3LH4A

Crystal structure of sialostatin l2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
MELALRGGYRERSNQDDPEYLELAHYATSTWSAQQPGKTHFDTVVEVLKVETQTVAGTNYRLTLKVAESTCELTSTYNKDTCQANANAAQRTCTTVIYRNLQGEKSISSFECAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted cystatin
publication title The crystal structures of two salivary cystatins from the tick Ixodes scapularis and the effect of these inhibitors on the establishment of Borrelia burgdorferi infection in a murine model.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Hydrolase inhibitor
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lh4A00
3UL5A 3K9MC 3SVAA 4N6TA 1M9GA 1CEWI 1R4CA 5ELUA 2O9UX 3Q2PA 1MOLA 4N6V0 1LXEA 1KWIA 1TIJA 2KXGA 1PFPA 3LH4A 5LC7A 1A67A 2W9PA 2OCTA 4N6OB 4N6LA 3MWZA 1FA3A 1G96A 3GAXA 3PXMA 4N6NB 1RN7A 1A90A 3KSED 5LC6A 1STFI 1DVDA 1EQKA 4TX4A 1CYUA 2W9QA 4IT7A 1ROAA 1GD3A 5EQLA 1FUWA 3PYJA 3UL6A 1MNLA 1N5HA 3NX0A 4N6MA 1N9JA 3IMAB 4ZM8A 1GD4A 3L0RA 4N6UA 3PS8A 1IV7A 2BO9B 5A0OB 3QRDA 1IV9A 3KFQC 1CYVA 1YVBI 3S67A 2CH9A 4CCVA 1NB5I 1WNHA 5ELJA 1N5PA 1DVCA 4LZIA 4EYCA 1NB3I
chains in the Genus database with same CATH superfamily
2RGQA 1NU3A 2UUGC 3ZG5A 1I8VA 3OWSA 2LYXA 4FMAA 5AYRB 3SYUA 4N6TA 5G2GA 1YJN3 3LXUX 1JZOA 1C7HA 2Y73A 4GSPA 1X1WA 1BU4A 4LYLB 2ML5A 1B2XA 5D82A 3NUVA 1B21A 1IVUA 1VQ83 1OGZA 2BMOB 1VZZA 2CKFB 1UGIA 3EN8A 2KRTA 4XB5A 1O7WB 3HOHA 4BTXA 9RNTA 1RGCA 1KWIA 1BGSA 2YFIB 4K1VA 1RSNA 2F5MA 4U13A 1GSPA 1BRGA 3KSPA 1RGFA 1FW7A 1CH0A 3ZFZA 1BVIA 3JUOA 5CXOA 1T3BA 2W9PA 1IQXA 3LT8A 2OCTA 4N6OB 4WYKB 3I563 1VQ53 1FGTA 2CG1A 7GSPA 1GY6A 1OHOA 1I2FA 4EV5A 4L8OA 1JBTA 1A2KA 5M1AA 5BVBA 1K9M4 3CCJ3 2WOFA 2ML6A 3ZG0A 5IENA 3WR2A 4HYZA 4G1MB 3DGYA 3F8HA 2H0IA 2YFLB 1GMRA 2F56A 1BNRA 4FR9A 1RTUA 4BTWA 1UCJA 1X1XA 5EVHA 2CFLA 3MKIA 4EXRA 1NNVA 4XDVA 4R9LA 1BNSA 1RNBA 1GMQA 1EEJA 4KFEA 2BT3A 3KSED 2CG0A 2W04A 2L1SA 2Q07A 3ALAA 4RNTA 1J2BA 2MC8A 1STFI 1IVWA 3NV0A 5AYSC 1O7PB 2CIUA 1I3FA 1AVKA 3NM7A 1JJ22 1JBSA 2GEXA 1KSIA 1Q9EA 4XBXA 4TX4A 4CDLA 3AMOB 1VQ73 1MWRA 4HM0B 2W9QA 2F98A 3DXOA 3K7CA 4HJLB 4IT7A 5EEOA 5M19A 3EF8A 1OHSA 1MWTA 5IEOA 1ISKA 3WHOA 3I553 1W2B2 1GD3A 1FUWA 1O7MB 2ZL8A 1YGEA 3UL6A 4OK0A 4HVNA 1IQ8A 4BIRA 1W4NA 3OX9A 4R80A 3IJEB 4WYKA 2GBWB 4AEQA 1FZUA 4ZM8A 3N8BA 3VSYA 1AY7A 1GS3A 1EKMA 1BNFA 4K1UA 4WP5A 1ULJB 2BMRB 1ZX2A 2OQEC 1BIRA 1Q42A 3FF0A 1R4YA 1IYYA 4MMYB 1EA2A 3KFQC 2CX0A 3CU3A 1YVBI 3B7CA 1A2PA 2BNGA 1SIIA 3BLZA 3KE7A 2QEX3 3BNDA 1W5ZA 2AAEA 3DGLA 3MHEA 1G0TA 1W00A 5IF6A 2CFWA 4Q53A 5M18A 1BSCA 2FGTA 3H3HA 4RBNA 6GSPA 2UGIA 3CPW2 1I0XA 3S29A 1ZS7A 1GY7A 5D83A 2INXA 3UNLA 2SBLA 5DRVA 3I0YA 1RGGA 1RMSA 1HKXA 1UW1A 3AMOA 1WNHA 3BU4A 3FF2A 4K61A 5AIHA 3OWUA 3LMLA 3K63A 3GWRA 3DGMA 1YGWA 4XBYA 2V1LA 3PGBA 3BIRA 1NB3I 1CQSA 3U1WA 3HZPA 1B20A 1IK3A 1W6CA 1O7HB 2XGNA 3HIIA 7STDA 3EB8A 1LQGC 2IY2A 1M9GA 4O8SA 1JV2B 1GOVA 2M7OA 3KCHA 3HK4A 5ELUA 4PEJA 1D6YA 1RJOA 4FMCA 3D3LA 1YIT3 4MEIA 1I0VA 1OACA 2R4IA 3K0ZA 3QK9A 1M904 2P09A 5JPUA 2KXGA 1US1A 3Q3FA 4O02B 1SJWA 1RGEA 4BL3A 1A67A 1OGXA 1T2IA 5LC7A 3LTDA 3VGNA 1EUIC 1UGHI 1M1K4 2HMJB 5FGOA 1AVLA 2IUKA 2B1XB 4R4KA 3EQQB 1RCLA 2P0XA 1JBRA 1BANA 1OCVA 1JZDA 3ER7A 3SLUA 1TRQA 3JUNA 2CC3A 3GSPA 4HZBB 3EJVA 4LGQA 4ORLA 3S28A 4X2HA 4EBGA 1TU5A 3NQYA 5IERA 2Z77A 1HU9A 5CK6A 3MG3A 3NV0B 1S723 3JUMA 3MG1A 2JQ5A 1RCKA 3SOAA 1VQQA 1WMNA 1BUJA 3OW22 2ZA4A 3Q90A 1TFKA 3F40A 2XFTA 3WA2X 1DETA 4XM4A 2L4VA 8RNTA 5IG4A 2CX1A 3EE1A 3WOEB 3Q1CA 3TDGA 4MMZB 5KP1A 3FSDA 1JNQA 1I2EA 1DVDA 3FLJA 1ZGXA 4HM2B 2CFGA 1IVXA 3KKGA 1E3RA 1UUVB 3H51A 1U5OA 3NXJA 1VQO3 1RGKA 3PZWA 5KP4A 3CCL3 1BNEA 3J7Yd 2RSXA 3BNEA 1Y4KA 3B4PA 2C10A 1VQL3 1VQP3 4LSOA 3MYTA 2HMLB 2I9WA 3F7SA 1VQM3 1S5AA 3X3XA 1PU4A 1VQ93 1X1YA 1UCIA 1DMMA 1N9EA 3NHXA 1RN4A 1BSBA 1TTOA 3LTBA 1N9JA 3IMAB 1BRKA 3CCQ3 1VQN3 3SX1A 4DKIA 3G8ZA 2R41A 1RHLA 3PS8A 1AV4A 3RGRA 4BTYA 3CCV3 1ULIB 1C54A 4FMBA 2RNTA 2BO9B 1UUGB 1OHPA 2CFDA 1PY3A 3QRDA 5TGNA 3CD63 4JF8A 2OWPA 3HIGA 1BNGA 1LOYA 3K5TA 3AGNA 4HM4B 2XGLA 4I5QA 1K41A 3LT9A 4MMXB 2FNQA 4RNYA 2HMMB 5IG5A 4LMIA 3D79A 3X3YA 2XSHB 1RGHA 2K3DA 3G713 1WMOA 3GZYB 1RNTA 3JUPA 3S67A 2F86B 1T2HA 5AIGA 4N3VA 3CC73 2KF6A 4WWUC 2OQEA 3EHCA 3B8LA 4EV2A 2E2TA 1LOVA 2Z76A 1GY5A 1TJDA 2IMJA 5G1KA 3CCM3 1FUSA 4AKZA 4EYCA 1K8A4 3IPTA 3WMDA 2HMKB 2CW9A 1ASKA 3FG1A 3DMCA 3SVAA 1VQ63 2UX0A 3A5EA 1W02A 1YI23 1I2GA 4NHFA 1Q824 2CFKA 2QIYA 2C4BA 1R4CA 2XEPA 3LOYA 1OPYA 3DM8A 4I4KA 1TUHA 2PNCA 4HBRA 1Q814 2O9UX 3KZTA 5JPPA 1KC84 3GZXB 3Q2PA 4FCJA 1BOXA 2BU4A 3G16A 3JUQA 3FKAA 1MGWA 3HI7A 4N6V0 1TIJA 1FGQA 1B27A 2OTJ3 4HAAA 1K28A 1FGRA 4HM8B 1UCLA 2WO0A 3CNXA 3PCRA 4NREA 4EC6A 3WDGB 1D6UA 3GZBA 5AEWB 1EG9B 1QALA 1M1XB 1WQLB 2D42A 1MGRA 2H0HA 3CMA3 4N6LA 3S5CA 1DE3A 2Z7AA 2W56B 4XBTA 2W6JH 3MWZA 1BNIA 2KCDA 4HM3B 1D6ZA 2GEYA 1FUTA 2FXTA 1B2UA 3N54B 2E2VA 3OXAA 5HGRA 1FA3A 2B24B 2WGQA 3B4OA 3EN1B 1QVG2 3O8YA 2PZVA 3V98A 2P38A 2WOHA 1E3VA 2XF3A 4OVMA 2MF7A 3D4AA 1V74A 3FZWA 5CF1A 1KQS2 3NM2A 4BU4A 1VQK3 2F4YA 7RNTA 1NDOB 3A76A 1RN7A 4KT3B 2H0GA 1IT7A 4HM6B 1FGMA 1LNIA 3LTAA 4KFDA 4NPBA 2K0MA 1RN1A 4KZ1A 1RGLA 2XR8B 3CNMA 3UJMA 2XRXB 1NWWA 4X2OA 2C11A 1IT8A 3U97A 2AADA 2STDA 3DZLA 3GZRA 3CCE3 3DY5A 2Z6BA 1WMPA 5AI1A 1ROAA 2W03A 1IDPA 1W6YA 1BRJA 1IVVA 3WODG 5D81A 3FG4A 4KVHA 3SEDA 4LEHA 1BNJA 1DMNA 3KIIA 2IA7A 3WOFB 1RLSA 1I3IA 4L8PA 1MNLA 1A2VA 1QMAA 3NX0A 3G6E3 2OTL3 2W56A 1BSAA 2F99A 1LOXA 1TP6A 1B2SA 3L0RA 1O7GB 2BMQB 1UCKA 3MPHA 2IYJA 2HMOB 2ZHXB 4H61A 1Q864 3BNCA 3CCR3 5IG0A 1NO3A 2GBXB 5A0OB 1Q40B 2CK3H 1OH0A 4XDWA 1CYVA 3LZAA 3VF1A 2XH9A 1HZ1A 2WGOA 4HM1B 5BIRA 3V92A 2F5WA 2YFJB 2W0QA 2JDIH 3RDEA 1UI8A 2KF3A 1MWUA 1SARA 1OUNA 2CH9A 3MSOA 1YVSA 4O2HA 1YJW3 3OV4A 3CC43 1KD14 1SQWA 1AQZA 4IPBA 1LRAA 4R9KA 4ILFA 3CCU3 2W2CA 3BNBA 3OWYA 2A15A 1B2ZA 2LQVA 2GXFA 1V58A 3EBTA 3M8CA 4FMDA 4HZ9B 1N5PA 1TRPA 3EX9A 1B3SA 2XSOB 1FGOA 5IEPA 3FGYA 1JB4A 1UUWB 3AHWA 4J9AA 1W2ZA 3UL5A 5BU4A 1BRNL 1G02A 4MJDA 2K54A 3K9MC 3MG2A 3V99A 4WFOA 2D1WA 2KF5A 3CC23 1RDSA 2P0MA 4RZMA 1JN5B 1CEWI 1ROVA 2E2UA 1JB2A 3SOYA 2BIRA 1K734 1RRHA 4OUQA 1JKGA 3FH1A 3T8NA 4CJNA 1Q7Y4 1OF5B 5AEUB 1LOWA 3N9HA 1W01A 1Z1SA 3T0UA 1Q40A 3F8XA 5AIFA 3STDA 3CME3 1MOLA 2J8XB 3FG3A 1N8R4 3LYGA 1VQ43 1LXEA 1UI7A 3ROBA 4EW5A 3G4S3 3ECFA 1BRIA 3F14A 4IIAA 4KFFA 4J8TA 1PFPA 4WHAA 3PCSA 4J5GA 1QJGA 3DUKA 3LTCA 1Q7HA 2QA43 1YNVX 3LH4A 1PYLA 3NBBA 1YIJ3 3RGAA 4R1KA 2BHMA 3X3ZA 3X41A 1X1UA 3GRDA 1L5GB 2KF4A 2ZDJA 5HOHA 4J5KA 1W7CA 3S27A 2RFRA 1BAOA 4JRFA 3DH2A 3AGOA 3T8UA 1MWSA 1RKYA 3G0KA 3F9SA 5CF2A 1G96A 3BB9A 3E99A 3EBYA 5BXQA 1NJI4 1STDA 3GAXA 1DMQA 4GHOA 6STDA 1GYBA 3PXMA 6RNTA 3F7XA 1JN5A 3D5GA 2GU3A 1QVF2 4N6NB 1A90A 1JRQA 5LC6A 3CPOA 4L7KA 3NBJA 5G1LA 3JVCA 1LNHA 1W6GA 2HOHA 1OF5A 2CWUA 1N8QA 3HX8A 3X40A 1F8NA 2CWVA 2RBIA 1O7NB 2CHCA 4FCZA 1DYUA 4H3UA 1GMPA 1GOUA 3D9RA 1EQKA 1RRLA 2O3OA 1FYSA 3RNTA 4STDA 1BUQA 1ZO2A 2RCDA 3KN4A 4AKYA 5IW9A 1CYUA 2KAAA 3EC9A 2GSPA 5RNTA 4HOHA 2CWTA 3X42A 4BL2A 4K90B 5EQLA 4RNZA 2Y74A 3PYJA 2OOVA 1IU7A 4CPKA 4QWTA 3DGOA 1QAFA 1N5HA 5KP3A 1UDII 1BSEA 4N6MA 1BRHA 2SARA 5FW5A 3CCS3 5DREA 1GD4A 3UB1A 5STDA 2GU1A 2OOVC 1QAKA 4N6UA 5CLKA 5I97A 1YJ93 2YX9A 4O3VA 1I70A 1B2MA 1YHQ3 3D5IA 1IV7A 1HYFA 1WTHA 1IQYA 3AHSA 5GSPA 1IV9A 1AR0A 1BSDA 1U8CB 2QGUA 4HM5B 3DGNA 1LQMB 3WA3A 3URPA 4FCMA 4GB5A 5IG3A 1TFOA 5AIIA 1V57A 3SXXA 1SPUA 3FCSB 1LVNA 3NQZA 4GL6A 1JB5A 1E97A 1GOYA 2HMNB 4HKVB 4CCVA 8CHOA 1NB5I 1T5YA 3NBRA 2IUJA 5ELJA 1SIHA 1RGAA 1JKGB 1DVCA 4LZIA 1BRSA 5JBSA 2XFSA 4HM7B 3CXC2 2P05A
chains in the Genus database with same CATH topology
2RGQA 1NU3A 3OWSA 2LYXA 4FMAA 5AYRB 4N6TA 5G2GA 1YJN3 3LXUX 1C7HA 2Y73A 5D82A 2ML5A 3NUVA 1IVUA 1VQ83 1OGZA 2BMOB 1VZZA 2CKFB 3EN8A 2KRTA 4XB5A 1O7WB 4BTXA 1KWIA 2YFIB 4K1VA 4U13A 3KSPA 3JUOA 5CXOA 2W9PA 1IQXA 3LT8A 2OCTA 4N6OB 4WYKB 3I563 1VQ53 1FGTA 2CG1A 1GY6A 1OHOA 4EV5A 4L8OA 1A2KA 5BVBA 1K9M4 3CCJ3 2WOFA 2ML6A 5IENA 4HYZA 4G1MB 3F8HA 2YFLB 4FR9A 4BTWA 5EVHA 2CFLA 3MKIA 4EXRA 4XDVA 4R9LA 3UNLA 4KFEA 1J2BA 2BT3A 3KSED 2CG0A 2W04A 3ALAA 2Q07A 2MC8A 1STFI 1IVWA 3NV0A 5AYSC 1O7PB 2CIUA 1AVKA 3NM7A 1JJ22 2GEXA 1KSIA 4XBXA 4TX4A 4CDLA 3AMOB 1VQ73 4HM0B 2W9QA 2F98A 3DXOA 3K7CA 4HJLB 4IT7A 5EEOA 3EF8A 1OHSA 1ISKA 5IEOA 1W2B2 3I553 1GD3A 1FUWA 1O7MB 2ZL8A 1YGEA 3UL6A 4OK0A 4HVNA 1IQ8A 1W4NA 3OX9A 4R80A 3IJEB 4WYKA 2GBWB 4AEQA 4ZM8A 3N8BA 3VSYA 1GS3A 1EKMA 4K1UA 4WP5A 1ULJB 2BMRB 1ZX2A 2OQEC 1Q42A 3FF0A 4MMYB 1EA2A 3KFQC 3CU3A 1YVBI 3B7CA 2BNGA 1SIIA 3BLZA 3KE7A 2QEX3 3BNDA 1W5ZA 3DGLA 3MHEA 1W00A 5IF6A 2CFWA 4Q53A 2FGTA 3H3HA 4RBNA 3CPW2 3S29A 1GY7A 5D83A 2INXA 2SBLA 5DRVA 3I0YA 1HKXA 1UW1A 3AMOA 1WNHA 3FF2A 4K61A 5AIHA 3OWUA 3LMLA 3K63A 3GWRA 3DGMA 4XBYA 2V1LA 3PGBA 1NB3I 1CQSA 3U1WA 3HZPA 1IK3A 1W6CA 1O7HB 2XGNA 3HIIA 7STDA 3EB8A 1M9GA 4O8SA 1JV2B 2M7OA 3HK4A 5ELUA 4PEJA 1D6YA 1RJOA 4FMCA 3D3LA 1YIT3 4MEIA 1OACA 2R4IA 3K0ZA 3QK9A 1M904 2P09A 5JPUA 2KXGA 1US1A 4O02B 1SJWA 1A67A 1OGXA 5LC7A 3LTDA 3VGNA 1M1K4 2HMJB 5FGOA 1AVLA 2IUKA 2B1XB 4R4KA 3EQQB 2P0XA 1OCVA 3ER7A 3SLUA 3JUNA 2CC3A 4LGQA 4HZBB 3EJVA 4ORLA 3S28A 4EBGA 4X2HA 1TU5A 3NQYA 5IERA 2Z77A 1HU9A 5CK6A 3MG3A 3NV0B 1S723 3JUMA 3MG1A 2JQ5A 3SOAA 1WMNA 3OW22 3Q90A 1TFKA 3F40A 2XFTA 3WA2X 4XM4A 2L4VA 5IG4A 3EE1A 3WOEB 3Q1CA 3TDGA 4MMZB 5KP1A 3FSDA 1JNQA 1DVDA 3FLJA 4HM2B 2CFGA 1IVXA 3KKGA 1E3RA 1UUVB 3H51A 1U5OA 3NXJA 1VQO3 3PZWA 5KP4A 3CCL3 3J7Yd 2RSXA 3BNEA 1Y4KA 3B4PA 2C10A 1VQL3 1VQP3 4LSOA 3MYTA 2HMLB 2I9WA 3F7SA 1VQM3 1S5AA 3X3XA 1PU4A 1VQ93 3NHXA 1DMMA 1N9EA 3LTBA 1N9JA 3IMAB 3CCQ3 1VQN3 3SX1A 3G8ZA 3PS8A 1AV4A 3RGRA 4BTYA 3CCV3 1ULIB 4FMBA 2BO9B 1OHPA 2CFDA 3QRDA 5TGNA 3CD63 4JF8A 2OWPA 3HIGA 3K5TA 4HM4B 4MMXB 5AEUB 2XGLA 1K41A 3LT9A 4RNYA 2FNQA 2HMMB 5IG5A 4LMIA 3X3YA 2XSHB 3G713 1WMOA 3GZYB 3JUPA 3S67A 2F86B 5AIGA 4N3VA 3CC73 4WWUC 2OQEA 3EHCA 3B8LA 4EV2A 2E2TA 2Z76A 1GY5A 2IMJA 3CCM3 4AKZA 4EYCA 1K8A4 3IPTA 3WMDA 2HMKB 2CW9A 1ASKA 3FG1A 3DMCA 3SVAA 1VQ63 2UX0A 1W02A 1YI23 4NHFA 1Q824 2CFKA 2QIYA 1R4CA 2XEPA 3LOYA 1OPYA 3DM8A 4I4KA 1TUHA 2PNCA 4HBRA 1Q814 2O9UX 3KZTA 5JPPA 1KC84 3GZXB 3Q2PA 4FCJA 3G16A 3JUQA 3FKAA 3HI7A 4N6V0 1TIJA 1FGQA 2OTJ3 1K28A 1FGRA 4HM8B 2WO0A 3CNXA 3PCRA 4NREA 4EC6A 3WDGB 1D6UA 3GZBA 5AEWB 1EG9B 1QALA 1M1XB 1WQLB 2D42A 3CMA3 4N6LA 3S5CA 2Z7AA 2W56B 4XBTA 2W6JH 3MWZA 2KCDA 4HM3B 1D6ZA 2GEYA 2FXTA 3N54B 3OXAA 2E2VA 5HGRA 1FA3A 2B24B 2WGQA 3B4OA 3EN1B 1QVG2 3O8YA 2PZVA 3V98A 2P38A 2WOHA 1E3VA 2XF3A 4OVMA 2MF7A 1V74A 3FZWA 5CF1A 1KQS2 3NM2A 1VQK3 1NDOB 3A76A 1RN7A 1IT7A 4HM6B 1FGMA 3LTAA 4KFDA 2K0MA 4KZ1A 2XR8B 3CNMA 3UJMA 2XRXB 1NWWA 4X2OA 2C11A 1IT8A 3U97A 2STDA 3DZLA 3GZRA 3CCE3 3DY5A 2Z6BA 1WMPA 5AI1A 1ROAA 2W03A 1IDPA 1W6YA 3WODG 1IVVA 5D81A 3FG4A 4KVHA 3SEDA 4LEHA 1DMNA 3KIIA 2IA7A 3WOFB 4L8PA 1MNLA 1A2VA 1QMAA 3NX0A 3G6E3 2OTL3 2W56A 2F99A 1LOXA 1TP6A 3L0RA 1O7GB 2BMQB 3MPHA 2HMOB 4H61A 1Q864 3BNCA 3CCR3 5IG0A 1NO3A 2GBXB 5A0OB 1Q40B 2CK3H 1OH0A 4XDWA 1CYVA 3LZAA 3VF1A 2XH9A 2WGOA 4HM1B 3V92A 2YFJB 2W0QA 2JDIH 3RDEA 1UI8A 2CH9A 1OUNA 3MSOA 4O2HA 1YJW3 3OV4A 3CC43 1KD14 1SQWA 4IPBA 4R9KA 3CCU3 2W2CA 3BNBA 3OWYA 2A15A 2LQVA 2GXFA 3EBTA 3M8CA 4FMDA 4HZ9B 1N5PA 3EX9A 5IEPA 2XSOB 1FGOA 3FGYA 1JB4A 1UUWB 4J9AA 1W2ZA 3UL5A 4MJDA 2K54A 3K9MC 3MG2A 3V99A 4WFOA 2D1WA 3CC23 2P0MA 4RZMA 1JN5B 1CEWI 1ROVA 2E2UA 1JB2A 3SOYA 1K734 1RRHA 4OUQA 1JKGA 3FH1A 3T8NA 1Q7Y4 1OF5B 3N9HA 1W01A 1Z1SA 3T0UA 1Q40A 3F8XA 5AIFA 3STDA 3CME3 1MOLA 3FG3A 1VQ43 1N8R4 3LYGA 1LXEA 1UI7A 3ROBA 3G4S3 3ECFA 3F14A 4IIAA 4KFFA 4J8TA 1PFPA 4WHAA 3PCSA 2QA43 1QJGA 3DUKA 3LTCA 3LH4A 3NBBA 1YIJ3 3RGAA 4R1KA 2BHMA 3X3ZA 3X41A 3GRDA 1L5GB 2ZDJA 1W7CA 3S27A 2RFRA 4JRFA 3T8UA 1RKYA 3G0KA 3F9SA 5CF2A 1G96A 3BB9A 3E99A 3EBYA 5BXQA 1NJI4 1STDA 3GAXA 1DMQA 6STDA 1GYBA 3PXMA 3F7XA 1JN5A 2GU3A 1QVF2 4N6NB 1A90A 1JRQA 5LC6A 3CPOA 4L7KA 3NBJA 3JVCA 1LNHA 1W6GA 3X40A 1OF5A 2CWUA 1N8QA 3HX8A 1F8NA 2CWVA 4FCZA 1O7NB 2CHCA 4H3UA 1DYUA 3D9RA 1EQKA 1RRLA 2O3OA 1BUQA 4STDA 1ZO2A 2RCDA 3KN4A 4AKYA 5IW9A 1CYUA 3EC9A 2CWTA 3X42A 4K90B 5EQLA 4RNZA 2Y74A 3PYJA 2OOVA 1IU7A 4QWTA 3DGOA 1QAFA 1N5HA 5KP3A 4N6MA 3CCS3 5FW5A 5DREA 1GD4A 3UB1A 5STDA 2GU1A 2OOVC 1QAKA 4N6UA 5CLKA 5I97A 1YJ93 2YX9A 4O3VA 1YHQ3 1IV7A 1WTHA 1IQYA 1IV9A 1AR0A 1U8CB 2QGUA 4HM5B 3DGNA 3WA3A 4FCMA 4GB5A 5IG3A 1TFOA 5AIIA 3SXXA 1SPUA 3FCSB 1LVNA 3NQZA 4GL6A 1JB5A 1E97A 2HMNB 4HKVB 4CCVA 8CHOA 1NB5I 1T5YA 3NBRA 2IUJA 5ELJA 1SIHA 1JKGB 1DVCA 4LZIA 5JBSA 3CXC2 2XFSA 4HM7B 2P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL5 A;  3K9M C;  3SVA A;  4N6T A;  1M9G A;  1CEW I;  1R4C A;  5ELU A;  2O9U X;  3Q2P A;  1MOL A;  4N6V 0;  1LXE A;  1KWI A;  1TIJ A;  2KXG A;  1PFP A;  3LH4 A;  5LC7 A;  1A67 A;  2W9P A;  2OCT A;  4N6O B;  4N6L A;  3MWZ A;  1FA3 A;  1G96 A;  3GAX A;  3PXM A;  4N6N B;  1RN7 A;  1A90 A;  3KSE D;  5LC6 A;  1STF I;  1DVD A;  1EQK A;  4TX4 A;  1CYU A;  2W9Q A;  4IT7 A;  1ROA A;  1GD3 A;  5EQL A;  1FUW A;  3PYJ A;  3UL6 A;  1MNL A;  1N5H A;  3NX0 A;  4N6M A;  1N9J A;  3IMA B;  4ZM8 A;  1GD4 A;  3L0R A;  4N6U A;  3PS8 A;  1IV7 A;  2BO9 B;  5A0O B;  3QRD A;  1IV9 A;  3KFQ C;  1CYV A;  1YVB I;  3S67 A;  2CH9 A;  4CCV A;  1NB5 I;  1WNH A;  5ELJ A;  1N5P A;  1DVC A;  4LZI A;  4EYC A;  1NB3 I; 
#chains in the Genus database with same CATH topology
 2RGQ A;  1NU3 A;  2UUG C;  3ZG5 A;  1I8V A;  3OWS A;  2LYX A;  4FMA A;  5AYR B;  3SYU A;  4N6T A;  5G2G A;  1YJN 3;  3LXU X;  1JZO A;  1C7H A;  2Y73 A;  4GSP A;  1X1W A;  1BU4 A;  4LYL B;  2ML5 A;  1B2X A;  5D82 A;  3NUV A;  1B21 A;  1IVU A;  1VQ8 3;  1OGZ A;  2BMO B;  1VZZ A;  2CKF B;  1UGI A;  3EN8 A;  2KRT A;  4XB5 A;  1O7W B;  3HOH A;  4BTX A;  9RNT A;  1RGC A;  1KWI A;  1BGS A;  2YFI B;  4K1V A;  1RSN A;  2F5M A;  4U13 A;  1GSP A;  1BRG A;  3KSP A;  1RGF A;  1FW7 A;  1CH0 A;  3ZFZ A;  1BVI A;  3JUO A;  5CXO A;  1T3B A;  2W9P A;  1IQX A;  3LT8 A;  2OCT A;  4N6O B;  4WYK B;  3I56 3;  1VQ5 3;  1FGT A;  2CG1 A;  7GSP A;  1GY6 A;  1OHO A;  1I2F A;  4EV5 A;  4L8O A;  1JBT A;  1A2K A;  5M1A A;  5BVB A;  1K9M 4;  3CCJ 3;  2WOF A;  2ML6 A;  3ZG0 A;  5IEN A;  3WR2 A;  4HYZ A;  4G1M B;  3DGY A;  3F8H A;  2H0I A;  2YFL B;  1GMR A;  2F56 A;  1BNR A;  4FR9 A;  1RTU A;  4BTW A;  1UCJ A;  1X1X A;  5EVH A;  2CFL A;  3MKI A;  4EXR A;  1NNV A;  4XDV A;  4R9L A;  1BNS A;  1RNB A;  1GMQ A;  1EEJ A;  4KFE A;  2BT3 A;  3KSE D;  2CG0 A;  2W04 A;  2L1S A;  2Q07 A;  3ALA A;  4RNT A;  1J2B A;  2MC8 A;  1STF I;  1IVW A;  3NV0 A;  5AYS C;  1O7P B;  2CIU A;  1I3F A;  1AVK A;  3NM7 A;  1JJ2 2;  1JBS A;  2GEX A;  1KSI A;  1Q9E A;  4XBX A;  4TX4 A;  4CDL A;  3AMO B;  1VQ7 3;  1MWR A;  4HM0 B;  2W9Q A;  2F98 A;  3DXO A;  3K7C A;  4HJL B;  4IT7 A;  5EEO A;  5M19 A;  3EF8 A;  1OHS A;  1MWT A;  5IEO A;  1ISK A;  3WHO A;  3I55 3;  1W2B 2;  1GD3 A;  1FUW A;  1O7M B;  2ZL8 A;  1YGE A;  3UL6 A;  4OK0 A;  4HVN A;  1IQ8 A;  4BIR A;  1W4N A;  3OX9 A;  4R80 A;  3IJE B;  4WYK A;  2GBW B;  4AEQ A;  1FZU A;  4ZM8 A;  3N8B A;  3VSY A;  1AY7 A;  1GS3 A;  1EKM A;  1BNF A;  4K1U A;  4WP5 A;  1ULJ B;  2BMR B;  1ZX2 A;  2OQE C;  1BIR A;  1Q42 A;  3FF0 A;  1R4Y A;  1IYY A;  4MMY B;  1EA2 A;  3KFQ C;  2CX0 A;  3CU3 A;  1YVB I;  3B7C A;  1A2P A;  2BNG A;  1SII A;  3BLZ A;  3KE7 A;  2QEX 3;  3BND A;  1W5Z A;  2AAE A;  3DGL A;  3MHE A;  1G0T A;  1W00 A;  5IF6 A;  2CFW A;  4Q53 A;  5M18 A;  1BSC A;  2FGT A;  3H3H A;  4RBN A;  6GSP A;  2UGI A;  3CPW 2;  1I0X A;  3S29 A;  1ZS7 A;  1GY7 A;  5D83 A;  2INX A;  3UNL A;  2SBL A;  5DRV A;  3I0Y A;  1RGG A;  1RMS A;  1HKX A;  1UW1 A;  3AMO A;  1WNH A;  3BU4 A;  3FF2 A;  4K61 A;  5AIH A;  3OWU A;  3LML A;  3K63 A;  3GWR A;  3DGM A;  1YGW A;  4XBY A;  2V1L A;  3PGB A;  3BIR A;  1NB3 I;  1CQS A;  3U1W A;  3HZP A;  1B20 A;  1IK3 A;  1W6C A;  1O7H B;  2XGN A;  3HII A;  7STD A;  3EB8 A;  1LQG C;  2IY2 A;  1M9G A;  4O8S A;  1JV2 B;  1GOV A;  2M7O A;  3KCH A;  3HK4 A;  5ELU A;  4PEJ A;  1D6Y A;  1RJO A;  4FMC A;  3D3L A;  1YIT 3;  4MEI A;  1I0V A;  1OAC A;  2R4I A;  3K0Z A;  3QK9 A;  1M90 4;  2P09 A;  5JPU A;  2KXG A;  1US1 A;  3Q3F A;  4O02 B;  1SJW A;  1RGE A;  4BL3 A;  1A67 A;  1OGX A;  1T2I A;  5LC7 A;  3LTD A;  3VGN A;  1EUI C;  1UGH I;  1M1K 4;  2HMJ B;  5FGO A;  1AVL A;  2IUK A;  2B1X B;  4R4K A;  3EQQ B;  1RCL A;  2P0X A;  1JBR A;  1BAN A;  1OCV A;  1JZD A;  3ER7 A;  3SLU A;  1TRQ A;  3JUN A;  2CC3 A;  3GSP A;  4HZB B;  3EJV A;  4LGQ A;  4ORL A;  3S28 A;  4X2H A;  4EBG A;  1TU5 A;  3NQY A;  5IER A;  2Z77 A;  1HU9 A;  5CK6 A;  3MG3 A;  3NV0 B;  1S72 3;  3JUM A;  3MG1 A;  2JQ5 A;  1RCK A;  3SOA A;  1VQQ A;  1WMN A;  1BUJ A;  3OW2 2;  2ZA4 A;  3Q90 A;  1TFK A;  3F40 A;  2XFT A;  3WA2 X;  1DET A;  4XM4 A;  2L4V A;  8RNT A;  5IG4 A;  2CX1 A;  3EE1 A;  3WOE B;  3Q1C A;  3TDG A;  4MMZ B;  5KP1 A;  3FSD A;  1JNQ A;  1I2E A;  1DVD A;  3FLJ A;  1ZGX A;  4HM2 B;  2CFG A;  1IVX A;  3KKG A;  1E3R A;  1UUV B;  3H51 A;  1U5O A;  3NXJ A;  1VQO 3;  1RGK A;  3PZW A;  5KP4 A;  3CCL 3;  1BNE A;  3J7Y d;  2RSX A;  3BNE A;  1Y4K A;  3B4P A;  2C10 A;  1VQL 3;  1VQP 3;  4LSO A;  3MYT A;  2HML B;  2I9W A;  3F7S A;  1VQM 3;  1S5A A;  3X3X A;  1PU4 A;  1VQ9 3;  1X1Y A;  1UCI A;  1DMM A;  1N9E A;  3NHX A;  1RN4 A;  1BSB A;  1TTO A;  3LTB A;  1N9J A;  3IMA B;  1BRK A;  3CCQ 3;  1VQN 3;  3SX1 A;  4DKI A;  3G8Z A;  2R41 A;  1RHL A;  3PS8 A;  1AV4 A;  3RGR A;  4BTY A;  3CCV 3;  1ULI B;  1C54 A;  4FMB A;  2RNT A;  2BO9 B;  1UUG B;  1OHP A;  2CFD A;  1PY3 A;  3QRD A;  5TGN A;  3CD6 3;  4JF8 A;  2OWP A;  3HIG A;  1BNG A;  1LOY A;  3K5T A;  3AGN A;  4HM4 B;  2XGL A;  4I5Q A;  1K41 A;  3LT9 A;  4MMX B;  2FNQ A;  4RNY A;  2HMM B;  5IG5 A;  4LMI A;  3D79 A;  3X3Y A;  2XSH B;  1RGH A;  2K3D A;  3G71 3;  1WMO A;  3GZY B;  1RNT A;  3JUP A;  3S67 A;  2F86 B;  1T2H A;  5AIG A;  4N3V A;  3CC7 3;  2KF6 A;  4WWU C;  2OQE A;  3EHC A;  3B8L A;  4EV2 A;  2E2T A;  1LOV A;  2Z76 A;  1GY5 A;  1TJD A;  2IMJ A;  5G1K A;  3CCM 3;  1FUS A;  4AKZ A;  4EYC A;  1K8A 4;  3IPT A;  3WMD A;  2HMK B;  2CW9 A;  1ASK A;  3FG1 A;  3DMC A;  3SVA A;  1VQ6 3;  2UX0 A;  3A5E A;  1W02 A;  1YI2 3;  1I2G A;  4NHF A;  1Q82 4;  2CFK A;  2QIY A;  2C4B A;  1R4C A;  2XEP A;  3LOY A;  1OPY A;  3DM8 A;  4I4K A;  1TUH A;  2PNC A;  4HBR A;  1Q81 4;  2O9U X;  3KZT A;  5JPP A;  1KC8 4;  3GZX B;  3Q2P A;  4FCJ A;  1BOX A;  2BU4 A;  3G16 A;  3JUQ A;  3FKA A;  1MGW A;  3HI7 A;  4N6V 0;  1TIJ A;  1FGQ A;  1B27 A;  2OTJ 3;  4HAA A;  1K28 A;  1FGR A;  4HM8 B;  1UCL A;  2WO0 A;  3CNX A;  3PCR A;  4NRE A;  4EC6 A;  3WDG B;  1D6U A;  3GZB A;  5AEW B;  1EG9 B;  1QAL A;  1M1X B;  1WQL B;  2D42 A;  1MGR A;  2H0H A;  3CMA 3;  4N6L A;  3S5C A;  1DE3 A;  2Z7A A;  2W56 B;  4XBT A;  2W6J H;  3MWZ A;  1BNI A;  2KCD A;  4HM3 B;  1D6Z A;  2GEY A;  1FUT A;  2FXT A;  1B2U A;  3N54 B;  2E2V A;  3OXA A;  5HGR A;  1FA3 A;  2B24 B;  2WGQ A;  3B4O A;  3EN1 B;  1QVG 2;  3O8Y A;  2PZV A;  3V98 A;  2P38 A;  2WOH A;  1E3V A;  2XF3 A;  4OVM A;  2MF7 A;  3D4A A;  1V74 A;  3FZW A;  5CF1 A;  1KQS 2;  3NM2 A;  4BU4 A;  1VQK 3;  2F4Y A;  7RNT A;  1NDO B;  3A76 A;  1RN7 A;  4KT3 B;  2H0G A;  1IT7 A;  4HM6 B;  1FGM A;  1LNI A;  3LTA A;  4KFD A;  4NPB A;  2K0M A;  1RN1 A;  4KZ1 A;  1RGL A;  2XR8 B;  3CNM A;  3UJM A;  2XRX B;  1NWW A;  4X2O A;  2C11 A;  1IT8 A;  3U97 A;  2AAD A;  2STD A;  3DZL A;  3GZR A;  3CCE 3;  3DY5 A;  2Z6B A;  1WMP A;  5AI1 A;  1ROA A;  2W03 A;  1IDP A;  1W6Y A;  1BRJ A;  1IVV A;  3WOD G;  5D81 A;  3FG4 A;  4KVH A;  3SED A;  4LEH A;  1BNJ A;  1DMN A;  3KII A;  2IA7 A;  3WOF B;  1RLS A;  1I3I A;  4L8P A;  1MNL A;  1A2V A;  1QMA A;  3NX0 A;  3G6E 3;  2OTL 3;  2W56 A;  1BSA A;  2F99 A;  1LOX A;  1TP6 A;  1B2S A;  3L0R A;  1O7G B;  2BMQ B;  1UCK A;  3MPH A;  2IYJ A;  2HMO B;  2ZHX B;  4H61 A;  1Q86 4;  3BNC A;  3CCR 3;  5IG0 A;  1NO3 A;  2GBX B;  5A0O B;  1Q40 B;  2CK3 H;  1OH0 A;  4XDW A;  1CYV A;  3LZA A;  3VF1 A;  2XH9 A;  1HZ1 A;  2WGO A;  4HM1 B;  5BIR A;  3V92 A;  2F5W A;  2YFJ B;  2W0Q A;  2JDI H;  3RDE A;  1UI8 A;  2KF3 A;  1MWU A;  1SAR A;  1OUN A;  2CH9 A;  3MSO A;  1YVS A;  4O2H A;  1YJW 3;  3OV4 A;  3CC4 3;  1KD1 4;  1SQW A;  1AQZ A;  4IPB A;  1LRA A;  4R9K A;  4ILF A;  3CCU 3;  2W2C A;  3BNB A;  3OWY A;  2A15 A;  1B2Z A;  2LQV A;  2GXF A;  1V58 A;  3EBT A;  3M8C A;  4FMD A;  4HZ9 B;  1N5P A;  1TRP A;  3EX9 A;  1B3S A;  2XSO B;  1FGO A;  5IEP A;  3FGY A;  1JB4 A;  1UUW B;  3AHW A;  4J9A A;  1W2Z A;  3UL5 A;  5BU4 A;  1BRN L;  1G02 A;  4MJD A;  2K54 A;  3K9M C;  3MG2 A;  3V99 A;  4WFO A;  2D1W A;  2KF5 A;  3CC2 3;  1RDS A;  2P0M A;  4RZM A;  1JN5 B;  1CEW I;  1ROV A;  2E2U A;  1JB2 A;  3SOY A;  2BIR A;  1K73 4;  1RRH A;  4OUQ A;  1JKG A;  3FH1 A;  3T8N A;  4CJN A;  1Q7Y 4;  1OF5 B;  5AEU B;  1LOW A;  3N9H A;  1W01 A;  1Z1S A;  3T0U A;  1Q40 A;  3F8X A;  5AIF A;  3STD A;  3CME 3;  1MOL A;  2J8X B;  3FG3 A;  1N8R 4;  3LYG A;  1VQ4 3;  1LXE A;  1UI7 A;  3ROB A;  4EW5 A;  3G4S 3;  3ECF A;  1BRI A;  3F14 A;  4IIA A;  4KFF A;  4J8T A;  1PFP A;  4WHA A;  3PCS A;  4J5G A;  1QJG A;  3DUK A;  3LTC A;  1Q7H A;  2QA4 3;  1YNV X;  3LH4 A;  1PYL A;  3NBB A;  1YIJ 3;  3RGA A;  4R1K A;  2BHM A;  3X3Z A;  3X41 A;  1X1U A;  3GRD A;  1L5G B;  2KF4 A;  2ZDJ A;  5HOH A;  4J5K A;  1W7C A;  3S27 A;  2RFR A;  1BAO A;  4JRF A;  3DH2 A;  3AGO A;  3T8U A;  1MWS A;  1RKY A;  3G0K A;  3F9S A;  5CF2 A;  1G96 A;  3BB9 A;  3E99 A;  3EBY A;  5BXQ A;  1NJI 4;  1STD A;  3GAX A;  1DMQ A;  4GHO A;  6STD A;  1GYB A;  3PXM A;  6RNT A;  3F7X A;  1JN5 A;  3D5G A;  2GU3 A;  1QVF 2;  4N6N B;  1A90 A;  1JRQ A;  5LC6 A;  3CPO A;  4L7K A;  3NBJ A;  5G1L A;  3JVC A;  1LNH A;  1W6G A;  2HOH A;  1OF5 A;  2CWU A;  1N8Q A;  3HX8 A;  3X40 A;  1F8N A;  2CWV A;  2RBI A;  1O7N B;  2CHC A;  4FCZ A;  1DYU A;  4H3U A;  1GMP A;  1GOU A;  3D9R A;  1EQK A;  1RRL A;  2O3O A;  1FYS A;  3RNT A;  4STD A;  1BUQ A;  1ZO2 A;  2RCD A;  3KN4 A;  4AKY A;  5IW9 A;  1CYU A;  2KAA A;  3EC9 A;  2GSP A;  5RNT A;  4HOH A;  2CWT A;  3X42 A;  4BL2 A;  4K90 B;  5EQL A;  4RNZ A;  2Y74 A;  3PYJ A;  2OOV A;  1IU7 A;  4CPK A;  4QWT A;  3DGO A;  1QAF A;  1N5H A;  5KP3 A;  1UDI I;  1BSE A;  4N6M A;  1BRH A;  2SAR A;  5FW5 A;  3CCS 3;  5DRE A;  1GD4 A;  3UB1 A;  5STD A;  2GU1 A;  2OOV C;  1QAK A;  4N6U A;  5CLK A;  5I97 A;  1YJ9 3;  2YX9 A;  4O3V A;  1I70 A;  1B2M A;  1YHQ 3;  3D5I A;  1IV7 A;  1HYF A;  1WTH A;  1IQY A;  3AHS A;  5GSP A;  1IV9 A;  1AR0 A;  1BSD A;  1U8C B;  2QGU A;  4HM5 B;  3DGN A;  1LQM B;  3WA3 A;  3URP A;  4FCM A;  4GB5 A;  5IG3 A;  1TFO A;  5AII A;  1V57 A;  3SXX A;  1SPU A;  3FCS B;  1LVN A;  3NQZ A;  4GL6 A;  1JB5 A;  1E97 A;  1GOY A;  2HMN B;  4HKV B;  4CCV A;  8CHO A;  1NB5 I;  1T5Y A;  3NBR A;  2IUJ A;  5ELJ A;  1SIH A;  1RGA A;  1JKG B;  1DVC A;  4LZI A;  1BRS A;  5JBS A;  2XFS A;  4HM7 B;  3CXC 2;  2P05 A; 
#chains in the Genus database with same CATH homology
 2RGQ A;  1NU3 A;  3OWS A;  2LYX A;  4FMA A;  5AYR B;  4N6T A;  5G2G A;  1YJN 3;  3LXU X;  1C7H A;  2Y73 A;  5D82 A;  2ML5 A;  3NUV A;  1IVU A;  1VQ8 3;  1OGZ A;  2BMO B;  1VZZ A;  2CKF B;  3EN8 A;  2KRT A;  4XB5 A;  1O7W B;  4BTX A;  1KWI A;  2YFI B;  4K1V A;  4U13 A;  3KSP A;  3JUO A;  5CXO A;  2W9P A;  1IQX A;  3LT8 A;  2OCT A;  4N6O B;  4WYK B;  3I56 3;  1VQ5 3;  1FGT A;  2CG1 A;  1GY6 A;  1OHO A;  4EV5 A;  4L8O A;  1A2K A;  5BVB A;  1K9M 4;  3CCJ 3;  2WOF A;  2ML6 A;  5IEN A;  4HYZ A;  4G1M B;  3F8H A;  2YFL B;  4FR9 A;  4BTW A;  5EVH A;  2CFL A;  3MKI A;  4EXR A;  4XDV A;  4R9L A;  3UNL A;  4KFE A;  1J2B A;  2BT3 A;  3KSE D;  2CG0 A;  2W04 A;  3ALA A;  2Q07 A;  2MC8 A;  1STF I;  1IVW A;  3NV0 A;  5AYS C;  1O7P B;  2CIU A;  1AVK A;  3NM7 A;  1JJ2 2;  2GEX A;  1KSI A;  4XBX A;  4TX4 A;  4CDL A;  3AMO B;  1VQ7 3;  4HM0 B;  2W9Q A;  2F98 A;  3DXO A;  3K7C A;  4HJL B;  4IT7 A;  5EEO A;  3EF8 A;  1OHS A;  1ISK A;  5IEO A;  1W2B 2;  3I55 3;  1GD3 A;  1FUW A;  1O7M B;  2ZL8 A;  1YGE A;  3UL6 A;  4OK0 A;  4HVN A;  1IQ8 A;  1W4N A;  3OX9 A;  4R80 A;  3IJE B;  4WYK A;  2GBW B;  4AEQ A;  4ZM8 A;  3N8B A;  3VSY A;  1GS3 A;  1EKM A;  4K1U A;  4WP5 A;  1ULJ B;  2BMR B;  1ZX2 A;  2OQE C;  1Q42 A;  3FF0 A;  4MMY B;  1EA2 A;  3KFQ C;  3CU3 A;  1YVB I;  3B7C A;  2BNG A;  1SII A;  3BLZ A;  3KE7 A;  2QEX 3;  3BND A;  1W5Z A;  3DGL A;  3MHE A;  1W00 A;  5IF6 A;  2CFW A;  4Q53 A;  2FGT A;  3H3H A;  4RBN A;  3CPW 2;  3S29 A;  1GY7 A;  5D83 A;  2INX A;  2SBL A;  5DRV A;  3I0Y A;  1HKX A;  1UW1 A;  3AMO A;  1WNH A;  3FF2 A;  4K61 A;  5AIH A;  3OWU A;  3LML A;  3K63 A;  3GWR A;  3DGM A;  4XBY A;  2V1L A;  3PGB A;  1NB3 I;  1CQS A;  3U1W A;  3HZP A;  1IK3 A;  1W6C A;  1O7H B;  2XGN A;  3HII A;  7STD A;  3EB8 A;  1M9G A;  4O8S A;  1JV2 B;  2M7O A;  3HK4 A;  5ELU A;  4PEJ A;  1D6Y A;  1RJO A;  4FMC A;  3D3L A;  1YIT 3;  4MEI A;  1OAC A;  2R4I A;  3K0Z A;  3QK9 A;  1M90 4;  2P09 A;  5JPU A;  2KXG A;  1US1 A;  4O02 B;  1SJW A;  1A67 A;  1OGX A;  5LC7 A;  3LTD A;  3VGN A;  1M1K 4;  2HMJ B;  5FGO A;  1AVL A;  2IUK A;  2B1X B;  4R4K A;  3EQQ B;  2P0X A;  1OCV A;  3ER7 A;  3SLU A;  3JUN A;  2CC3 A;  4LGQ A;  4HZB B;  3EJV A;  4ORL A;  3S28 A;  4EBG A;  4X2H A;  1TU5 A;  3NQY A;  5IER A;  2Z77 A;  1HU9 A;  5CK6 A;  3MG3 A;  3NV0 B;  1S72 3;  3JUM A;  3MG1 A;  2JQ5 A;  3SOA A;  1WMN A;  3OW2 2;  3Q90 A;  1TFK A;  3F40 A;  2XFT A;  3WA2 X;  4XM4 A;  2L4V A;  5IG4 A;  3EE1 A;  3WOE B;  3Q1C A;  3TDG A;  4MMZ B;  5KP1 A;  3FSD A;  1JNQ A;  1DVD A;  3FLJ A;  4HM2 B;  2CFG A;  1IVX A;  3KKG A;  1E3R A;  1UUV B;  3H51 A;  1U5O A;  3NXJ A;  1VQO 3;  3PZW A;  5KP4 A;  3CCL 3;  3J7Y d;  2RSX A;  3BNE A;  1Y4K A;  3B4P A;  2C10 A;  1VQL 3;  1VQP 3;  4LSO A;  3MYT A;  2HML B;  2I9W A;  3F7S A;  1VQM 3;  1S5A A;  3X3X A;  1PU4 A;  1VQ9 3;  3NHX A;  1DMM A;  1N9E A;  3LTB A;  1N9J A;  3IMA B;  3CCQ 3;  1VQN 3;  3SX1 A;  3G8Z A;  3PS8 A;  1AV4 A;  3RGR A;  4BTY A;  3CCV 3;  1ULI B;  4FMB A;  2BO9 B;  1OHP A;  2CFD A;  3QRD A;  5TGN A;  3CD6 3;  4JF8 A;  2OWP A;  3HIG A;  3K5T A;  4HM4 B;  4MMX B;  5AEU B;  2XGL A;  1K41 A;  3LT9 A;  4RNY A;  2FNQ A;  2HMM B;  5IG5 A;  4LMI A;  3X3Y A;  2XSH B;  3G71 3;  1WMO A;  3GZY B;  3JUP A;  3S67 A;  2F86 B;  5AIG A;  4N3V A;  3CC7 3;  4WWU C;  2OQE A;  3EHC A;  3B8L A;  4EV2 A;  2E2T A;  2Z76 A;  1GY5 A;  2IMJ A;  3CCM 3;  4AKZ A;  4EYC A;  1K8A 4;  3IPT A;  3WMD A;  2HMK B;  2CW9 A;  1ASK A;  3FG1 A;  3DMC A;  3SVA A;  1VQ6 3;  2UX0 A;  1W02 A;  1YI2 3;  4NHF A;  1Q82 4;  2CFK A;  2QIY A;  1R4C A;  2XEP A;  3LOY A;  1OPY A;  3DM8 A;  4I4K A;  1TUH A;  2PNC A;  4HBR A;  1Q81 4;  2O9U X;  3KZT A;  5JPP A;  1KC8 4;  3GZX B;  3Q2P A;  4FCJ A;  3G16 A;  3JUQ A;  3FKA A;  3HI7 A;  4N6V 0;  1TIJ A;  1FGQ A;  2OTJ 3;  1K28 A;  1FGR A;  4HM8 B;  2WO0 A;  3CNX A;  3PCR A;  4NRE A;  4EC6 A;  3WDG B;  1D6U A;  3GZB A;  5AEW B;  1EG9 B;  1QAL A;  1M1X B;  1WQL B;  2D42 A;  3CMA 3;  4N6L A;  3S5C A;  2Z7A A;  2W56 B;  4XBT A;  2W6J H;  3MWZ A;  2KCD A;  4HM3 B;  1D6Z A;  2GEY A;  2FXT A;  3N54 B;  3OXA A;  2E2V A;  5HGR A;  1FA3 A;  2B24 B;  2WGQ A;  3B4O A;  3EN1 B;  1QVG 2;  3O8Y A;  2PZV A;  3V98 A;  2P38 A;  2WOH A;  1E3V A;  2XF3 A;  4OVM A;  2MF7 A;  1V74 A;  3FZW A;  5CF1 A;  1KQS 2;  3NM2 A;  1VQK 3;  1NDO B;  3A76 A;  1RN7 A;  1IT7 A;  4HM6 B;  1FGM A;  3LTA A;  4KFD A;  2K0M A;  4KZ1 A;  2XR8 B;  3CNM A;  3UJM A;  2XRX B;  1NWW A;  4X2O A;  2C11 A;  1IT8 A;  3U97 A;  2STD A;  3DZL A;  3GZR A;  3CCE 3;  3DY5 A;  2Z6B A;  1WMP A;  5AI1 A;  1ROA A;  2W03 A;  1IDP A;  1W6Y A;  3WOD G;  1IVV A;  5D81 A;  3FG4 A;  4KVH A;  3SED A;  4LEH A;  1DMN A;  3KII A;  2IA7 A;  3WOF B;  4L8P A;  1MNL A;  1A2V A;  1QMA A;  3NX0 A;  3G6E 3;  2OTL 3;  2W56 A;  2F99 A;  1LOX A;  1TP6 A;  3L0R A;  1O7G B;  2BMQ B;  3MPH A;  2HMO B;  4H61 A;  1Q86 4;  3BNC A;  3CCR 3;  5IG0 A;  1NO3 A;  2GBX B;  5A0O B;  1Q40 B;  2CK3 H;  1OH0 A;  4XDW A;  1CYV A;  3LZA A;  3VF1 A;  2XH9 A;  2WGO A;  4HM1 B;  3V92 A;  2YFJ B;  2W0Q A;  2JDI H;  3RDE A;  1UI8 A;  2CH9 A;  1OUN A;  3MSO A;  4O2H A;  1YJW 3;  3OV4 A;  3CC4 3;  1KD1 4;  1SQW A;  4IPB A;  4R9K A;  3CCU 3;  2W2C A;  3BNB A;  3OWY A;  2A15 A;  2LQV A;  2GXF A;  3EBT A;  3M8C A;  4FMD A;  4HZ9 B;  1N5P A;  3EX9 A;  5IEP A;  2XSO B;  1FGO A;  3FGY A;  1JB4 A;  1UUW B;  4J9A A;  1W2Z A;  3UL5 A;  4MJD A;  2K54 A;  3K9M C;  3MG2 A;  3V99 A;  4WFO A;  2D1W A;  3CC2 3;  2P0M A;  4RZM A;  1JN5 B;  1CEW I;  1ROV A;  2E2U A;  1JB2 A;  3SOY A;  1K73 4;  1RRH A;  4OUQ A;  1JKG A;  3FH1 A;  3T8N A;  1Q7Y 4;  1OF5 B;  3N9H A;  1W01 A;  1Z1S A;  3T0U A;  1Q40 A;  3F8X A;  5AIF A;  3STD A;  3CME 3;  1MOL A;  3FG3 A;  1VQ4 3;  1N8R 4;  3LYG A;  1LXE A;  1UI7 A;  3ROB A;  3G4S 3;  3ECF A;  3F14 A;  4IIA A;  4KFF A;  4J8T A;  1PFP A;  4WHA A;  3PCS A;  2QA4 3;  1QJG A;  3DUK A;  3LTC A;  3LH4 A;  3NBB A;  1YIJ 3;  3RGA A;  4R1K A;  2BHM A;  3X3Z A;  3X41 A;  3GRD A;  1L5G B;  2ZDJ A;  1W7C A;  3S27 A;  2RFR A;  4JRF A;  3T8U A;  1RKY A;  3G0K A;  3F9S A;  5CF2 A;  1G96 A;  3BB9 A;  3E99 A;  3EBY A;  5BXQ A;  1NJI 4;  1STD A;  3GAX A;  1DMQ A;  6STD A;  1GYB A;  3PXM A;  3F7X A;  1JN5 A;  2GU3 A;  1QVF 2;  4N6N B;  1A90 A;  1JRQ A;  5LC6 A;  3CPO A;  4L7K A;  3NBJ A;  3JVC A;  1LNH A;  1W6G A;  3X40 A;  1OF5 A;  2CWU A;  1N8Q A;  3HX8 A;  1F8N A;  2CWV A;  4FCZ A;  1O7N B;  2CHC A;  4H3U A;  1DYU A;  3D9R A;  1EQK A;  1RRL A;  2O3O A;  1BUQ A;  4STD A;  1ZO2 A;  2RCD A;  3KN4 A;  4AKY A;  5IW9 A;  1CYU A;  3EC9 A;  2CWT A;  3X42 A;  4K90 B;  5EQL A;  4RNZ A;  2Y74 A;  3PYJ A;  2OOV A;  1IU7 A;  4QWT A;  3DGO A;  1QAF A;  1N5H A;  5KP3 A;  4N6M A;  3CCS 3;  5FW5 A;  5DRE A;  1GD4 A;  3UB1 A;  5STD A;  2GU1 A;  2OOV C;  1QAK A;  4N6U A;  5CLK A;  5I97 A;  1YJ9 3;  2YX9 A;  4O3V A;  1YHQ 3;  1IV7 A;  1WTH A;  1IQY A;  1IV9 A;  1AR0 A;  1U8C B;  2QGU A;  4HM5 B;  3DGN A;  3WA3 A;  4FCM A;  4GB5 A;  5IG3 A;  1TFO A;  5AII A;  3SXX A;  1SPU A;  3FCS B;  1LVN A;  3NQZ A;  4GL6 A;  1JB5 A;  1E97 A;  2HMN B;  4HKV B;  4CCV A;  8CHO A;  1NB5 I;  1T5Y A;  3NBR A;  2IUJ A;  5ELJ A;  1SIH A;  1JKG B;  1DVC A;  4LZI A;  5JBS A;  3CXC 2;  2XFS A;  4HM7 B;  2P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...