA 4DG4A 3UNRA 5DO4H 4GHTA 1VGCC 3ZZ5A 2C93B 4YO9A 1QB1A 3OSYA 3AAVA 3SU5A 1GHWH 3SJIA 1YP9A 3SV8A 2A45B 2R3UA 1QL8A 3GY4A 2BD7A 4Y8ZA 1ZRBA 1MAXA 2BVRH 5BRRE 4Y8YA 5AVDA 1SHHB 1C1VH 4IBLH 1HV7A 3BTEE 3Q3KA 1GBJA 1WV7H 5TCCA 1Z7KA 1G30B 5E8EH 3MOCA 1SQTA 2ZZUH 3UREA 1A0LA 1RFNA 2BZAA 3RXGA 4TY7A 2BDBA 3VGCB 3UNSA 4DOQA 2NU0E 1C9TA 3T2NA 3UOUA 1AI8H 2BD5A 3E91A 1UVOA 1O3HA 4FU9A 5CHAC 3V7TA 5HXFA 2AIPA 4DW2U 1YPEH 2BOHB 1GBFA 3VB5A 1FMGA 2ZG0H 1Y59T 5JBAS 5EQQA 3MNSA 2BXUH 3KCGH 2I6QA 1GHAG 3EDXB 4NIYA 1GDQA 1W7XH 1AFQB 2JH5D 3A7XA 2GCHG 1BMAA 2ANYA 1KYNA 2BHGA 1K1JA 1ACBE 4BTTB 2GP9B 2P59A 1ZHMA 5EW2H 2YOLA 4K2YA 1N6YA 1XUFA 1QURH 1C5OH 1W8BH 3TJVA 3TH4H 5EPYA 4FVDA 1WSSH 1ID5H 2XBYA 4X6PA 3ZZBA 4ISLA 4H42U 1P2MA 4JZIA 1FY1A 3VFEA 1HCGA 2VWNA 2ZCLP 3KL6A 3ZZ4A 1G3BA 1HAZB 3LT3A 2BZ6H 3KNXA 1ZSJA 2C4FH 3BF6H 3CS7A 3M61U 1GGDC 2LPRA 4GLYA 5DP7A 1ZSLA 2C8ZB 4AGKA 1GI0A 1O3BA 2ZDVH 4NSVA 4Y0YE 4ZKNU 3BV9B 1Z1IA 1NM6A 1QTFA 1O32A 1EAUA 3GISB 4IMZA 4E7NA 4I7YH 3KF2A 3O8CA 4BAKB 1GHYH 5C5NA 4K1TA 3URDA 1EAIA 3K9XB 3BSQA 2GDEH 4X2WA 5GDSH 1XXDA 3ZZ7A 2OP9A 3GY3A 4YLQH 3RXTA 1MZDA 1A61H 1JWTA 1FN8A 2Y5HA 3TK6A 1YM0A 2FP7B 1B0FA 3QTVH 2QXJA 1EOLA 4AFUA 1G2MA 4B75A 1BDAA 1BQYA 1CVWH 4B74A 4ABIA 1O2NA 3SI4H 1TOMH 3MNCA 2WUCA 4FUIA 1KXCA 1B7XB 1MBMA 4ZKSU 2H5CA 3RXKA 4GPGA 1A7SA 2Q6GA 3MU1A 1TMTH 2SGDE 4UD9H 2FPZA 2P8OB 5BPEA 3DFLA 4K8BA 3S9CA 1EOJA 1TPSA 5ESBA 1XVOA 1QBVH 3BG4C 2PWXA 1RD3B 3TH2H 4MNWA 3FP7E 2A5IA 2GGVB 1GMDF 1FN6A 2XCFA 1GHVH 3LDXH 3FP6E 2W7SA 1J14A 4NZLA 2VGCB 4WH8A 4VGCB 2AMDA 1C5LH 3SJ8A 4AB9A 2AGEX 3HKJB 2ZFQH 3K6YA 4BTUB 1MU8B 1LPZB 1HDTH 4I32A 1D4PB 1G32B 1GL1A 1O33A 4WMFA 1MD7A 2M5TA 4ABHA 3VB3A 4A7IB 4ZXYH 1LHDH 2BLQA 5EPNA 3OY5U 2C8WB 2FEQH 2H6MA 1GHBF 1V2WT 1AB9C 1SGNE 1BITA 1C5VA 1GCTC 5G4BA 1NFUA 1BTZA 1O5GH 3P8NA 1GL0E 1OS8A 3E0NB 1TMBH 3S69A 3TJOA 2ZEBA 3UTUH 3KIDU 1MKXH 1VITG 2ZTXA 3RM0H 3ZVDA 2NU4E 3TLOA 2G4TA 1CQQA 1K1IA 4NG9H 3STIA 3PMAB 5FX5A 1HNEE 1DUAA 3SU0A 1QGFA 8GCHG 1C2LA 5FCKA 1SGCA 2OC7A 1FPHH 1TBQH 1CSOE 2G51A 2HNTE 3P70B 3F9EA 1UVSH 5E0HA 4ABJA 3ZVFA 1P2KA 3SNAA 4CRCA 5JBTA 2PSYA 1HIAB 2V0BA 2O8MA 3E0PB 3AAUA 3PROA 1SLUB 3Q3YA 4GAWA 3BIUH 3LJOA 4KTUA 1MKWK 3ZZ6A 2PSXA 3SBKA 3SV7A 1L1GA 3LGYA 5A09A 3SNEA 1PQAA 4HZHA 3RXQA 3P8FA 4IGDA 1O2LA 1O3KA 3A8BA 1O2RA 1O2JA 2GCTC 1BOQA 3RM2H 1FDPA 1HAGE 1HJ9A 1P03A 1V2OT 5E2PA 1BMNH 5DP8A 1RRKA 5F8TA 1MQ6A 3TH3H 4AB8A 3TJUA 2VB0A 2BOKA 1A1RA 5L6NH 1ELFA 1Q2WA 1TWXB 1C4U2 1OWJA 3V0XA 5ABWA 4ZHMU 3MO9A 1EAXA 1W7GH 2FOGA 3GY8A 4FVBA 1FY4A 1OX1A 1JRTA 2VH0A 2FMJA 3RLYH 1GHAF 1JMOH 3VPKA 3RMOH 1D3TB 2QV1A 1UO6A 1MU6B 1TQ7B 3EA8A 4FXGH 2XCNA 5C5OA 5A8ZA 3RU4D 1ZSKA 3RMLH 4Z6AH 2BY8X 1XUHA 1V2ST 3UUZA 3MI4A 4AFSA 1LVMA 2J38A 1EPTB 2OQ5A 1S85A 1TNLA 5EOKA 1UVUH 5T3HA 4Y0ZE 3TGKE 1SFIA 1BRAA 1KSNA 4Q80A 1HAIH 1P01A 3LGWA 1OWEA 4X1RU 1CGHA 2YNBA 5GXPA 1SGRE 2ALVA 4O03A 5FBEA 4KKDA 1QRZA 3LGVA 3TNTA 1C2DA 3SN8A 7KMEH 3RXHA 2A2XH 2PV9B 2A0QB 1NS3A 2EI8A 2RA0A 3ATWA 2H9HA 1C1UH 2BDHA 2CV3A 2CF8H 4ZKRU 3RDZA 1ABJH 2R0KA 3TK5A 1IQFA 4YOGA 3GDSA 2F91A 3U8OH 1P02A 3U8TH 1NTPA 1ZJDA 2ZF0H 1ZGVA 3SUDA 1LVYA 5T6DA 1SGFG 3GCHB 3MNBA 2Q6DA 2VIVA 2WYGA 2XW9A 2SNWA 3PTNA 2F3CE 1VGCB 1YPKH 1IQMA 1RIWC 1C2FA 1C5WB 3BIVH 4IN1A 1CA0C 1DLEA 1AO5A 3NPSA 2O8UA 5GJ4B 1TX6A 1IHTH 3LONA 4RKOB 5JDUB 3MWIU 1P3CA 3E6PH 1SGPE 4WXVA 1ETTH 4ISIH 2FM2A 1BB0B 3PWCA 1MTNB 1BBRH 5A8YA 2HVXA 1BTYA 4CBOA 5DKMA 2PLXA 2ZGHA 2ALPA 1QY6A 1LCYA 1ZRKA 4I8JA 4MQAA 4RSPA 1O2YA 1E35B 1TB6H 2A31A 3R3GB 1MAYA 4X6NA 3ZVAA 3UQVA 5EQRA 1P2JA 1A5HA 5I46H 1OWKA 2EI6A 1O37A 1BJVA 2G5NA 4JYVH 3EGKH 1JOUB 2C90B 1AUTC 3ATLA 5CHAB 1N8OB 1O2PA 2Z6BD 3SO3A 1TGNA 1TX7A 3DUXH 1RJXB 4O3UA 1T8OA 3QUMP 1C5XB 1KDQB 4AGJA 1GBDA 2STAE 3RU4E 6LPRA 5EW1H 1O0DH 1E36B 5F03A 3G01A 3SOSA 3BG8A 1GI5A 1H1BA 2ZDAH 4U32A 4DURA 1EP6A 4DJZB 5DP6A 4U2WA 1B0EA 2O9QA 4J2YB 1SGDE 1MTUA 1LQDB 1P2NA 3MU5A 1LDTT 4X6MA 4BXWA 4NA9H 4MPVA 2W7UA 1AGJA 2NU3E 3H7TA 3ZYEA 1H8DH 3PLPA 4X0WU 1NN6A 4ZH8A 1P9UA 1TOCB 1Y3YA 2WYJA 1T7CA 4CRBA 1BBRE 1IQGA 3CS0A 3AW0A 1VITH 2OUAA 4INLA 2VIWA 4XBDA 1T8MA 1F2SE 4KGAA 4Y79A 4E7RG 1P09A 1KLIH 2ZECA 1EATA 1GGDB 5J4QA 1UCYE 1AFEH 1O38A 3SHAH 1HAXB 1SFQB 3SU3A 4BTIB 3A86A 4X1PU 2A4RA 1WBGB 2BY9X 3T26A 3BTFE 2GD4B 2PKAB 3S9BA 2BD9A 1NT1A 5DG6A 1QQUA 2H2ZA 1BHXF 2FI3E 1LKBA 1IOEA 3MO6A 2UUFB 6ESTA 2HPQH 3ZVCA 4TPYA 5FPTA 1YC0A 1BT7A 2Z3CA 4JK6A 3I78A 5DP5A 1ANDA 1O2WA 1E34B 1FY8E 1QL7A 1TLDA 2D8WA 2ODQA 4FUDA 4ISOA 5IDKA 4I31A 1ELEE 1OWDA 4YOIA 2FS9A 3FFGA 3FVFB 2F9VA 3RXFA 2ZGCA 3LH3A 1V2PT 1O2QA 1KXAA 4A1TA 4D8NA 3FP8E 3PLBA 2G52A 1NC6A 1NRPH 1GBCA 1J9CH 2UWLA 1QA0A 3ZVEA 1VCWA 2WPHS 1GPZA 3D62A 1XUJA 2GMTC 2R9PA 1UTMA 1RTLA 2SGAA 2SFAA 2XC0A 4GVUA 3DD2H 4K8YA 3LJJA 1O5AB 1ZYOA 2ZFFH 2TGAA 1C2IA 1MUEB 1UTLM 2ZU3A 2OC0A 1NRSH 1EZSC 1TGTA 1GMHG 1D3DB 1W10U 2ZU1A 3OY6U 2FS8A 1LMWB 3U1JB 2QN5T 1UVPA 4UDWH 5EQSA 3ZVGA 1G37A 1HB0B 3U1IB 2BXTH 2PKSC 2OTVA 1FIWA 5FCRA 2Y7ZA 3SUEA 2ZHDA 3RC6A 1C2HA 2R3YA 1K28D 4JZDH 1MD8A 1OP8A 5HM2A 3ATIA 4ZHAA 2CJIA 1AB9B 3UPEA 2FODA 3TITA 1G3DA 2B9LA 3GYLB 1OOKB 2F9PA 1D6RA 2QY0B 3BTTE 3A7VA 1GCTB 4GCHF 4MPUA 1BTPA 2QA9E 1ANBA 2VIPA 2FI5E 3RC4A 1FI8A 2PGQB 2Y81A 4BAMB 2VWLA 4HI3A 1W14U 4JZFH 2ZU2A 5FPYA 2FOBA 2VIQA 5JB8S 6GCHG 1SGQE 1F5RA 1Y3XA 2XNIA 4TWWA 1K1MA 2KAIB 1SL3A 2OBQA 2A4OA 3LC3A 5A2MH 1C4V2 1S0RA 2CHAC 4WJG2 4ZXXH 5C1YA 4NWLA 2A7JA 4ABDA 2G81E 1MZAA 3PO1B 4Y76A 3SUFA 4PROA 1ARCA 5I25A 3PMBB 2AYWA 4ZUHA 1N6XA 1GBMA 2FOHA 1ZOMA 4ABEA 1C2KA 2ZHEH 5T6FA 1GVLA 5C2ZA 4H6SB 5JBBS 1O3CA 1IHSH 2XBXA 1UVTH 1BZXE 5FX6A 2GCTB 4NFFA 1LVBA 1CT2E 4NA8A 2FWWA 2XXLA 1FNIA 5ETXA 1K1LA 4OS5A 2AFQB 1IQJA 4MPWA 4ZAEA 2GV7A 2QCYA 3RMNH 1XKBC 4AOQA 3V12A 1V2TT 2VIDA 4ZHLU 1C5QA 3PWBA 1ELVA 1TIOA 1S82A 3RXJA 3F9HA 3L6PA 2XC4A 3RXVA 1WOFA 1PPGE 3F1SB 1GBBA 4I33A 1S81A 2XTTB 1NFYA 5EGMA 1DSTA 2DUCA 5GCHF 4NZQA 4INKA 1GMCG 1O2UA 2GZ8A 2HLCA 5C1UA 1MMJN 1HJ8A 1QRWA 1O2MA 1ANEA 1A3BH 2J94A 1FQ3A 1P11E 1F0SA 1GI3A 2WPIS 1ZR0A 1V2QT 1SOTA 1CHGA 4B76A 1TQ0B 5EXNA 1A0HB 2A32A 5HMAA 4TWYA 1HLTH 1SPJA 1FPCH 1BRBE 1FY5A 1P3EA 3MMGA 3F9FA 2OINA 2SGEE 2H5DA 1O5FH 1AMHA 1JIRA 1KTSB 8ESTE 1AVGH 2TGTA 1DY9A 1HAVA 2P3UB 1HXFH 3A87A 4BAOB 1BBRK 1J17T 1H4WA 4FUCA 2VVCA 2BYAX 4KELA 2ZFRH 3PTBA 3W94A 1HJAB 2BVXH 3W95A 2AIQA 5F8ZA 3MTYA 4NWKA 2CXVA 2G55A 1UCYK 4D76A 1C2JA 2TBSA 4K1EA 1XM1A 2PHBA 1SHYA 4YZUA 2BLWA 3MH7A 1CT4E 3SV2H 6CHAC 1G3EA 2J2UA 1F0UA 1UK2A 5PTPA 2Y5GA 3TVJB 3ATKA 3M7QA 3QX5H 1ELCA 2AH4X 5AFYH 3A89A 2BQ7B 2ZHWH 1HUTH 4ESTE 1SVPA 2HNTF 1IQEA 1UTPA 1X7AC 1W0YH 2Z3DA 4UFDH 1F0TA 1LO6A 1O3OA 3I77A 2FI4E 3E8LA 5EXMA 3K6ZA 1TNKA 3OX7U 5LPFA 4R0IA 1SI5H 4R8TB 5H4IB 1Z8JB 2HOBA 2J4IA 3T28A 2Y7XA 4OGYA 2BD8A 1ZTLA 4XOJA 4K60A 2ZKSA 1GJAB 1SLXB 4JZEH 1GBEA 1BTUA 2JKHA 4B73A 3QK1A 1U6QA 3RXAA 1TYNA 1A46H 3EQ0H 4DY7B 1A2CH 7GCHF 3ZV8A 2UWPA 1SGYE 1EJAA 2WUBA 2THFB 1INCA 4MPXA 1DVAH 3MU0A 2J95A 3FZDA 4JMYA 1DWCH 1MCTA 1V2NT 3RXEA 3VB4A 1PPFE 4X6OA 1F92A 3SW2B 2Z9IA 3SNDA 4BXSA 1VJAU 2VWMA 3H7OA 1S6FA 4CR5A 1O2SA 1DPOA 3M5MA 1QBOA 1QQ4A 3ODFA 3URCA 4NIVA 3QN7A 4JYTA 4B2BA 1PYTC 1O3AA 1GI7B 3NUMA 3A81A 1QJ7B 2BDCA 1BCUH 4K5ZA 3ZYDA 1V6DA 4X1QU 4FUBA 1HAPH 1VJ9U 1GI1A 2BD3A 2STBE 1CO7E 3MO3A 5E0GA 4NA7A 4JCNA 3E1XB 2DE9A 3E90B 2HRVA 4D7FA 2A4QA 4WVPE 4BAQB 3LIWA 3KHVA 1AHTH 1GI8B 3V3MA 4TPIZ 2VVUA 1KXFA 1DICA 1G36A 1O3PB 1BMLA 1EJMA 1BMMH 1P12E 1GG6C 3RXMA 3BTME 1ZJKA 2RG3A 3SJOA 1UTQA 4X2YA 2BM2A 2ZQ1A 3UFAA 2V6NA 1C5PA 4IS5A 2BDGA 1DUEA 1P8VC 3SZNA 3OU0A 2BLOA 1ZTKA 5C1XA 4AZ2B 1ZMLA 1AWFH 1IQIA 3LH1A 3S7HB 3M37A 3SUGA 4CRDA 2GCHF 3LU9B 1YPLH 2BDIA 1SR5C 2ZPSA 2ZTYA 1V2RT 3LC5A 1A3EH 2IOTA 1E38B 2D26C 4AG1A 3SI3H 2OXSA 3RXDA 2EC9H 1NY22 4M7GA 3TK9A 1THRH 2FOAA 3ZV9A 1HAHH 1RXPA 1N1LA 4CH8B 2FTLE 1FONA 4DCDA 5E0JA 3ELAH 4FUFA 1IQLA 1QR3E 3T25A 1YCPH 3LGTA 2ZU4A 5EU8A 3BN9A 1O3JA 4Y8XA 1QRXA 2ZIQH 1CHOG 4A5TS 1H9IE 2JH6D 1DXPA 2IN2A 2P3FH 4AORA 2A4GA 2Y6TA 4DIIH 2ZFPH 1KY9A 5A0CA 1JXPA 5JYIA 3BTQE 3ESTA 1O34A 1LTOA 1P2OA 3VEQB 2O8TA 1F0RA 1LHCH 3QLPH 1C5ZB 1KXBA 1M9UA 3MFJA 3LGUA 2ZNKH 3QZQA 1SBWA 3SHCH 4XFQA 3Q00A 3HGNA 2FDAA 3NZIA 4HGCA 1VR1H 1ZLRA 1BRCE 1W0ZU 4AYYB 2BY5X 5C67A 1TNIA 4INHA 3P95A 2ZPRA 4AX9H 1KIGH 2V3HH 3SV9A 2BLVA 2D1JA 3HK3B 1D3QB 4AG2A 2O8WA 3DFJA 1C1WH 1G3CA 5A0AE 2PKSB 4X8SH 1ESAA 1MTSA 4XSKU 1O3GA 2SGFE 5DP9A 5JBCS 4KTCA 1YPMH 2P3TB 3M7TA 1XKAC 4UE7H 1O2ZA 4OS1A 1K1PA 2H9TH 2ZI2H 3QTOH 1K1OA 1ORFA 3EE0B 1GI2A 3U9AH 1HAYB 3A7ZA 1QNJA 1CT0E 1DE7H 1O2OA 3U8RH 1ZPCA 2P95A 2YNAA 1JRSA 5L30H 1C1MA 3P17H 1V3XA 2A5AA 1XX9A 4D9RA 1UHBB 5FAHA 1GDNA 3GCNA 4VGCC 5F6MA 1ZZZA 1GVKB 2WPJS 2FO9A 3KN2A 3KQCA 5GIBA 1C5UA 1LHEH 2SNVA 1GJBB 1DXWA 2QXHA 1O3EA 1C2MA 1DT2A 1W2KH 1KXEA 3EYDA 2PW8H 2F83A 1A4WH 2Q6FA 2JETC 3MH5A 3TPIZ 1NRQH 1NROH 1SC8U 2CN0H 4YOJA 1ELBA 3GOVB 1PQ7A 4GUXA 1UJ1A 1MH0A 1GBTA 3B9FH 1ZMJA 1T8LA 3PB1E 2D2DA 5DJ7A 1GJ5H 3T29A 4WF8A 3FANA 1BTXA 1MBQA 4B2CA 2CF9H 4F4OC 1GJ7B 1NRRH 1ELTA 2AMPA 4BANB 3GY6A 1GI6A 1HBTH 3H5CB 4B2AA 1DLKB 1HGTH 1O2GH 2GZ9A 1TPPA 4K1SA 4YTAA 1WU1A 1L1NA 2ZQ2A 1BTHH 1VCQA 1OXGA 1AKSB 1GJ4H 2QIQA 3BTKE 4JK5A 1FXYA 3BEIB 3DHKH 1FUJA 1VITF 2XWAA 3L3TA 4WMDA 1IAUA 3QO6A 4B71A 4FUHA 2FLBH 4FUEA 3RXUA 3GCTG 8GCHF 4X1SU 1PPZA 4CRGA 1RTKA 2W5EA 1TRYA 1ARBA 1DDJA 4NCYA 4GSOA 5A0BA 1CBWC 4KP0A 1IQNA 1TABE 4IW4E 1F7ZA 4D7GA 3LKWA 1ELDE 1HRTH 1HYLA 2RDLA 1QJ1B 1NFXA 3UY9A 4Y10E 3RU4T 2ANMH 2VNTA 3BEFB 3TU7H 1C5SA 1HAOH 1GJCB 1D6WA 1O5BB
chains in the Genus database with same CATH superfamily
5AFZH 5C17A 2A5KA 1IQKA 3T27A 1AUJA 1RS0A 1O2KA 3AASA 2ULLA 1EASA 2ZWLH 1XMNB 3AK5A 3UAIC 4B1TA 2K0QA 3LOXA 5FBIA 3QGJA 3NK8A 4XBCA 4CHAC 2ZCKP 5TCAA 2XWBI 2FOCA 4K69A 1DS2E 1TNGA 2AERH 1DWDH 1L4ZA 3A85A 1C1PA 4Q7ZA 1TBRH 3RXLA 3E16B 1VCPA 3EAJA 2KAIA 1MKWH 4MDSA 4FU8A 1GBAA 2HPPH 1GMDG 3D23A 1SGFA 1EB2A 1QHRB 2A7HA 3ODDA 1NRNH 3PM3A 3O8DA 3SV6A 3SU1A 3KGPA 5AF9H 3BG4B 1LPGB 2TPIZ 1MKXK 1EUFA 3NRLA 3H09A 1RGQA 2PUXB 4MVNA 1TRMA 3A82A 1UTOA 2O8LA 2ZGJA 1V2UT 1ABIH 2ODYB 3Q3XA 3RXPA 1DWBH 2CGAA 1ZPBA 3K65B 5IYTA 4CRAA 5T1VA 2J9NA 1NFWA 1GHZA 1Y5UT 1P2QA 2HLDD 4O97A 1THSH 1QFKH 3VB6A 3GYMA 3GY2A 1GHBG 1FLEE 3A7YA 4Q4LA 1YLDA 1EP5A 1RTFB 1CA8B 1GJDB 4QT8C 3C1KA 1NZQH 2AS9A 1T31A 1PJPA 1WUNH 2HGTH 3PYHA 2WV5A 4YT6H 2R2MB 5JPMH 4IN2A 1Y8TA 1AD8H 2NU1E 4WXIA 1AVXA 1EX3A 1EXFA 1O5CB 2GKVE 4IC6A 4WMEA 3U69H 3GCHC 2F9NA 5L2YH 1SOZA 4AN7A 1K1NA 4ASHA 2H1UA 3GS9A 1YPJH 1WTHD 2J92A 2EEKA 4FU7A 3KQBA 1AVWA 1F5LA 1H8IH 1J15A 1O36A 5HYOA 1AY6H 3JZ1B 2FYQA 4UFFH 2EQNA 1SSXA 1YKTA 1Z8IB 1TMUH 1MTNC 5DPAA 3GDUA 3KQDA 3MNXA 1BUIA 5SGAE 1EZQA 3HK6B 1ELGA 4ABFA 3OEED 2ASUB 3M3TA 4KTSA 2ZO3H 2BD2A 1LVOA 1Z6EA 5F53A 5CMXH 3LPRA 3RUOA 4OS7A 2C8XB 3BTWE 1FY3A 2FZZA 2Z7FE 1S5SA 4XE4A 5EXLA 1P2IA 4NGAH 1GJ6A 2CMYA 3STJA 1TALA 1N8OC 2ZDNA 2ZCHP 3TIUA 1GG6B 1YCPK 4MNYA 5L2ZH 3A7TA 3P8OA 1WCZA 2KM0A 2B5TB 2ZDLA 3ZZCA 3TJNA 1Z71A 1EJNA 2QAAA 1BJUA 4BAHB 2OC8A 1ETRH 1LQEA 2RFKC 1C5RA 3RLWH 1J8AA 1PPEE 3UNQA 1NU9A 4UFEH 1NO9H 2GDDA 2FOMB 3TGJE 3MHWU 7LPRA 1TE0A 5K7RA 1F5KU 5EJLA 1TNJA 2XRCA 3A8DA 1KTTB 3RP2A 2Z94A 1C1NA 1GI4A 4UFGH 3QWCH 1O2XA 2VIOA 1KLJH 2UWOA 3SORA 4NIWA 2GX4A 4LOYH 2BDYA 1AE5A 3SNBA 1XUGA 1DSUA 2FOFA 1QBNA 3E3TA 2AMQA 5LGOA 4LZ4B 1DX5M 1OP0A 1Y3UA 5C3NA 1CGIE 3SGBE 2RA3A 1C2EA 3T5FH 4Q7XA 2PTNA 1QB6A 2OBOA 3ENSB 5A8XA 5HGGA 2AEIH 3F9GA 1YPHC 1W13U 4NIXA 5FHTA 1K9OE 2V35A 1TPOA 1TBZH 5DK1A 3PMJA 3ZZDA 1MCVA 1SLWB 2F9UA 5DP3A 1P0SH 4RKJB 1HFDA 2I6SA 1OYTH 1AE8H 3M5OA 4Y11E 2EA3A 3BTDE 3GCTF 1XXFA 2ANWA 2BDAA 1DITH 2P16A 3SQEE 3GDVA 4MNXA 2XBVA 1ZPZA 2OCVB 3A88A 1TGBA 2BB4A 3KQEA 2ZU5A 4JZ1A 1GBKA 2QC2A 1AWHB 4A1XA 2Z9LA 3S9AA 2GT7A 2ZDKA 1K2I1 2XBWA 1YLCA 3UR6A 1TPAE 2H9EH 4FUGA 4CREA 3MH4A 1O39A 4THNH 1HIAA 1RIWB 5CE1A 4YM9A 1QA7A 2BTCE 3B23B 1FIZA 1H8ED 4OS4A 1CA0B 4SGBE 2WPKS 2Z3EA 2IPHA 1V2JT 4HTCH 4CBNA 2ZC9H 1BMFD 3CP7A 1ESTA 2ANKH 1UK3A 1B5GH 1XVMA 1O30A 5B6OA 4I8HA 2UUJB 1W11U 3ZZ9A 3SGAE 1SGEE 1C1QA 1ELAA 2KZ4A 4O9VA 1AU8A 1Y5BT 2DE8A 2Z9KA 3DSOA 2UUYA 4ABGA 1L2EA 2ESTE 2GTBA 2G4UA 1WDIA 3Q76A 2BQ6B 1TAWA 2XYAA 3CENA 1ANCA 4AFZA 2ODPA 2YMSC 2ZFSA 1LHFH 3F2HA 1H8HD 2JETB 2KFWA 3RXOA 1HXEH 3L33A 1GMHF 3S0NA 4J1YA 4O3TA 1PQ5A 1FZZA 3IITA 1PPHE 1WQVH 1UTNA 3A7WA 2WPMS 1OPHB 4FETA 1YBWA 4ABBA 4HG6A 5J4SA 1O3IA 4I8KA 4ZMAH 1TX8A 1HAVB 1OWHA 5HM9A 1TGCA 2L6OA 2PUQH 2FX6A 4E05H 1DWEH 4X8TH 3GY5A 2EI7A 1UW7A 1EPTA 1P10A 3ITIA 1T32A 4F49A 3DT0H 4AYVB 3SJ9A 1V2VT 2BX4A 2BY6X 5F8XA 2Z9GA 2KCOA 2W3IA 2IJOB 1O2HA 1HPGA 1GBLA 4IMQA 3VXFH 3U98H 1C1OA 1OSSA 3OE7D 3R0FA 4WH6A 3F3BA 3VGCC 4ACAA 3S7KB 5FPSA 5C20A 1C5YB 2FTMA 3PMHB 6GCHF 1O3LA 3RXSA 1OYQA 2F9OA 3PO1C 1O35A 4OGXA 1YCPM 2OLGA 5AHGH 5JB9S 2PR3A 4RT1A 4A6LA 1C9PA 2B7DH 2XOKD 4IC5A 2AGIX 1YGCH 2F4LA 1SGTA 1L0ZA 1Q31A 4ABAA 4NSYA 1V2LT 1AN1E 1K22H 1TFXA 5GWZA 4Q7YA 1GBIA 1A5GH 1Z1JA 1AFQC 1CBWB 2UUKB 2FYRA 4CR9A 1O5EH 4BOHA 4X8VH 1QJ6B 3PLKA 3SGQE 3WY8A 5IK2D 2TRMA 1WQSA 2FXRA 3M7UA 2G8TA 3KYFA 3N7OA 2B8OH 2BQWB 1O2IA 1ZGIA 3ZVBA 3D49H 1XUKA 3NWUA 4Y7AA 1LKAA 1WTGH 2QXGA 1FAKH 1YYY1 3EA9A 3K2UA 1AZ8A 3QZRA 5EJ1A 1O5DH 1EAWA 1ZHPA 2Y5FA 2A1DB 3DSGA 4HFPB 3JZ2B 5LPRA 1C1RA 4DVAU 4CHAB 5HIYA 3RXRA 4DIHH 4OM9A 4LXBH 1W12U 2VH6A 1E79D 4TYDA 1DOJA 2GV6A 2WINI 1UHBA 1ZMNA 2J98B 3OTJE 1BTWA 1EQ9A 1L1JA 4Y6DA 3ZZ3A 2XC5A 7ESTE 2K1QA 2Q1JA 1THPB 1GMCF 1GVZA 1Y5AT 1O2TA 5LPEA 1DFPA 3Q77A 3C27B 4WY3A 2GMTB 1SQAA 4MLFB 1GHXH 1AIXH 9ESTA 1S0QA 1VZQH 1JBUH 3M36A 1JIMA 1EB1H 1GI9B 1SLVB 2ZGXH 1O2VA 3BTHE 4RI0A 4ZKOU 1DM4B 3AVZA 4I8LA 1UMAH 5HIZA 3TNSA 1S6LA 3A80A 1KDQA 5CHBA 5T6GA 2QYIA 3M3VA 2OQUA 2LNCA 3O8RA 3FAOA 1NU7B 3SU4A 2J34A 4ZROA 1WYKA 1SB1H 4P02A 1HJAC 2FLRH 2HWLB 2A2QH 3M3SA 2QXIA 4LK4A 2JH0D 4Q63A 1SQOA 3SQHE 1P9SA 1QB9A 4Z0KA 2WV4A 5ESTE 1GJ8B 2R2WU 3M5NA 1A0JA 5FXLA 3SJKA 4OS2A 2ZHQH 2KR7A 4GCHG 1D9IA 1FJSA 1AKSA 1O3DA 3SU6A 1C4Y2 2ZP0H 4RN6A 3T62A 2V3MA 3MYWA 2P8OC 2P93A 2C3SA 3I29A 4TT3D 4ISHH 2ZDMA 4K3JA 2FX4A 1XUIA 2XNDD 3GCOA 1T8NA 4H4FA 1ZTJA 3EA7A 2G5VA 3A8AA 4X2VA 2G00A 2Y82A 1OP2A 2Z9JA 1P57B 3VB7A 2HNTC 2VGCC 1TA6A 1C1TA 8LPRA 2QF5A 3QGNB 1MTWA 3RMMH 1C5MD 2PKAA 2FIRH 1P04A 2CHAB 1BRUP 3BEUA 1G2LA 4ISNA 1E0FD 2QGRA 5DGJA 4FUJA 1Z8GA 1D3PB 4Y71A 3RXBA 2PFEA 1TGSZ 1FV9A 4U30A 2GVFA 1CU1A 4A92A 3IG6B 1H9HE 1UCYH 2NWNA 4U01A 9LPRA 3GICB 1A5IA 4DT7B 3MU8A 2SGQE 1UTJA 4GHQA 4UONA 3FZZA 2W26A 2OC1A 4UEHH 4YT7H 1P06A 3F6UH 1C1SA 1IQHA 3UIRA 1V2MT 1J16A 1AQ7A 3OAAD 2RCEA 3KEEA 1MQ5A 2BY7X 4OS6A 5TJXA 4X2XA 1GWAA 5EODA 4AFQA 2VINA 4D9QA 1O3NA 1O3MA 3RXCA 1GJ9B 5GCHG 1C2GA 1DANH 2TGDA 4X1NU 1ESBA 2OK5A 3VXEH 2HALA 3LGIA 2NU2E 2AGGX 1CE5A 2VU8E 1C5TA 4CRFA 1S84A 3PV4A 1P05A 1QL9A 3NKKA 1TA2A 2V7QD 4E06H 5LH8A 3MH6A 3NCLA 1T4UH 1MABB 2GZ7A 4Q2KA 1CGJE 4Y7BA 1QCPA 3DCLA 1OKXA 3BTGE 4TY6A 2ZA5A 5DP4A 1SGIB 3F0PA 2TGPZ 4YXWD 2BVSH 4XBBA 3A8CA 2ZFTA 3NXPA 3UOPA 1E37B 2ZHFH 1EZXC 3SU2A 1TRNA 2W3KA 4A1VA 1L4DA 3GY7A 3P6ZB 1Y3VA 2P94A 2Y80A 3ZZ8A 2C8YB 2VVVA 1PFXC 1LHGH 3SNCA 1V2KT 1OWIA 1QIXB 2R0LA 2A7CA 2ILNA 4JYUH 3MU4A 3P92A 2BD4A 1UK4A 1NESE 1SMFE 5E2OA 1DY8A 3O8BA 1ZHRA 2BMGB 3OYPA 4LZ1H 5EG4A 2W6JD 1YF4A 1MTVA 2F9BH 8KME2 2ZGBH 3A83A 4MNVA 2B0FA 3TGIE 1BHXB 1Q3XA 3VG8A 1EKBB 2TIOA 1O3FA 3HATH 1PQ8A 1UTKA 6CHAB 1C5NH 4SGAE 1KLTA 1T4VH 4DGJA 3ZZAA 1EPTC 3M35A 3RC5A 1Z6JH 2ZPQA 1Z8RA 3HGPA 3AW1A 4I8GA 2VJ1A 3UWIA 4MG3A 2OD3B 1AZZA 3F68H 3M5LA 1PYTD 1K21H 1FAXA 3PV2A 1TNHA 3UWJH 5K0HA 4XDEA 2PTCE 1Y3WA 4CH2B 2QF0A 2VWOA 3ATMA 3D65E 3UR9A 2FOEA 3FOAA 2KCYA 3QDZB 1BIOA 1O31A 1YPHE 7GCHG 1NBME 1GDUA 3HPTB 2V3OH 2SGPE 3B8JA 1BA8B 1CHOF 2ZTZA 4BNRA 3UQOA 1KXDA 1W3CA 4YLUA 1YPGH 4MTBA 1KMHB 3A84A 5GPIB 1GBHA 1S83A 1GCDA 4XD7D 4X8UH 1ETSH 2FESH 2BX3A 3P8GA 4H6TA 4NFEA 1PPBH 3DA9B 1H9LB 4WWYA 3RXIA 2QE7D 2QF3A 5FL7D 1S6HA 1G9IE 3HKIB 4YESB 1NPMA 2WPLS 1EZUC 3V13A 1SG8B 2GT8A 1WAYB 1LPKB 2PGBB 1PPCE 3IWMA 1TONA 4DG4A 3UNRA 5DO4H 4GHTA 1VGCC 3ZZ5A 2C93B 1W0KD 4YO9A 1QB1A 3OSYA 3AAVA 3SU5A 1GHWH 3SJIA 1YP9A 3SV8A 2A45B 2R3UA 1QL8A 3GY4A 2BD7A 4Y8ZA 3FN8A 1ZRBA 1MAXA 2BVRH 5BRRE 4Y8YA 5AVDA 1SHHB 1C1VH 4IBLH 1HV7A 3BTEE 3Q3KA 1GBJA 1WV7H 5TCCA 1Z7KA 1G30B 5E8EH 3MOCA 1SQTA 2ZZUH 3UREA 1A0LA 1RFNA 2BZAA 3RXGA 4TY7A 2BDBA 3VGCB 3UNSA 4DOQA 2NU0E 1C9TA 2JJ1D 3T2NA 3UOUA 1AI8H 2BD5A 3E91A 1UVOA 1O3HA 4FU9A 5CHAC 4RT0A 3V7TA 5HXFA 2AIPA 4DW2U 1YPEH 2BOHB 1GBFA 3VB5A 4XRNA 1FMGA 2ZG0H 1Y59T 5JBAS 5EQQA 3MNSA 2BXUH 3KCGH 2I6QA 1GHAG 3EDXB 3FKSD 4NIYA 1GDQA 1W7XH 1AFQB 2JH5D 3A7XA 2GCHG 1BMAA 3F0OA 3KYGA 2ANYA 1KYNA 2BHGA 1K1JA 1ACBE 4BTTB 2GP9B 2P59A 1ZHMA 5EW2H 2YOLA 4K2YA 1E1RD 1N6YA 1XUFA 1QURH 1C5OH 1W8BH 3TJVA 3TH4H 5EPYA 4FVDA 3F2GA 1WSSH 1ID5H 2XBYA 4X6PA 3ZZBA 4ISLA 4H42U 1P2MA 4JZIA 1FY1A 3VFEA 1HCGA 2VWNA 2ZCLP 3KL6A 3ZZ4A 1G3BA 1HAZB 3LT3A 2BZ6H 3KNXA 1ZSJA 2C4FH 3BF6H 3CS7A 3M61U 1GGDC 2LPRA 4GLYA 5DP7A 1ZSLA 2C8ZB 4AGKA 1GI0A 1O3BA 2ZDVH 4NSVA 4Y0YE 4ZKNU 4F55A 3BV9B 1Z1IA 1NM6A 1QTFA 1O32A 1EAUA 3GISB 4IMZA 4E7NA 1VKYA 4I7YH 3KF2A 3O8CA 4BAKB 1GHYH 5C5NA 4K1TA 3URDA 1EAIA 3K9XB 3BSQA 2GDEH 4X2WA 5GDSH 1XXDA 3ZZ7A 2OP9A 3GY3A 4YLQH 3RXTA 1MZDA 1A61H 1JWTA 1FN8A 2Y5HA 3TK6A 1YM0A 2FP7B 3SYJA 1B0FA 3QTVH 2QXJA 1EOLA 4AFUA 1YY3A 1G2MA 4B75A 1BDAA 1BQYA 1CVWH 4B74A 4ABIA 1O2NA 3SI4H 1TOMH 3MNCA 2WUCA 4FUIA 1KXCA 1B7XB 1MBMA 4ZKSU 2H5CA 3RXKA 4GPGA 1A7SA 2Q6GA 3MU1A 1TMTH 2SGDE 4UD9H 2FPZA 2K8IA 2P8OB 5BPEA 5C0UA 3DFLA 4K8BA 3S9CA 1EOJA 1TPSA 5ESBA 1XVOA 1QBVH 3BG4C 2PWXA 1RD3B 3TH2H 4MNWA 3FP7E 2A5IA 2GGVB 2J5UA 1GMDF 1FN6A 2XCFA 1GHVH 3LDXH 3FP6E 5DSFA 2W7SA 1J14A 4NZLA 2VGCB 4WH8A 4VGCB 2AMDA 1C5LH 3SJ8A 4AB9A 2AGEX 3HKJB 2ZFQH 3K6YA 3FO8D 4BTUB 1MU8B 1LPZB 1HDTH 4I32A 1D4PB 1G32B 1GL1A 1O33A 4WMFA 1MD7A 1W0JD 2M5TA 4ABHA 3VB3A 4A7IB 1YWUA 4ZXYH 1LHDH 2BLQA 5EPNA 3OY5U 2C8WB 2FEQH 2H6MA 1GHBF 1V2WT 1AB9C 1SGNE 4I86A 1BITA 1C5VA 1GCTC 5G4BA 1NFUA 1BTZA 2LP6A 1O5GH 3P8NA 1GL0E 1OS8A 3E0NB 1TMBH 3S69A 3TJOA 2ZEBA 3UTUH 3KIDU 1MKXH 1VITG 2ZTXA 2J98A 3RM0H 3ZVDA 2NU4E 3TLOA 2G4TA 1CQQA 1K1IA 4NG9H 3STIA 3PMAB 5FX5A 1HNEE 1DUAA 3SU0A 1QGFA 8GCHG 1C2LA 5FCKA 1SGCA 2OC7A 2HVYB 1FPHH 1TBQH 1CSOE 2G51A 2HNTE 3P70B 3F2FA 1UVSH 3F9EA 5E0HA 3ZVFA 4ABJA 3N99A 1P2KA 2JIZD 3SNAA 4CRCA 5JBTA 2PSYA 1HIAB 2V0BA 2O8MA 3E0PB 3AAUA 3PROA 1SLUB 3Q3YA 4GAWA 3BIUH 3LJOA 4KTUA 4B6FA 1MKWK 3ZZ6A 2PSXA 3SBKA 3SV7A 1L1GA 3LGYA 5A09A 3SNEA 1PQAA 4HZHA 3RXQA 3P8FA 4IGDA 1O2LA 1O3KA 3A8BA 1O2RA 1O2JA 2GCTC 1BOQA 3RM2H 1FDPA 1HAGE 1HJ9A 1P03A 1V2OT 5E2PA 1BMNH 5DP8A 1RRKA 5F8TA 1MQ6A 3TH3H 4AB8A 3TJUA 2VB0A 2BOKA 1A1RA 5L6NH 1ELFA 1Q2WA 1TWXB 1C4U2 1OWJA 3V0XA 5ABWA 4ZHMU 3MO9A 1EAXA 3PV5A 1W7GH 2FOGA 3GY8A 4FVBA 1FY4A 1OX1A 1JRTA 2VH0A 2FMJA 3RLYH 1GHAF 1JMOH 3VPKA 3RMOH 1D3TB 2QV1A 1UO6A 1MU6B 1TQ7B 3EA8A 4FXGH 3W1EA 2XCNA 5C5OA 5A8ZA 3RU4D 1ZSKA 3RMLH 4Z6AH 2EY4C 2BY8X 1XUHA 1V2ST 3UUZA 3MI4A 4AFSA 1LVMA 2J38A 1EPTB 2OQ5A 3CNRA 1S85A 1TNLA 5EOKA 1UVUH 5T3HA 4Y0ZE 4F48B 1SFIA 3TGKE 5C0TA 1BRAA 1KSNA 4Q80A 1HAIH 1P01A 3LGWA 1OWEA 1EFRD 4X1RU 1CGHA 2YNBA 4DT4A 5GXPA 1SGRE 2ALVA 4O03A 5FBEA 4KKDA 1QRZA 3LGVA 3TNTA 1C2DA 3SN8A 7KMEH 3RXHA 2A2XH 2PV9B 2A0QB 1NS3A 2EI8A 2RA0A 2WZQA 3ATWA 2H9HA 1C1UH 2BDHA 2CV3A 2CF8H 4ZKRU 3RDZA 1ABJH 2R0KA 3TK5A 1IQFA 4YOGA 3GDSA 2F91A 3U8OH 1P02A 3U8TH 1NTPA 1ZJDA 2ZF0H 1ZGVA 3SUDA 1LVYA 5T6DA 1SGFG 3GCHB 3MNBA 2Q6DA 2VIVA 2WYGA 2XW9A 2SNWA 3PTNA 2F3CE 1VGCB 1YPKH 1IQMA 1RIWC 1C2FA 1C5WB 3BIVH 4IN1A 1CA0C 1DLEA 1AO5A 3NPSA 2O8UA 5GJ4B 1TX6A 1IHTH 3LONA 4RKOB 5JDUB 3MWIU 1P3CA 3E6PH 1SGPE 4WXVA 1ETTH 4M9FA 4ISIH 2FM2A 1BB0B 3PWCA 1MTNB 1BBRH 5A8YA 2HVXA 1BTYA 4CBOA 5DKMA 2PLXA 2ZGHA 2ALPA 1QY6A 2KCPA 1LCYA 1ZRKA 4I8JA 4MQAA 4RSPA 1O2YA 1E35B 1TB6H 2A31A 3R3GB 1MAYA 4X6NA 3ZVAA 3UQVA 5EQRA 1P2JA 1A5HA 2WHXA 5I46H 1OWKA 2EI6A 1O37A 1BJVA 2G5NA 3N7EA 4JYVH 3EGKH 1JOUB 1NBMD 2C90B 1AUTC 3ATLA 5CHAB 1N8OB 1O2PA 2Z6BD 3SO3A 1TGNA 1TX7A 3DUXH 1RJXB 4O3UA 1T8OA 3QUMP 2WV9A 1C5XB 1KDQB 4AGJA 1GBDA 2STAE 3RU4E 6LPRA 5EW1H 1O0DH 1E36B 5F03A 3G01A 3SOSA 3BG8A 1GI5A 1H1BA 2ZDAH 4U32A 1QZ8A 4DURA 1EP6A 4DJZB 5DP6A 4U2WA 1B0EA 2O9QA 4J2YB 1SGDE 1MTUA 1LQDB 1P2NA 3MU5A 1LDTT 4X6MA 4BXWA 4NA9H 2L74A 4MPVA 2W7UA 1WXRA 4ZCNA 1AGJA 2NU3E 3H7TA 3ZYEA 1H8DH 3PLPA 4X0WU 1NN6A 4ZH8A 1P9UA 1TOCB 1Y3YA 2WYJA 1T7CA 4CRBA 1BBRE 1IQGA 3CS0A 3AW0A 1VITH 2OUAA 4INLA 2VIWA 4XBDA 1T8MA 1F2SE 4KGAA 4Y79A 3MQKC 4E7RG 1P09A 1KLIH 2ZECA 1EATA 1GGDB 5J4QA 1UCYE 1AFEH 1O38A 3SHAH 1HAXB 1SFQB 3SU3A 4BTIB 3A86A 4X1PU 2A4RA 1WBGB 2BY9X 3T26A 3BTFE 2GD4B 2PKAB 3S9BA 2BD9A 1NT1A 5DG6A 1QQUA 2H2ZA 1BHXF 2FI3E 1LKBA 1IOEA 3MO6A 2UUFB 6ESTA 2HPQH 3ZVCA 4TPYA 5FPTA 1YC0A 1BT7A 2Z3CA 4JK6A 3I78A 5DP5A 1ANDA 1O2WA 1E34B 2YMSD 1FY8E 2W6ID 1QL7A 1TLDA 2D8WA 2ODQA 4FUDA 4ISOA 5IDKA 4I31A 1ELEE 1OWDA 4YOIA 2FS9A 3FFGA 3FVFB 2F9VA 3RXFA 2ZGCA 3LH3A 1V2PT 1O2QA 1KXAA 4A1TA 1SKYE 5B6LA 3PRDA 4D8NA 3FP8E 3PLBA 2G52A 1NC6A 1NRPH 1GBCA 1J9CH 2UWLA 1QA0A 3ZVEA 1VCWA 2WPHS 1GPZA 3D62A 1XUJA 2GMTC 2R9PA 1UTMA 1RTLA 2SGAA 2SFAA 2XC0A 4GVUA 3DD2H 4K8YA 3LJJA 1O5AB 1ZYOA 2ZFFH 2TGAA 2KX4A 4ACBA 1C2IA 1MUEB 1UTLM 2ZU3A 2OC0A 1NRSH 1EZSC 1TGTA 1GMHG 1D3DB 1W10U 2ZU1A 3OY6U 2FS8A 1LMWB 3U1JB 2QN5T 1UVPA 2YMSB 4UDWH 5EQSA 3ZVGA 1G37A 1HB0B 3U1IB 2BXTH 2PKSC 2OTVA 1FIWA 5FCRA 2Y7ZA 3SUEA 5HKKD 2ZHDA 3RC6A 1C2HA 2WSSD 2R3YA 1K28D 4JZDH 1MD8A 1OP8A 5HM2A 3ATIA 4ZHAA 2CJIA 1AB9B 3UPEA 2FODA 3KQ5A 3TITA 1G3DA 2B9LA 3GYLB 1OOKB 2F9PA 2PP6A 1D6RA 2QY0B 3BTTE 3A7VA 1GCTB 4GCHF 4MPUA 1BTPA 2QA9E 1ANBA 2VIPA 2FI5E 3RC4A 1FI8A 2PGQB 2Y81A 4BAMB 2VWLA 4HI3A 1W14U 4JZFH 2ZU2A 5FPYA 2FOBA 2VIQA 3ZIAD 5JB8S 6GCHG 1SGQE 1F5RA 1Y3XA 2XNIA 4TWWA 1K1MA 2KAIB 1SL3A 2OBQA 2A4OA 3LC3A 5A2MH 1C4V2 1S0RA 2CHAC 4WJG2 4ZXXH 5C1YA 4NWLA 2A7JA 4ABDA 2G81E 1MZAA 3PO1B 4Y76A 3SUFA 4PROA 1ARCA 5I25A 3PMBB 2AYWA 4ZUHA 1N6XA 3U28C 1GBMA 2FOHA 1ZOMA 4ABEA 1C2KA 2ZHEH 5T6FA 1GVLA 5C2ZA 4H6SB 5JBBS 1O3CA 1IHSH 2XBXA 1UVTH 1BZXE 5FX6A 2GCTB 4NFFA 1LVBA 1CT2E 4NA8A 2FWWA 2XXLA 1FNIA 5ETXA 1K1LA 4OS5A 2AFQB 1IQJA 4MPWA 4ZAEA 2GV7A 2QCYA 5KECA 3RMNH 1XKBC 3WWBA 4AOQA 3V12A 1V2TT 2VIDA 4ZHLU 2RDEA 1C5QA 3PWBA 1ELVA 1TIOA 1S82A 3RXJA 3F9HA 3L6PA 2XC4A 3RXVA 1WOFA 1PPGE 3F1SB 1GBBA 4I33A 1S81A 2XTTB 1NFYA 5EGMA 1DSTA 2DUCA 5GCHF 4NZQA 4INKA 1GMCG 1O2UA 2GZ8A 2HLCA 5C1UA 1MMJN 1HJ8A 1QRWA 1O2MA 1ANEA 1A3BH 2J94A 1FQ3A 1P11E 1F0SA 1GI3A 2WPIS 3EE7A 1ZR0A 1V2QT 1SOTA 1CHGA 1YLNA 4B76A 1TQ0B 5EXNA 1A0HB 2A32A 5HMAA 4TWYA 1HLTH 1SPJA 1FPCH 1BRBE 4FOUC 1FY5A 1P3EA 3MMGA 3F9FA 1K0HA 2OINA 2SGEE 2H5DA 1O5FH 1AMHA 1JIRA 1KTSB 8ESTE 1AVGH 2TGTA 1DY9A 1HAVA 2P3UB 1HXFH 3A87A 4BAOB 1BBRK 1J17T 1H4WA 4FUCA 2JJ2D 2VVCA 2BYAX 4KELA 2ZFRH 3PTBA 3W94A 1HJAB 2BVXH 3W95A 2AIQA 5F8ZA 3MTYA 4NWKA 2G55A 2CXVA 1UCYK 2F43B 1C2JA 2TBSA 4D76A 4K1EA 1XM1A 2PHBA 1SHYA 4YZUA 2BLWA 3MH7A 1CT4E 3SV2H 6CHAC 1G3EA 2J2UA 1F0UA 1UK2A 5PTPA 2Y5GA 3TVJB 3ATKA 3M7QA 3QX5H 1ELCA 2AH4X 5CDFE 5AFYH 3A89A 2BQ7B 2ZHWH 1HUTH 4ESTE 1SVPA 2HNTF 1IQEA 1UTPA 1X7AC 1W0YH 2Z3DA 4UFDH 1F0TA 1LO6A 1O3OA 3I77A 2WPDD 2FI4E 3E8LA 5EXMA 3K6ZA 1TNKA 3OX7U 5LPFA 4R0IA 1SI5H 4R8TB 1SQRA 5H4IB 1Z8JB 2HOBA 2J4IA 3T28A 2Y7XA 4OGYA 3UB0A 2IPQX 2BD8A 1ZTLA 4XOJA 4K60A 2ZKSA 1GJAB 1SLXB 4JZEH 1GBEA 1BTUA 2JKHA 4B73A 3QK1A 1U6QA 3RXAA 1OHHD 1TYNA 1A46H 3EQ0H 4DY7B 1A2CH 7GCHF 3ZV8A 2UWPA 1SGYE 1EJAA 2WUBA 2THFB 1INCA 3OFND 4MPXA 1DVAH 3MU0A 2J95A 3FZDA 4JMYA 1DWCH 1MCTA 1V2NT 3RXEA 3VB4A 1PPFE 4X6OA 1F92A 3SW2B 2Z9IA 3SNDA 4BXSA 1VJAU 2VWMA 3H7OA 1S6FA 4CR5A 1O2SA 1DPOA 3M5MA 3PRBA 1QBOA 1QQ4A 3ODFA 4TSFD 4ASUD 3URCA 4NIVA 2M2AA 3QN7A 4JYTA 4B2BA 1PYTC 1O3AA 1GI7B 3NUMA 5EJZA 3A81A 1QJ7B 2BDCA 1BCUH 4K5ZA 3ZYDA 1V6DA 4X1QU 4FUBA 1HAPH 1VJ9U 1GI1A 2BD3A 2STBE 4P00A 1CO7E 3MO3A 5E0GA 4NA7A 4JCNA 3E1XB 2DE9A 3E90B 2HRVA 4D7FA 2A4QA 3OEHD 4WVPE 4BAQB 3LIWA 3KHVA 1AHTH 1GI8B 3V3MA 4TPIZ 2VVUA 1KXFA 1DICA 1G36A 1O3PB 1BMLA 1EJMA 1BMMH 1P12E 5KEDA 1GG6C 3RXMA 3BTME 1ZJKA 2RG3A 3SJOA 1UTQA 4X2YA 2BM2A 2ZQ1A 3UFAA 2V6NA 1C5PA 4IS5A 2BDGA 1DUEA 1P8VC 3SZNA 3OU0A 2BLOA 1ZTKA 5C1XA 5C94A 4AZ2B 1ZMLA 1AWFH 1IQIA 3LH1A 3S7HB 1FX0B 3M37A 3SUGA 4CRDA 2GCHF 3LU9B 1YPLH 2BDIA 1SR5C 2ZPSA 2ZTYA 1V2RT 3LC5A 1A3EH 2IOTA 1E38B 2D26C 4AG1A 3SI3H 4AC9A 2OXSA 3RXDA 2EC9H 1COWD 1NY22 4M7GA 3TK9A 1THRH 2FOAA 3ZV9A 1HAHH 1RXPA 1N1LA 4CH8B 2FTLE 1FONA 4DCDA 5E0JA 2JDID 3ELAH 3SZEA 4FUFA 1IQLA 1QR3E 3T25A 1YCPH 5KGOA 3LGTA 2ZU4A 5EU8A 3BN9A 1O3JA 4Y8XA 1QRXA 2ZIQH 1CHOG 4A5TS 1H9IE 2JH6D 1DXPA 2IN2A 2P3FH 4AORA 3WWFA 2A4GA 2Y6TA 4DIIH 2ZFPH 1KY9A 5A0CA 1JXPA 5JYIA 3BTQE 3ESTA 1O34A 1LTOA 1P2OA 3VEQB 2O8TA 1F0RA 1LHCH 3QLPH 1C5ZB 1KXBA 1M9UA 3MFJA 3LGUA 2ZNKH 3QZQA 1SBWA 5EIYA 3SHCH 4XFQA 3Q00A 3HGNA 2FDAA 3NZIA 4HGCA 1VR1H 1ZLRA 1BRCE 1W0ZU 5DN6D 4AYYB 2BY5X 5C67A 2QF4A 2J97A 1TNIA 4INHA 3P95A 2ZPRA 4AX9H 1KIGH 3DSPA 2VBCA 2V3HH 3SV9A 2BLVA 2D1JA 3WW7A 3HK3B 1D3QB 4AG2A 2O8WA 3DFJA 1C1WH 1G3CA 5A0AE 2PKSB 4X8SH 1ESAA 1MTSA 4XSKU 1O3GA 2SGFE 5DP9A 5JBCS 4KTCA 1YPMH 2P3TB 3M7TA 1XKAC 4UE7H 4Z1MD 1O2ZA 4OS1A 1K1PA 2H9TH 2ZI2H 2LELA 3QTOH 1K1OA 1ORFA 3EE0B 1GI2A 3U9AH 1HAYB 3A7ZA 1QNJA 1CT0E 1DE7H 1O2OA 3U8RH 1ZPCA 2P95A 2YNAA 1JRSA 5L30H 1C1MA 3P17H 1V3XA 2A5AA 1XX9A 4D9RA 1UHBB 5FAHA 1GDNA 3GCNA 4VGCC 5F6MA 1ZZZA 1GVKB 2WPJS 2FO9A 3KN2A 3KQCA 5GIBA 1C5UA 1LHEH 2SNVA 1GJBB 1DXWA 2QXHA 1O3EA 1C2MA 1DT2A 1W2KH 1KXEA 3EYDA 2PW8H 2F83A 1A4WH 2Q6FA 2JETC 3MH5A 3TPIZ 1NRQH 1NROH 1SC8U 2CN0H 4YOJA 1ELBA 2GJGA 3GOVB 1PQ7A 4GUXA 1UJ1A 1MH0A 5GNDA 1GBTA 2CK3D 3B9FH 1ZMJA 1T8LA 3PB1E 3N7DA 2D2DA 5DJ7A 1GJ5H 3T29A 4WF8A 3FANA 1BTXA 1MBQA 4B2CA 2CF9H 4F4OC 1GJ7B 1NRRH 1ELTA 4B6EA 2AMPA 4BANB 3GY6A 1GI6A 1HBTH 3H5CB 4B2AA 1DLKB 1HGTH 1O2GH 2GZ9A 1TPPA 4K1SA 4YTAA 1WU1A 1L1NA 2ZQ2A 1BTHH 1VCQA 1OXGA 3OTPA 1AKSB 1GJ4H 2QIQA 3BTKE 4JK5A 1FXYA 3BEIB 3DHKH 1FUJA 1VITF 2XWAA 1E1QD 3L3TA 4WMDA 1IAUA 2KCAA 3QO6A 4B71A 4FUHA 2FLBH 4FUEA 3RXUA 3GCTG 8GCHF 4X1SU 1PPZA 4CRGA 1RTKA 2W5EA 1TRYA 1ARBA 1DDJA 4NCYA 4GSOA 5A0BA 1CBWC 4KP0A 2IJD1 1IQNA 1TABE 4IW4E 1F7ZA 4D7GA 2AHME 3LKWA 1ELDE 1HRTH 1HYLA 2RDLA 1QJ1B 1NFXA 3UY9A 4Y10E 3RU4T 2ANMH 2VNTA 3BEFB 3TU7H 1C5SA 1HAOH 1GJCB 1D6WA 1O5BB
chains in the Genus database with same CATH topology
5AFZH 2A5KA 1IQKA 3T27A 1AUJA 1RS0A 1O2KA 3AASA 2ULLA 1EASA 2ZWLH 1XMNB 4B1TA 3LOXA 5FBIA 3QGJA 3NK8A 4XBCA 4CHAC 2ZCKP 5TCAA 2XWBI 2FOCA 4K69A 1DS2E 1TNGA 2AERH 1DWDH 1L4ZA 3A85A 1C1PA 4Q7ZA 1TBRH 3RXLA 3E16B 1VCPA 3EAJA 2KAIA 1MKWH 4MDSA 4FU8A 1GBAA 2HPPH 1GMDG 3D23A 1SGFA 1EB2A 1QHRB 2A7HA 3ODDA 1NRNH 3PM3A 3O8DA 3SV6A 3SU1A 3KGPA 5AF9H 3BG4B 1LPGB 2TPIZ 1MKXK 1EUFA 1RGQA 2PUXB 4MVNA 1TRMA 3A82A 1UTOA 2O8LA 2ZGJA 1V2UT 1ABIH 2ODYB 3Q3XA 3RXPA 1DWBH 2CGAA 1ZPBA 3K65B 5IYTA 4CRAA 2J9NA 1NFWA 1GHZA 1Y5UT 1P2QA 4O97A 1THSH 1QFKH 3VB6A 3GYMA 3GY2A 1GHBG 1FLEE 3A7YA 1YLDA 1EP5A 1RTFB 1CA8B 1GJDB 4QT8C 3C1KA 1NZQH 2AS9A 1T31A 1PJPA 1WUNH 2HGTH 3PYHA 2WV5A 4YT6H 2R2MB 5JPMH 4IN2A 1Y8TA 1AD8H 2NU1E 4WXIA 1AVXA 1EX3A 1EXFA 1O5CB 2GKVE 4IC6A 4WMEA 3U69H 3GCHC 2F9NA 5L2YH 1SOZA 4AN7A 1K1NA 4ASHA 2H1UA 1YPJH 1WTHD 2J92A 2EEKA 4FU7A 3KQBA 1AVWA 1F5LA 1H8IH 1J15A 1O36A 5HYOA 1AY6H 3JZ1B 2FYQA 4UFFH 1SSXA 1YKTA 1Z8IB 1TMUH 1MTNC 5DPAA 3GDUA 3KQDA 3MNXA 1BUIA 5SGAE 1EZQA 3HK6B 1ELGA 4ABFA 2ASUB 3M3TA 4KTSA 2ZO3H 2BD2A 1LVOA 1Z6EA 5CMXH 3LPRA 3RUOA 4OS7A 2C8XB 3BTWE 1FY3A 2FZZA 2Z7FE 1S5SA 4XE4A 5EXLA 1P2IA 4NGAH 1GJ6A 2CMYA 3STJA 1TALA 1N8OC 2ZDNA 2ZCHP 3TIUA 1GG6B 1YCPK 4MNYA 5L2ZH 3A7TA 3P8OA 1WCZA 2B5TB 2ZDLA 3ZZCA 3TJNA 1Z71A 1EJNA 2QAAA 1BJUA 4BAHB 2OC8A 1ETRH 1LQEA 1C5RA 3RLWH 1J8AA 1PPEE 3UNQA 1NU9A 4UFEH 1NO9H 2GDDA 2FOMB 3TGJE 3MHWU 7LPRA 1TE0A 5K7RA 1F5KU 1TNJA 2XRCA 3A8DA 1KTTB 3RP2A 2Z94A 1C1NA 1GI4A 4UFGH 3QWCH 1O2XA 2VIOA 1KLJH 2UWOA 3SORA 4NIWA 2GX4A 4LOYH 2BDYA 1AE5A 3SNBA 1XUGA 1DSUA 2FOFA 1QBNA 3E3TA 2AMQA 5LGOA 4LZ4B 1DX5M 1OP0A 1Y3UA 5C3NA 1CGIE 3SGBE 2RA3A 1C2EA 3T5FH 4Q7XA 2PTNA 1QB6A 2OBOA 3ENSB 5A8XA 5HGGA 2AEIH 3F9GA 1YPHC 1W13U 4NIXA 5FHTA 1K9OE 2V35A 1TPOA 1TBZH 5DK1A 3PMJA 3ZZDA 1MCVA 1SLWB 2F9UA 5DP3A 1P0SH 4RKJB 1HFDA 2I6SA 1OYTH 1AE8H 3M5OA 4Y11E 2EA3A 3BTDE 3GCTF 1XXFA 2ANWA 2BDAA 1DITH 2P16A 3SQEE 3GDVA 4MNXA 2XBVA 1ZPZA 2OCVB 3A88A 1TGBA 2BB4A 3KQEA 2ZU5A 4JZ1A 1GBKA 2QC2A 1AWHB 4A1XA 2Z9LA 3S9AA 2GT7A 2ZDKA 1K2I1 2XBWA 1YLCA 3UR6A 1TPAE 2H9EH 4FUGA 4CREA 3MH4A 1O39A 4THNH 1HIAA 1RIWB 5CE1A 4YM9A 1QA7A 2BTCE 3B23B 1FIZA 4OS4A 1CA0B 4SGBE 2WPKS 2Z3EA 2IPHA 1V2JT 4HTCH 4CBNA 2ZC9H 3CP7A 1ESTA 2ANKH 1UK3A 1B5GH 1XVMA 1O30A 5B6OA 4I8HA 2UUJB 1W11U 3ZZ9A 3SGAE 1SGEE 1C1QA 1ELAA 4O9VA 1AU8A 1Y5BT 2DE8A 2Z9KA 2UUYA 4ABGA 1L2EA 2ESTE 2GTBA 2G4UA 3Q76A 2BQ6B 1TAWA 2XYAA 3CENA 1ANCA 4AFZA 2ODPA 2ZFSA 1LHFH 2JETB 3RXOA 1HXEH 3L33A 1GMHF 3S0NA 4J1YA 4O3TA 1PQ5A 1FZZA 3IITA 1PPHE 1WQVH 1UTNA 3A7WA 2WPMS 1OPHB 1YBWA 4ABBA 5J4SA 1O3IA 4I8KA 4ZMAH 1TX8A 1HAVB 1OWHA 5HM9A 1TGCA 2PUQH 2FX6A 4E05H 1DWEH 4X8TH 3GY5A 2EI7A 1EPTA 1P10A 3ITIA 1T32A 4F49A 3DT0H 4AYVB 3SJ9A 1V2VT 2BX4A 2BY6X 5F8XA 2Z9GA 2W3IA 2IJOB 1O2HA 1HPGA 1GBLA 4IMQA 3VXFH 3U98H 1C1OA 1OSSA 3R0FA 4WH6A 3VGCC 3S7KB 5FPSA 5C20A 1C5YB 2FTMA 3PMHB 6GCHF 1O3LA 3RXSA 1OYQA 2F9OA 3PO1C 1O35A 4OGXA 1YCPM 2OLGA 5AHGH 5JB9S 2PR3A 4A6LA 1C9PA 2B7DH 4IC5A 2AGIX 1YGCH 1SGTA 1L0ZA 1Q31A 4ABAA 4NSYA 1V2LT 1AN1E 1K22H 1TFXA 5GWZA 4Q7YA 1GBIA 1A5GH 1Z1JA 1AFQC 1CBWB 2UUKB 2FYRA 4CR9A 1O5EH 4BOHA 4X8VH 1QJ6B 3PLKA 3SGQE 3WY8A 2TRMA 1WQSA 2FXRA 3M7UA 2G8TA 3N7OA 2B8OH 2BQWB 1O2IA 1ZGIA 3ZVBA 3D49H 1XUKA 3NWUA 4Y7AA 1LKAA 1WTGH 2QXGA 1FAKH 1YYY1 3EA9A 3K2UA 1AZ8A 3QZRA 1O5DH 1EAWA 1ZHPA 2Y5FA 2A1DB 4HFPB 3JZ2B 5LPRA 1C1RA 4DVAU 4CHAB 3RXRA 4DIHH 4LXBH 1W12U 2VH6A 4TYDA 1DOJA 2GV6A 2WINI 1UHBA 1ZMNA 3OTJE 1BTWA 1EQ9A 1L1JA 4Y6DA 3ZZ3A 2XC5A 7ESTE 2K1QA 2Q1JA 1THPB 1GMCF 1GVZA 1Y5AT 1O2TA 5LPEA 1DFPA 3Q77A 3C27B 4WY3A 2GMTB 1SQAA 4MLFB 1GHXH 1AIXH 9ESTA 1S0QA 1VZQH 1JBUH 3M36A 1JIMA 1EB1H 1GI9B 1SLVB 2ZGXH 1O2VA 3BTHE 4ZKOU 1DM4B 3AVZA 4I8LA 1UMAH 3TNSA 3A80A 1KDQA 5T6GA 2QYIA 3M3VA 2OQUA 2LNCA 3O8RA 3FAOA 1NU7B 3SU4A 2J34A 4ZROA 1WYKA 1SB1H 1HJAC 2FLRH 2HWLB 2A2QH 3M3SA 2QXIA 4LK4A 2JH0D 1SQOA 3SQHE 1P9SA 1QB9A 4Z0KA 2WV4A 5ESTE 1GJ8B 2R2WU 3M5NA 1A0JA 5FXLA 3SJKA 4OS2A 2ZHQH 4GCHG 1D9IA 1FJSA 1AKSA 1O3DA 3SU6A 1C4Y2 2ZP0H 4RN6A 3T62A 3MYWA 2P8OC 2P93A 2C3SA 3I29A 4ISHH 2ZDMA 4K3JA 2FX4A 1XUIA 3GCOA 1T8NA 4H4FA 1ZTJA 3EA7A 2G5VA 3A8AA 4X2VA 2G00A 2Y82A 1OP2A 2Z9JA 1P57B 3VB7A 2HNTC 2VGCC 1TA6A 1C1TA 8LPRA 3QGNB 1MTWA 3RMMH 1C5MD 2PKAA 2FIRH 1P04A 2CHAB 1BRUP 3BEUA 1G2LA 4ISNA 1E0FD 2QGRA 5DGJA 4FUJA 1Z8GA 1D3PB 4Y71A 3RXBA 2PFEA 1TGSZ 1FV9A 4U30A 2GVFA 1CU1A 4A92A 3IG6B 1H9HE 1UCYH 2NWNA 4U01A 9LPRA 3GICB 1A5IA 4DT7B 3MU8A 2SGQE 1UTJA 4GHQA 4UONA 3FZZA 2W26A 2OC1A 4UEHH 4YT7H 1P06A 3F6UH 1C1SA 1IQHA 3UIRA 1V2MT 1J16A 1AQ7A 2RCEA 3KEEA 1MQ5A 2BY7X 4OS6A 5TJXA 4X2XA 1GWAA 5EODA 4AFQA 2VINA 4D9QA 1O3NA 1O3MA 3RXCA 1GJ9B 5GCHG 1C2GA 1DANH 2TGDA 4X1NU 1ESBA 3VXEH 2HALA 3LGIA 2NU2E 2AGGX 1CE5A 2VU8E 1C5TA 4CRFA 1S84A 3PV4A 1P05A 1QL9A 3NKKA 1TA2A 4E06H 5LH8A 3MH6A 3NCLA 1T4UH 2GZ7A 4Q2KA 1CGJE 4Y7BA 1QCPA 1OKXA 3BTGE 4TY6A 2ZA5A 5DP4A 1SGIB 2TGPZ 2BVSH 4XBBA 3A8CA 2ZFTA 3NXPA 3UOPA 1E37B 2ZHFH 1EZXC 3SU2A 1TRNA 2W3KA 4A1VA 1L4DA 3GY7A 3P6ZB 1Y3VA 2P94A 2Y80A 3ZZ8A 2C8YB 2VVVA 1PFXC 1LHGH 3SNCA 1V2KT 1OWIA 1QIXB 2R0LA 2A7CA 2ILNA 4JYUH 3MU4A 3P92A 2BD4A 1UK4A 1NESE 1SMFE 5E2OA 1DY8A 3O8BA 1ZHRA 2BMGB 3OYPA 4LZ1H 5EG4A 1YF4A 1MTVA 2F9BH 8KME2 2ZGBH 3A83A 4MNVA 2B0FA 3TGIE 1BHXB 1Q3XA 1EKBB 2TIOA 1O3FA 3HATH 1PQ8A 1UTKA 6CHAB 1C5NH 4SGAE 1KLTA 1T4VH 4DGJA 3ZZAA 1EPTC 3M35A 3RC5A 1Z6JH 2ZPQA 1Z8RA 3HGPA 3AW1A 4I8GA 2VJ1A 3UWIA 4MG3A 2OD3B 1AZZA 3F68H 3M5LA 1PYTD 1K21H 1FAXA 1TNHA 3UWJH 5K0HA 4XDEA 2PTCE 1Y3WA 4CH2B 2QF0A 2VWOA 3ATMA 3D65E 3UR9A 2FOEA 3QDZB 1BIOA 1O31A 1YPHE 7GCHG 1GDUA 3HPTB 2V3OH 2SGPE 3B8JA 1BA8B 1CHOF 2ZTZA 4BNRA 3UQOA 1KXDA 1W3CA 4YLUA 1YPGH 4MTBA 3A84A 5GPIB 1GBHA 1S83A 1GCDA 4X8UH 1ETSH 2FESH 2BX3A 3P8GA 4H6TA 4NFEA 1PPBH 3DA9B 1H9LB 4WWYA 3RXIA 2QF3A 1S6HA 1G9IE 3HKIB 4YESB 1NPMA 2WPLS 1EZUC 3V13A 1SG8B 2GT8A 1WAYB 1LPKB 2PGBB 1PPCE 3IWMA 1TONA 4DG4A 3UNRA 5DO4H 4GHTA 1VGCC 3ZZ5A 2C93B 4YO9A 1QB1A 3OSYA 3AAVA 3SU5A 1GHWH 3SJIA 1YP9A 3SV8A 2A45B 2R3UA 1QL8A 3GY4A 2BD7A 4Y8ZA 1ZRBA 1MAXA 2BVRH 5BRRE 4Y8YA 5AVDA 1SHHB 1C1VH 4IBLH 1HV7A 3BTEE 3Q3KA 1GBJA 1WV7H 5TCCA 1Z7KA 1G30B 5E8EH 3MOCA 1SQTA 2ZZUH 3UREA 1A0LA 1RFNA 2BZAA 3RXGA 4TY7A 2BDBA 3VGCB 3UNSA 4DOQA 2NU0E 1C9TA 3T2NA 3UOUA 1AI8H 2BD5A 3E91A 1UVOA 1O3HA 4FU9A 5CHAC 3V7TA 5HXFA 2AIPA 4DW2U 1YPEH 2BOHB 1GBFA 3VB5A 1FMGA 2ZG0H 1Y59T 5JBAS 5EQQA 3MNSA 2BXUH 3KCGH 2I6QA 1GHAG 3EDXB 4NIYA 1GDQA 1W7XH 1AFQB 2JH5D 3A7XA 2GCHG 1BMAA 2ANYA 1KYNA 2BHGA 1K1JA 1ACBE 4BTTB 2GP9B 2P59A 1ZHMA 5EW2H 2YOLA 4K2YA 1N6YA 1XUFA 1QURH 1C5OH 1W8BH 3TJVA 3TH4H 5EPYA 4FVDA 1WSSH 1ID5H 2XBYA 4X6PA 3ZZBA 4ISLA 4H42U 1P2MA 4JZIA 1FY1A 3VFEA 1HCGA 2VWNA 2ZCLP 3KL6A 3ZZ4A 1G3BA 1HAZB 3LT3A 2BZ6H 3KNXA 1ZSJA 2C4FH 3BF6H 3CS7A 3M61U 1GGDC 2LPRA 4GLYA 5DP7A 1ZSLA 2C8ZB 4AGKA 1GI0A 1O3BA 2ZDVH 4NSVA 4Y0YE 4ZKNU 3BV9B 1Z1IA 1NM6A 1QTFA 1O32A 1EAUA 3GISB 4IMZA 4E7NA 4I7YH 3KF2A 3O8CA 4BAKB 1GHYH 5C5NA 4K1TA 3URDA 1EAIA 3K9XB 3BSQA 2GDEH 4X2WA 5GDSH 1XXDA 3ZZ7A 2OP9A 3GY3A 4YLQH 3RXTA 1MZDA 1A61H 1JWTA 1FN8A 2Y5HA 3TK6A 1YM0A 2FP7B 1B0FA 3QTVH 2QXJA 1EOLA 4AFUA 1G2MA 4B75A 1BDAA 1BQYA 1CVWH 4B74A 4ABIA 1O2NA 3SI4H 1TOMH 3MNCA 2WUCA 4FUIA 1KXCA 1B7XB 1MBMA 4ZKSU 2H5CA 3RXKA 4GPGA 1A7SA 2Q6GA 3MU1A 1TMTH 2SGDE 4UD9H 2FPZA 2P8OB 5BPEA 3DFLA 4K8BA 3S9CA 1EOJA 1TPSA 5ESBA 1XVOA 1QBVH 3BG4C 2PWXA 1RD3B 3TH2H 4MNWA 3FP7E 2A5IA 2GGVB 1GMDF 1FN6A 2XCFA 1GHVH 3LDXH 3FP6E 2W7SA 1J14A 4NZLA 2VGCB 4WH8A 4VGCB 2AMDA 1C5LH 3SJ8A 4AB9A 2AGEX 3HKJB 2ZFQH 3K6YA 4BTUB 1MU8B 1LPZB 1HDTH 4I32A 1D4PB 1G32B 1GL1A 1O33A 4WMFA 1MD7A 2M5TA 4ABHA 3VB3A 4A7IB 4ZXYH 1LHDH 2BLQA 5EPNA 3OY5U 2C8WB 2FEQH 2H6MA 1GHBF 1V2WT 1AB9C 1SGNE 1BITA 1C5VA 1GCTC 5G4BA 1NFUA 1BTZA 1O5GH 3P8NA 1GL0E 1OS8A 3E0NB 1TMBH 3S69A 3TJOA 2ZEBA 3UTUH 3KIDU 1MKXH 1VITG 2ZTXA 3RM0H 3ZVDA 2NU4E 3TLOA 2G4TA 1CQQA 1K1IA 4NG9H 3STIA