3LH2L

Crystal structure of hiv epitope-scaffold 4e10_1vi7a_s0_002_n 4e10 fv complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
AEIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIYGASSRPSGVADRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGQSLSTFGQGTKVEVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4E10_1VI7A_S0_002_N (T88)
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Artificial gene
molecule tags Immune system
total genus 26
structure length 110
sequence length 110
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lh2L00
3B9KA 3WN5B 1TTUA 1KBGL 5EN2A 2MNUA 2BDNL 4WWKD 4QT5B 4GG6B 5AD0B 3MTRA 4TNVK 1IEBA 2EYSB 1ZEAL 5FM5O 2VUYA 3GMOA 3RVVD 5T1KA 2IQ9H 5GRYA 2VR4A 3E3QC 3BZDA 2RFXA 4X4YB 4YC2B 2WP3T 4YX2H 5DR5H 3U46B 1NGYA 4FQPA 4NM8H 1FG2A 3LAFA 4OQTA 4MQ7B 4L8SC 4P3CH 3NMEA 2VXUH 4PJEE 1F4YL 1IKNA 1A21A 3LQAH 3FQNA 5E6IC 4YO0B 3FN0H 1X6LA 1DBMH 1EUTA 4NRYA 2XTLA 4GMTH 1TNMA 3IDMB 4XHJD 4LCYA 5JXAL 3HZKA 3GSNA 1HKFA 2FSEA 1AHWC 5DRZA 1IZKA 1A14H 5BQ7B 1QFOA 1GSMA 1WITA 2ADJA 3W9DA 3MMEA 3UC0H 4JQVA 3OF6A 2PYFB 3IFOA 3V6BR 4KVNH 5KW9H 4ODSH 4HIJA 1MH5A 2CMRH 1UKSA 5ECJE 1D6VH 4QRQA 2IAND 3BW9A 5GZND 3CAFA 3V5HA 5C08A 1G9NH 3FHQA 4NPYB 1YEKH 4OKDA 4FFWC 3CLEL 3LRSA 3KPTA 4TUJB 1QA9A 4LARH 3IDXH 4F7PA 3WIFA 3WXVL 4TUKL 1HK6A 3ZKMC 3TO2B 3F7RA 2Z4QB 3QQ3B 3QPQD 3WJJA 5JHLH 4KJWC 2EDWA 2FL5B 5SX4I 3VFGH 4LSVL 4UAOC 4PG2C 4HWZB 3GGWB 1GIGH 4EOWL 1TZIB 1YEIL 1TCMA 2EDHA 2VLRD 2VLJB 3SDXB 1IQDA 4DKEL 3FQUB 3RA7L 4OCXH 5IFAH 3VXQB 4JREB 3D39D 1WT5A 1KN2H 2HKHH 2R1XA 4I2XE 3VE0A 1RZKC 3RGVC 1E0OB 5FCUL 5I74C 4XCCH 5A3ID 5HGDB 3KPQB 2BSTA 3V4PL 5FHAH 4D9RD 4D94A 5DJ2B 1INEL 4YDVB 3KPNA 3MCKB 4ODTL 2HT4D 1M7IA 3DV4B 4KJPD 3FONB 3RWCA 4S2SB 2O61A 5C6WH 3JTTB 2EZ0C 4P3DB 1QKZH 5T1LA 2VDNH 4K3HA 4GW4B 4D9LL 1FNGB 3MLWH 3MXWH 1KIPA 4KKNA 5K9KB 2AXFB 1WBZA 4OCLC 2LTQB 4DKAA 2WM0A 5C8JB 4NQSA 3KYNB 1OP5H 1EGJA 2JCCF 5BV7C 4QRPB 5AEAA 2B0SL 1CLZH 4HJJL 5TGBB 2NY2D 1BF8A 1RIVH 3V7MA 2AVGA 4WW2A 1CXFA 3SE8H 5IMLA 1BPVA 4POUB 5FFLA 1EPFA 1NAMA 4JCMA 5CJOH 1RZ7H 5DT1H 2OR8A 4KK6D 2ICCA 4YDKL 4YHKL 4JFXB 3QHTC 5I71B 3F7PC 4K9EC 3WBDA 4H88H 4I3SL 3VFNA 3WNNA 4AT6A 5F9JB 2EDOA 1DDHA 5EO9A 4QOKA 3PL6D 4YE4L 2E27H 1QEWB 3DIFB 5D5MA 1D5MB 4FHBD 3MLSH 2NY3B 3TM6A 4X98A 1C5BL 5MP6H 4YDIH 1PX4A 1BFOA 3QWOA 2R4SH 4P2CG 4X4MA 2K1MA 4HZLB 3GIZH 1Q1JL 4JQXC 5LGJB 4JM2C 4HWUA 3NGBB 2NY0C 2B20A 3DWTA 1CD8A 4UV4L 2BHZA 2BVUA 1OP9A 2WWKO 5HHNB 3KLSA 2BXYA 1C12A 2NY4C 1D7FA 5IM7B 2IQAB 1MRFL 4XPFH 3I6KA 1ZLVH 1JZ8A 3WCYA 5K9JH 1WBYB 5JIIA 2PYEE 3BI9X 3PWLB 3QUYB 2ZUQB 3L5XH 2NX5D 2KKQA 1RVFL 4YHYC 2H6PA 4HWBA 4Y1AD 4Q2ZA 1I7ZA 5F7FA 2GJZB 2DB8A 2B4CC 1S8DB 3DARA 3P77A 3QJHB 1EEYB 2XKNA 2IG2H 1OM3L 2DBJA 2P24B 3SDXF 1TQCB 4M6OH 2Z9TA 2P4AB 4P5TA 2R0WL 4IOIB 4NN7B 4ERSL 2W1NA 3U4EA 5DHVB 2ESVB 5FYLE 3SGKC 3LMJH 3MV8A 1GGTA 5F88A 1SBSL 1FYTE 1CTOA 2NQCA 3GB7B 3U9PL 2PUQT 4M00A 2ORBL 2FHBA 2D0FA 5FM5M 4G7YH 4MJIB 4Y19A 2R0LH 2F54A 1BX2A 3TZVB 2VB5A 1R5IA 4JVPA 5LWYH 4PJFE 3MRCA 4FNLH 2Z93A 4TNVF 1UXSA 3REWB 3C08H 3NIGF 3CSPA 1CLYL 4YGVA 2H41A 4LSDA 8FABB 3G5XA 3MA9L 4FQLL 5IESL 1RHFA 2ITCA 4P5TC 2HLFC 2X4UB 3UTQB 4WI5A 4NQXA 2X9XA 3DGGA 4L8DB 1S7SB 1KTRL 2HT3D 4N90D 1BBJA 4PTTA 2W9LA 1B0GA 1WSST 1H8OA 2C7UA 3IT8D 1H8NA 5EZJB 4K3GA 3HE6A 1UM6L 4R8WH 1EHLH 1DBKL 5E2WL 3IDGA 4R2GC 3B6SA 4WI7A 2C3HA 3KS0J 4ZTOL 3LS5H 4D3CL 2D03H 4GSDH 3KPRD 1T1YB 2AXGB 1QBBA 4XPHH 2ICWJ 4HKXB 1FFPB 4AEIH 3FT4B 3NPSB 4B7LA 2VQ1B 4N8VB 4NC1E 3T3PF 2R4RL 4UUJA 5F93C 4HQQH 3GI8L 1BVZA 3EYVB 3TO4B 4YDLB 3KXFE 3PV6B 4YZFE 3HLAB 5IHBA 1RY7B 5L7XH 3NN8B 3O81A 1HIMH 4KRLB 3GSRB 3QHZH 4NN6B 1FGVL 1LQSR 1Z2KA 1U58A 4FQQA 1LK3H 1QR4A 1CFBA 2FR4B 1AD0B 2M2DA 4JZJB 1QPXA 1BJ8A 1T2QH 1AIFA 3CNKA 3C8KB 1RUMH 1ZHNA 4TULL 5D72L 1V3LA 3UAJD 4KZEH 4PJXB 1JRHH 4S1RL 3ZE0F 2W92A 5JQHC 5D7JB 1CD1B 1NC4B 3ZMRA 3S35L 3KLAB 5GJSL 4WTXA 4DCQA 1TETH 5IB5A 1OQOA 5ICYA 1W72H 2XA8L 4QRRB 1RMFL 2EC9U 3PE9A 3P0VL 4FZEL 5C0CE 2NPLX 4JM4L 1Q94A 3M17B 2WWMC 4FXKB 3IDJB 1ERNA 2NTFB 1A7RL 2R1YA 1EO8H 3BYYA 2G5RA 1JMXA 5GS2H 5FB8A 3MJGX 4UTAH 4LVNC 2DQJL 3QBTB 2EIEA 1YJDH 2W9DL 3L5WA 3FO2A 3O3AA 4OLUH 1UWEL 4DKFH 4KQ3H 5IJKA 3GK8L 3EHBD 2EO1A 5IG7A 4OQTL 4WI3A 2XZAH 4IRJD 3V6FB 2AJYH 5DVLA 1KJ3H 4FQJH 1CFTB 5SWQA 4LSUH 5DRNB 1YMMB 1A6UH 4OF5A 1I7RB 5DD3H 2B7DT 1U8MB 3MV7A 2BERA 2EIBA 4MA3A 1UZ8A 4MNQE 4M7JL 2Q6WB 2IGFL 1FORH 1MUJA 2IAMB 4K2UL 3VH8B 5GGVY 1L9MA 4EI5A 3EYSH 3GSNL 3B9VA 5DEGB 4OF6A 4ZDHB 4U49A 5EIQA 3VWKA 2P1YA 3WNLA 1ZSDB 4LLQB 3PIQB 2I9TA 1GAFH 5F72S 2A9NH 1FFNB 3TP4A 1ACZA 5GS1C 4NM4L 3SGJC 1NFIA 4G8IA 4XP5L 3EDKA 2Z92B 3VDBA 2D7TH 4NWTH 1H3TA 3UJTH 3QO1B 1TNNA 3X3FL 2D31A 3TH2T 4LCWB 2ATPA 1OSZB 3K2UH 1Q9OA 4OCWH 3VFTA 4KWUA 4L4VA 1C5CL 4BSJA 1DQJA 3FTGB 2N56A 4ZNEE 3BUYA 5GRXG 3WD5H 4JFZL 5DXWA 2P42B 1IEAB 2CR6A 1BQHB 5F1KC 3O2WL 2FWOA 5DVOA 4Q74A 4JPVH 5BV7L 4LEOA 5CUSL 1S7WA 4GKZA 2CKBH 2GITA 4JFDA 3TBSB 4NQDD 4L3EE 4TOYH 1JE6A 4XWGH 2YA0A 1EERB 5IHZB 3OXSA 3QIUD 5DZLA 2A83B 3W39A 3H42L 4ALAH 1B2WH 5MHSD 3AY4C 5HYJA 4CVZA 1BAFH 3EZJB 3DXAD 3IJSB 5JOPD 1MCOH 5FO7A 2ICEA 1I8LA 1XCQA 4QRSB 3HHRB 4YDJB 1A4JB 5GGRB 1GOHA 3OKOB 3MV9E 3IDYB 4QRUA 1NCDL 1WEJL 3CLFL 1ITCA 3PQYD 1NL0L 2Z31B 1ZT4A 1BWWA 1G7HA 1EGJL 2A0LC 2VE6A 3NTCH 3AS3A 4FQCL 2F5AH 1JWUB 2F19H 4ZUSA 1DZBA 1A6AB 2X5PA 3FB7B 3O6FD 3H9HB 4NC2B 2JJTA 2NY7L 1G6VK 3U36B 5IBLD 5IMMB 3LKRB 4EUPA 5JR1H 1H3WM 4NO3A 3MROA 4XVSH 1L4IA 4WVRA 1NAML 5C0JB 4PP1D 3GMPB 3ZTNL 5J3HD 3U4AA 2OL3A 5TPWH 1HEZB 4HPYH 4QHLA 4BQBA 3VMNA 5I15L 1ES0A 5T5NG 3O3BA 5D9SA 3BMVA 2Y6SC 4GXUM 3KPLB 3S7GA 3PABA 1A7NH 2ZNWA 1N2RB 3EYQD 2NY5H 4GAYB 3P4LA 1NGPH 5KG9B 3HAEB 1YY8A 2XIDA 4LKCA 5B8CB 1JVKA 2ZKHL 2VXTH 1OGTA 3QDAA 5MEND 3NIDF 4WHTB 4JGJA 1J05B 2R29L 1D5BA 4EJ1C 2F53A 1ITBB 4R4FL 1TVDA 1JZ4A 1DQDL 4UT7H 4AEHH 2HTLD 4PRPD 2HTKC 3DYPA 1EK3A 1TITA 1AP2B 2XWBA 3STLB 5GSRB 2F9BT 4EDXA 4LEXH 2XN9B 1T7VA 4F37K 3CFJA 3TT3H 1HCFX 1MWAA 3WDJA 1F3JB 3OR7A 1GOGA 4N8VG 2VITB 5L2KD 4NWUH 4JY4B 4PRHD 3R8BB 1D5XA 3BEWA 4GXUN 2AJSH 3NFSL 1KIRA 3SQOH 3X3GH 2FX7H 3PDOA 5D1ZD 4Z7VA 4HWBL 4B5EA 4PY7A 4RGNC 4LSPL 5MI0B 2MHAB 2YD1A 3NCJL 3EFDH 2XQYG 4XH2B 4BQ6A 2CXGA 1TIUA 2J6EH 3BPNB 4HJGB 4V1DB 2I9LB 3SO3C 5BS0E 1A6VL 3TN0D 3SPVB 4H20H 3FB8B 4PTUA 4RAVB 4XP1L 4M1DL 2R2HA 1OT1A 4YIQB 5JPNA 3VRLF 5CP3A 4U05A 1S7UA 1GPOH 4U1IA 3S9DB 1ZLSL 1HDMA 4OIIL 4LCIH 4QXGH 4RFNC 5T1MB 2HMID 3OAUL 1YYMH 1A7PL 2IWGA 4WWKC 5HY9A 2P5ED 1P7KA 4BYHA 4A2LA 4LMQI 1UB6B 3RVVC 3G6DH 4ZOEA 3TNNB 4ZUVB 3U2SA 4DVRL 5BRZD 3GSXA 3S34L 3BP4A 2UWEF 2ED9A 2IANA 2IJ0C 4UBDD 3MLVH 1S7RA 5I1KH 5C7XH 4ODBD 1X5YA 1CZ8H 4HSQA 5DJYB 5IVXA 2ZNXA 3IDIB 5T5FL 3NIGE 4ZUUB 4IJ3B 3RZCD 5HYQB 4JQIL 4RA0C 1KCRL 1WWAX 4U1LA 2FYYB 1PD6A 2GJ6D 3OL2A 1LEIA 4NZDA 5E1AA 5IQ9B 5J1AB 4XHJC 1FSKC 5IB3B 3RVTD 3MXVL 4EI6A 2BRRH 3VH8G 5GGSB 3D6GA 1JPTL 4RNRA 1QO3B 2ILLA 3DVNA 4PS4H 3FRPA 2VLRA 4Z7WA 1F8TH 4MA1C 3CX5K 1FAKT 5EO1B 5E5RB 4AZ8A 2C3XA 1DE4A 4WV1B 5CINH 1UENA 5H94B 4N1EA 3CFEB 4XC3L 2X4TA 1I1RA 1J7VR 4TUOA 1RUAH 3TT1L 2AEIT 3ROOA 5GZNC 4PGBB 3BGMB 3NAAH 3SDAD 4FQHA 1FVCA 3L9RA 5KANI 3I9GH 4AK1A 2LVEA 4JDZB 1GVIA 1KCSH 5DJAB 4EBQH 5DA0B 4W6XB 3QIBD 3T3PE 1AXSB 5DVMA 4OBRA 3SKMA 2EICA 5BXFA 3O2DA 3WFBL 3QPQC 4HF5L 2AK4D 2GW5A 4ETQA 4KKAD 1YEGH 4HV8B 1Z0MA 1QSFE 4NDMB 1MVUB 3RWDB 1MHEB 4BFIA 3BP5A 3P4NB 2FX9H 1T03L 3VXMA 2XXMB 1BQHG 1LEGB 1IFHH 1LE5B 3LEXB 2VO5A 1FZOB 3RKDD 1D5IL 4OF7A 1OF2A 4MQSB 2VDKH 3MGTA 3DX8B 4GBXA 5FF6B 1L0QA 1OY3B 4G8GE 3PGCB 1JGUL 4OFKA 1EAPB 3VGGA 2JELH 4IDJH 3T0DA 4HCRH 1Q0YL 1LK2B 1PKQE 4R3SB 3UDWA 3ZE0E 2YPLE 1F4WL 3L95A 4UILL 1UCBL 1SYSA 4HUUA 4PLJD 2HT4C 1HXYA 4KTDH 5B21A 4CUCA 5I30L 3ZZ1A 3HPLB 2PYEB 1OW0A 3SGEH 4F15B 5BO1H 1K8DA 25C8L 4GW1B 1NBVL 4L3AA 4NQCD 5EPMA 2UV3A 4PGDA 1WFUA 4UB0H 2VZVA 3RWIB 3BT2H 2G2RA 5DQDL 4P4KD 1A6WL 3PL6A 4P57A 1NKRA 1ZGLB 2QADD 1JF6A 1IEBB 2PTTB 1R5WB 2OX5A 4GKNA 2XZCH 3T1FB 5SWSE 3ES6A 1Y18B 2RFXB 4JO1L 5HHXH 2APWA 3PP4H 1OTUD 2NY2C 4FQ1H 4PB9H 1OAXH 3CK0H 3MJ6A 1I1YB 2M8XA 2GIYA 3BO8A 2NLJB 4JFYB 4X4XA 1AGFB 1FYTB 1A3RL 4HUXA 1KEGL 4HK3N 3V79C 4XNUH 5EU7C 3PHQB 4OCMC 5D96B 3RTQA 3ZTJG 1OW0C 2H1PH 2IBZX 4WHCA 2YK1L 4F58L 5D71L 3T0ED 3D87B 1U3HC 4KHXH 5E5MB 3NA9H 4LLYA 1Z9MA 3ARRA 4X99A 2DBLL 1JGLL 4RAUA 2NX5A 1B4RA 4FTVB 4TNWK 1U91A 4NNPH 4MCZA 4Y1AA 4HULB 4EDWH 1RJCA 5DUPL 4LP4A 3HAEG 5H37G 4OZHA 1Q9KB 5D4QA 3EOAB 1R3JB 1N3NA 2I5YH 4FQXD 1I7TA 3QXDA 2PR4L 3FQWA 3E0GA 3JVGA 3ULUL 4D0DB 4JKPH 1CLOL 3LEYH 4ELMB 1KJ2H 2CO6B 2X10A 4NHCL 4GJTB 5I76B 4WUKH 5C0AA 3HE7D 1OAUH 4LIQE 3GIVA 2WMPA 4F37F 2X4RB 5JA8B 3AREB 5C09E 5FHBH 2UYLB 4UT9L 1FVEA 4MJ6A 1L7IH 4FQ2L 2EH8L 4XCNB 5SWZD 3QPXH 3D1MC 4I18B 4LCUA 1IQDB 2Z8RA 1B90A 1CI5A 3D3VE 2FH8A 4AEFA 5FA4A 2R1XB 5TE6L 1MEXL 4ZQKB 3VFRA 3DX7B 3VXRE 2NXZB 1H15A 3LQAC 1T4KA 2D0GA 3LKSA 5I2IA 3QO0A 4MA7L 3DURA 2O61B 1OAZL 4WY7L 5C0BD 3PNWB 5GS3A 3QAZB 1KIPB 1OT2A 2ATKB 1WBZB 3K3QA 3WLBA 4KUZH 3VWJD 2FRGP 3STZB 1JTPA 1C16A 2OXHA 3MYZA 3U4BL 3MV11 2Y5EA 4HUKB 3EFFB 5F89A 4PB0L 2DTML 4XNZB 5DD1H 5DWUL 4DEPB 4R96B 4WU7B 2OL3L 4X80L 3FRUB 2DQIH 2YBRA 2E6JA 5D2NA 2DIAA 3PJSA 1RIHH 3ARDC 3ARXA 1G9NC 3L3KA 3W0WD 1BOGB 5FK9B 1J12A 3FQXA 2H2PD 5IMLB 3HG1E 5E08H 2C4FT 4ZUWA 4XCYB 1BF2A 2HFTA 5H2BB 3D18B 5J06A 3LDBB 3BPCB 2HT3C 1T1ZA 1SYVA 1PQZA 4PY8J 3BIBX 3QJFA 4LAQH 1M05A 3VGFA 4QXUL 2VXQL 2JB5H 5HVHB 15C8H 1RK0A 4Z7UA 3HMXH 4GS7B 4QOKB 4CMHC 1LO4L 3V5DA 1UM4L 2BK8A 3OQ3B 5E56A 2R69H 4P2RD 3BMWA 1S5IH 2VXVH 4NP4L 1OARL 4RRPG 3T2PA 3FOMB 4X98B 5F7EL 4HXBH 1NMBH 4X9IA 4OLYH 3CCHA 1L9NA 1IT9L 2XTJC 1MWAL 5D2NC 3P73A 4GLRH 3TJEH 1RK1A 2X4NA 5D7IA 2AJXH 1LE9A 1EEQA 3C6LB 3MZTA 1MCWW 1TPXB 2M1KA 2AV7A 2XWTA 3NVQA 1T0MA 2VLMD 1NCBH 1IBGL 4G42B 4TSAL 3QQ9D 3VW3L 3WIHH 4U1NA 1MIEL 2O5XH 1S9WA 4XXCC 4F9LA 1Q72H 5J6HB 1TQBC 4NO5A 4AH2B 3O9WB 4LFHD 4IRJA 5I1AA 4L9LC 3LV3A 5D70H 3UAJC 1G7MA 1JZ7A 3DUUA 4OZ4A 5TDNA 3OBAA 4OKVA 2ENYA 5T1DH 3BEVB 3W9EA 1JYVA 3TBVA 4YHNA 4OD2B 2MPAH 1YN7A 1XF4A 4UT6L 2DIBA 1SHMA 4P59H 5GS0H 1W0YT 2D0HA 4NIKB 4BUGA 3U4EB 1G6RH 3U83A 4RBPK 1AGCA 1TVBB 1DR9A 2VDLL 2OQJA 4Y19B 4Q9QL 2F54B 3QXVA 4XPTH 3KYMA 1KF9B 1XF5A 2UWEE 5FUOH 4B7IA 1WAAE 2Z93B 4X6FA 1MFAH 1UXSB 5FA3A 5F1OB 1EFXD 2ZJSH 4P5MA 4YPJA 3TCLB 4YGVB 5DMYA 3MLTA 5CZKA 3E2HB 1RURL 2ADGA 5E8NA 3ZKSD 3WYRA 3O4LD 4KGLA 1UACH 3K74B 1YUHB 1HXMA 2IPUK 3QUMB 4LPVA 3BWAB 3JV6B 1ZLUH 5T33L 4KV5F 1UM5H 3IFPA 4H25A 3L6FA 3KPMB 5E4EC 5EU6E 1BBJB 1WIOA 4YPGA 3H2WA 4WW2F 4PTTB 4X83A 4M4RA 5CGYD 3EJYD 1INQA 4NQDA 4JM2F 2O5YL 2ZCKL 5C71A 3AROA 3KS0H 3BP6B 2XY1A 3QIUA 4Z5RA 1CS6A 3B2UC 2IADB 3H9YA 4OI8A 3KYKL 4TNWF 2DWDB 3MJ8B 3I6GA 3VXSD 3MBED 1A9BB 4Q6IB 2VH5H 3CMOL 3G5VB 4PD4K 3GMQB 2BJML 3DXAA 3O2DL 1DBBL 4KTYA 5CHNA 2H9GA 1YEHH 2P46B 5D5MF 1G7QB 4N68A 3A6OA 3DMMD 3LEVH 3BHBA 3MRPB 1A7OH 1X5KA 1UYWL 3F7QA 1ZHBB 2I07A 2FEDD 2DM2A 3QCVH 2A73B 2G9HB 3O8XD 4PJGA 1Q9WA 3QXAB 3P11H 2X4PA 5D1XD 4JANB 2DQTH 2NW2A 3SDYL 3O6FA 3D0VA 7FABH 4OM1H 1AIFB 1NUGA 3QIUC 1PEWA 1DLFL 1ZHNB 3D9AH 3G5ZA 1NLDH 3FO9B 5IBUB 2OM5A 3CX2A 5LGHH 2OJZL 2IBZY 4NT6A 4R7NA 3MCLH 3B83A 4PJ8C 1VPOL 3QH3B 3MOAH 3U6RA 4L5FH 1Q94B 4JHWL 4ZD3L 5DUBB 1KGCD 1DBJH 1KPUB 1NFKA 5HGBA 1U8QA 1G84A 5JHDD 5MENA 3BPOB 1CE6A 1KELL 3FO2B 2H26B 1F13A 2XA3A 4RA3A 4KH2A 3O6FC 4PGEB 2W0LA 5IBLC 5IB2A 5JW3H 1EEUA 3TBYA 5CJXC 4OUOA 5KBNC 3VFPB 4NSKB 5SWQB 5JZ7D 4I0PD 4P48A 5J3HC 1R24A 2QJDA 3LS4L 3OHXA 4EQ3A 5CEZH 4JRWA 1DN0B 3VG9B 4LOUD 5I19L 4J4PD 5AYUH 5KSBB 1T0NA 2D4FA 4EI5B 1ZT1B 5I1CL 4LF3B 5CBEA 1W72A 3CVHA 4PYGA 1T0PB 1IGFH 4MD0B 1DQMH 5D1ZA 1ACYH 2DLIA 2LVCA 4LQFH 4QHUB 1X4YA 4U1MA 3E6HA 2IQ9L 1QSEE 3QNYB 2AAVA 4X7FC 5GRWA 1DQQA 1T1XA 3ME0A 4AMKL 4JFEA 1NFIB 3O45A 5J1TC 4HDIB 2HTLC 2JB6B 3RPIB 4P3CL 2VXUL 3TN0A 2X9WA 2V2XA 5DC4B 5EBMA 1KIQB 3VGAB 5JLZA 4NGHH 2ATPB 1AO7E 2A1WH 3FN0L 2Y06H 1DBML 4L4VB 5A2JH 3MQIA 4GMTL 5FKPA 3BUYB 3RZWA 5DYOA 5C6PB 1HHGB 5GS0D 5FV1L 1A14L 2FWOB 3QUKA 5D1ZC 3IU4H 2X1PA 1KV3A 4PUBH 4X4ZA 5F7WC 1YJDC 4KVNL 5KW9L 4ODSL 2CMRL 3SOBH 5IF0A 1D6VL 3RL2A 3VXUD 1HHJA 3BD4A 1DBAH 1DANT 4I0CC 5ESVA 1G9NL 3MBXH 4NO2B 1YEKL 5ETUA 3TN0C 1EDQA 3OWEA 1G1YA 3OXSB 3MUGA 4HS6A 4L4TE 3RZCA 4XNQA 2JLLA 2LQRA 3IDXL 4LARL 4ZAKD 2GJ6A 5HYJB 1FFOA 3E3QE 2CJUL 4CVZB 1IC7H 3ARZA 1CFNA 1BVLB 5JHLL 4N0UB 2ADIA 3ABZA 1XCQB 2P5WD 2GUOA 3VFGL 4KAQH 1HZHL 2EEAA 2BNQD 4GKSA 3D0LA 2DQFB 1F11A 2FGWH 4KJQC 3QI9C 1Q8MA 3IJHA 3ZDYE 2ID5A 5IFAL 2DQDH 1VGEH 2CKBA 1KN2L 4J1UA 2HKHL 2R0ZH 3SDAA 4H0GA 3VCLA 1MLBA 3X11A 1PZ5A 4JVUA 5JIHA 3BP7A 4JZNA 4XCCL 2A74A 4EUPB 3QIBA 3HN3A 3P2TA 3ZKQD 3HNVL 2DN7A 4HUNB 4PJAB 5C0FA 4JRXE 4UU9A 2AK4A 5ICZB 5LQBH 1F2XK 1OGAB 3RVTC 2UZYB 4KKLD 1CE1H 2VDNL 1DQLH 3MJ7A 1JWMB 3MLWL 3MXWL 3TVMD 4DGYH 1V3MA 1NLBH 1JGDA 1K9TA 3P9LA 1A2YB 5BW7C 1UG9A 4HGWA 1FNAA 3F12B 3DO7B 1MRDH 3KPOB 1XR9A 3JV0A 4X5WA 3MRJA 4CMMB 3SDAC 1D5BB 1CLZL 4A6YB 2ZSVA 3QDJD 3CFDB 3SDCB 1PBYA 1BFVH 4AENB 5HHMD 1WWBX 5MEOA 1VADA 3MREA 1J5OH 5FAAA 5JORA 5AZEL 5IHUH 5CJOL 5DT1L 1RZ7L 4NQCA 4GRMB 2G60H 2JJSA 5DRWB 4KKAC 1MWAB 4X5XA 2ZOLA 1JHLH 4UIKH 1E28B 5IQ7H 5C08E 3BEWB 5IFJB 4K3JH 3RKDC 3VG0H 1HSAA 3PDOB 2BOBB 3BGFB 4WI2A 1SJHA 4RMQA 5IW6A 3ULUF 3V6OC 4O5LH 2H2SD 2AGJH 5MP6L 1N0LA 4M3KB 4RDQF 3VD7A 2D3VA 4FZ8L 5CS7A 4GFTB 5EULV 1F6AA 5A40E 5DHVH 3GIZL 3VGDA 4M5YH 4JEGB 4PLJC 3IDUA 3FHAA 3EW3B 4KK5D 2HVKA 3H7LA 2R2HB 3TV3H 3OMZA 4I4WB 2JJSC 1H5BB 5CEZD 3T0EA 4XPFL 1BFSA 1JUFA 2IH1A 5K9JL 1U8IA 4P4KC 1Z9LA 5ICXB 2C1PA 1FJ1A 1YPZA 5E70A 3RWHB 4HPOH 2FHFA 3UTPD 2QADC 1NJ9A 3L5XL 4ZTPL 1HHKA 1K8IB 2V5RA 1BWMA 1QPPA 2NY5C 4NYLA 4G9FA 2C26A 3AFLA 5DDHA 3TPUB 5BVPH 3VXRB 1OTUC 1A6TB 1VCAA 3STBA 4FQXA 3WEXB 1A9EA 2A6IA 3EJJX 4PGZA 1CWVA 2J6EA 5DS8A 2IG2L 1YC7A 2ZCLL 4MJ2A 4XZUA 5DQ9A 1G9MH 3IKCB 4M6OL 5GRJH 3AXLA 3I3BA 4X6CA 5BVJA 3MCG1 4MDJA 1Z9SA 4N8CH 3SE3C 2Z0BA 1CL7H 3HE7A 2FDBP 1KPRB 2ZZUT 5L9DL 4TRPL 4U1LB 3C2AH 5LKNA 3CIQA 3BH8B 3BSZH 3T0EC 1DL7H 2FO4A 3H7BA 5EIIB 3B8YA 3SGDH 4KV5E 3OKDA 3D25B 1S3KH 4K94H 5SWZA 4G7YL 1R3HB 5ACZA 2R0LL 2VLJD 5E00A 5KANG 4Q9BA 3LKNB 4EN3B 4CADA 1ND0B 8CGTA 3ZHLA 5LWYL 1LDPL 5INDB 4FNLL 3T65B 3LN9A 4F8QA 4XPAH 1NBQA 3IXAA 3ULSB 4G6AD 3C08L 1J11A 1Z0NA 3BDYH 5E2JA 1BEYH 4FQXC 3RIFK 3UTTA 4K7FA 1FVCB 3MFFB 1J0KA 1QTYT 4X7EC 4BH7A 3Q3GA 4ZS7L 2Y36H 3VRIB 1FPTH 1JHTB 2GSIB 4KUCF 1FL6A 2CDEA 4PPTA 5D5ME 3DVFA 4ONHB 3V0VB 5BXFB 2X44D 3H6JA 5DMKB 3ZHDA 4ETQB 4HLZG 3MRRB 4M9PA 4UV7H 3CVIH 1VACA 3OJDB 4HS8H 3ALWA 5JQ6L 4R8WL 4O58H 1EHLL 5EOQH 3VXMB 4Z9KB 3VWJA 4HIXH 1SJVA 3L3GB 4QRPD 2GAZA 3WL9B 2C4FU 2HRLA 1IKFL 2CO7B 2D03L 3LS5L 4GSDL 4LHJB 2IH3A 4E42A 3UPRB 4QTHB 1KB9J 3Q2CA 4GBXB 4AEIL 2RHEA 5KSVA 2EDRA 1F90H 4ZXBC 3W0WA 3BKYH 4FQIH 1EA9C 1YN6B 4HQQL 4Z7VF 2YD3A 3LN5B 4HUUB 5ANMB 3QNZB 1HXYB 4ONGH 1BD2B 5DJCB 4X8XA 5IR1A 2CRMA 2VOTA 1KBGH 2UY7A 3QHZL 4PGDB 4PYHA 5KTEL 5KS9F 1LK3L 2PXYD 3JTSA 4QTIL 2X89D 1CG9A 1J0HA 2EC8A 4HIEA 4P57B 5DTFA 1Q9LB 5F7HA 2JJUA 3VWJC 1T2QL 1PW3A 3EO1A 5ESQA 4J3TA 1D5ZB 1M6OA 2NY3D 4M7LH 4P2RA 3FZUD 1RJZB 1KPVB 1RUML 5CBAA 3BH9B 3LZFH 4WFHD 5FYJU 4MB4A 1J1PH 3REVB 4KZEL 1JRHL 3UTSA 1J0IA 3X12B 4JRYB 4HCRA 1PAMA 1TETL 2H2PC 4WI8A 3N1MC 2F74A 4X4XB 2AEPH 1W72L 2IEPA 2WSKA 3CVHL 3LIZH 4EUPG 3PWVB 3MRFA 2AJZB 4K7PL 4E9LA 3RTQB 3DUSB 4IDLA 3EKCA 4IHOB 2Q7YA 1EO8L 1MJ7H 5IVXF 4UTAL 4H0IA 1IGJA 1T80A 2OJEB 4W70A 4KQ3L 3QUYD 5C6TH 3WLWD 4HGKC 4PJDB 4QEGA 3LH2L 2XZAL 1KLGA 2AJYL 3ZL4L 2ZSWB 3FQRB 4JJ5B 4LSUL 2YMXH 4XNXH 4XP6H 1A6UL 3CXHJ 3Q1SL 4WI9A 5DD3L 4MLSA 1OWRM 5D2LE 1A3LH 3BFOA 3CLEH 1REIA 2FECI 4Q0XH 2GY7B 4Z7WF 1FORL 2BC4B 2J2ZA 2G75B 3RWFB 4XNYH 3WXVH 2NR6D 3HCVA 4U2YA 5EU6B 3EYSL 2ESVD 3UTZA 4LSTL 4BFEA 4C58B 4JLRA 1MFNA 2CIKA 2DMBA 3RUGA 4P23A 2HJLA 3BESR 4OCSH 5C0AB 3GSVB 3QQ9C 5D7LB 3ZE2F 3HKFA 1TJIL 1GAFL 2YD4A 3QIWB 1MAJA 2YRLA 4EOWH 4MJID 4D9QE 5FYJE 3TZVD 4M9OA 3G6JA 4MJ6B 1XGPB 3QRFM 1KN4H 3MOQA 4LCUB 2D7TL 2R2BA 3ARBB 4NWTL 5HGAB 3UJTL 3QEGH 1QBAA 1EFXA 3RU8H 1V5JA 1JFQL 2GTZB 1WGOA 1KACB 3K2UL 1ZVHA 3EZ8A 2V2WA 4WNQB 4OCWL 4BFBD 4X6EA 3O4LA 1YEDA 3PG2A 4UQ2A 1NCNA 1WZKA 1EIBA 1H15B 5KAQF 4K3DL 1KC5H 3ILQD 4RCAA 4D8PB 1KG0A 1UQSB 3AC0A 2IBBA 4MCYA 4LMQE 4JPVL 4I0KA 4UDUB 2CKBL 1JPGB 2E8ZA 3FCTB 5FGCE 4CNIB 1I3VA 4TOYL 3WLBB 4XWGL 1ZLVK 4I9WD 5F1NB 3ZTJH 5C07E 3VXSA 3JV4A 5T3XE 1F42A 4C54A 4ALAL 1BZQK 1B2WL 5F44A 5CD3A 4WU5A 1TZHA 2CDGB 3O3DB 1FRGH 1BAFL 2VQTA 4L29B 1HHIA 3TO4D 1MCOL 4R90L 3DMMA 2FECL 3ETBF 3FQXB 1BZ7A 1JZ2A 2ZWLT 3P0YL 3MRNA 2BSED 3HAEH 5H37H 1QLRB 1T1ZB 1EV2E 4HUVA 3O8XA 4LLUB 3MV7E 5D1XA 4YE4H 2BOCB 2F5AL 3CFBA 5SX4H 2F19L 4MJ5A 2E9BA 1AGEB 1VFMA 1WJ3A 1WTGT 5JR1L 3MBEC 1I1FB 1RFDL 4XVSL 5EC2A 2R1WA 2N4IA 4P9HL 5D7JD 1OTTC 4HKZA 1NC4D 1ZLWH 5TPWL 1K5NA 1ORSA 4U1JA 2AQ2A 1KTDB 3K4DA 4QRRD 3DMMC 3RIFF 1FH5H 1Z9OA 3KYAA 4P2QB 1LE9B 1IAIH 2UZXB 5INCA 1QSEB 1CFSB 1A7NL 4OZHF 4HMEA 4YHOH 1T0MB 1VFBA 1T21B 2FEDC 3TIDB 5HYIA 3PWUA 2Y7QA 1NGPL 2APTA 5JOEA 1JGVL 3ARFC 4GUPA 1JHKH 5DHYA 2VXTL 4Y5YC 1R5VB 4MDIB 5IKCA 3HMXA 1RVFH 4H8WC 1EO7A 2BVPB 4KROB 4WTZG 3NBNA 5J13B 1YMMD 4AEHL 3A6CH 3N50A 3QULB 4I0PA 4PJBA 4DZ8B 2KZ1B 3VFSB 1GZQA 4F7EA 7CGTA 4H26B 5T3ZH 3TIEA 3ZYZA 4OFYA 5TDNB 1OM3H 1DCLA 4OKVB 1G0DA 3GBMH 4N0FA 2IAMD 4NQEB 5I17A 5KAQG 3TBVB 4J4PA 3SHSA 3BRDA 2P8MB 4YHNB 3TT3L 2R0WH 1YN7B 4JFDE 2R8SH 4ONFL 4NWUL 3NCYS 1BGXH 3BXNB 4R6UA 1H9VA 1WFNA 2AJSL 3ZHKA 4GKOA 2NXYB 5EOTB 4LHQB 3SQOL 4OD3H 3X3GL 2X4OB 3WIHA 1BBDH 3VD5A 4IIQC 2EDBA 4LAJH 4U1HA 3MO1B 4PJCA 3S4SB 3T4AA 4L4TB 2W65B 3GJFB 1JTOA 4N9OB 5CZXC 4H0HB 4R26H 2J6EL 5DF0A 1IAIM 5JZ7C 4I0PC 5TDPA 5C3TA 4LCWD 3RJQB 3EYUH 4X6FB 4H20L 4DOHE 4MMXC 3FQTA 1XGUB 4LOUC 4FQLH 1GPOL 3MRQB 4J4PC 4L8SB 1SQ2N 5CJQH 1P2CB 3FFDB 5FKAA 2DI7A 2DKSA 3F65A 4QXGL 1EO5A 1RQ5A 4JAMB 1YYML 5I9QB 4L1DA 3RVUD 1DANU 3VFMA 2ZUTA 1PVHA 1P84J 4YBLC 3L6FB 3G6DL 1YYLH 1UM6H 4EKXA 4JR9H 5E2WH 4NOFA 3L1OH 1M7XA 2X70B 1MCPH 1AHWB 3VFUB 3CZFA 3UZEA 4X6DA 4D3CH 5I1KL 5C7XL 3VXTA 4YHPB 1CZ8L 1LEKB 4JFQA 3NIFF 1F2QA 3NZ8A 5EU5A 3BZ4A 4HLJA 4GAGH 4ZAKA 3SGEI 3WHXA 2WWKT 5HI3C 2RJMA 5JXED 2YR3A 4Z7UF 1MCWM 2Q1EA 3N1QC 5B4MD 3GI8H 4PJ5B 4RGNE 4WHYG 4OJFH 4WW1A 5F3BA 5DC9B 3FFCB 2P5WA 2BRRL 2NCMA 2F53E 3KJ4C 1DSFL 2YS4A 2BNQA 3TNMB 5GS0C 3FT2A 4C56B 4PS4L 2Z31D 4U3CA 1F8TL 3SKNA 2R23A 1AC0A 2A6JB 4WEBL 2DRUA 5CINL 1IGTA 3SO5A 2DICA 1U8PB 4U6HA 5D7IF 3GUTB 4JZOA 5HHQB 4UAOB 4E41E 1RUAL 2L4OA 3Q5TA 2Q86B 3LOWA 4PR5A 1Q0XH 1I9IH 3EGSA 3MRBA 1NGWB 3KNBB 3NAAL 5D72H 2QQKH 1PGRB 4JFFB 1KCSL 2ICWA 4EBQL 3IFNL 1U8JB 3G5ZB 4ZAKC 2WV3A 4BSVA 5E8OA 3WXWH 4DFHA 2H32B 5DMIH 1CDUA 2DKMA 4LCCB 4XC1H 1UC6A 5DK0A 4Z7VE 1UH4A 5I74B 5JDJA 2XV6B 4GW5A 5D93C 3VGEA 1OTSD 3WS3A 3EOBA 1YEGL 4G8EA 4JM4H 5JPMA 3GO1H 5CAYB 1A7RH 2LE9A 4DGVH 2HN7A 2FX9L 3DVGA 2DQJH 2YSSB 4OZIB 4HIIB 3IJYA 4E0RA 5KS9E 1UWEH 1IFHL 4O02H 4LPUA 2Y07L 3GK8H 4ZFOA 4MZ3A 3HZVA 1EZVX 4OGXL 2VDKL 5HYSB 4HJ0C 1Z5LA 4DWHA 4JY5H 4P5KB 4X9HA 3G9AB 2PTUA 3QDJA 5I1DA 3RWEA 2VDPL 5FO9B 1AGDB 1JPFB 1LHZA 2WIIA 5E99L 3LKPB 2JELL 1SM3H 4IDJL 4HCRL 3IFLH 4F7MA 2CR3A 1K4DB 1T7WA 4F33B 2VL5A 1FZKB 4M7JH 2XN9D 4KTDL 1LP9B 3QDME 3OHXB 3VMPA 5JUEH 4KKLC 4OLVH 3MGAA 3WN5A 1T0NB 4R4NC 1AE6L 2VDRH 4X9GA 2FIKB 4UB0L 2UY6A 4QT5A 3BT2L 5BZWB 3TVMC 5AD0A 4GG6A 1I8IB 4MSWB 2EYSA 3CVHB 3ELAT 2X7LB 5IVXE 1HWHB 5C0RH 1F3RB 1L0YA 2PW2B 1KSRA 1UH3A 5CLWA 1A6PA 4X4YA 1L0XA 4NM4H 4ZYKB 2XZCL 3DX6A 4DN3H 4Z7OE 1YNKH 4XP5H 5ADOH 3KVQA 4MQ7A 2CLRB 1T1XB 2C5DC 5HHXL 3PP4L 4Z0BH 4V1DD 1ZGLM 4JFEB 4PB9L 3CK0L 2VERN 1FFRA 3GI9L 1IAOB 2FATL 4YO0A 1N64L 4J7RA 5HBBA 5JOFB 3JWDC 1Z3GH 2D7NA 3UYPA 2VLRE 4Z7WE 5HVFB 5JLZB 3B9EA 4XNUL 5T3ZD 2Y1VA 4TVPL 2E6PA 3D39E 2H1PL 3V52L 4JFZH 1KTKE 3WN5C 4KHXL 2COQA 3O2WH 5DURB 3NA9L 4U2ZA 2AJVH 3ZE2E 4D9RE 4CVWA 2PYFA 3QUKB 3LPFA 4ESKA 2H2SC 4U7KA 2EDXA 2MCPH 1H0DB 1FIGH 2BNRB 2O5ZL 4M6AA 2VSCA 2YEZB 4TUJA 2WLZA 1QRNB 4U1KB 2I5YL 3ZYOA 4YHYB 1XZ0A 4YHZH 4WCYH 1KLUB 4JKPL 3V95A 4PJGF 3LEYL 4HS6B 4KK5C 3TO2A 2Z4QA 3QQ3A 3O3UN 4LASH 2YA1A 4WUKL 1IGYB 2BY3A 1MELA 1OAUL 1FFOB 1MY5A 2FL5A 3GKZA 1KXTB 4BKLB 3JUYA 4TPRH 4HWZA 5AWNL 5FHBL 4HEME 4F9PA 5KSUB 2VLJA 2LABA 1U0QA 1L7IL 3VXQA 1YEJH 3QPXL 3QFDA 4Y0GA 2X1XR 1CGWA 5TE7H 3IJHB 5EU7E 4LRNH 3P30H 1I3GH 5HGDA 3T8XA 3KPQA 1MLBB 3S4SG 1PZ5B 3HTLX 5DJ2A 4KC3B 1K2DB 5HPMB 1T66D 3MCKA 3DV4A 5I1IH 5I15H 3FONA 2ZUWA 1W0WB 4S2SA 4HFUH 4ODWB 4TTDC 5E5UB 4NZUH 4UU9B 3JTTA 1XEDA 4HG4J 5J6GB 4P3DA 3RY5A 4GW4A 3K46A 1FNGA 2IALB 5EUKB 4RMUA 2EIDA 3PV7A 5K9KA 2AXFA 2VNCA 4C55A 5C8JA 3MJ7B 1A7QH 3KYNA 1FE8H 4F9PC 3FO1B 4MX7B 2FLRT 4I77L 3T3ME 3MNZB 4KUZL 4JREC 4QRPA 4FOMA 2CGRH 5DJ0B 2R29H 3DBXB 1ZS8A 3ARUA 4G6AC 5TGBA 1A1OA 5DD1L 4U3XA 4M6NH 4X5WB 4TQEH 5E2TH 3BD5A 5GJTL 1UVQB 1RIHL 3IDNB 2FX8H 2W38A 2NY1B 2ZG3A 1N0XH 3CH8A 5E08L 2NX5E 5JORB 4LHUB 4JFXA 3KPSB 3OPZH 1E27B 4C83B 4Y1AE 3C09B 5EORH 5DFWH 4LAQL 3HZYA 5F9JA 5HSFA 5DLML 5K9OB 4OZHE 2LTQC 4X7CC 2JB5L 1QEWA 2X89A 15C8L 1EMTL 1T20B 3ARTA 1WLHA 3HMXL 3ULVH 3DIFA 3O3EB 2MWCA 5EZIH 5D2LB 3TBTB 43C9B 3C2SA 5IW1B 1HSAB 1S5IL 2VXVL 1SJHB 1JGEB 3ZYJA 3GBNH 1XIWA 1RHHB 1F3DJ 1X5LA 4HXBL 4MXQD 4HZLA 4OLYL 1X5JA 1X5ZA 2FNBA 5LGJA 3AGVA 3TJEL 1FYTD 3EO0A 4QYOB 2AERT 2Z35A 1UJ3B 2AJXL 3WHE1 5HHNA 1GL4B 5IM7A 2IQAA 5EC1B 2R56H 5I71C 5GSVB 2C1OB 4KZDL 4PJHB 2Z91B 3WIHL 2O5XL 3E8UH 3PWLA 3QUYA 5ACLA 1Q72L 1U8IB 2PXYC 4FTVD 1LNUB 3WFCH 4ODXB 1X4ZA 2NY3C 1NJ9B 1GOFA 3FZUC 5BOPA 5D70L 2GJZA 4NYLB 3KDMA 4N90E 1S8DA 4NKDB 3QJHA 1EEYA 4MAUH 2P24A 5T5FH 2E9JA 5T1DL 5HYSG 1A9EB 2MPAL 3QUMH 4IOIA 3NGBC 4XWOD 2VIRB 2ESVA 5DHVA 4XZUB 4P59L 5AG8A 3AXLB 2VZ1A 1MCDA 1ZT7B 3B9AA 3MXVH 3KPRE 3RKPA 3R8QA 1AGBB 4LLDB 3ARED 2X41A 1JPTH 5C07B 4MJIA 2ZUQC 5C9JB 3TZVA 3WLWC 5FECB 2AJUL 5D2NE 2V5MA 3REWA 2IFFH 4P46B 1B0RA 4XPTL 4YR6B 5FUOL 1MFAL 4GRLB 3J7HA 1CXIA 4FN0A 3T1WA 5GS1B 2I26N 5DRXA 3UTTB 1S78D 4LVOB 4K7FB 4KQ4H 3BD3A 2NXZD 3HS0B 4NN7C 4Z7UE 4L8DA 3UTQA 1S7SA 1UACL 2GTWB 4LDOB 2BX5A 4AY0A 5BJTB 2OI9B 1CXKA 4R0LB 4AEEA 3GZKA 3BAEH 3CX5J 4YBHA 1UM5L 2VKXA 3R1GH 5EZJA 2PCPA 5HDBF 3S96B 1EZVY 3TZVC 3QG7H 1E4XI 2DLGA 5AYQA 5D7IE 1OAKL 1T1YA 2AXGA 2UVEA 4HKXA 4ORGB 1FFPA 3FT4A 1IC5H 2IH3B 1BJMA 2VH5L 3NCCB 3EYVA 4WFGD 1F4WH 3TO4A 2MQ3A 4UILH 3HLAA 1YEHL 5I30H 4ORZC 4LBEB 3RVXD 1G9MC 1R6VA 3LEVL 1NBVH 1WBXB 3ILQC 3DSFH 2X05A 3U7YH 5DQDH 1BQUA 1YQVH 5BMFH 4JKMA 4ZFOL 5IR1B 3QCVL 4JZJA 2DLFH 5B39A 4QOKD 2VL4A 3C8KA 2ENSA 2DQTL 1CG9B 5FO8B 4K94C 4LU5H 3K1DA 3S6CA 7FABL 4OM1L 3R4DA 1CDJA 4PJXA 3FJTA 4LSQL 1RIUH 2BNUB 3NPSC 4S1DD 1NUNB 5F70A 1CD1A 4X0KB 3KLAA 1YPZF 3UTSB 5LGHL 1HI6B 3PHOB 3TO4C 4QRRA 3C6LD 2ZPKL 1DVFC 5E6YA 2F8XC 3M17A 3GM0A 3MCLL 4NCDA 4FXKA 3IDJA 4IRSA 2NTFA 3MOAL 3WE6B 4F58H 2ITDB 4L5FL 4NN6C 1DBJL 1QFWM 2DQGH 4WUUE 2DBLH 1JGLH 1HH6B 3O9WD 1K4CA 2BVYA 3V6FA 4X6CF 3PGDB 2JJWA 1CFTA 5LJYH 3IS0X 5DRNA 1YMMA 3QEQB 1ADQH 4HGMA 5JW3L 3ULVD 3WO4B 4B53A 1U8MA 1ZXQA 4XTRD 5DUPH 1OQXA 1U95B 2EDQA 1E4XL 2OCFD 4HLZH 5C3LD 2CK0L 2FD6H 5D7JC 2IAMA 2FIRT 5DHXB 4AM0B 3VH8A 1EBPA 5CEZL 5CKGA 1ZAGA 3EDEA 4NKOB 1RZFH 5AYUL 5I66B 5DEGA 4NHCH 4NQDE 4ZDHA 4JHBA 2ERJB 5EBLB 3UTZB 1BJ1J 5E2VH 2V5TA 1ZSDA 4LHUG 4LLQA 3PIQA 1IGFL 4P23B 2FGZA 1FFNA 2P49B 1ACYL 5MHSE 5FDYA 3F5WB 6FABH 2CIIB 3QDGB 3DXAE 5JOPE 3AM8A 2Z92A 3BPLB 5HI5D 4Y19D 2F54D 4IOFD 1I9RH 3QO1A 3ILPB 2F8VA 4LGPB 4N0YH 5J7CC 1OSZA 1MHHB 5DFVD 3PQYE 2YD7A 1ONQB 1P69B 1IARB 1ZGLP 2NNAB 2YHGA 4NGHL 4XX1E 4MD5B 2A1WL 1Y6KR 1Y0LA 4PJGE 2Y06L 4X6BB 3RVWC 3SO3B 3V4UH 4DKDC 1G7JB 3VDCA 1IEAA 5F7YC 1BQHA 2MKWA 4QCIB 1KXVC 4E41B 4TSCH 4U6TA 2YD8A 3ZDZF 3OZ9H 2YPVH 2Q3AA 3QA3B 5HGHB 3INUH 3IU4L 4BZ1L 4PUBL 1MSPA 4NQTA 4LKXA 2MFNA 3SOBL 2XNAB 5IHZA 1QD0A 5TH2B 4EUPH 4KY1L 4FG6D 4IOSD 3S88H 2A83A 2CLZB 4LLMB 1DBAL 3MBXL 2W91A 4X80H 3IJSA 3TCXA 4K8RH 4WU5B 1YY9D 4QRSA 5MENE 4YDJA 1A4JA 5GGRA 5DQJA 3OKOA 1I85A 1FL3A 2Z31A 3GMNB 4PRPE 3RVUC 4HUWB 4KAQL 2H3NB 5F6IC 2BFVH 4QXUH 1BOYA 4QHMA 4DW2L 5IGXH 4AQOA 3O0RH 2VXQH 3OAYH 4KXZI 1A7BA 4XI5D 4A6YH 1A6AA 1MCQA 2DQDL 3FB7A 1VGEL 1J87A 3H9HA 3U36A 1UM4H 3CFBB 2R0ZL 3LKRA 5CCKL 3W81A 5L2KE 1NCWH 3QDMB 4PJIA 1WK0A 4PRHE 5C0JA 3CU7A 3GMPA 4RISH 4U1SB 5JXEC 1HEZA 3ORJA 5D1QB 5EC2B 1MWAH 2R1WB 4L3CB 5B4MC 3LRGA 4LQ1A 5LBSH 5LQBL 1K5NB 3KPLA 3MNVB 5DO2D 4S0TD 1CE1L 4OV6F 1I85C 1DQLL 1O5DT 2A2QT 3IDYC 4OF8A 1N2RA 4TSAH 2HT2D 4OLEA 4DGYL 1P5VA 3VW3H 5KG9A 4KI5D 1NLBL 3HAEA 3DYMA 4PJEA 5B8CA 1FCGA 4WHTA 3KR3H 1AR1D 3GSUB 1MRDL 1M4KA 1ZLUK 1P7QB 4P2OC 4KPHH 1I1AB 2DKUA 4M7KL 1TVHB 3RUGF 3STLA 5GSRA 5EIVA 1BFVL 3D39B 2P5EE 2JIXB 5CP3H 1FGNH 2N7AA 2XN9A 1C1EH 2XKUA 1W8NA 1CGXA 5IHUL 2VITA 1F6LL 4N0FB 5E9DB 5LG1A 5BRZE 4DQOH 2G60L 2CRYA 3SGDI 1OTSC 3G6JF 4EI5D 4YXLH 2NMSA 2O93L 2W07A 4Z6AT 3MZGB 5CILH 3TLRA 3DX9B 4AIXA 2OP4H 1BHGA 1H3VA 5IVNA 5I1HH 5DD5H 5IEHB 4K3JL 3UJJH 4LSSH 5B8CC 3VG0L 3OKEA 2MHAA 2RQ8A 1PG7W 2OR9L 2GJ6E 4XH2A 1FBIH 2LAGB 2QQQA 2E7LC 3LQZA 4HJGA 4V1DA 2J5LB 3B2VH 3KWWB 5C1MB 3SPVA 3QWRD 2E9IA 3FB8A 5A2LH 5DI8B 1M71B 4RAVA 1CICA 1X3DA 4YIQA 4HKJB 3PWPB 4M5YL 3T2QA 4G9DB 4KDTA 1PKOA 2NY2B 3FQTB 5KJRH 2HVJB 5EU3A 3TV3L 1CGYA 4L4VD 1TENA 4DZBB 1U9KA 4FA8A 4N9GA 5CWSB 5FYKH 1E6JH 1MJJB 1UB6A 4O00A 2QQLH 1CGSL 1SEBB 4HPOL 3TNNA 4ZUVA 2B1AH 3B5GA 3VFMB 5J0BA 1U93B 1U3HB 2QEJA 4M1GH 2O5YH 3TFKC 2V17H 2W0FB 2AK4E 2GYSA 5DJYA 3BPNC 5I75C 3IDIA 3UO1H 2VSDA 3CZFB 2OTUB 5TFSL 4LK4A 5K93A 2P8PB 5HYQA 2J4WH 1G9ML 5GRJL 1DBBH 4KDTC 5HYJD 4N8CL 2Y5TB 1AFVL 1CL7L 5IQ9A 5J1AA 5IB3A 3ESVF 3C2AL 5GGSA 1CQYA 3TF7C 3V6OE 5C0IA 1WIPA 3SJVB 3C9NA 1QO3A 1ZV5A 5B3JF 4WV1A 1OB1A 4RRPA 1S3KL 5E8EB 5H94A 4K94L 2CH8A 2DLTA 3CFEA 3FT2B 5JNYB 4YBQD 4ZSOB 1CN4A 5D6DA 4Y4FC 4YK4B 5K59F 4YEEA 5DJZB 3MLRH 3SQBA 1JZ5A 4NO0A 2XPGA 3BGMA 4PGBA 4LNRA 1C08B 2YWZA 4NQCE 4XPAL 3EDJA 3DGCR 3NPZB 2ZG1A 1FN4B 4JDZA 4XP4H 3MRBB 1BEYL 5DJAA 3NCBB 3ALXA 2YZ8A 3BE1H 1JIBA 3VFWB 4ISVB 1HN1A 2ED8A 2Y36L 4N5UA 1XMWA 1QOKA 1FPTL 4HV8A 1M1SA 3Q6FB 1OGAD 5JW4R 4NDMA 3LD8B 4K8RD 4HXAH 1MVUA 2XY2A 1MHEA 3RWDA 5L0QB 3P4NA 3QR2A 4PJBF 4UV7L 3S36H 4ZD3H 3CVIL 5JPMB 1LEGA 4BFGA 3SE4A 3RBSA 3LEXA 1RUQH 1FZOA 2HN7B 3QRGH 3CFIC 4OGZA 5EOQL 3S36X 4HIXL 3MODH 3IJYB 4E0RB 2YZ1A 3E6FB 2CLVB 3DX8A 1S7TB 5FF6A 5IMOB 4ZFOB 4KUCD 3PGCA 3UYRH 5IVOA 4W81A 4PP2B 1LK2A 1UFUA 3T0EE 3SDCD 1PZUB 1WICA 1WVZA 2WIIB 4LVHB 1F90L 4HH9B 1T66C 3BKYL 4FQIL 1YPZE 2H8PA 3HPLA 2PYEA 1UXWB 1P4IH 1GGIH 1NUDA 3CXDH 4GW1A 4PJCF 4JE4B 1GGBL 2J8UE 1P6AB 4ONGL 1EJOH 3RWIA 4Y4HC 5I1CH 3ARDB 2DF3A 4XNMB 1F5WA 5FOJA 1ZGLA 2DL2A 5DGQA 4JPKH 1NANI 3SE4C 1F6FB 3BQUC 2PTTA 1R5WA 2PO6C 1MCRA 5D6CA 2X4SA 3T1FA 1Y18A 4M7LL 4X6CE 1B3JA 1J9CT 4RGMC 2WZPD 4WHYH 4AMKH 3LZFL 3DX6B 1MLCA 2HFGH 1I1YA 1J1PL 1QHOA 2PNDA 5I1LB 1RJYB 2NLJA 4JFYA 3HUJB 1AGFA 1FYTA 3EYOB 2R15A 2YUXA 4I48B 3DOSA 3ZSTA 3SKUD 2AEQH 3PHQA 1TZGH 5SWZE 2AEPL 4ZS6C 3LIZL 3RWGB 4ZUTB 1HQRB 2F15A 2XTJB 4YXHH 1J0JA 5E5MA 4X6DF 3A67H 3PGFH 5KOVC 3TYGL 3NCYP 3B9KC 1MJ7L 4QXWA 5ERWB 2D9CA 4FTVA 4HW6A 3JWNC 5C6TL 3N1PC 2Q7NA 1H3XA 1Q9KA 3EOAA 1R3JA 2YMXL 4XNXL 4XP6L 3VXRD 1NGZA 4U4BA 4MXQC 1CD0A 4M02A 1A3LL 2WLYA 4HKBB 4KRNA 1FL5B 4D0DA 1WCQA 1QZ1A 4L9LB 4Q0XL 5C0BE 4ELMA 1FNFA 1IKNC 1XZ0B 4YAQB 4PY8I 4XNYL 1G0YR 5I76A 5IT2H 4JY6B 1FO0B 1S9VA 2CJUH 4KKCD 3ARQA 5GRVL 1IGMH 4L8BB 2X4RA 1Y6NR 3AREA 4WIQA 1T04B 4OCSL 2F5BH 4GAFB 2UYLA 4TVSa 1HZHH 4JFOB 4A2MA 2KH2B 4XCNA 5IROA 3UPCA 3KHQA 2RR3A 5FYKD 4JO2H 4I18A 3W0WE 4Y5XB 43CAB 4EN3D 1FC2D 4JQVC 3K8LA 1KN4L 1XH3A 5HHOB 3QFDB 2GI7A 3OR6B 1UEMA 3KXFA 3QEGL 1GGCH 1HSBB 3ALPA 3RU8L 2VTFA 5GGUB 4ZQKA 1HYSD 3T8XB 1CIUA 3DX7A 1ORQB 4HMCA 1IAII 2HLAA 3HNVH 4XWOC 3IVKB 1ULVA 5A1AA 1AC6A 1KC5L 4APQB 4P2RE 2GHWB 3WJJC 3UBXI 3PNWA 3CSBA 2ATKA 4JO3H 4O51B 5IWLA 5TQ2H 3LCYA 3VXMD 3STZA 1S9XB 4I18C 3ZE1F 3EFFA 2RIKA 5IB1B 5E4EB 1WT5C 1QFUH 5GRUH 4RSVA 4R96A 2Q20A 2VLME 4WU7A 1ZS8B 2QHRH 4EIZC 1IC1A 3FRUA 2CDFB 4GBXD 1A1OB 4OBSA 4WTWA 4GG6F 4K3EH 5F9DC 1II4E 1C5DB 1BOGA 5FK9A 1S78C 1FRGL 1CFVH 4Q97A 2NXZC 4XCYA 5H2BA 3D18A 1KCUH 3BPCA 5AZEH 5GQBA 4V2BA 5HDQH 3HC4H 2E7CA 4NKIH 4WUUB 1BD2D 3LHPH 4ZFGL 2CSPA 3O41B 5SV4A 2IMMA 1P7HL 3HZYB 2EKSB 3QAZC 1NCAH 5EUOE 1I8KB 5HD8D 3I02A 5DMGD 4N1HB 1WV7T 3GMLB 3WNKA 5IOPB 3V7AG 3FOMA 4XNZC 4DEPC 3CFCH 1G7IB 1XCTA 4PJ7B 1KYOJ 5HGGS 4FZ8H 3RUGE 4JRYD 1XIWB 4WW2C 3WIIH 2VZUA 2X6MA 2EE9A 3QWQB 4D0BB 3K80A 1K3ZA 3EIFA 4DUXA 2CQVA 3C6LA 4KVCL 3J8F7 3BVNB 3EO0B 3LDBC 3RVXC 4Z76B 2Z35B 1FH5L 4G42A 1IAIL 4I5BB 2FEEI 4UNUA 3RTQD 3MLYL 4J3WA 2N7BA 4YHOL 5J6HA 5HVHC 1DUZA 1F4HA 4AH2A 5IB4B 3O9WA 3GJFH 5GGTH 4PJ8B 4QGTA 4GS7C 4FXGB 4H1LB 1JHKL 1K6QL 4ZTPH 1E4KA 1PJ9A 3O4LE 1GHFL 1N59A 2XQYK 2AQ3A 5AUMB 3A6CL 1MI5B 3BEVA 1T83A 1UEYA 3KDMB 4RWYH 4OD2A 2WANA 5T3ZL 3GBML 3LKQB 1AKJB 2ZCLH 3V0AC 4M3JA 1LO5B 1R3LB 4UZGA 3CMGA 3GDBA 2DOCA 3C6LC 5F7LB 1LMKA 1TPXC 4J3SA 3TYFB 2R8SL 5EOCJ 5L9DH 2UZIH 4TRPH 1BGXL 2VZOA 4PGCB 3WDIA 4L3EA 5C0AD 5D7LD 3VXSE 1TVBA 4OD3L 1X7QB 3QIWD 3OGOE 1BBDL 3KPPB 4NUGH 3LRHA 1E4KC 2KQMA 1LDPH 3ULVC 4XBGB 4XTRC 1HINH 5IHLB 3ARBD 4R26L 3QUXA 1B0RB 4RAHA 4CGTA 3TCLA 2K3TA 1T83C 3EYUL 4OLXH 1LGVA 3FN3A 5EBWB 1DLHB 4M7LT 5DRXB 2RBLA 4ZS7H 1YUHA 4MNGB 5MERB 1N8ZB 3WHE0 5CJQL 3QUMA 1JJUA 3V9FA 2VLKB 3BWAA 3JV6A 5DUMH 1MFBH 5JW5B 1BZ9B 1CFQB 4P4RB 5F9AC 3QZWB 3KPMA 3GSOB 5FUZL 3VDAA 3VI3F 2BCKB 3LY6A 2FEEL 3N1GC 1U8LB 5B3JE 1YYLL 5JQ6H 2PCPB 1AD9B 4JR9L 1BFTA 3C5SB 3L1OL 5HI5C 1MCPL 3BP6A 4IOFC 4F2MB 2IADA 3MRLB 2DWDA 5EZOH 1IKFH 3MJ8A 1DEDA 3VRJA 1A9BA 1NFDE 3L3DB 2H32H 4Q6IA 4Y5VB 3G5VA 3KHOA 1RZKH 2C9AA 3R06A 3GMQA 4GAGL 4MAYB 3ZDXF 5F7DA 3WUWB 2AXJA 3E2HC 1LWRA 2A6KB 5JHDE 1G7QA 3K81A 4XVTL 4OJFL 2A77H 3MRPA 2L7UA 1V7ML 3MA7B 3U9UA 1ZHBA 1FV1B 2A73A 2G9HA 3L3OB 3QXAA 5FGBA 5ALBH 3GHEH 5KTEH 1U2HA 1S5HB 5E8DL 4QTIH 3O4OB 4JANA 3HE6C 2ZCHH 3A6BH 2P5EB 5B39B 1TXKA 3OKNB 4FG6C 3PDGA 1Q0XL 2B1HL 1I9IL 2QR0B 2V9QA 3FO9A 3FL7A 3QI9B 2MSPA 2QQKL 4Q6IC 1YNLL 1P4LB 2BP3A 3ZO0A 3GMMB 3WXWL 1S7VB 1YY9C 5DMIL 3FMGH 3SDDA 5E7FA 3WFHB 4I1NB 4XC1L 3RQ3A 3DHMA 3CVHH 3QH3A 3FN9A 3NCFB 4P2QD 4NRXB 4K7PH 4PJCE 4XP9H 5C92A 1QSED 4U3HA 2V5YA 5DUBA 3D2UB 3GO1L 4K9EH 3ARWA 4IRSB 1KPUA 2ZUUA 4DGVL 1IAKB 4K7PX 5EU4B 5FGBC 2LU3A 2H26A 4RMVA 4O02L 4XI5C 4X9FA 1K4CB 1GGYA 3OKMB 4PGEA 3LH2H 4FS0A 4KROD 4JY5L 3VFPA 3ZL4H 4NSKA 2WK2A 4ZFZB 2HJKA 4GH7B 4MNHB 3Q1SH 1SM3L 4NNXB 3IFLL 4WFED 1DN0A 4R7DB 1I75A 3AAZB 3IF1B 4NQED 2E9WA 4JJHA 5KSBA 4NHUB 5JUEL 1IGIH 1ZT1A 4LF3A 1CDYA 4LSTH 5DO2C 4OLVL 1BJ1H 1JPST 3N9GH 2VABB 2VDRL 3CC5B 3VXUE 4F7CB 4MD0A 2HT2C 5T5NF 4X6DE 4Y16B 2NXYD 4KI5C 2RB8A 4QHUA 5C0RL 3QNYA 1TJIH 3BPOC 1AH1A 1AR1C 5IJKC 1JNLH 4DN3L 3TA3B 4L4TD 1YNKL 4GRWB 4HDIA 5ADOL 2JB6A 4HFWA 3MACH 3RPIA 3WNMA 2VYRE 1GGUA 1SY6L 3QWRA 4Z0BL 1ADQA 2W9EH 3DRQA 3OXRB 1JFQH 1KXQE 1KIQA 2BNQE 1Z3GL 4MB5A 3VG9C 4MHHG 1AXTH 3G5YB 4EI5C 1Y0LB 4K3DH 4CU8A 1MFDH 1HHGA 1K85A 4Y4KB 3OKLB 5LXGL 3AU1B 3VWKC 2ARJQ 1ZLWK 5LCVH 4HD9A 5CGMA 4FMFA 4BQCA 2R0KH 3WKNA 2AJVL 4RMSA 2C3VB 1INDH 4W68A 2EDKA 5DVKA 5F1IB 4LKXB 2MCPL 1FIGL 3OAZH 4NO2A 4H1LG 2FB4H 5DSCB 1TFHA 4YHZL 4WCYL 3VGAC 4F80A 3IAQA 4CRPA 4PJ5D 1BVLA 4LASL 1N6QL 4N0UA 4FFWD 4R90H 3ULUC 3FFCD 3P0YH 5M95B 4PJXF 3H9SB 4TPRL 5DQJB 1FL3B 2DQFA 4C56D 3ZKMD 3OG6B 3O6KL 5HHME 3L7EB 1RJLB 2J12B 4QHMB 2SEBB 3ZT5A 1YEJL 3DYOA 1X44A 1D6EB 2LAAA 1T3FB 5TE7L 2EYTB 4U31A 3U1SL 5F97E 3ZE1E 2JCCE 4OZGB 3SEPA 4LRNL 2DQUH 3P30L 1I3GL 3W11D 2K9UA 4Y2DB 1RFDH 4MD4B 4JFFD 4PJIB 4GG6E 4PJAA 3NACH 4P9HH 3QFJB 5I1IL 5ICZA 1YA5A 1QYGH 3WS6A 1OGAA 4HFUL 3DECA 4NZUL 2AKRB 1I8LC 3D85B 2OZ4H 1ZOXA 1JWMA 2DJ4A 4LNVA 3BIAX 1N6VA 1MHPH 2HP4A 2WBJA 3H3KA 1A2YA 4H5SB 4HS3A 1A7QL 3G9VA 1FE8L 4M43H 1N6UA 4YBQC 2EZ0D 3ZKXB 3QZWG 3FO0H 1JWSA 4PJEB 3F12A 3DO7A 1JGVH 1G9EA 3KPOA 2CGRL 4Z78A 4CMMA 1JYWA 4A6YA 3LKOB 2XACC 1NMAL 1T7ZA 3CFDA 3SDCA 4M6NL 2JJTC 4PRIE 4AENA 4HX1B 4TQEL 5E2TL 4OFPA 5BCAA 3EO9H 3V6ZB 2FX8L 3PXHA 4JHAH 2K7PA 1ZVSB 1N0XL 4GRMA 4WRLA 2VWEC 5FV2A 5DRWA 3WS6C 2DQEH 3OPZL 4K8RC 1C7SA 3W5MA 1VEOA 2EDNA 4ONFH 5EORL 4ZXBB 3TBWB 3WUWG 1F00I 3DTXB 2YKLH 5MEQA 1E28A 5I73C 2GSGB 3TWCL 5IFJA 1P1ZA 5ID0B 4JB9L 3ULVL 5EZIL 2BOBA 4GAJH 1BVKB 4NCC1 5GS2D 4JFHD 3OKEB 5TJWK 3RWJB 1PDKA 5JO5B 5E94B 3UBXB 3GBNL 3LQZB 3CH1B 4JFED 3SDCC 2I60H 5B39G 4DVBB 5H35B 1HHHB 1WZ1L 3MFGB 3S37H 5D7KD 5CZVL 4UDTB 1CICB 1FHGA 1MCFA 4I4WA 3SDXE 1H5BA 4XXDB 1SVZA 2R56L 1UA6H 5SX5H 5EU3B 4RGOL 3OX8B 5T3XH 1L7TH 1EX0A 5ICXA 5M7QA 1NSNH 5DURD 3MUZ1 3RWHA 4N9GB 3E8UL 4KJYA 4DN4H 4HT1H 4Z77A 1K8IA 3OTTA 1ETZB 1M7DA 4I2XB 2YUVA 3WFCL 4XMLL 4CKVX 4JCLA 3BGFC 2J3SA 3LSOA 4J8RB 3TPUA 1JBJA 1QFWI 3VXRA 1A6TA 3R0MA 4OZFB 2BNRD 3WEXA 1CK0L 2NW3B 4MAUL 1QRND 1PG7H 4NBYB 3U7WL 5I16A 3IKCA 3QUML 4LPWA 4P9MH 4F7TB 3B4NA 4N8PA 1KPRA 4FFZH 3BH8A 4OQ1A 1H5BC 3VA2C 3QCUH 4OIBA 2X1QA 4QRPE 1R0AL 2XZZA 5EIIA 1DSFH 4PJIF 3VI4F 1VKXB 3D25A 5C0IB 2G5BB 3GBLA 1CU4H 3C9NB 3O6LH 3VI3E 1R3HA 5EFIB 3GSWB 1J8KA 4WFFD 4QRTB 3LKNA 3TESA 4EN3A 1ND0A 4WEBH 1VDGA 1B6DA 1OB1B 5INDA 3T65A 2IFFL 2QSTA 3ULSA 4NC0B 3P4MB 3NFPB 2OMBA 1N5AA 4NO0B 2XPGB 4LNRB 5F1SA 2BSSB 5ITFB 3MFFA 3SKJH 5FDWB 5D8JH 2B39A 5EZLB 3ZDXE 3IFNH 3VRIA 4KQ4L 1JHTA 2GSIA 3CJJA 3L7FB 4ONHA 3V0VA 1MQ8A 1YEFH 5DMKA 1X5IA 4NCC2 3MRRA 4K7PY 4WFHE 3SE9L 3BAEL 1N5YH 4FFVD 4RFEB 3OJDA 2HLFD 3R1GL 4RMRA 4WTZA 2XWJB 5KN5B 3G04B 4KRMB 5DJXB 4G43B 4PV9A 3CFKB 2Z8WC 1QFPA 3QG7L 2Y07H 4JN2B 3L3GA 3WL9A 4O2CB 4OGXH 3UPRA 1MAKA 4QTHA 2VDPH 1IC5L 2BY0A 5E99H 1HYSC 5A3IC 4YEFA 1YN6A 2NY1D 3LN5A 4K71B 4BJLA 1OD7A 5ANMA 6CGTA 4DFIA 3QNZA 4LHUD 1BD2A 2H8PB 4KJPC 5DJCA 3KPSD 1HOCB 4LDLB 1DUYB 1NBYB 1BMGA 3DSFL 1AE6H 3U7YL 1CGVA 5BMFL 1YQVL 1I3UA 1Q9LA 3F58H 5ELIA 3MRMB 2DLFL 1D5ZA 1RJZA 3VJ6B 1KPVA 1FNHA 1NKOA 4RMWA 5A16B 1VERA 3BH9A 4LU5L 2ESVE 5D6CB 2QSVA 2X4SB 1U8OA 1WTLA 4P49A 3ZT7A 3REVA 1RIUL 1NBZB 1QR1B 4GBXC 3X12A 3I3DA 1QUNA 4JRYA 1MLCB 3GI9H 3QB7C 4IMLB 2FATH 1N64H 3UDWC 4MJIE 5LAXB 1YNTA 2OTWB 3PWVA 2GFBB 2AJZA 1PY4A 2WINB 1RZIB 4KK6C 4U1GB 4MMZC 3DUSA 4TVPH 4IEFB 4IHOA 3ZYIA 5DVNA 3V52H 5E95B 2EYRB 3L3JB 5B22A 1CCZA 2OJEA 4PJFB 1WAAA 2DQGL 3PL6C 4PJDA 5HD8C 5DMGC 3MRHB 5I1GH 4GG8B 1X5XA 2WWMD 1EXUB 4RWHA 4Z7QF 4AIZB 2ZSWA 3FQRA 4JJ5A 1ADQL 1DQTA 3BGAA 2O5ZH 3OKKA 4B50A 3HR5A 4G9FD 3ARFB 1ZA6B 3MV01 1NGZB 4Y5YB 5CIPB 1PYWA 2FD6L 5IV2B 3SKOB 2BC4A 4OD1H 4S1SH 2G75A 2CRIA 3RWFA 2BVQB 4YFLI 2MKLC 5EU6A 1RZFL 1QBLH 1FG9C 1A1MB 2ZOKB 3GSQB 2CXKA 3S5LB 3RTQC 5ACMA 3GSVA 3HA0A 5H8DA 1S9VB 5D7LA 5E2VL 3QIWA 2D4DA 3U82B 1IMHC 4OB5L 5AWNH 5C07D 5ILTL 4G80A 6FABL 5T3XD 2WQRA 1NFDB 3CSGA 1XGPA 3C60A 1PY9A 2D7PA 4ENED 4P46D 4PREB 3ARBA 1GC1H 5HGAA 1I9RL 3ECBB 2HJFB 1XH3B 1U8KB 3MRDA 4GRLD 2GTZA 4N0YL 4IIQB 3KXFB 4WNQA 3IB4A 3QISA 3UP1A 3UTTD 1YC8A 3TH3T 3UBXG 3JVGC 2EDDA 3V4UL 1OHQA 2HLAB 5CMAB 1MY7A 5I8KH 3SY0B 4D8PA 1UQSA 2XG4A 4PJXE 4TSCL 1RZ8B 4KMTH 3OZ9L 4UDUA 2YPVL 3VFOA 1JPGA 1YEEL 3INUL 2FJHB 3FCTA 3P40A 3DLQR 4HUMB 4PJ9B 4CNIA 4LLWB 3F7VB 1NAKH 4WJ5B 4I77H 5F1NA 4DUVA 4QRRE 2VISA 3S88L 4YBLB 1TJGH 4K55A 2FH6A 2MTPA 1CBVH 3Q48A 3JWOH 2CDGA 3O3DA 5HI4D 1EEZB 5GJTH 4OZFG 5C0CB 1ZANH 1UADC 1NPUA 4K8RL 4L29A 4OSUH 2J88L 4YGAB 1FLRL 2EEDA 3VXOA 2GK2A 3HB3D 1A5FH 3T04D 2X4QA 3CDGA 1QLRA 5F7KC 2XXCB 1YMME 1JV5B 1DFBH 4G6MH 4HWNA 4LLUA 2BFVL 5DLMH 5IGXL 1WQVT 4UIMA 3O0RL 1EMTH 2BOCA 3NOIA 3GM8A 3RY6A 3V0WH 4DJMA 2YUZA 2XG5A 4A6YL 4R9HA 1AGEA 3RP1A 1W0VB 2F58H 3I02B 4MNQB 1HQ4A 4OUUB 4WDIB 3RPKA 3NIDE 1I1FA 3IRZA 1NCWL 3HI6H 4Z7NF 2AV1A 3GHBH 1XCTB 4RISL 3UTSD 1A02N 2X9YA 3I6LD 1KTDA 5FOBB 1IEHA 5LBSL 2ZUXA 4O2EB 4Z0XB 4P2YA 4PRNB 4PLNC 4ZG1A 4P2QA 1QNZH 1QSEA 1CFSA 2VDQH 2OSLB 4R4BA 1GCFA 1T21A 4KZDH 3TIDA 5AZ2L 3V2AR 3T4YB 1WFTA 4IS6B 4LCWE 5CJBA 4MB3A 4ELMF 1DUZB 4NQVB 4HH8A 1R5VA 3RY6C 3TPKA 4EVNB 3PXJA 4MDIA 3KR3L 1MIMH 2BVPA 2CUIA 2B5IB 5I0ZA 3QEQD 2P44B 3QULA 5IVZB 4LIQL 4KPHL 4DZ8A 1N59B 1RUPH 3VFSA 2H45A 3S3SA 1A8JH 2F8OA 3JBG7 4H26A 1E4WH 3BIKB 1SEQL 4LLVB 1GZPB 4OFIA 4NQEA 1FGNL 1AQDB 1SMAA 1XR8B 2P8MA 3O2VH 1C1EL 5HXMA 5IJVB 3T08A 4KFZC 3X14B 3H0TB 4DQOL 3VRLE 5IP4A 5EOCH 1KB9K 4YXLL 3BXNA 2D7MA 3TH4T 3I85A 3DHJA 5EOTA 3QXUA 4F57H 1U92B 5CILL 4ODVH 2OP4L 3FAWA 4P23D 5GIRA 2X4OA 2PW1B 4TVPD 4L3EB 5I1HL 5DD5L 3UJJL 2B2XL 4F9LC 4LSSL 3MO1A 3S4SA 3QDGD 2AJUH 3EHBC 4L4TA 2W65A 3WJLA 3GJFA 5GGTA 4ETYA 1FBIL 1U8HB 4IRJC 5J13C 1I8MB 5ISZE 3B2VL 4MS8D 2JJVA 2W0KA 2YOCA 3CSYB 3B3IB 3QCTL 3QUXB 1XGUA 2V9TA 3MRQA 4L8SA 4RX4D 4J3VA 3VA6A 1P2CA 3FFDA 3MV9B 5KJRL 1CT8A 5F9WB 1MNUH 1QVOB 5C0EB 4JAMA 1I3RB 3AS1A 4BK4A 5FYKL 4HIHB 1E6JL 2FHCA 4E41D 5J1SC 2JK5A 1H3GA 1XGTB 2QQLL 1JNJA 3K7UA 2B1AL 5F8RC 2X70A 4JN1H 4MLIA 1AHWA 5F7NC 3JUZA 3VFUA 4M1GL 1Z6JT 3WJLC 1ROWA 2V17L 2IC2A 3GFUA 4JRXA 5L88H 4YHPA 1LEKA 1OAKH 4S1QL 3UO1L 1JNHB 3VRJB 3H3PH 4QHNA 4IMKA 2HH0H 2J4WL 3R06B 5TQ0L 4PJ5A 4GMSH 1S7XA 4HZAA 3WMSA 5I6XB 5KSAB 5F7DB 3LPGA 1N4XH 3FFCA 3CXHK 1MCNA 1X9QA 3TNMA 2GY5A 3GNMH 1HNFA 3C6SB 1KOAA 5I9QC 4C56A 4O4YL 3U9UB 3S5LG 2A6JA 3Q6GH 1U8PA 4Y8AA 4PRIB 3GUTA 5HHQA 2XN9E 3BZFB 4PG2A 2Q86A 3I50L 1IRAY 3MLRL 1NGWA 3KNBA 1YECH 3SBWA 4DGIL 5JDSB 3QDMD 1MJ8L 4LSQH 4XRCB 4XP4L 4JFFA 3MSPA 2Y9RT 1U8JA 1FZMB 3HC0B 2XQBH 1NDGB 1WUNT 1NMCC 5D1QD 3BE1L 2H32A 5KVEH 1C7TA 4LCCA 1RPQA 4IMKC 1CQKA 4MYWB 3RGVA 3VXPA 4ZO9A 4BH8B 3MR9B 1B88A 5BZDB 1RZGB 1U2CA 3SDDB 3ULVF 2ZPKH 3VXNB 2VC2L 4HXAL 5F9OH 3IU3B 5GGVH 5DJ8B 2QKIA 4V1DE 1G1CA 2YSSA 3S36L 4OZIA 4HIIA 5AAWA 1RUQL 5TDOB 3QRGL 2P45B 3MJ9H 4CVUA 1LDSA 3MODL 5HYSA 5C0ND 5BS0B 4CVXB 4P5KA 5T3ZE 3VFVB 1XF1A 3QYCA 1AGDA 5FO9A 1JPFA 1P7QD 2KUTA 4ZO6A 3UYRL 2EIZB 1I1AD 3LKPA 1J86A 4PFEA 3SBWC 3W11C 1K4DA 4F33A 4JDVB 1E4XH 2HJKB 4J3OC 1FZKA 1ED3B 2CK0H 2JIXD 4I3GA 4AG4H 4PP1C 1LP9A 5HVWA 4HMDA 4LCCC 4OFYD 4Z8FL 1J18A 1P4IL 1GGIL 3CXDL 5E9DD 5F3HA 2FIKA 1EJOL 5BZWA 1I8IA 4MSWA 2X7LA 3I2CH 3EYQC 4JPKL 2PW2A 5FIEA 3GJEB 5I8OH 1BQLL 1MCEA 4ZYKA 3MUHL 4QKXB 2CLRA 3ROLA 4Z7QE 5CD5D 1UB5B 1J1OH 1UWGH 2HFGL 3M1BB 4HFWB 1IAOA 5EO0B 4OCYH 3OAYK 1DEEB 5JOFA 1FO0H 3DRQB 2BSRB 3PWPD 1RAMA 2AEQL 5I8EB 5DEFB 1TZGL 3W2DH 5J4MA 3PDDA 5A2KH 4RFOH 5KOMC 4JQXA 1IL1A 4YXHL 3U0WH 4JM2A 1H3PH 3A67L 3PGFL 4M5ZH 2DQHH 2C4XA 2D2OA 3B8SA 2NYYD 1MRCH 1KIUA 4BZ1H 4QY8B 1A0QL 1A6ZB 3F7YB 1U3HD 2DD8H 1MHCA 3MGOB 1H0DA 1RU9H 1U3YA 2BNRA 3I84A 1KB5A 2PXYB 4KY1H 2YEZA 3IGAA 3QHFH 4M61B 1QRNA 4U1KA 2GCYB 2UUDH 5J89A 3I75B 1KLUA 1ZMYA 4EXPX 4Q58C 1QSFB 4ZPTA 1IGYA 5IT2L 1LO0H 3NABH 1OP3H 1J8HE 4BKLA 1IGML 1BLNB 2HMIC 3LB6D 3SJVD 2F5BL 2P8LA 2AQ1A 2A9MH 4KU1A 2FLBT 5KSUA 3SGKA 4DAGH 4U6XB 1OPGH 4PRDB 4DW2H 2V6HA 1JI1A 4G8GB 3Q5YA 4NNYB 4JO2L 1FAIH 2V7HB 5J9PB 1PKQB 2YPLB 4UBDC 3AB0C 5CCKH 3DROB 1GGCL 4XAKD 3C5ZB 1K2DA 4KI5F 5HPMA 4YUEH 5KVDH 1W0WA 4F3FB 3RZCC 1JZ6A 2PTVA 4ODWA 5J6GA 4HK0B 1YDPB 2IALA 5EUKA 4L4JA 5J12B 4X7TB 1KJMA 3OJ2C 4NJ9H 5SWSB 4JO3L 3GRWL 1U3ZA 3FO1A 4MX7A 4GT7A 2WBJB 2DL9A 5TQ2L 3MNZA 2LU4A 4HS3B 2CK2A 2MMXA 2VZSA 4NFDA 5DJ0A 3DBXA 5KSBF 1F97A 3EYFB 1JWSB 1HKLH 2YPKB 5C0GB 3MOBL 1T6WA 1QFUL 5GRUL 4YNYB 4Z78B 1IAMA 1T22A 2QHRL 3SCMB 4M7KH 1P84K 1UVQA 4K3EL 5DD6B 3IDNA 3TGXA 4R97B 4Z7NE 2BY1A 5DJDB 1XT5A 3QIBC 1BECA 1CFVL 4C57C 4LHUA 4FTVE 1KCUL 3KPSA 1CXLA 1E27A 5HDQL 3HC4L 4C83A 4NKIL 1JN6A 1T5XB 3LHPL 5C0DB 3FB5B 3ARDD 5K9OA 1G7LB 4FFVC 5B38A 4H1LH 3DUHA 3RNKB 4I3RH 1T20A 1ZE3C 2PKDA 2OZ4A 3O3EA 3RDTB 4OAWA 5MEQB 1NCAL 1P1ZB 3BN9D 5D2LA 3C5JB 1F02I 3TBTA 4UNVA 5B3NA 3IRPX 4ELME 43C9A 5IW1A 1V7NH 3B43A 5E6ZA 2OR9H 5ESAB 2W59A 1JGEA 4KXZH 3RNQB 3CFCL 1RHHA 1JNNH 4O2FB 3IS1X 3UEZA 1FZJB 5I8CA 4LSRL 4QYOA 3WIIL 2NY1C 1UJ3A 2R2EB 4RQQB 4YXKH 2VMFA 5KVFH 2AEWA 5EC1A 4U6YB 2FJGA 2C1OA 4P9HC 4ZOCA 5GSVA 5C09B 1URLA 3C09C 4PJHA 1OAQH 5IBUG 2XTJD 5ADPL 2Z91A 1WISA 2V7NB 1NC2B 2VDMH 1J88A 1MF2H 1DVFB 3HFML 3THMH 1CGSH 1LNUA 1VEMA 2W60B 3D3VB 5ENWB 5GGTL 4ODXA 4KJYB 3BRFA 4Z77B 3DV6B 2IPTL 1M7DB 3QP3A 4WI4A 4M8QB 1Y6MR 1J1XH 3LSOB 4U0RC 4NKDA 1QQDB 3E1F1 1GH7A 4YWGL 4ELKB 4RWYL 5TFSH 3X13B 2QQNH 3MRIB 2VIRA 5I16B 1UJ3C 1BIIB 3A0OA 2CD0A 1TMCB 1AFVH 1ZT7A 4U33A 2UZIL 2DYPB 5HJ3B 3V5KB 1AGBA 2EE3A 4LLDA 3P4OA 1RULL 5C07A 5C9JA 1FNEA 2C3WA 2BVEA 5FECA 3H9ZA 4HHAA 4PJAF 2Q87A 4WFGE 1R3IH 4P46A 1AY1H 4NUGL 5C2UB 4N1CA 4YR6A 1ZK9A 2A6DB 5HHOD 1OD9A 4ZOBA 4IM8A 1U8NA 1HINL 4GRLA 3GKWL 5GS1A 3SGJA 3ARSA 3HG1B 2HFFB 1N5AB 2Q8AH 4YFLF 4OLXL 3FKUS 5CEXA 2BVOB 1P4BL 3HS0A 3WSQH 4EXKA 3QSKB 2GTWA 4QOKE 2HG5B 2HFEB 5BJTA 4R0LA 5DUML 1P53A 3HE7C 5DZNA 1MFBL 4APQD 4PRBB 1IM9A 4XBPB 1AQKH 1VGKB 1I4FB 4RZCB 3C87A 4QNPF 3S96A 4OCRH 4OV5B 2RCSH 2BMKB 4PV9B 4X4ME 4ENEC 32C2B 3MLXL 4P46C 4BSWA 4Y7MA 2IMNA 3CUPA 4P0DA 4XCFH 4ORGA 2XFXB 4O9HH 5EZOL </