3LH2L

Crystal structure of hiv epitope-scaffold 4e10_1vi7a_s0_002_n 4e10 fv complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
b'AEIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIYGASSRPSGVADRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGQSLSTFGQGTKVEVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4E10_1VI7A_S0_002_N (T88)
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Artificial gene
molecule tags Immune system
total genus 26
structure length 110
sequence length 110
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lh2L00
4KZDL 3QDAA 3NA4A 2I9LA 4P5KA 2OR8A 4ELKB 2D7PA 4P2OD 1RFDH 5ACZB 4PLKD 2E7MA 3MOQA 1R5IB 3CDYA 4HIHA 1JN6A 4PJCF 3BT2L 4BKLB 1MH5B 4LCYB 3MRJB 4MNGB 2XZAL 4KAQL 3BRFA 4WW1B 2Q76B 4M8QA 4IMLA 5HGHA 5IB1B 1FNSH 3ME0A 5FYKU 2EYTB 4M5YL 4YPJA 4N0CC 2PXYC 3MJ6A 4YBHA 5EO0B 1YN6A 5I1IL 1DANT 4MQSB 4MS8C 4DVBA 1HQRB 4L8CA 5IFHL 5FUZL 3GSUA 1UEYA 2MCPL 3U83A 1NCCH 1FVCA 1H15B 4KI5F 4P2RB 3GHBH 4JR9H 3SCMA 4PRHB 1J05B 4OB5L 4QRTA 4LKXB 4ETQA 1A9BA 4NGHL 2E5EA 4TSAH 5D2LE 4IOFC 4DTGH 5ICXA 1UCBL 3OJDB 2AQ3A 5L2JA 1OTTC 3NN8A 4QRPD 4OCXL 4DOHB 5C0CB 5MEQA 5DEZA 2X89D 1X44A 2LABA 4XWOC 3UYRH 3UTPD 1Q9OA 3LEVH 2R1XA 5TQ2L 1IGTB 5L6YL 2IBGA 3QUXD 5K9QG 1FQ9C 4GBXD 3QUZC 4LVOC 3TP4A 2CRIA 4LSRL 4MWFB 4PJ8A 4TOYL 5D70L 5K9OA 4GXVH 3WIHH 2W07A 3Q1SL 2VZ1A 2BSRB 2ICWI 1LD9A 3VFNB 3T0EC 4DN3H 3EO1B 4PJBB 3MV7B 4RIRA 4OFYA 3FN3A 4KFZC 3V5DB 4EUPH 2HRPH 2C1PB 1EAJA 1BD2E 5DHYA 3PGFL 3QIBC 2YA0A 4G6AC 5CD5C 4EI6A 5DD6B 3V5KA 5ENWA 2NY6B 1PFCA 3S4SG 2J8HA 5FF6B 4JHWH 1LDSA 2XOTA 4Q9RL 1BFSA 1I85C 3FMGL 4IDLA 4U0RB 4MQ7B 1C16A 4NQDD 1L9NA 3DECA 5JXAH 1E28A 5E8NA 4R6UA 2HFTA 4U3CA 3NFNA 1E6OH 4G9DB 1ZT4A 4NO0B 4Z76B 4UAOC 4KY1L 2MPAL 5CKAA 1CD1A 1MWAH 3G6JF 1T21A 3HI1B 5SX4I 1AE6L 4Y2DA 4F58H 2H3NB 4JDTH 3WEXB 3T09A 2P5EA 5GS3A 5EBGA 1B0RA 5C0EB 5BV7B 5DI8B 1U9KA 3QIUC 4NCC2 5I71C 4HK3J 1MCLA 2FX8H 3ZKXB 4TTDC 5SX5H 5IBUB 5DSCB 3QNYB 1R3KB 3T3PE 4PREA 4ZPVB 2JJVA 3TH4T 5CZXD 4QWWD 2EEBA 1YEFL 3LCYA 3MFFA 2A73B 3L6FB 1FSKC 1U8MB 4UT9H 5BMFH 4YDJA 4I3SH 3GMPB 3UTSE 5HXMA 4L9LA 3BQUD 1A1OA 3OB0K 4MAYB 3LEXB 1BVKA 3QCUH 1R3LB 5EFIB 4GLRI 4XAKE 4OV6F 5DJXA 4RBPK 2BVPA 3LSOB 1DEDA 5CP3H 5IVZA 4P3CL 5E5MA 3F7VB 3X3GH 4AY0A 4W70A 5HYIA 4D94A 4G9FA 5CUSH 4XNXH 4JHBA 4P2QB 2VNCA 3WUZA 1DQQA 1IKNC 1DP0A 1EJOH 4TUOA 3JV0A 3E8UH 3N1QC 5F7FA 5J6GA 3H9SE 1YY8B 4HFWB 5I1CH 1LO2L 3TZVD 4HCRH 4NM4H 3GHBL 2BHUA 1F6AB 4ODUB 3RNKA 1I1AC 4WGWB 5JA9A 3SDAA 4FA8A 4LSPH 2UZIH 2JB5H 4FXKB 5EC1B 3O4LB 4QOKE 1KGCE 3WCYA 4Q0XH 4TNVK 4ZPTB 3EYOB 3VXMD 3G5XA 3RJDA 1J1PL 4HMCA 4K7PY 2Z31B 2UV3A 4QCIB 1UZ8A 3LQMA 5ITFA 4V1DA 5BO1H 4P23D 3UYRL 1DL7H 3BPCA 4NFCA 5KVFH 1SBBA 1A02N 3P4NA 4Y4FA 4LLWA 3PQYB 2BSTA 3IXAB 2X4SB 5JTWA 1KULA 3AB0B 3RHWF 5BS0D 1MUJB 5D72L 2P44B 3KJ4B 3JTTB 4CRPA 1RHHA 5H2BA 3MUGA 5F7WC 3WIHL 4Y1AA 3F7RA 1FIGL 5D1XD 4DN3L 2QKIA 2VXSH 2K7PA 1QQDB 3DHMA 4KU1A 2YRPA 4U2YA 5GGTH 4MB5A 4EQ2A 5ETUA 1XR9B 1RZJH 1DQMH 4C56B 2HRPL 4X6DB 3CX5K 4U1HB 4KQ4L 4UB0H 1EFXD 2N7BA 4I5BB 1K4CB 4RMQA 3P40A 1JPST 4ZOEA 4X98B 1FL6B 3C2SA 5L2KA 2HLAB 3T04D 4ZNEA 3TN0C 3WHE0 4W6YB 1G9NH 1RIHL 5DZLA 3WL9B 4JHWL 5E0QA 1G6RB 1WAAE 4XP9L 4OBRA 3AFLA 5D5MA 3U0TB 2VXUL 3O6FA 4GAGH 5K9JL 4KJQC 1NCWH 5F9JB 5ANME 5JXAL 1I7UA 3GMLB 4U6VH 4LPVA 4P5TC 4WI5A 2EXYC 2YSSA 1E6OL 4FQJH 2VH5H 3DMMD 1DQLH 2R9HD 4XNQA 5D6DC 2EC8A 2J6EA 1RJYA 4UOW1 2NXYB 4M9OA 1TETH 3ARGD 4BYHA 3TT1H 3FRUA 4S1QH 3BEVA 3T3ME 1XGTB 1FV1A 2UZXB 3TA3C 1VGEL 3MUY1 3T8XB 1IGIL 2A6IA 2VDLL 1C08B 1OP9A 4PJ7F 3CZFB 3RVTD 4I3RH 3QULA 2VLKD 3EYUH 4F33B 5GRWA 3OAZH 3HNSH 5HYSG 4DCQA 3IFNH 3L7EB 1M6OA 1MPAH 4M03A 1FLRH 3BPOC 5JLZB 2P24B 1UH2A 4CVZA 3OKKB 4AMKH 5IW1A 1K4DA 5C0GA 3NH7L 1ZA3B 1ADQA 1E27B 1UM5H 4UBDD 1J0HA 2OTPA 1JZ2A 1DTUA 1X6LA 5IB4A 2PW2B 5C09A 1HHKB 1S9YB 1CFTA 2CQVA 1ND0A 3WKMH 4JFPA 2V2XA 5DT1H 3I3DA 1UKTA 5D96B 5AD0A 5CUSL 4XNXL 4AG4H 3HNTH 2Z4QB 4EIZC 5C0FA 2JIXB 4WNQA 3E8UL 1NBQA 4MNQB 1F00I 5I1CL 3VFWB 2CR3A 4WJ5A 2AABL 1NEZA 1HHIB 1QVOB 4HCRL 3WJJA 3PGCA 4NM4L 4S1SH 4I0PC 4AEEA 1JHKH 2VYRE 5GZNC 4XP5H 2BSSA 1PAMA 2AJVL 3TNMB 2UZIL 4HLZG 2JB5L 1PJ9A 4CDGC 4LBEB 3QDGA 5CEYA 4RCAA 1K8DA 1ZHKA 3BVNB 2EECA 1U8NB 4Q0XL 4AENA 4UDTB 5M94B 5DJYB 3H6JA 1N8ZA 3ULUD 4Z7VB 2ITCB 3QHFL 1IAII 3EFFB 3HUJB 3ARTA 3WLBA 2F54A 2ICEB 3HPLA 4KRPD 5BO1L 4XT1C 2Y6SD 1HK6A 1DL7L 3IRPX 2NY3D 5KVFL 5FECA 5JXEA 1QLFA 3RZWA 2RQ8A 2P8PB 4RAUB 3MJ9A 3KXFB 3QQ9D 4HS8H 2GSGA 3F7YB 4M1CC 1WWWX 4MXWH 4N0YL 4WDIA 3UAJC 3VE0A 1F90H 3CUPA 2G9HA 4OKVA 5F1NB 5FKPA 4PTUB 4FNLH 4PLJC 1CT8B 2DQDH 1WBZA 1ZA6A 1LE9B 1DQML 3W0WB 4JANA 5E6ID 5L8LB 2IPTL 5CWSB 4UB0L 4NN7B 5FK9B 1FL3B 1U36A 5DK2A 4QYOA 4RGNB 5ID1A 5ACLA 3C6LA 5DJ2A 1MOEA 2BOBA 4OAWA 1IC7H 1MLBB 5GRZA 3K4DA 1A3LL 4LPWA 1WT5C 1G9NL 2F15A 1OAQH 3I6KA 4TVPD 5GGSB 2Q8BH 1OSZB 3QBTB 3NPSC 3GIVA 4GRWB 4QLRA 5KOMC 1NMBL 3CMOL 3DTXA 4NKOA 4NWTL 2C3VA 4GAGL 4C83A 1FNFA 2FEDD 4LHUA 1NCWL 4P2OB 4HKBB 4RSVA 4U6VL 2XN9B 4XBPB 3EYFA 4FQJL 4EEEA 4JPKL 4WUUB 4FQIL 5CEXB 1OQXA 3DX6A 3MV8E 4L4TD 2F8XC 4XX1E 1KLFA 3U6RA 2NPLX 3AMKA 3KYOA 3TT1L 1I9IH 1GZPA 1HH9A 2YBRA 4YIQB 4JFFE 5KZCD 1LEIA 4NRXA 2OR9L 3K8MA 4LRIA 2B4CL 3GMQB 3KPMA 4I3RL 3HC0B 2MQ3A 3IB4A 2F5AL 3EYUL 3WS6C 1T04A 4LKCA 1MPAL 1S7SA 1T2JA 2OJZH 3FO0H 3ARVA 1NCTA 4WWKD 1UVQA 5IQ7H 1OARH 4P46A 4JHAH 1TVDA 1WC7B 1GRWA 4RNRB 3HKFA 3QCTH 2E7LA 1GPOL 3HN3A 5DDHA 3DUHA 3VFSB 4XBEH 1MHHA 4NQEA 3WKML 4ZTOH 4QRPB 4K94H 4FOMA 5DT1L 4XNMB 4TNWF 1ZLWH 3U1SL 2O61B 4PJBF 1FJ1A 5DUMH 4AG4L 3HNTL 2DKUA 1IGFH 3F62A 1TVHB 4FFVD 3DSNA 3QUXB 3IYLW 2X1WL 4CNIB 4I8DA 1KCUL 4GBXB 4XRCB 1PSKL 1T0NB 4ZXBC 4ODHH 5JORB 3ARPA 2C3WA 3W5NA 3BZFB 4G7YH 4HX1B 2PYEB 4NCDA 3HCVB 4NBYB 1MI5A 3SDCD 1M7DA 4PJHB 1J11A 2F58L 1JHKL 4XP5L 4JVPA 4XVJH 1AFVH 4GG8A 4UDUB 3RTQD 1F3JA 2V9RA 3ARWA 4F3FB 3D85B 4HS3A 1NFDB 3RDTD 1CLCA 4L3EE 4CMMA 1QFOA 1RY7B 4XCNB 3KPOB 1X5YA 3G5VA 4J3TA 4P99A 2XWTB 2DYPA 5SWZD 3CDCA 2IWGA 3BD5A 1VKXB 2NW3A 1FORL 5IGXH 3UEZA 3VGEA 1UG9A 4KHTL 3H3PH 2B2XH 4GUPA 1QZ1A 1NLDL 1T3FA 1NDGA 1BVZA 2KQMA 1HHJA 4XGZB 3JV4B 4JDZB 4KH2A 4MXWL 1J10A 3NFPA 7FABH 1F90L 1A6TB 2D7NA 1JGEA 1N3NB 1VPOH 4RFEB 4U6YA 3U7YL 4WHTA 1CZ8L 2BVUA 2VLJA 5HHMD 4HJJL 3KPRE 3HLAA 2DQDL 4M62H 1ZTXL 3REVB 5E8EB 3PWUA 2V17H 3STLA 5I30H 2GYSA 6FABL 1BJMA 4K71C 1CGVA 4EN3D 3MTRA 4R4BB 1GC1H 1P4LA 4Z0XB 3AAZA 3DIFA 3LPGA 1Q0XL 5T3ZE 5F7EH 1IC7L 1X7QB 2HT3C 4DZ8A 3FFCD 1ONQB 3ALWA 1DQJA 3JWOH 5IT2H 3OR7A 4OZHB 5IMLA 2Q8BL 4F7EA 3RY4A 3QI9B 1V3JA 2HFGH 4XNZB 5HVFB 2HJKB 4HPOL 4GMTH 4ISVA 2QLVB 5D7KE 2WP3O 3QFJD 2OJEA 3TVMD 3B5GA 1ACZA 3HZKA 3MROA 5B8CC 5EZJB 2CJUH 2CK2A 3BQUB 5F7HA 4HG4J 1NGPH 3RVVD 2P43B 1J0ZA 4Y5YC 2YPLE 1X6NA 4HJ0C 2LTQB 2ZCLL 4NNYA 4FABL 1KG0A 2FJFB 2B7DT 4RA0C 1JGUL 5CSZB 1CLYH 3G5ZB 1MF2H 3S88L 2YZ8A 1HKLH 3PUCA 5LCVH 2AK4D 3VGDA 5EDXA 5JHDA 2X89A 3PGDB 4A2MA 1J88A 1DUZA 5BVJB 3ZSTA 3CFEA 2CLRB 1ZE3C 3WLWC 5MERA 3K0WA 1CICA 1MWAB 4PRIA 1PY4A 4JG0H 1SYSB 5I8EB 1H8NA 2KZ1B 1MHEA 3VG9B 1P7QA 5IBTH 3C08H 4JM2D 3MLZH 5DJDA 1ZVSA 2OJZL 1NFKA 1HYSD 4P9HC 3RPIB 1OARL 5CS7A 5C0AA 4JHAL 3B2VH 4LLYB 1KB5H 4MQXC 4WO4D 3QCTL 3VXMB 1I8IA 4XBEL 3WXWL 1WIPA 4ZTOL 4OZIA 4U6HA 3VFVB 4K94L 4BUGA 4P23B 4AEHH 3WXVL 4LSUH 5DUML 5I75B 2RGSA 5EU6D 4X6DF 4YFEA 5IMMA 4XH2A 4KK8D 5KVGL 1W72L 3VCLA 5BS0B 3LKQB 2P7TB 3LHPH 4RMVA 3ZDZF 3NGBC 1JHTB 4UT7H 4DKAA 4HD9A 1N0XH 1KIRB 2YR3A 5D1XB 3OX8B 2GFBB 1CGYA 5D7IE 1YZZA 5HHOD 4QT5A 5ICYB 3AS0A 4Y8DC 2X7LA 4CJ0A 1OW0A 4UOW0 3QIWA 3HB3D 4XZUB 4O2EB 4QXUH 1O5DT 1EFXB 4NO5B 2BSED 1E6JH 1F11B 3MLWH 3D39A 2WANA 12E8L 1NBVL 3HE7A 3WIHA 5IJVA 5IGXL 5JDSB 4UMGA 2DIJA 1T0MA 3OKDA 3CFKA 5JPMB 3OAZK 1TTFA 1FE8L 2W60A 4YGVA 1UZ6E 4H5SA 4EUPA 4Z7WE 2YS4A 5DWUL 4YDLB 2WBJC 1A7RL 1AGEB 1NJ9B 1I8LA 2XQYK 4R0LB 2J4WH 4WTZG 3MRLB 4M62L 4OCSH 1A64A 3MO1B 3T4AA 3ARGB 3QR2A 4PJEE 5I30L 3QPXH 2F74A 1B6DA 1AO7E 3MNZB 2R4RH 3BAEH 3BSZL 4JPWL 3K46A 4OLUH 3MNWB 3MRIB 3TH3T 5CLTA 5F7EL 1UB6B 2W0FA 4KGJA 1XEDA 4J23A 2XTJC 3X13A 5ECJE 4JQXA 4OTXH 3P4OB 35C8H 3T08A 1BLNB 2YXFA 2I25N 2HFGL 4XVUD 3VDAA 2CLZB 1K3IA 4NZUL 2JCCB 1IM9A 4K7PH 4GMTL 3T1FB 1JUFA 3NCBB 4JRYA 1S5HA 3MLVL 2YD7A 3LB6D 4MA1B 3C5SA 2CJUL 4UOJA 4U1GB 4MXQD 1NGPL 4X99B 5EUOA 1MVUB 5IBLC 3C09C 1ZT7B 4G8GD 2VWEE 5FYKE 1CYGA 2BC4A 2QR0B 4BFGA 4P4KC 3L9RA 1NFIB 3S5LA 3JZ7A 1TQCC 4D0CA 3DX8A 4ZTPH 5JQ6L 2EDQA 3IFPB 1G7LB 1MF2L 1P7KA 3V0WL 4ODTH 4XVTL 1A7QH 3MV9E 3QJFB 5AG9A 1QPXA 5IB2A 5KSAC 5KS9B 4JG0L 1JGVL 4PRNA 4YAQB 4Z7VF 3CCHA 3QEQA 3BP4B 3L1OH 4ZQKB 2EZ0C 3HUJF 4Y4HC 3DETC 5IBTL 3C08L 4ODSH 3BKJL 5F9WC 1LNUB 1XIWD 4PRPA 3IKCA 4KKLD 1QSED 3B2VL 3OV6A 4GG6F 3QDMD 5JW4N 5FHBH 4PJIE 3SDXE 1HEZB 4BFIA 5IWLA 4PJXF 3VXRB 2VSDA 5MI0C 1TZIA 2HT2D 2EICA 2JB6A 4OGAC 2NX5E 4N90E 3WJLA 4KRPB 1CXHA 4AEHL 3DYPA 4HJGA 2NY3B 2E3VA 4HCRA 5DEFA 3QJHB 1INEH 4LCWD 4HBCH 3H7BB 3VFRB 2OTWB 3SPVB 1KLGA 1OF2A 1WLHA 4X6EB 5L0QB 1BZ9A 4ORGB 4IRJC 1MQKL 4JRXD 4LP4A 4X0KB 5ERWB 4YFDB 4Y16D 3TLRA 1BF8A 1S9VB 3BH9A 4RQQB 4UINL 2PR4H 1N5AB 3DMMA 4GRWF 4L9DA 4OZFB 1CS6A 5E6IB 1V7NH 4CW1B 5D7LD 5DJ8A 4R7DB 1RZKC 3MLRL 3P4MA 3CFBA 3SJVE 2VQUA 3O2DH 1MCWM 5FDYA 2FX9H 4DQOH 5FO9B 1X5LA 4UQ2A 4J12A 5A16A 1MFDH 4ZFFB 1CXKA 4P9MH 1IAOB 2VLKA 1DCLA 2Y06H 4Y89A 3VI4F 1KPUA 2JK5A 2ADGB 3MRKA 1MJUL 4M93C 5HYJA 3OGCA 4JEGB 4KKCD 1SM3H 4LCIH 4N5UA 1U8PB 2Q8AL 1MCSA 2J4WL 5GZOD 2Q3ZA 3UJIH 4L4TB 2E7CA 4OCSL 1QFWL 4ONFH 1CXFA 1A1MA 2I24N 2V6HA 4N5ED 3QPXL 4PJAB 3LPFA 3MJ7A 1QA9B 15C8L 2R4RL 1BWWA 4Y5VC 3BAEL 2HVJA 3LQZA 3ZHDA 2NR6D 3WE6A 2ADFH 5JDJA 5F21B 3NMEA 3ARDC 3DBXA 4YBQD 1NC4D 1YYMH 3CX2A 4WFED 3SDDC 4JVUA 4O9HH 1I3RA 3Q6FB 3V9FA 5LJYH 3RUGB 4PP2A 1C7TA 4WUKH 1XGPA 4WWKB 4Z7OF 3NCMA 1HQ4B 3L3JA 1TFHA 2NY0C 4IMLB 2VQ1A 1VFAA 3VW3H 2K7QA 2NY5H 1GGBH 3QRGL 3VFPA 3NIGF 1JRHL 1IEBB 3QDJD 5DYOA 3H9YA 3ZYOA 4NQVA 3BGMB 1KIQA 1Q9LA 3CVHB 4X80L 3C9NA 2FO4B 4PJHF 3CFCH 4ZTPL 2DB8A 5F96H 2NY1C 2YWYA 4ODTL 3KDMB 1A7QL 1D6VL 3SCMB 5KSBB 2YN3A 5F88A 1NFDF 4LLQA 3B5HA 1A9BB 4HS6A 4YO0A 1PZ5A 3IETB 1U8LA 5AEAA 2Y4SA 5HHPB 1JK8A 2V2WA 2GT9A 3O41A 2UYLB 1RZ8B 4N0CD 2PXYD 5EIIA 3MRMB 2IANA 3SDCB 1WCBA 1LDPH 2BCKA 4MS8D 3RZCA 4JJ5B 1AY1H 3RTQB 5DFTA 1CD9B 2VDNH 1PX3A 3KHOA 1AXTL 4M6MH 4KVCH 3DGGA 3RDTB 2BXYA 1SQ2N 4IM8A 2RCSH 3MLTA 3JWNC 5SWZB 4Y19E 5CBEB 3OTTA 4IOFD 3MRHB 3MCKA 4JFQB 4A6YB 3QO1B 4R2GC 4H0HB 1OTTD 3UBXA 1ODAA 1CFSA 4U1IA 4YHIB 3V7AG 4CN4A 3I84A 2ID5A 1RZ7L 4XWOD 3HZMA 4F15C 4ODXA 2EKSB 1LP9A 2GQHA 4QRQA 2ZJSL 5DO2C 4Q74A 2IQAB 3CFJB 4PD4J 5HHMB 3QUZD 4FFYL 4OZHF 4ZO7A 2WIIA 3TBSB 2AEPH 2D0GA 3ZDXF 1ZLSL 4CVUA 2VC2H 3T0ED 1W0VB 4WRLA 4XI5C 1KNOB 4M1DH 1PYWA 3FRPG 4I4WA 1IM3B 2FX9L 3LEYH 3QEUA 2DF3A 2B1HL 4D8PA 4ODBD 4LSVH 1N4XH 5DUPH 3S34L 3QIBD 5C08D 4G6AD 5CD5D 2OX5A 3GSNL 5T1DH 1MFDL 4P9ML 2DWEB 2Y06L 4UTAL 4ZO9A 3VGBA 1ETZB 3PV7A 1ZK9A 4Z8FL 3QB7C 2H2SC 3QFJB 4WEBL 5J56B 5I8CA 1PQZA 4P57B 4NZRH 3D87B 4LCIL 1U3ZA 4F8TA 4TPRH 1U3HA 2X4PB 5IJKA 3BX7C 4GXUN 1FIEA 1B0RB 3IKKA 2ZUUA 4XPAH 3V8OA 2FX7H 3U9UB 2R15A 1KTLA 3FO9A 2D3VA 3EAKA 3MRRB 4NUJB 3CDGA 4FQQB 4I18C 2OXHA 4LF3A 1RD6A 5MHSD 1P9MC 5K9KB 3Q5OA 2CGRH 2BJMH 4L9LB 2AJYH 1BVKB 1EO8L 1PVHA 3GKWH 5CHNB 1J7VR 4RAVB 4X6CE 4POUB 3QIUD 3AREA 5ADPL 4WUKL 4TTDD 4EOWL 5FOJA 4ZODA 4X7DC 2RR3A 3VXSE 4QRUA 2NY5L 1GGBL 2OQJA 1I7RB 1I3GH 1IFHH 4YFLI 4NN6B 3B6SA 2YMXH 2HTLC 4JJHA 4TUOB 3MUHL 5J6GB 5SWSD 1S7XA 4XXDA 4L4VD 3W39A 2BY3A 4X7SH 5EU7C 5EU6B 3OXRB 3BDBA 4MB4A 3RI5F 1FZMA 4K3DH 1EXUA 1B90A 2MNUA 3O3EA 4PY8J 4XPGL 4YHZL 4CMHC 4R3SB 3MRGA 3DI2B 2G5BB 4ZUUA 4J3WA 1DVFA 4ODVH 5JIPA 5TQ0H 3ZSSA 5HHOB 3WBDA 4FTVE 1LDPL 1I8KA 2PN5A 2R69H 4PJCE 5C9JA 1MJJA 2DM3A 2UWEA 4MJIA 1AY1L 2J88H 2ZZUT 1C5CL 3B3IA 2VDNL 5T1MA 4Y4FB 3VD4A 1K9TA 1MHCA 4DZBA 1VACB 4M6ML 4KVCL 3TO2B 1I1AD 3EFDH 3HG1A 3U36B 2AXFB 3IU3A 1GVIA 5C0DA 4NQCA 1R24A 1YNLL 5F97E 3O3DB 3AC0A 1J8HA 1JGLL 4HT1H 5HGDA 3SE8L 2QKIB 1S7UB 3FQRA 4QRRE 1FFOA 2WBKA 1INQA 5ETUB 1JNHA 4KI5E 5HHVH 2DQUH 3NZ8B 3LH2H 4HWZB 3OSKA 3N9GH 4JFEE 1JNNH 3GJFB 1UJ3B 2BERA 1RULL 2JCCF 5ESAA 3P30H 5F7NC 2AJ3A 4PGBA 4Z7UA 2WUBL 1IQWH 4M1DL 3O6FB 1NL0L 2FJHA 1YDPA 5TE7L 4X4ZA 5I17B 1D6EB 1UM4H 4FQLH 1N4XL 1E4KC 1BOGA 4NPYB 2P46B 2N56A 3IJYB 5A2JH 4WFFD 4MCZA 4L4JA 2AK4A 3D48R 1Z6JT 5T1DL 5IEKA 4XNQB 2C4FU 3RX7A 3TN0D 2W9EH 4NQSB 2FECI 3DXAA 3PHQA 1Z0NA 1R5VB 3MGOB 4TPRL 3BHBA 4HXAH 1X5IA 4KJQD 4G8GB 1RK1B 5KS9F 3MV01 2FBJH 5F44A 4O02H 4PUBH 4P3DA 1MCEA 1Z9LA 2EXYD 3DV6B 4WO4A 5EZIH 4FQXC 4AEIL 1EEYB 3VFTB 3T4YB 1CLZL 4JKPH 1CL7H 3L3IB 3ZTJG 2NY7L 1T20B 1T2XA 4KUZH 2AJYL 3ULUF 4DKFL 3TA3D 3GGWB 2EYRB 2SEBA 3VGGA 5C0RL 1IGML 1RJZA 3W9DA 1QUNA 4YEEA 2AK1H 5E6ZA 3UZQA 3KYMA 3G6JE 4NRYA 4DKEH 3BP6A 3QDMB 1NANH 4M7LT 2FH8A 1CVRA 3MRNA 4F9PC 1Q0YL 2DL2A 2A1WL 3QWQB 1JJUA 2YMXL 5D2LA 4YPGB 2ZSWB 4IOIA 4R96A 2V2TB 2CIKA 1A0QH 3VH8B 1UH4A 2DLEA 4YBLB 3ARQA 5GGQH 1AKJD 3RY6A 4OD1L 4OLXL 4H8WL 5GS1C 4X7SL 1QG3A 3RU8H 5DVKA 4LCWB 4M4PA 5TH2A 1LO3L 4EVNA 5I19L 3GMRA 4K3DL 3B4NA 5DMIH 3UPRA 1KB5A 3TV3H 3ARBC 2LU3A 4JRXB 2F53E 2G60H 4GAFB 2KZWA 4ODVL 1XR8A 3QQ3A 3UMTA 3V7AE 3NCJL 2R69L 3WLBB 1DLHA 1MRFH 1T5XA 4YHLL 1KLUB 4ZUSA 1HINL 5DJCA 3NACH 1G7HA 3DRTA 4L5FH 1T22A 1WITA 2XA8H 1D7FA 4I0PD 3INUL 1LP9F 3EFDL 5GZND 5ESVB 1UB5B 5I1DA 1BD2A 2ESVB 3JTSA 3VFUB 2IFGA 3ROOB 3QNZB 1ZGLP 4JFDD 3AU1B 1J5OL 1YN7B 5BVPH 2G9HB 3O3AA 3MLUL 3BP7A 2X40A 4HT1L 4U1MB 4OKVB 5EU4B 1OY3B 1FVEA 1SEQL 3OF6D 5FKPB 1YMME 4PJAF 1U3JA 1ZA6B 2ZPKL 1SYVA 3OAUH 2OI9B 2DQUL 4NZTH 1PW3A 3LH2L 1U8KA 5T3ZL 4LVNB 1YMHB 4O2FB 2QJDA 4P5MB 4KJYA 5BZWB 2G2RB 4XNUL 1H5BB 4M1CD 3N9GL 3UAJD 2D7OA 2EE3A 4RMSA 4OLWH 4ELMA 4I9WE 3AM8C 3P30L 5C07D 1CFNA 5JMOC 4L29A 4LSTH 3QG7H 3RUGF 4IIQC 1IQWL 2H6PA 4PLJD 3JWDL 5DGRA 4FHBD 5F6IB 4FQLL 4X5XA 3OHXB 4MAUL 4APQC 3EO0B 1U41A 2OMBA 5FYKH 3ECBB 4UV7H 3KS0H 2C7UA 2PETA 1NC4B 2MKLC 3KAAA 2W9EL 4BUHA 3EOBA 3U6RB 3LZFL 5IQ9A 2I9TA 3W11C 1ORSA 4Y4KA 1BBJA 1IZKA 4L8SA 3S36X 5DRNB 1A1NB 1JPTH 3PWLB 1AHWA 1JPSH 3O11A 1XIWA 3V4PH 5E8PB 4OZ4A 4ZFOB 3UTSA 2JJTA 2FBJL 1QSEA 3QDJB 2HJLB 3CFDB 1QRND 2E8YA 1XCQB 4I48B 2VL5B 1A8JH 2D31B 2Z9TA 1T5WB 5CAYB 1FC1A 2P8LB 3MSPA 4JO2H 3WHXA 4E0RA 5D8JH 4NQXA 2I5YH 4WTWA 3WFDH 1ZGLM 4KPHL 5DMKA 4KUZL 3WFHA 4F2MB 1EGJH 2HG5B 5IBUG 3MJ8B 3QFDA 5GGRY 1FN4A 2NMSA 5TE6H 2PXYB 4NQEB 2W1NA 3H9SA 5DJAA 5GSRB 1FRGL 5MENE 1QKZH 4YWGH 4QF1B 3BUYB 5E2UH 4DKEL 4GOSA 2C4FT 4X6BA 4Z9KB 2AJUH 4K3EH 4U4BA 1WBXB 1I9JH 4G7VL 5I1LA 4NNPL 4OUUB 1DN2A 1K8IA 3ES6B 5HI4C 4XAWH 2XKNA 3GI9H 4HKZB 5D7LA 4ORZC 4LSDA 2Y7QB 4PJ7E 4WHYG 4RDQF 1Q72L 2P5WB 5GGQL 2APXA 3QQ4B 1QR1A 1JI2A 2ED8A 5TJWK 1MI5B 3WD5H 4OM1H 3RKPA 5A2KH 2K3TA 3LKSA 4UQ3A 1JWSB 2V5SA 4GG8B 4NQTA 5AUMB 2HKFH 4YZFF 5DMIL 2AI0H 3ZHKA 3TV3L 3ZT6A 2Y5TA 3BN3B 2YPVH 4M3JA 1DUYB 2G60L 4PRDA 4G8FA 3RIFK 3H3BC 3KPSA 4LNRA 5T3XH 4LVOB 4ZXBD 3GBNL 4KTEH 4MD0A 4XCYB 3I6LD 2X4RA 1RUQH 3WS3B 3RGVA 3P73A 4JLRA 1JPGB 5DEGB 4U1NA 3OKOA 4KTYA 3ARSA 1P4IL 2R23A 1NH6A 4ZFZB 3MRCA 4R7NA 1IL1A 4X9FA 5I1AA 3HE6C 3QIBB 1G6VK 1R3HB 5BQ7A 5BVPL 3RIAK 1CXEA 3B9KA 4DGYH 5F3HA 3VG0L 1SY6L 3K2UH 4TSCH 1WAAA 3MRBA 3OAUL 3RA7H 4DFIA 2ZUTA 4JPIA 2PW1A 5H37H 1L6XA 5JR1H 4AL8H 4NKDA 1L7TH 5ANMA 3DIFB 3O2DA 1WV7T 1D9KC 4M3KB 3GSNA 2FDBP 4F7EB 2KDGA 4JM2F 4S1RL 4UAOB 3UX9B 3QG7L 1UXWB 3UYPA 4UILH 3WSQH 2APTA 1QO3B 5DFVC 4FQHB 4NFDA 2D03L 3MNVA 1FNHA 4KHXL 5T3XD 3MROB 5FYKL 3BO8A 4UV7L 4M1GH 2RJMA 5KN5A 2HT3D 4TSBH 2XRAH 3HR5A 4CKVX 4ZAKC 5L7XH 3K2MC 3QIUB 2AJSH 3OR6B 2I26N 3MRQA 3QPQC 3V52H 1JPSL 2GSIA 3V4PL 3TBTA 2J3SA 3ULVH 1FSKB 3OJVC 1VENA 1MFCL 3T0VA 1KJ3H 4LPUA 1N59B 3PHOB 3MLXL 4HJ0D 2R8SH 4LCUA 3T0DA 5SWSB 5CEZE 3CAFA 1MCCA 4L4VB 2DS4A 2W92A 5FUCE 4JGUA 1BBDH 2CKBH 5D8JL 1VADB 3L3OA 2V7NB 2W91A 2I5YL 3H8NA 3WFDL 2XV6B 3SGDH 1A6UH 1G7IB 4PRBA 5FGCE 4D9QE 1CDHA 1MRDH 3DRQA 4LHUG 5TGBB 2ZWLT 1DN0A 2DLTA 1HN1A 3FO2B 1HXYB 3WLWD 2ORBH 1IEAB 2B39A 3VWKA 1PKOA 5E2UL 3HRZA 3LKRA 2ARJB 2XXMB 3KYAA 4K3EL 1K6QH 2F19H 4KDTC 1I9JL 4P2RE 4RMWA 1I1AB 2L4OA 4PRHE 4XAWL 3GI9L 2IPUK 5EC2B 5J89A 4HWBH 4JFXB 1IGCL 2M1KA 1QP1A 32C2B 4MQXD 3Q0HA 3SQOH 2DMBA 5C6TL 4G6FD 1L9MA 3GIZL 3WD5L 4QT5B 4BA8A 3SKOB 1HE7A 3IDIB 4R90L 3BZ4B 1YNKH 4DOHE 5DRXB 5T33H 3RRQA 1QEWB 4KKAC 2AI0L 4I0CC 4DGVL 3LKNB 1KUMA 4RX4D 2FB4L 2FEEL 4MSWA 3NABH 1JZ7A 5D2NC 1M71A 1MAMH 4XPFL 3LMJH 1I7TA 1H3WM 4D0DA 3HAEH 5CZKA 1OP3H 2X1XR 1ZHLB 1HHHA 1RUQL 2DIAA 3HE7B 1CR9H 5I76A 5HY9B 3HC4L 4GQPH 3I9GH 1JFQL 5J9PB 2BVOB 1T0MB 3ARFA 2IAMC 3MV7E 1FNEA 3P11H 1CBVH 4MA7L 1CK0H 1VFOA 2EYSB 4ELMF 4X9GA 5D1QC 5HVHC 4DGYL 5DA0B 4HFUH 4V1DE 5F89A 3K2UL 3G08B 2Q7YA 3FQUA 3TN0B 2GTZB 3OKMB 3RL1B 2GJZA 1P4BH 3RA7L 3T4AB 1T83A 4NSKA 4AL8L 3LQAH 3NCCB 4JY5H 3PWNA 4QY8A 1L7TL 5HHNA 5AYUH 4CVXB 4OGZA 1EX0A 3BZEB 4MX7B 1NGQH 4LRNH 3IU4H 3HS0B 1OGAD 1U8IB 2WBJD 4Z77A 3QUKB 4LLDB 2VXVL 5E2TH 3MV8A 4NN7C 5IF0A 5IKCB 3GK8H 1RHFA 3QQNA 5FGBA 4X4XB 4DFHA 4UILL 4XP6L 3WSQL 3D2UA 3BW9B 3T2NL 2B1AL 4PIRF 1CGTA 4ZO6A 1A6ZA 4JFFA 3S96A 3ZT5A 4GAJH 4ZMAT 5DQJA 3TA3B 1HSBB 1S8DA 3SO3C 1V7MH 5DD0H 3GSVB 2IBZX 2XRAL 2XTJD 43C9A 5L7XL 5I9QC 4PJ9C 3ZO0A 5FB8B 1OAZL 1KIPA 4BQ9A 3V52L 2IQ9H 1MHPL 4MGXA 5CJOH 3BPOB 4RFOL 2VISB 2YD8A 3FHAA 3NCEB 5ILTH 2X1QA 2X6MA 1KJ3L 2AV7B 1S7VB 1IGYA 3V7MA 1L0XA 3CCHB 5IBLD 5IG7A 4M48L 4S0TD 4QHUA 1AKJB 3E3QE 4JHZA 3SO5A 1BBDL 4P4KD 3PIQA 1IKFH 1NMAH 1OSPH 1QBAA 5T1KD 1RZGB 4L3CA 2VOTA 2JE8A 4P2QE 3QH3B 1MCQA 2BP3A 2VN4A 4W6WB 1H0DB 1XGQB 1Y18A 5I1GL 3OPZL 5E24E 3AS3A 5ISZD 2ORBL 5KSAD 1RZKH 2XZZA 2EZ0D 3ESVF 4Y4HD 1QLEH 2F19L 3DETD 1JV5B 4HWNA 4WU7A 3MRFB 3MR9A 5C71A 1T89C 1FL5B 5GRXG 4QGYA 4WV1A 4GKSA 3S97C 4IJ3C 4WCYH 4M7KH 5DD5H 5E1AA 4I0KA 4AT6A 1G9MC 4JFDB 1QFHA 1CDBA 5F7LB 3SQOL 5EH1A 1HI6A 5C0BD 3WYRA 5BZDA 2YD2A 4OGAD 2ICWJ 4J4PA 1H9VA 1YNKL 3C60A 4NUGL 5FM8A 3FO1B 3KLAA 2A2QT 2VJXA 1C12A 5C2UB 1T1WB 3HRPA 4ZO8A 1T1XB 5I18H 5DJ8B 3LMJL 4MCYB 3QWRA 4YHKL 4ZDHB 3DURA 4IRJD 1LEGB 4WI9A 1CR9L 5FUOH 4HV8A 3BD3A 1NAMH 3IFLL 5DS8A 4Q6IA 5C07B 5E56A 1DE4B 2LV4A 4P5TA 1QSFD 3P11L 3FQWB 1CBVL 1LEKA 1B0WA 1OD7A 1WIUA 4J1UB 4KDVA 5D6DA 5IB5B 4C56E 1F3RB 4X6DE 2DQFB 5HJ3A 2OTUA 2FR4B 4RISL 2F54E 4BQCA 3ZDZE 2OL3L 4EJ1C 4IHOA 1EZVX 3MPCA 1TNMA 4BQBA 2DLFH 1FVDB 4K07A 3DROB 3LIZH 5FA3A 4GSDH 1I4FA 3LQAL 1Z3GH 4GO6B 5I66B 4LASH 1U2HA 3SE4A 2BY0A 1UCTA 5BW7A 4H1LH 3U2SB 4NP4L 2UVFA 1UM6H 3TBWA 2YPLA 5INCA 3JXAA 3X12B 3GK8L 1RZIA 5J1AB 1I9RL 2LAAA 3FB8A 4KGLA 1JNJA 4LDEB 4U1JB 2W9LA 1CGUA 1TCRA 4RRPA 1XGRA 4GAJL 5KSUB 3UTTA 2NLJA 5CBAA 2VQ1B 1VFAB 1V7ML 3QI9C 5DD0L 4EUPG 3TIDA 4HC1H 5EG6C 4G8EB 4O58H 3ZTNH 3ARDD 4X8XA 3WUWA 5TDPA 1J1OL 4F7MB 3IS1X 1FFPB 2IQ9L 3DVGB 3SDDD 4YX2H 4EDWL 1G1YA 1FYTD 4YDIH 5CJOL 4JCMA 3OKEB 4E5XB 1CWVA 1KCRL 1OGTA 1F13A 2FHBA 4MJ5A 3UTZA 2BOCA 4U33A 1FFQA 2NY0D 4GMSL 3R0NA 4EDXB 1FC2D 4N8VB 2CDEA 1UXSB 3UC0H 4YEFA 3QA3B 1CQKA 3EBAA 1PD6A 1IKFL 4QHMB 1CFBA 2DWDB 1WZKA 5IV2B 3CMGA 3SEPA 3OF6A 2ZUQB 4ONOA 1T66C 2NY1D 3HNVL 3A6BH 4Y5XC 4ZFGL 3DGGB 4G43B 4OFVA 5I8OH 3KPPB 4PJFB 5GXBB 1V3LA 1JPFA 3PNWB 1FZJA 1JNLH 5I1JH 4ZXBB 3H0TA 4HUUA 2ADJA 4MNQE 5D7IA 1F42A 1QLEL 2GK0A 5IEHB 1AIFA 3AXLB 1BIIA 2H32B 3FOMA 3S5LG 3LS5H 4O5LH 1S7RA 1U93A 3LKPB 4YUEH 5DD5L 3UBXI 4JQVA 2PCPA 3OJ2C 1ZS8B 3N1PC 3RWJA 3VXOB 1MY7A 3RL2B 4Z7VE 1UACL 2DQTH 3GSRA 3FOLA 4LLMB 3P9MB 4LEOA 3FONB 4Q97A 4M00A 3SQBA 5I18L 4R2GD 2XA3A 3LAFA 3SGKA 1U8QB 1Z9SA 1YEDA 4WI7A 1TVBB 3X11A 4HUXB 4Z7WA 1DBBH 3KXFE 4GG6E 4GRLA 3CZJA 4PJXE 4XB8A 3PF2A 1A7OH 5I6XC 5E2JA 5FAAA 2NNAB 5T5NF 5BXFA 3R06B 5DO2D 1SY6A 1IC5H 1XAUA 3AY4A 3KPTA 3BH8A 3ZE2F 4PJEA 3OKNB 1VEMA 5C6WH 5E00A 2OR7A 4FQ1L 3T65A 3W0WE 1AO7A 5IHZB 1CDCA 1Q1JH 2VIRA 4XI5D 2VR4A 4K71B 1AD9B 4RGNE 1CU4H 2QSTA 1T1ZA 3HZYA 5LVEA 3L3DA 4XNYL 4BH8B 2HTKC 4M7ZC 3IDXH 1QLRA 4NM8L 3D0VB 4QHNA 1QNZL 3IFOA 2IADA 4PR5B 4GRWE 4WEMB 3RWHA 5IVXA 3WFCH 4LASL 1E0OB 4BQ8A 5L9DH 4LGPB 4ZOAA 3ALXA 3ZE1F 2H2SD 3B2UC 4GAYB 3L3HA 3UTQA 1BVLA 5B8CB 4L8DA 4JPVH 4TULH 1KPVB 4Y5YB 5CLWA 3OZ9H 2EDTA 3HMXH 2QQNH 4NFBA 3JUYA 1N6QL 5DQDH 2CO6B 3G5YA 2XFXB 3VXQA 4ZSOB 2GUOA 3VI4E 1Q9WB 2AQ1A 4BFEA 3SE3C 3WNOA 1O7VA 3N1MC 1CG9B 3HC3H 4KROC 1ZGLB 4ESKA 5LXGH 4HC1L 1A6AB 3OAYH 4L1HA 3ZTNL 5GGSY 2EDXA 2E9BA 5E9DD 3AS2A 1YA5A 4IRZH 4YX2L 4XXDB 4U1GC 1OP3K 1OD9A 2AJXL 4KRMB 4PGZA 1A2YA 2CLVA 5E5RB 2B5IC 4U1KA 5D9SA 4Q9CA 4HZLB 3L7FA 1HOCA 2ZOLA 1BGXH 3PWPA 4LAQH 3DUSA 3P0GB 4K9EC 3WV0A 1FBIH 4F37K 1KEMH 2R2EA 4G6FB 1RVFH 4RGMB 3D69A 2PYFA 1BQHB 4LP5A 3I75B 3MACL 2HTLD 3O45A 3MMEB 3MA7A 4QRPE 5EBLB 3MZTA 3DOSA 1EMTH 2Y36H 4NBXB 3B3IB 3A6BL 1MHCB 3UTPE 5A43C 1GAFH 4Z7OE 2XZQH 4PRIE 1W72B 2E7BA 3QUYC 5IOPB 4NQCB 5I1JL 4ZS7L 3NIGE 4KUCD 3NGBB 2AV1B 3O3BB 3THMH 1D5BA 5TDOA 1DFBH 5FKAB 4EI5A 4XTRC 5HGDB 1DBKL 1RZFH 3DX9A 4PRAA 4PJHE 1LK2B 3IJSA 4PY8I 4R97B 4O5LL 1LHZA 2XQYG 3QEGH 4PJDA 3SJVA 5IMKB 3MXVL 3IXTB 3L3KA 1KYOJ 1B6UA 2DQTL 3QT2A 3IAPA 4IMKC 4RWYH 4OLZH 1F4HA 3ROLA 1NGWA 2ILLA 4K7FB 4LLUB 3BYTA 4DUVA 3MBEC 4QNPF 2ITDA 1F6LL 4WW2C 4MDIA 1DBBL 4LIQH 2ZNXA 3NBNA 1JF1B 4NQDE 1YQ2A 1OGAB 3X14A 4P4RA 4HWEH 3OXSA 3IDUA 3FN0H 1D5XA 4POYA 4GRMB 1KT2A 4U1LB 1IC5L 3HI5H 2CMRL 2AW2A 1N5YH 4OQ1A 1A9EB 3V79C 2FZ3B 3EYVA 1EHXA 4JFYA 4X8JB 3GSQB 2LU7A 1JZ8A 2A6DA 3V5HB 3VI3F 1GIGH 1IRAY 3IJHB 3K80A 5JW3H 5GHWH 2DD8L 5CEZH 1S7QA 4JE4B 4OZHE 5EOTB 3ZDXE 3TCLA 3PE9A 3G9AB 4O2CA 5HHQB 5FO8A 2VAAA 2HH0L 1CFQA 5C8JA 1EJ6A 2J8UF 2P45B 1TNNA 2A77H 1ZKAA 3BXNA 3OZ9L 1HDMA 4IDJL 3EOTL 1F02I 5DQDL 2HA1A 5MP6H 2RBLA 3BKYH 4FQXD 2YHGA 4FFWC 4JY6B 3ZE0F 2FIKA 2XWJB 3SGJA 3UDWC 5LXGL 5B39B 5ISZB 5D2LB 5KSAB 3TBYA 1S7TA 3FB7B 4IRZL 1VA9A 3ZKMC 4YXKH 4Y4HB 1P7HL 1JGDA 3S9DB 3VRLF 3ARXA 2HLFC 5DJ6A 1UA6H 4XXCA 3ET9F 3MLYH 3SBWC 3DI3B 4LAQL 1ZLUH 2A6JB 3A6OA 3VWJA 4HKXA 2JELH 4XCCH 1FBIL 3OKLA 4WI4A 2GAZA 5MI0B 3ZT7A 1RVFL 1KEGL 4Y19A 2C5DC 5C0BB 3EYQC 1DLHB 3SCMC 2EE9A 2F8VA 3K3QA 2DN7A 2A74A 4WFGD 1R3IH 2V7HB 2W59A 4MQTB 2QSVA 2QBWA 2XZQL 4JFOA 5EU5A 3QWOA 2CDGA 3N50A 5DR5H 1BD2B 5BS0E 1AJ7H 5I1DB 3JTSB 3WNLA 4HWBA 4L3ED 4X7EC 1W8OA 5JHLH 5HDOA 5EUKA 3THML 1DBJL 3FB6A 1WIOA 3ARBD 4XCFH 1DFBL 1U8JA 5IM7A 2BVEA 5HGAA 4G8IA 4GW1A 1RZFL 2R56L 5FM5M 4S1DC 3PABA 1QSFB 1HH6A 1MJ7H 1U95A 4CADB 4K8RH 1T2QH 4Z5RB 1NDMA 1L6ZA 4PJ8C 2CR6A 1CDJA 3GSXA 3MA9L 3GO1L 2E27L 1DJSA 5IK3A 1VESA 5E4IA 4NNXA 2KL6A 4UUJA 1C5DA 4RWYL 4MVBC 1OT1A 5CJ5A 4YK4C 1CGXA 5SX4H 5TE4L 3KPRD 1HHGA 2A38A 4U7SA 3GSOA 3MCG1 3V6OE 3K8KA 1YJDL 5HSFA 3NIDF 4PV8B 1S9WB 5EBWA 4M93B 3H2WA 4Z0BH 1K2DB 2AKRB 4AH2A 2YUZA 3FN0L 4NC1E 5FV2A 4K3JH 5IVXF 1M05A 1R5WB 1OLZA 2HFFB 3ULSB 1DDHB 2J8OA 3BESR 1AXSA 5E70A 4E42A 3SKNB 5D6CA 5FM5O 5MEOB 4GW5B 1QBLL 5GPRA 5I0DA 4MD4A 1QFWI 4MA3A 1HIML 3P9LA 3VXUD 1YPZB 1UFUA 2YK1H 2LVCA 3QP3A 4GLRH 4LU5H 4APQD 2VR5A 3P0VH 5HTSA 2VLKE 5CEZL 1QR4A 3ARDB 3L5WB 4Y2DC 2ZKHH 5KG9B 4HIIB 3SDDB 5JUEL 3V6ZA 1FYTB 8FABA 1ZVYA 1OPGH 2JCCE 2IGFH 5BJTB 3W11D 2FHFA 3FQXB 3NZHH 3WFHB 5DMKB 3VD7A 2NY0B 4PJFF 3EO9L 2O5ZL 5DJ0A 2X5PA 2A77L 3VA2C 2GCYA 2NZIA 3IDNB 3VXNA 1YEIH 1XF5A 4U31A 4YE4H 1F4YH 1JRHI 1TPXB 2P8MA 4QRSA 1UADC 3MRDA 2VMFA 4L9LC 1JWUA 4FMKA 2NY1B 4OUOA 3FB5B 2ZSVB 1CGSH 2AVGA 4LPYA 1RMFL 1ZHBB 4QOKB 3L5JA 1F6FB 4D0BA 4K2UL 5CILL 2IH1A 3O6KL 1F3DH 3FQTA 3UTOA 3CC5A 5KS9E 1NGYB 3QO0B 4XB7A 2I07B 2XWBB 3RHWK 4YXKL 4FTVA 2EDWA 4PJCA 2AAVA 4N0FB 5HVGB 5GISL 1HWHB 3TT3H 1GZQA 1LMKA 1ZSDA 3LVEA 5DTFA 3T0WA 3MLYL 3SKJL 3I50L 4IOSD 2GITA 3NA9L 3WO3B 3IVKB 1BQUA 1KJVA 4XBGB 1WZMA 2M8XA 4XCEB 4ONHB 4OV5A 3QXVA 5HI4D 3ULUE 5GRJL 3LS4H 1AR2A 3SDAC 4OFIA 4RMRA 3NCYS 3D1MC 4KMQA 1YEKH 1C7SA 3GSWA 5CJQH 1JYWA 5E95B 4PJDF 4M7LH 4ZUWB 4QRRA 1AH1A 3P73B 2H2PC 4R2GB 1RUPL 4JB9H 3W82A 3QDHA 1OTSC 3W9EB 1A3RH 1SJEA 1AJ7L 3DV4A 2W9DH 4FQCH 4QXTB 2COQA 5JHLL 5M7QA 4YQXH 3TO4A 2DMKA 1NBZA 5E5UB 1FG9C 4F15B 4N9OB 2Q86B 4JFEA 4LEXH 1MVFA 5IFAH 4Y4FC 3PXHA 4QKXB 5E2VH 4Q2ZA 4YHNA 4M5ZL 1YQVL 1G6RH 1MJ7L 4K8RL 1T2QL 1IC4L 4PP1C 3O4LD 1KF9B 4HSQA 1HZHH 4NDMA 1AGDA 4NO3B 5A3IC 1TZHB 2CRYA 4Y5VA 3PJSA 4JN2A 2X4UB 3HE6D 3G9VA 3D18A 2VLLA 4TVPE 2BNQA 1NAMA 2A9NH 3PQYD 3S3JA 1MLCA 5IMOB 1UQSA 1T1YB 3FL7A 1TTUA 4Z0BL 1HXMA 1WZ1L 2Q87A 3WDJA 1LP9E 3FFDA 4U0QB 1D5MA 1BQLL 3W81A 5BV7L 1XH3A 5KANG 5CJXA 5KN5B 4OGYL 4JO1H 1A4KA 2EEAA 3O6FC 4L4TE 1D5IL 1D9KD 4W68A 1OAXH 2X4NA 1X5GA 4I18B 4WY7H 1XFPA 4PJAE 3O9WB 1NCBL 2YK1L 5J6HB 3P3YA 3B43A 2KQNA 4H1LA 5DFVD 2FL5B 3IDMB 5DQ9B 3TNNB 4KZEH 3P0VL 1FPTH 4YDKH 5AZEH 5MEPB 1IAKA 1EEQA 3QAZC 4OM0H 4DGIH 2Q3AA 3GMMB 4LMQE 1XGUB 4S2SA 2DI8A 1OPGL 2IGFL 1QOKA 1VFMA 4ZAKD 3G6JA 4RZCA 4MXVF 3RUGE 4NRZA 5D7JA 3QPQD 4PV9B 3BYYA 3N1GC 4DJMA 3MV9D 4Q9QL 3DRQB 3J7HA 4HGWB 5KVEH 4X7TB 4YR6B 1CGWA 4HC1A 1YEIL 4HGMA 3RVXC 1XF4A 3T0AA 1J12A 4IS6B 1H3PH 3VWKB 2QHLA 2X4TB 5D1ZA 3TFKC 3U4AA 5BRZA 4L1DA 1FGNL 2N7AA 1S9XA 4JM4H 5K9QI 3H9HB 3QNXA 4TRPL 2XPGB 5EOQH 3DO7B 3BE1H 4HULB 5T5FL 2F53A 1IAIH 3C6SB 4NHUA 1SEBA 5ITBH 4C54A 4HK0B 3G04B 3KWWB 2DAVA 5IIEB 2C9AA 3TT3L 2EIDA 4FZ8L 1U8HB 2GTWA 5EO9B 1X5XA 2FO1A 5EZLA 5TDNB 5H94A 3S4SB 1DBML 4YBLC 5A2FA 1XF2A 2IH3A 5GS0C 1NKOA 3WJJC 1A14H 1OB1B 3LS4L 4LSSH 5IR1B 2OSLA 5SWZE 4JZOB 5GSVB 4C4KT 2XQBH 3FRPA 8CGTA 5I76B 3NVQA 4FMFA 1YMMA 4M7LL 4HUNB 1D5ZA 3C5JB 3ZLQC 4XMLL 4JB9L 2W9DL 3OL2A 4JDVB 3IDGB 4KKAD 4YQXL 3WNMA 1AQDA 2X4QA 3CPLA 3TYFA 3O6MH 2H26A 4CAGA 1TJGH 5FCUL 5IFAL 2DTSA 3BZDA 5JXEC 1FNGA 4QHKI 1MJ8L 5E2VL 5HHME 3WDHA 2G75A 2A83B 4X6FB 4PGEB 1G6RL 1EAPA 3IGAB 4AIZB 4GRWH 2IAMD 1ZVHA 2MFNA 1NC2A 1BM3L 1U92B 4YZFE 4WU5A 1H3VA 4UTBH 4UU9A 4F7PA 2OLDA 1W0WA 3EJZC 3FFCE 3PWJA 3GMNA 2R1YA 1J0KA 1WISA 5D1QD 1ITCA 5HYFA 3MV8B 3ZL4H 5IB3B 2C1OA 5GGRA 4U6XB 1EO5A 4XHJC 3C6LC 5E9DA 4ZUTA 4WVRA 4ZYKB 3QFJE 5IVNA 4GW4B 5EZOH 5L8KB 2BMKA 1E4XL 2P4AB 5DUBA 1S8DB 3HZVB 2DL9A 2VXQH 3U0PA 3KJ6L 2D0HA 3QXTA 2NZ9C 2VZVA 1S7WA 4N0UB 4ZUVB 2IFFH 2DLIA 4PY7B 5GGUB 4U1SA 1AR1C 3BKMH 4FQXB 3U46B 4IBLT 3O2VH 2JJSA 2QQLL 3SE9L 3VRIA 3TPUA 5JW5A 2HYMA 3OKYA 5FYJD 4OZGB 5JOPD 1Z5LB 4CN1A 5I1HL 2AK4E 5DHXB 2QTEA 2YD4A 4UZGA 3T0XA 5KJRH 1JCKA 4NJAH 4RFNC 4TNWK 3CH8A 4KZEL 4IRSA 4JKWA 1FPTL 4LLVB 3LPWA 4YDKL 2E7HA 1IAMA 1MCDA 4OM0L 3G6AA 2CD0A 1MREL 4DGIL 4MDJA 5MENA 4X7CC 4LSQL 4PJ9D 4LRIC 3O4OC 3U4EA 3O8XA 5CD3A 3EDFA 2BNRD 4H26A 2XN9D 3GJEA 1WBYB 1MNUL 2GHWB 4WUUD 3BIKA 1WZLA 2R2HA 1X5JA 1G7MA 2PO6A 4PJ7A 2A9MH 1FO0B 1H3PL 4C57C 3A0OA 4TQEH 3TCXA 3U7WH 2HJFB 2D9CA 4P46C 1FAIH 1G7JA 4TUJA 2VLRD 1U91A 4ZOCA 5GS1B 4WU7B 5HGBB 5EU6E 1CDYA 2E7LC 2FYYA 5F1IB 3BE1L 1QRKA 2FH6A 2R1WA 1NSNH 4L3EB 1IAIL 2D9QB 5FDWB 1P1ZB 3ARBB 3F7PC 2VE6A 3PDDA 3IAGC 5JW4R 1F58H 2YC1A 3RWFB 2EDOA 1AI1H 5LWYL 2IPKB 3C60B 1RK0A 1KN4H 4YLQT 1NCAH 5DJZA 3TJHC 3N1FC 3EGSB 1MIML 3BWAA 3WN5A 3RWCB 3IF1B 5F8QC 1I8MA 3F12A 2R2BA 4MZ3A 3HPJA 4HF5L 4YC2C 5HGGS 3KPNB 4DW2H 2XQBL 3DSFH 2MMXA 1EIBA 3DX7B 3KPRB 4CBPA 4LCCA 1ED3A 5DGQA 2VITB 1RIUH 1OL0A 2XNAA 3FT2A 5IW6A 3F5WB 5GIRA 4YNYA 3ZYIA 5DRWB 2ICWB 1YPZF 5HJ3B 3D5OF 2PYED 3O6ML 2ZCHH 1NUGA 4HKJB 5I2IA 3Q3GA 3STZB 3WFZA 4J3OC 1BX2A 1CTOA 4K23H 4RWHA 3WIFA 2YZ1A 1Q9KA 1XT5A 2HVKA 3D85D 2OP4H 4G6MH 4PB9L 4JZJB 1GGIH 3BEWA 3RBGA 4FP8H 3LV3A 1G7PB 2RFXB 4IIQB 3VXUB 3I3BA 1OAYL 5C0JA 2YWZA 1ES0B 3RWDB 5HYSB 1NCDH 1NBYA 3TYGH 3SKMB 3VXTB 4JZNA 4APQB 3CLFL 5EBMB 1BWMA 3ZL4L 5T1LA 1NMCC 5B3JF 2K1MA 3VXPA 5F9OL 5TPWH 5DRZB 1KJMB 3C5ZA 4PBVC 4L8BB 5J3HC 3PWVB 1F8TH 3QHTC 4M6AA 4ELKA 2QQKH 4JVWA 5ACZA 3FHQA 2PTTB 2VXQL 4G8GE 4HHAB 1R5IA 3TIDB 4ELME 4AIOA 4PJ5D 3O2VL 1MH5A 1VCAA 4LCYA 4Q9BA 4YXLH 1OGTB 1NAKH 4MJ5B 5KJRL 4WW1A 2Q76A 1I1YB 2VXTH 4NJAL 4X5WA 2Z93B 4B41A 5IB1A 1ZWIB 5F9DC 2X9XA 4A2LA 2DKSA 2EYTA 5F3BB 3QI9D 5E2WH 2J7LA 5EO0A 2FWOA 1HQRA 1RFDL 3FN9A 1P53A 5CCKH 4XX1G 2ZUXA 3MOAH 3QEHA 1H15A 4HK3N 1CICC 4NT6B 4P2RA 1QSEE 4MJ6B 4AQOA 4PRHA 1J05A 4LKXA 5DLMH 2A9ML 2YRZA 3MYJB 4DEPC 3CFIC 2ADJB 4LPCA 1KCSH 3OJDA 3F65A 5H35B 5JPNB 1FAIL 2GK0B 1KXQE 5C0CA 1FNSL 3O2WH 3DUUB 4LCWE 5CMAB 3Q5TA 3DGCR 1MFEH 1NSNL 1IGTA 2X41A 1T66D 4HPYH 5J11C 4AEFA 4BFBD 4JRXE 4TVSa 1NCCL 4UIMA 4MWFA 1F58L 4JR9L 1AGCB 3QXDB 3FOLB 2BSRA 3VFNA 1NCAL 3EO1A 4TSAL 1MEXH 4PJBA 3MV7A 2AGJH 5D7LE 1YEDB 5F1OB 4DTGL 3V5DA 3UYOD 2C1PA 4JO4H 1TJHH 3L3GB 1OW0C 3HE6B 5DD6A 5JOFB 3CJJA 1LE5A 1JF6A 3QIWC 2R39A 3P2TA 3LEVL 2R29H 1BJ8A 3D9AH 3T65B 4GKNB 5DHVB 1ACYH 2DQJH 4MQ7A 3KNBB 3KPSE 3HE7C 3LN5B 4GXVL 1JI1A 2VDQH 4GFTB 3H3KA 4MHHG 1KPRB 1UJTA 4G9DA 1D9KB 1CDUA 4NO0A 4Z76A 4QHNB 2OP4L 1YY9C 1GGIL 4HIEB 5JO5B 3HI1A 1I8LC 2XXCB 1PLGH 2DM4A 2O93L 2H3NA 4PG9B 3UXFA 1F4WH 3CXHK 3TYGL 1IT9H 1KCKA 3TBVB 2CSPA 3C8KB 5C0EA 1YEGH 1JIBA 2GI7A 2D0FA 1Q8MA 4WFEE 5DI8A 1MRCH 1X4ZA 2HTKD 4ZAKB 5DSCA 1R3KA 4ZPVA 1A21A 2PKDA 1F8TL 4JQXC 1OM3H 2QQKL 5E99H 2A73A 3L6FA 3MV9B 1U8MA 5IHBA 4ETYA 2W0LA 3GMPA 3B2UD 1XCTB 4KUCF 4MAYA 1MWAL 3LEXA 1OAUH 4ZNCD 1R3LA 5EFIA 3T0BA 4F58L 4JDTL 5EO1B 2W0KA 1AC6A 1XGYH 3LSOA 5FOBB 1NAKL 2IPUG 3F7VA 4P2QA 4PJIB 3SDXB 3WDIA 3ZKSD 3PDGA 2XKUA 2FX8L 1MCNA 3QHZH 3ULUH 3KYKH 4N9GB 3VGAB 4KROD 1HNFA 2HRLA 4W81A 2NX5B 5A2LH 3MRPB 4FXLA 1A6WH 1P5VA 3RNQB 4E41D 1B0GB 3MODH 5DURB 2H8PA 1YY8A 2P47B 4HFWA 4UT9L 5EU3B 3T2PA 5BMFL 3RWIB 1V5JA 3MOAL 1RU9H 4I3SL 1LQSR 2BVQB 5F71A 1F6AA 1G7QB 4ODUA 3QCUL 1MCOH 3BKCH 5EN2A 1WFNA 1CCZA 5EC1A 5DLML 4RRPG 3O4LA 4JG1H 1RUKH 1URLA 5EA0H 3EYOA 3RX8A 1JTTA 2XTLA 2Z92B 1N0LA 1D5BB 3X3GL 2Z31A 4QCIA 1F5WA 3PL6A 1BZ7B 4S10A 4KJPC 4M6NH 5IWLC 3WUWG 4OZFH 3IJSB 1EEZB 5F70A 1VHPA 1XMWA 4X7FC 1EJOL 5DXWA 4XC1H 3IXAA 4ONGH 2X4SA 3CNKA 3CXDH 3FT4B 3WJLC 1T7ZA 5I16B 3U9PH 5D2NB 3QUYD 2FEEI 3RWGA 3IDJA 3ROLB 4TVPH 4K3HA 1IE5A 4LSPL 1BJ1J 5B38B 4N8CH 3JV5A 4XTRD 4G80B 3T0EE 4M02A 1XR9A 3VXRD 2IAMB 2MKWA 4C56A 3UPCA 4X6DA 5IW3A 4U1HA 1TJHL 5DMGC 3BJLA 4I5BA 1K4CA 2XICA 3X14B 4X98A 2NYYC 5LAXB 1FL6A 5C08E 1D5XB 5D1QB 5HVHB 1IZJA 1KT2B 5DD3H 5IFJB 1G6RA 2XACC 1ROWA 4OCWH 1KJ2B 3MBED 4OZGF 3U0TA 1VFBB 5F9JA 3KPQB 2GJ6D 2VDQL 2VLME 3MXWH 2NTFA 3GMLA 4JGJA 2VXSL 3V0VB 3REWB 2BZDA 5GGTL 1RZJL 5CJBA 3WFBH 3KLSA 3S8WA 5EOCJ 1CLOH 4KXZH 5FA4B 4OF0A 2NTSP 5MHSE 4O2CB 1CFVH 1ZT1B 1Z9MA 1IT9L 4S11A 3RY5A 1G9NC 1XGTA 2MHAB 1H8OA 2ATKB 3D0LB 1YEGL 3FCTB 3R8QA 1C08A 1LVEA 3SO3B 3RP1A 5DC0A 4Z95H 1MRCL 1HDMB 2ZG3A 3BDYH 2DI7A 3WO4C 3N06B 4BQ6A 4F33A 2XKSA 3CVHH 5I9QB 3D3VD 2ERJC 4PJ9B 5CIPB 4KVNH 3BP5B 3L7EA 4FG6C 2BNRB 2Z35B 3CX5J 1AGBB 2DM2A 2P24A 5E99L 3OKKA 1TIUA 2VH5L 1DQLL 1MCWW 1ZA3A 2Y07H 1E27A 3P77B 1KENH 1OAUL 2PW2A 1L0YA 3QUMB 1TETL 3EUUA 1S9YA 1PX4A 4S1QL 5SWSE 2ZUVA 4I2XE 1NGZB 3OGOE 4HQQH 4L4VE 4Q6YA 2VLRB 1T4KB 1OTUC 1TITA 1OAKH 2NY2C 3JBG7 4F57H 3E0GA 5GJTH 2B4CC 1JE6A 3VJ6B 4X4YB 4NHCH 1Q38A 4FFWD 4OT1H 3RJQB 4WHDA 2WUCH 2Z4QA 3VWJB 3QHZL 3ULUL 3KYKL 3HNSL 3IFNL 2JIXA 4I1NB 3MGAA 1A6WL 1FLRL 3ILPB 4MNQA 2A6KB 4G5ZH 4H25B 4AMKL 2DQGH 3VFWA 4A6YH 4HH9B 3HTLX 1QVOA 1HHIA 1UM5L 4KV5F 3ZKMD 5KAQG 4PGDB 3JVGA 3TNMA 2HLFD 3GBMH 4JFOB 1PBYA 3U0WH 1M7IB 1KB9K 4NYLB 4LBEA 3CH1B 4JG1L 3BVNA 4BSWB 3PP4H 5HVWA 1U8NA 3SOBH 4UDTA 5EA0L 4IJ3B 4NC2B 4I77H 5DJYA 1OP5H 4AYFA 3RZCC 1B4JH 4MNHA 4Z7VA 2ITCA 4XPBH 1CDIA 2ZUQC 3HUJA 3EOAB 4G8IB 4LK4A 4LL9A 3I02B 3EYQD 2ICEA 4M6NL 4HEPG 3SCMD 2WWMC 2Z0BA 5ICZB 3L5XH 4XC1L 1UENA 2ZOKB 4RAUA 3KXFA 4GG6A 1TTGA 3EKCA 5B22A 3GSXB 3U9PL 4PJXA 5DK3A 4S1SL 3BRGC 3QZWB 2HFEA 4TVPL 2IALB 5F1NA 1K5NB 1ORQB 4PTUA 43CAB 2VUYA 3TJEH 1CT8A 3LRSB 4PTTB 4S1DD 4BSVB 4JRWA 3LN4B 3W0WA 1KBGH 2VDMH 5CWSA 2CDFB 3G6DH 5FK9A 1FL3A 4PJ8D 1KV3A 4WFFE 1MLBA 3L95B 4HZAA 2FD6H 2OL3B 4QHLB 5DD3L 4HS8L 1A4JB 4MVBD 5GGSA 4OFYD 5JNYB 1OSZA 4OCWL 1AQKH 5SX5K 5I74B 5D6CB 2XYCA 4QTHB 4B5EA 4OSUH 4P2OA 4HKBA 5E08H 3CSYB 3DO3A 2QL1A 2VDKH 5LGJB 4XBPA 3FKUS 4FNLL 4OD3H 4PJ5B 1WEJH 4WUUA 5HYQB 3WFBL 2AXGB 5CEXA 3M1BB 2KH2B 4X6CB 2YRLA 2X70B 4J3VA 2VABA 1CLOL 1U3HC 5E7FA 5IJKC 1CFVL 4QNPE 3F6LA 3GMOB 4XC3H 5FYLH 3VXSB 5FO7B 4YIQA 4HDIA 4G42B 1OAQL 4C55A 2DBLH 3GMQA 4Z95L 1HYRC 3HC0A 2YPKB 5HDBF 3RI5K 4KTDH 3S7GA 3CVHL 1OHQA 3SDYH 4Y2DD 2P8MB 4OCRH 4Z78B 2VL4A 3X3FH 2P5ED 2VKXA 2Y07L 1X4XA 1QPPA 5H37G 1P2CB 4D0BB 1I1FB 1KENL 4OLYH 3VI3E 1WC7A 2YD6A 3AREC 4RNRA 1JMXA 1I9IL 1FG2B 1T89A 4PYHA 4QRPA 4F57L 4XNMA 5GJTL 2XT1B 3UTTE 2O61A 3P4LA 4B53A 5J12B 1X5FA 4NHCL 2BDNH 4HUWA 2R0ZH 2GITB 1IQDB 1TVHA 4G6KH 2L0DA 3E6HA 4Y5XB 1AD0B 3QUXA 1FFNB 4AZ8A 4CNIA 4GBXA 4XRCA 4OV5B 1T0NA 4GKZB 5JORA 2J8UE 1J18A 4G5ZL 5E6YA 5ESQA 3BZFA 3KPLB 4HX1A 2N4IA 3GI8H 3B9EA 5IUSA 3FO0L 4A6YL 5FYLD 5IQ7L 4G9FD 4PJHA 4RAHA 1YNTB 5AAMA 4F7TB 5INDB 2DQEH 3RVWC 3T2OA 5SWQB 5I73C 4F3FA 3U0WL 3ZE0E 4RGMC 1DVFC 1J9CT 4R8WH 3PP4L 2BFVH 3TIEB 1NFDA 4I77L 4K94C 2FJGB 4F9LA 1B4JL 1V3MA 4JFDE 4XCNA 4M6OH 1BFVH 1FNLA 2XWTA 3C8DA 2C3HA 1IGFL 1MFNA 3V6BR 3GJFH 1F45A 3VFOB 3SDAD 3L5XL 3VRLE 4ODHL 2H2PD 5GJSH 3VFMA 4G7YL 4MD5B 4XGZA 4JDZA 4NQDA 1OTSD 2BNUB 1A6TA 4R97C 4V1DD 4XVJL 5I6XB 1AFVL 3ZHLA 2X44D 3F58H 1I3VA 1ZHNB 4Y4FD 2ATPB 3TJEL 5C07E 4ENEC 4Q7DA 5C7XH 3REVA 2YD3A 1F2QA 3E2HC 5E8EA 3EHBC 1KIUA 2VDML 3G6DL 4YJZL 4PP1D 4ZS6C 1HXMB 4FXGB 3FFDB 4R4BA 3TWCH 4Y1AD 4RMTA 1X7QA 4LPTA 1FZOB 2FD6L 3H3PL 1ONQA 4GS7B 5A3ID 2B2XL 4PLOB 4PPTA 4M7ZB 4OZHA 4M7JH 3T77B 1AQKL 1U8OB 4PS4H 1IGJB 1BF2A 3OG6B 2Q1EA 7FABL 4ODWB 2FSEB 2HJKA 3O81A 1VPOL 2X9WA 4AM0B 2ADIB 4BH7B 3JV6B 4PJIF 1WK0A 4PG2A 5L2KD 1ADQH 5EZJA 4OD3L 3BQUA 4JO3H 3OG4B 1QRNE 2YKLH 4MJ4A 1S9KC 2V17L 5CGTA 2DDQH 3HAEG 4J2XA 1F97A 1GC1L 2FJFA 5CINH 3O6FD 1WVZA 3LY6A 4XC3L 4OLVH 4LQFH 3QSKB 5CSZA 2MQ0A 2HN7B 3JWOL 1MQ8A 1QBBA 3G5ZA 5D7JB 5IT2L 1CE6B 2DBLL 4KROB 5BVJA 1RJLA 2CLRA 4OGXH 4KTDL 1MWAA 1XF4B 1SYSA 1EUTA 2YUVA 4E41B 1QTYT 5IVXE 3V4VH 4OCRL 5D1ZB 2EIEA 3TZVA 3X3FL 3RPIA 2B5IB 2WLYA 3BMWA 4OLYL 3W5MA 2QHRH 5IHLB 3VXMA 5F7KC 2Z91B 3BDXA 5E8OB 1CLYL 3RVXD 3VFVA 5LCVL 1HKLL 5DFWH 3VRJB 3EYSH 4OCLC 4P23A 1AP2B 3V0AC 1SJHB 3QCVH 2GTWB 3TFKD 2R0ZL 1NCUA 2CKNA 4G6KL 1O0VA 7CGTA 5BS0A 3LKQA 5C09D 2WINB 3RY6C 3QUYB 4UV4H 3MLZL 3GI8L 4HMEA 5CP3A 5KSVB 1KIRA 1VGKB 5D1XA 4NO2B 3OX8A 1N2RB 2GFBA 3I6LE 1DEEB 1FFRA 5C2BH 4PJGB 1KB5L 2DQEL 1PKQB 1X5HA 1FZKB 2O5YH 3PWPE 5HI3C 3FTGB 2OZ4H 5K59F 2BFVL 4XZUA 1EH9A 2VZUA 4O2EA 1EFXA 1FDLH 4NO5A 4Y88A 1FAKT 1F11A 4WI3A 2X4QB 4YDVB 2KBGA 4OF6A 4LSUL 5GS0D 5DK0B 1JWMA 3GKZA 3RX5A 1QHPA 5JDSA 3SY0B 3V6OA 3ILQC 3LHPL 3QDGD 3MBEB 3MREB 1AGFB 4J8RB 5GJSL 1R0AH 4UT7L 5JPMA 4WW2B 4D9LH 4G6JH 3PV6A 1N0XL 3KYNB 2IJ0C 2GJ6B 4H0GA 2CIIB 2OK0H 2DLHA 3U30C 1AGEA 1FGVH 1NJ9A 1GL4B 2F54D 4R0LA 3PDOB 2NY4C 3M17B 3F58L 2R1YB 3CD4A 1YEJH 2FATH 3K81A 5DD1H 4QXUL 2Q6WB 2C1OB 3MRLA 5JXED 4NN5C 1E6JL 3LKOA 3MO1A 5F7DB 1YECH 3ARGA 4PJDE 3MLWL 2ESVD 2PTUA 3MBXH 1REIA 2YEZA 3MNZA 3TWCL 3MNWA 3MRIA 5T3XE 1UB6A 5E8DH 3T2QA 4W4OA 1UWEH 1XZ0B 3EJZD 5GGTA 1BLNA 4PS4L 5DVOA 4JN1H 3D3VB 2DJUA 1LGVA 1INDH 2CLZA 3BT2H 2WZPD 2JCCA 3I85A 3T1FA 4XHJD 3C6LD 4LFHD 3S98A 1EHNA 4KAQH 3HFMH 2J5LC 2YKLL 3KVQA 4X99A 1MVUA 3D25B 3QXWA 4Y4KC 4PGCB 3KR3H 2DDQL 4L8SC 5HPMB 1ZOXA 2QR0A 1AHWC 1WF5A 2NZ9D 2I9LB 4P5KB 4OLUL 1NFIA 2EO1A 4LHUD 2EDHA 4LQFL 1ZLWK 1AR1D 2JJTC 1X9QA 5IFHH 1G7LA 4ZSOE 4JKKA 4OCYH 2ZUWA 4OTXL 35C8L 3QJFA 2ZG1A 4HIHB 1JN6B 3O0RH 3ESUF 5KS9A 3NTCH 4K7PL 4NGHH 4YAQA 3BP4A 4ZQKA 3V4VL 1T7WA 5J7CC 1LNUA 4M8QB 1KN2H 4OCXH 5HGHB 3BGFC 4FZEH 1QYGH 25C8H 2LFGA 2Z8SA 4BZYA 1YN6B 4BK4A 1HEZA 1TPXC 5L6YH 3VXRA 4DVBB 4L8CB 1QACA 4H1LG 1IC1A 3GSUB 2V5YA 4LSRH 1FVCB 5D70H 3Q1SH 4QRTB 3ULVE 4P46D 4ETQB 2OMNA 3QJHA 4C4KO 1C5BH 4MXVE 3H7BA 3L1OL 2OTWA 3SPVA 4X6EA 2EE2A 5ICXB 3WN5B 2NXZC 5TF1H 4ODSL 2ICES 1HWGB 4NQED 5L2JB 3NN8B 3PGFH 2NCMA 4X0KA 2R2BB 5ERWA 1TQBC 2GY5A 1MSPA 5MEQB 3MC0A 1S9VA 1Q9OB 5FHBL 1BOYA 4RQQA 1XF3A 2O5YL 2R1XB 1N5AA 5IROA 1JYNA 4OZFA 5E6IA 1D3CA 4CW1A 4PJ8B 3TJHD 2MTPA 5K9OB 2P5WD 2DICA 2BRQA 1LD9B 3RGVC 1MI5D 2APWA 2EDJA 1INEL 1RJCA 4HBCL 5I0ZA 2R2CA 5FO9A 4X6CF 4RIRB 1PG7H 4TN9A 1Q9KB 4YK4B 4ZFFA 2DQCH 2X4OA 4KY1H 2MPAH 5DVNA 1IAOA 3TGXA 5DHYB 1PDKA 2ADGA 1U58A 4EI6B 3B9KC 2Q7NA 3V5KB 2DYPD 5ENWB 1NBYB 1U8PA 1OGAE 2PR4L 5DA4A 1UH3A 5AAWA 1FCCA 4CU7A 2C26A 1YEJL 1S3KH 1V7NL 2FATL 3BWUC 4ZG1A 4L4TA 1OT2A 1WFTA 1YECL 5C9KA 1C16B 3O2DL 3MBXL 4PJAA 1QA9A 3C5ZB 1E28B 5E8NB 4C59B 4DQOL 3NFNB 1YEFH 4ZFOL 1ZT4B 5E8DL 3O3UN 1UWEL 2VLJD 1CD1B 1T21B 2XTJE 4JN1L 1H8SA 3S3PA 3UDWA 4Y2DB 4LGSB 1INDL 1SM3L 3Q6FA 2P5EB 3RUGA 4WWKA 1HQ4A 4P3CH 5FGCB 3V6FA 3HFML 3UJIL 5J3HD 4X5WB 5J13C 4ONFL 3KR3L 4HIXH 1IEBA 2F8OA 4PREB 3SBWA 4GH7B 3EDJA 3BGMA 3O9WC 3CVHA 2FWOB 2ZCKH 2FO4A 3MFFB 4YDJB 1LO2H 4OIIH 4Z6AT 2ADFL 3QEHB 3RPKA 4OCYL 1A1OB 1JBJA 3KDMA 3GJFK 5KSBA 1YYML 2EH8H 3O0RL 4KK5C 1J1XH 5DJXB 4O9HL 3NTCL 2EIBA 2WV3A 2BVPB 3IETA 5ISZE 2HMIC 5HHPA 2J12B 5IVZB 1J1PH 2UYLA 4MB3A 1RZ8A 4GKOA 5E5MB 3MRMA 3SDCA 4HUMB 1H3TA 3H9ZA 1KN2L 4G9FB 4JJ5A 2NY5C 4FZEL 5JHDD 3VW3L 3L5HA 1DQQB 1QYGL 3RTQA 4GJTB 3S6CA 25C8L 1CICD 3RDTA 4PRID 3VWKC 3NIFF 1OOAA 3CFCL 5I15H 5SWZA 5F96L 1P7QD 1SVZA 4UIMB 5C0BE 1KCVH 1J0YA 4N1EA 1YC7A 5D72H 5CBEA 3RNKB 3MRHA 3SDAB 3FT3A 4HWUA 4JFQA 1FIGH 4A6YA 3QO1A 5DC4B 1T80A 3MGTA 5C0AD 3RFZC 3GHEH 1C5BL 3G5XB 4YHIA 3ZYJA 2AJZA 5TF1L 4WEUD 4KQ4H 1UZ8B 2EKSA 5ITFB 4V1DB 1WWBX 2BK8A 4RMUA 2IQAA 3CFJA 3BPCB 1LE5B 2JJUA 5EIQA 1S78C 3P4NB 4LLWB 1RIHH 2BSTB 4KDWA 5IHUH 3TBSA 1QSFE 2RCSL 3C8HA 1W0VA 1KNOA 4XP9H 4EN3A 3QXAA 2VXUH 4PBXA 9CGTA 1RHHB 5H2BB 1PGRB 3MUGB 5K9JH 4Y1AB 1IM3A 1RUMH 3FFCA 3ARFC 1PG7L 2B0SH 1SMOA 2DQCL 2DWEA 1YEEH 3QIWD 1ETZA 4P2YA 3CVIH 3QFJA 2WQRA 3TVMA 2XY2A 3D39D 5L2KB 4IEFB 4P57A 1G0YR 2X4PA 2AEPL 4POZC 1VGEH 3HE7D 1GGYA 1S3KL 1IGIH 1T83C 2VC2L 3U9UA 2VDLH 1LO4H 3MRRA 4NUJA 5D5MB 3VU2A 4FQQA 3LEYL 5F9AC 4LSVL 1I7UB 1YY9D 5DUPL 3M07A 5K9KA 2YSSB 3NH7H 1YPZE 5D71H 5FGBC 1RJYB 2BNQE 1EBAA 1VFUA 4JFHD 5CHNA 3FRUB 3QAZB 2UY7A 3BD4A 1R3JA 3BEVB 4RAVA 4D9RE 4NZRL 3LOWA 4JM2A 3BPNC 1FV1B 1FYTE 2ARJQ 4XPAL 5FYJU 2A6IB 2FX7L 2LE9A 3QULB 2VERN 5AG8A 1I7RA 1BEYH 5IESH 3S35H 4HIXL 3V4UH 4DCQB 3SGEH 1IM9D 1M6OB 1KACB 2ZCKL 4CVZB 4JRYD 1WJ3A 4DUXA 2H8PB 1K4DB 2CGRL 4PJGF 5IW1B 5C0GB 3FQNA 5B3JE 4OIIL 2AABH 2BJML 5EU6A 4MLIA 3OXRA 5IB4B 2HP4A 3GKWL 5EN2B 2EH8L 2AJVH 5C09B 1J1XL 2Z8RA 5EIVA 1CFTB 1ND0B 4R3SA 2UUDH 4JFPB 2G5BA 1U42A 2V2XB 3DPBA 5AD0B 3QHFH 5HHOA 1DBAH 3PL6B 5EPMA 1KELH 4LNVA 1I3GL 5C0FB 1IFHL 4WW2F 2OCFD 1VACA 1TZGH 4L3AA 4WNQB 3TO2A 2EDFA 3QEQD 3U36A 2AXFA 5I15L 4N0YH 4WJ5B 1NEZB 4H8WC 1KCVL 3PGCB 3RWGB 5BRZE 3IDJB 3O3DA 4B50A 2BSSB 3HA0A 4PRPD 4WV1C 1S7UA 3QDGB 3GHEL 4FS0A 1K8DB 1ZHKB 5CEYB 5KBNC 4AENB 4KJPD 3DJ9A 3S37H 1N8ZB 2IMMA 3NZ8A 5TQ0L 2IPTH 4HWZA 4J4PC 2F54B 3HPLB 3C60C 2HT4C 2J88L 1UC6A 2QADC 1A3LH 1EDQA 5FECB 3NFSH 2EDEA 1QLFB 4MJ2A 5IHUL 3GJFA 2Y1VA 4JY4A 1UJ3A 4P0DA 1MY5A 2GSGB 3TF7C 1G0XA 3J8F7 4MMZC 4WDIB 1NMBH 2X1OA 3CMOH 4NWTH 3VE0B 3BI9X 1FLTX 3CUPB 5I17A 1D6EA 1RUML 2HAZA 1J0JA 4Q6IC 2NTFB 4NPYA 1ZANH 5DMGD 3DHJA 3IJYA 2B0SL 3JSSA 1WBZB 2NYYD 4JPKH 5HHVL 1CE1H 4FQIH 4JANB 1YEEL 4NQSA 5DK2B 4QYOB 5CJ8A 3CVIL 5ID1B 2CXGA 3C6LB 5DJ2B 2BOBB 4OAWB 1R5VA 1JNNL 3MGOA 1EHAA 2DI9A 3N0PB 4G8GA 3I6KB 1RK1A 2OR9H 5KW9H 1OWWA 1A22B 1GOGA 2B4CH 4JZJC 1LO4L 3GIVB 1I7ZA 2WBWB 3BISA 2F5AH 3DTXB 4NKOB 1E4XI 3DV6A 3JWDC 2C3VB 3SE4C 2K9UA 4C83B 2E9JA 4LHUB 1EEYA 3VFTA 3T4YA 1WWCA 5HYJD 1UM4L 5BW7C 3TH2T 3L3IA 4OF3A 3EYFB 3EJYC 4X4ME 4YH6A 4OIAA 2R0WH 1T20A 5D71L 5E94A 3DX6B 4RFNB 3VD9A 3GGWA 2EYRA 4HGKC 4XMKH 3KYOB 1GPOH 5EULV 1GZPB 5E9DE 3VDBA 5HI5C 1HH9B 3R8BB 2YBRB 5KSBF 2CRMA 4HXAL 1LEIB 4NRXB 1VSCA 3O4OB 2Z8WC 2D2OA 4WFHD 3U1SH 1EA9C 3KPMB 4O02L 4PUBL 1SJVA 3QDMA 4FG6D 2AEIT 1ZEAH 5EZIL 1BEYL 5IESL 3S35L 3V4UL 1KCUH 1T04B 4YPGA 4LKCB 2ZSWA 1PSKH 2V2TA 4JKPL 1S7SB 1CL7L 3VH8A 4P49A 1UVQB 2VDPH 2VAJA 4P46B 1Y6MR 2F58H 2H32H 4LCWA 1OTUD 2NY2D 1IARB 5EU7E 4YHOH 2FGWH 4YGAB 5DDHB 1I9EA 2AK1L 1MHHB 1GH7A 4JRXA 1M7XA 4MNHB 4U7MA 4Y16A 1QBMH 2IG2H 1DBAL 1FJ1B 1HCVA 1KELL 1KLUA 1FORH 2P48B 5E7BA 4F7CA 5J1TC 4KHTH 4KI1A 1TZGL 4GG6B 1A0QL 1NLDH 5SV4A 5ESVA 1UB5A 2BRRH 2ESVA 3VFUA 2WWKT 4PJXB 5DF0A 3QNZA 3ROOA 4CU6A 2IAND 3AU1A 3RU8L 1M7DB 2HFEB 2HKHH 1EO7A 3U7YH 1YN7A 3RZCD 3VD3A 4YC2B 1CZ8H 1JL8A 4U1MA 5EU4A 1F3JB 3GUTA 4ZD3H 4JQVC 4HJJH 4HS3B 4WI8A 1NGXA 5M95B 3S37L 1ZTXH 4CMMB 2OZ4A 5ALBH 2WWMD 3G5VB 2DYPB 2VSCA 6FABH 4HG4K 1MRFL 1YMHA 4I13B 4O2FA 1A7PH 2EDDA 4P5MA 2NW3B 5BZWA 2G2RA 1H5BA 1Y6KR 3TEUA 1Q0XH 3NACL 4DKDC 4P3WA 4L5FL 3NFSL 1KC5H 3SGKC 2XA8L 4GUPB 1T3FB 1NDGB 4GRLC 1HHJB 1RQ5A 3NFPB 4XMPH 1JGEB 4HPOH 4U6YB 4WHTB 3OHXA 1ZANL 2VLJB 4LHQB 3AY4C 3EO0A 3HLAB 3ECBA 1ITBB 1KXTB 2ZUYA 5BOPA 1NC4A 1CE1L 3PWUB 2VDOH 2ZCLH 4NZTL 3STLB 1NMCB 4FABH 2VABB 1P4LB 4KK6C 3AAZB 2N1KA 5C6PB 5DRNA 1A1NA 5AZ2H 1JGUH 3PWLA 4DZ8B 4HDIB 4DUWA 1DQJB 4OLWL 5FCSH 5E8PA 3OR7B