3LH4A

Crystal structure of sialostatin l2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
b'MELALRGGYRERSNQDDPEYLELAHYATSTWSAQQPGKTHFDTVVEVLKVETQTVAGTNYRLTLKVAESTCELTSTYNKDTCQANANAAQRTCTTVIYRNLQGEKSISSFECAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted cystatin
publication title The crystal structures of two salivary cystatins from the tick Ixodes scapularis and the effect of these inhibitors on the establishment of Borrelia burgdorferi infection in a murine model.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Hydrolase inhibitor
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lh4A00
1N9JA 1PFPA 3Q2PA 1KWIA 2CH9A 1A90A 1IV7A 2O9UX 3K9MC 4N6MA 4LZIA 4EYCA 1GD3A 5A0OB 1DVDA 3GAXA 1TIJA 3SVAA 1G96A 1MOLA 1LXEA 3L0RA 3LH4A 3MWZA 4N6TA 1FUWA 1IV9A 3PYJA 4TX4A 4IT7A 5ELJA 3UL6A 4ZM8A 3PXMA 2OCTA 4N6NB 4N6LA 5LC6A 3S67A 4N6OB 2KXGA 3UL5A 2W9PA 4N6V0 3IMAB 1CEWI 1A67A 4N6UA 4CCVA 3QRDA 1RN7A 1STFI 1ROAA 1M9GA 1R4CA 1NB5I 3NX0A 1N5PA 1FA3A 1EQKA 1CYUA 1GD4A 5EQLA 1DVCA 5ELUA 1MNLA 1N5HA 1YVBI 2BO9B 3KSED 3KFQC 1CYVA 5LC7A 2W9QA 1NB3I 3PS8A 1WNHA
chains in the Genus database with same CATH superfamily
2O3OA 3X3ZA 1PFPA 1YI23 4HM6B 4LMIA 2IUJA 3FG3A 2E2UA 3FLJA 4WYKB 1M1XB 2F5WA 4I5QA 1KWIA 4J5KA 3ECFA 1RCKA 1BRHA 1IT7A 1IV7A 1W7CA 5G1KA 5STDA 2XEPA 3MG1A 1O7GB 4H3UA 4OVMA 5M19A 5I97A 3CC43 2PNCA 3A76A 1JBSA 4WWUC 1AR0A 2GU3A 1ISKA 1BSEA 1I3IA 1OF5A 4X2HA 3KE7A 2B24B 2AADA 4L8OA 2SBLA 5HOHA 4XBYA 3OW22 1QMAA 5AIIA 1GD3A 3I0YA 3HX8A 1G0TA 1TFKA 2GEYA 3LTDA 3K63A 4CDLA 5AIGA 3S5CA 3B8LA 1UGIA 1EKMA 1MOLA 1LXEA 3LH4A 1O7MB 4HZBB 2CWVA 4LGQA 4XB5A 2Y73A 1YJ93 1VQN3 1GY6A 3EQQB 1IV9A 1OPYA 2UX0A 3PYJA 4K90B 5M18A 3AMOA 3CCL3 4IT7A 4JRFA 1NJI4 1MWSA 3MG2A 1BNIA 1ASKA 2D42A 1ZS7A 3PZWA 1E3VA 4CPKA 4HVNA 1R4YA 1I2EA 3UL6A 2Z7AA 3AGOA 4HKVB 3CCM3 1U8CB 3CNXA 1DYUA 1SJWA 2R4IA 2CFKA 3UB1A 6GSPA 1E3RA 3S67A 1JB4A 4N6OB 1OCVA 1NDOB 1QJGA 1I3FA 2CFGA 3GZYB 3DM8A 4LSOA 3UL5A 3FH1A 1VQ73 3CD63 3IPTA 2OQEC 3NQZA 5BVBA 3F7SA 2H0GA 3IMAB 1JV2B 3KN4A 2E2TA 3VSYA 2XSOB 1B21A 1TRPA 1L5GB 4CCVA 1GOYA 2BT3A 1RN7A 4IPBA 1GMRA 2CWTA 1Q864 1IVUA 5JBSA 3G6E3 1UUVB 1YJN3 1RGHA 3DUKA 1BGSA 1OGXA 3ALAA 1V58A 1I8VA 1CH0A 1M9GA 4HM8B 3U97A 1OHPA 1K9M4 2K0MA 2CG0A 4FMBA 2L1SA 4XBTA 2RBIA 1FA3A 2GXFA 4HAAA 3K5TA 4STDA 4MMXB 1GD4A 4GSPA 4I4KA 5RNTA 3OWYA 1DVCA 1B20A 2AAEA 1ZX2A 2W56A 3B7CA 5AIHA 1GOUA 1Y4KA 3MKIA 3DMCA 1MNLA 1MWRA 3CNMA 3LT9A 3NV0B 2HOHA 5HGRA 2RNTA 3BNBA 3G713 2CIUA 1N9EA 2F56A 1A2PA 3D79A 1IDPA 5D81A 2RGQA 1BVIA 4BIRA 3B4OA 1YIJ3 1MWUA 1AY7A 1RDSA 1VQ53 3SEDA 1VQ43 1E97A 5JPUA 1MGWA 4RBNA 1N8R4 1BSDA 3RDEA 1BUJA 2Z76A 4EV2A 2W9QA 3PGBA 2KAAA 4HM0B 4O3VA 3Q3FA 1KSIA 1NB3I 3NBJA 1T3BA 2Z77A 3GZRA 4O2HA 2K3DA 4FMAA 5GSPA 2Y74A 1T5YA 3WR2A 3S29A 7GSPA 1UI7A 3JUOA 1O7PB 1QVF2 1GMPA 2XH9A 1N9JA 3Q1CA 1BU4A 2XR8B 3LTAA 5TGNA 1W6YA 2OTL3 3S27A 4K1VA 3DXOA 1OGZA 5D83A 3ER7A 3Q2PA 4R9LA 1B2UA 1FGTA 1B27A 1X1XA 3EX9A 1IVXA 1A90A 5FW5A 1BUQA 3DGLA 3OWUA 3G16A 1VQM3 3AHWA 3NM7A 1SARA 3LT8A 1FGMA 1PY3A 2P09A 2UUGC 2C11A 4HM4B 2CKFB 1ULIB 2O9UX 2L4VA 1DMMA 2H0IA 3WDGB 3ZG0A 1SIHA 1VQQA 2OWPA 4R1KA 5BXQA 1KD14 1IYYA 1UI8A 3N54B 1MWTA 2YX9A 4GHOA 4LZIA 3V98A 4BTWA 1JBRA 1JZOA 2W04A 1RRHA 4J5GA 5A0OB 1MGRA 2GBWB 3H3HA 1DVDA 1W6CA 1B2XA 5KP1A 3GAXA 1FGOA 1O7NB 3WA2X 2H0HA 3KKGA 3SXXA 4QWTA 3U1WA 1HYFA 3I563 4GL6A 3MHEA 4OUQA 3L0RA 1FUWA 1OHSA 2C4BA 1B2MA 3T8UA 3LMLA 3F7XA 3H51A 1JKGA 1VQ83 7STDA 3MYTA 4KFDA 1TFOA 3CC23 4RNYA 2FXTA 1F8NA 4OK0A 1BRJA 1OF5B 1GOVA 1AQZA 2HMNB 3PXMA 3TDGA 4ZM8A 3LTCA 3K7CA 3KZTA 1FZUA 4N6NB 1BNEA 5LC6A 4K1UA 2SARA 1X1WA 3CME3 3STDA 2QGUA 1C54A 1WMNA 4BL2A 3BB9A 1GMQA 2W9PA 2BU4A 4K61A 3N9HA 5D82A 1LOWA 3ZG5A 2KRTA 3MG3A 1K41A 5IG3A 4G1MB 3DY5A 4N6V0 3A5EA 4J8TA 3Q90A 1LNIA 1JB5A 5IF6A 5IG0A 4HM5B 1SPUA 5CK6A 4L8PA 1OH0A 4ORLA 4N6UA 5G2GA 2OQEA 3DGMA 3T0UA 1X1YA 3AMOB 5IEOA 2Z6BA 1A2VA 4BTXA 2CW9A 3HZPA 1A2KA 3EBTA 2PZVA 1Z1SA 1JJ22 1NNVA 3M8CA 4EBGA 2FNQA 3FGYA 3E99A 3FG4A 4KT3B 2MC8A 3OX9A 2RCDA 5KP4A 1NO3A 1RMSA 1RN4A 3HIGA 1ZGXA 4XDWA 3I553 2CWUA 2XFSA 5EQLA 1S723 1OACA 4FCJA 1RRLA 5ELUA 3EE1A 3BNEA 3WHOA 3CCE3 3CCR3 2CFDA 1HKXA 3URPA 1M1K4 1QAFA 1RNTA 2BO9B 2C10A 3BU4A 3KSED 3KFQC 4J9AA 4LYLB 4O8SA 4AEQA 7RNTA 3GZBA 1UUWB 2QA43 3J7Yd 2P0XA 1VQK3 3LXUX 4HZ9B 1RGGA 4X2OA 5LC7A 3SOAA 2MF7A 2KF5A 3FG1A 1HZ1A 2CHCA 1D6UA 3KSPA 4NREA 2LYXA 4O02B 3WODG 2B1XB 2JDIH 2P0MA 1IQXA 1LQGC 3T8NA 3CCV3 3FF0A 2XF3A 3IJEB 3EHCA 3HOHA 2QEX3 2W56B 1TTOA 2GU1A 1B2ZA 1U5OA 2E2VA 2XSHB 5DREA 2F99A 3D5IA 5M1AA 1RGFA 2F86B 2XFTA 2ML6A 3EB8A 3O8YA 1X1UA 1M904 1B2SA 1AV4A 3EF8A 1UCJA 2W03A 2BHMA 5IG4A 3KIIA 3X42A 4BTYA 1BNGA 3CU3A 3OV4A 1DETA 1O7WB 5IEPA 1BSBA 1W6GA 3NBRA 5JPPA 1IK3A 4H61A 4XBXA 4NPBA 1I2GA 1WMOA 4HOHA 3WA3A 3DGYA 1UCKA 4KVHA 1CQSA 1DMNA 1DE3A 4FCMA 3F8HA 3NM2A 2W2CA 1YJW3 3LYGA 5CLKA 4WHAA 3CCU3 1VQP3 3F9SA 1UCIA 5AYRB 4EYCA 1LVNA 3HK4A 4HJLB 4AKZA 3QK9A 1Q9EA 1PYLA 1FW7A 1YVSA 4U13A 3CCS3 4AKYA 2ML5A 3D9RA 3CC73 3BNCA 3D4AA 2CC3A 1FUSA 3CPW2 2KF6A 4EXRA 1G96A 3SVAA 4N6TA 3MWZA 6RNTA 2F98A 1B3SA 1W01A 1ZO2A 1EEJA 1D6YA 1BSAA 2D1WA 2W0QA 3B4PA 4MEIA 1YIT3 3GZXB 1OUNA 2P05A 1S5AA 5FGOA 3X3XA 3JVCA 2ZA4A 4PEJA 1BRIA 4FCZA 3WOFB 2FGTA 1RSNA 1ULJB 1VQL3 4WP5A 2IY2A 2WO0A 1BOXA 3G8ZA 3MSOA 4CJNA 1YNVX 3BIRA 2KXGA 3MPHA 4IIAA 1JN5A 1JNQA 2UGIA 3NBBA 5EEOA 2XRXB 1BRGA 1SQWA 1CEWI 1I2FA 1TRQA 1TJDA 1RGCA 2WGOA 4RNTA 1JKGB 3K0ZA 3QRDA 2CFLA 3JUQA 4KFEA 1LOYA 1Q7Y4 1KQS2 1FGQA 3UNLA 1GS3A 1SIIA 2RFRA 1STFI 1YHQ3 1UCLA 2IMJA 2QIYA 2OOVA 3ZFZA 1EUIC 2F4YA 2ZHXB 3LTBA 5CF2A 3CCJ3 3DGOA 5AEUB 4HM2B 1IVWA 1R4CA 1NB5I 1C7HA 2CX0A 1BSCA 2HMOB 3NX0A 1BRNL 1QAKA 1N5PA 4N3VA 4HM3B 1GYBA 1VQ63 4MMYB 2BMQB 1Q40A 3FF2A 1K734 3CPOA 1WMPA 3G0KA 1AVKA 1JB2A 4HM1B 4XM4A 3SX1A 1D6ZA 1FGRA 1BRSA 1G02A 1ROVA 1STDA 2GEXA 2KCDA 4HM7B 3SLUA 2IYJA 4WYKA 1RNBA 1BRKA 3BLZA 2OOVC 1YGWA 3NHXA 2Q07A 3AHSA 3BNDA 2CK3H 5CXOA 1CYVA 2V1LA 1IU7A 3D5GA 4EC6A 1PU4A 4BU4A 3FKAA 3KCHA 2XGNA 8RNTA 3UJMA 4FR9A 2GSPA 1BNSA 1N8QA 3OXAA 4LEHA 3EC9A 5IERA 5IG5A 1QVG2 1EA2A 4RZMA 1IVVA 1TP6A 1LQMB 2RSXA 2WOFA 4RNZA 2CFWA 2IA7A 1Q814 1RGAA 2WOHA 1V74A 3DZLA 2WGQA 1IT8A 3HI7A 2CH9A 4FMCA 4R80A 2YFLB 3V99A 5IENA 3F14A 3SOYA 1WTHA 1K28A 1RLSA 1KC84 3HIIA 2J8XB 3FCSB 1RCLA 3EN8A 3FZWA 1W00A 3JUPA 1W4NA 1UGHI 2F5MA 3GSPA 2BMRB 3RNTA 3PCSA 1UUGB 1W2B2 1J2BA 5AYSC 3K9MC 4N6MA 3V92A 3DGNA 4L7KA 4JF8A 1JBTA 4NHFA 1AVLA 1RGEA 2HMJB 1TUHA 1NWWA 8CHOA 3NUVA 2ZL8A 2I9WA 3NQYA 1TIJA 3CCQ3 1LNHA 3EJVA 1RTUA 1BNJA 1RGLA 1Q824 1EG9B 1LOVA 1V57A 3CXC2 2M7OA 2INXA 1NU3A 4TX4A 4R9KA 3EBYA 2CG1A 1LOXA 1HU9A 5ELJA 2ZDJA 4KZ1A 1GSPA 1OHOA 1FYSA 1Q42A 2HMLB 3WMDA 1I0VA 2HMKB 4DKIA 1DMQA 1JZDA 2K54A 1BAOA 2OCTA 3RGRA 4N6LA 1BNRA 1YGEA 1UDII 1GY5A 3X40A 3JUMA 3EN1B 3VGNA 4R4KA 5G1LA 5EVHA 2STDA 3AGNA 2A15A 3D3LA 3FSDA 1QALA 3PCRA 3S28A 3VF1A 1VQO3 6STDA 1FUTA 1W02A 3N8BA 4Q53A 3X41A 1RKYA 2KF3A 1RN1A 2YFIB 1A67A 1VQ93 1RJOA 9RNTA 2XGLA 4GB5A 3ROBA 2KF4A 3LOYA 5BIRA 1TU5A 3NV0A 1GY7A 2BNGA 1ROAA 1BANA 2BMOB 2IUKA 2R41A 1T2HA 4BL3A 1I0XA 3JUNA 4ILFA 2YFJB 1K8A4 5DRVA 5IW9A 5AEWB 1W2ZA 4WFOA 1I70A 3GWRA 2BIRA 4HYZA 4EW5A 1BIRA 1JN5B 3LZAA 1EQKA 1CYUA 3WOEB 4HBRA 4MMZB 2HMMB 5AIFA 5KP3A 3CMA3 2P38A 2OTJ3 1N5HA 2JQ5A 1YVBI 1O7HB 3OWSA 3GRDA 5AI1A 3NXJA 3F40A 1VZZA 3DH2A 1IQYA 1US1A 2LQVA 1W5ZA 1RGKA 4FMDA 1JRQA 4XDVA 1BNFA 1Q7HA 3RGAA 3X3YA 4KFFA 3G4S3 1UW1A 2GBXB 1LRAA 1IQ8A 3F8XA 1T2IA 4MJDA 1Q40B 3PS8A 4EV5A 5BU4A 5CF1A 2CX1A 1RHLA 3SYUA 1WNHA 2W6JH 1WQLB
chains in the Genus database with same CATH topology
2O3OA 3X3ZA 1PFPA 1YI23 4HM6B 4LMIA 2IUJA 3FG3A 2E2UA 3FLJA 4WYKB 1M1XB 1KWIA 3ECFA 1IT7A 1IV7A 1W7CA 5STDA 2XEPA 3MG1A 1O7GB 4H3UA 4OVMA 5I97A 3CC43 2PNCA 3A76A 4WWUC 1AR0A 2GU3A 1ISKA 1OF5A 4X2HA 3OW22 3KE7A 2B24B 4L8OA 2SBLA 4XBYA 1QMAA 5AIIA 1GD3A 3I0YA 3HX8A 1TFKA 2GEYA 3LTDA 3K63A 4CDLA 5AIGA 3S5CA 3B8LA 1EKMA 1MOLA 1LXEA 3LH4A 1O7MB 4HZBB 2CWVA 4LGQA 4XB5A 2Y73A 1YJ93 1VQN3 1GY6A 3EQQB 1IV9A 1OPYA 2UX0A 3PYJA 4K90B 3AMOA 3CCL3 4IT7A 4JRFA 1NJI4 3MG2A 1ASKA 2D42A 3PZWA 1E3VA 4HVNA 3UL6A 2Z7AA 4HKVB 3CCM3 1U8CB 3CNXA 1DYUA 1SJWA 2R4IA 2CFKA 3UB1A 1E3RA 3S67A 1JB4A 4N6OB 1OCVA 1NDOB 1QJGA 2CFGA 3GZYB 4LSOA 3DM8A 3UL5A 3FH1A 1VQ73 3CD63 3IPTA 2OQEC 3NQZA 5BVBA 3F7SA 3KN4A 3IMAB 1JV2B 2E2TA 3VSYA 2XSOB 1L5GB 4CCVA 2BT3A 1RN7A 4IPBA 2CWTA 1Q864 1IVUA 5JBSA 3G6E3 1UUVB 3DUKA 1OGXA 3ALAA 1M9GA 4HM8B 3U97A 1OHPA 1K9M4 2K0MA 2CG0A 4FMBA 4XBTA 1FA3A 2GXFA 3K5TA 4STDA 4MMXB 1GD4A 4I4KA 3OWYA 1DVCA 3B7CA 1ZX2A 2W56A 5AIHA 1Y4KA 3MKIA 3DMCA 1MNLA 3CNMA 3LT9A 3NV0B 5HGRA 3BNBA 3G713 2CIUA 1N9EA 1IDPA 5D81A 2RGQA 1YIJ3 3B4OA 1VQ53 3SEDA 1VQ43 1E97A 5JPUA 4RBNA 1N8R4 3RDEA 2Z76A 4EV2A 2W9QA 3PGBA 4HM0B 4O3VA 1KSIA 1NB3I 3NBJA 2Z77A 3GZRA 4O2HA 4FMAA 2Y74A 1T5YA 3S29A 1UI7A 3JUOA 1O7PB 1QVF2 2XH9A 1N9JA 3Q1CA 2XR8B 3LTAA 5TGNA 1W6YA 2OTL3 3S27A 4K1VA 3DXOA 1OGZA 5D83A 3ER7A 3Q2PA 4R9LA 1FGTA 3EX9A 1IVXA 1A90A 5FW5A 1BUQA 3DGLA 3OWUA 3G16A 1VQM3 3NM7A 3LT8A 1FGMA 2P09A 4HM4B 2C11A 2CKFB 1ULIB 2O9UX 2L4VA 1DMMA 3WDGB 1SIHA 2OWPA 4R1KA 5BXQA 1KD14 1UI8A 3N54B 2YX9A 4LZIA 3V98A 4BTWA 2W04A 1RRHA 5A0OB 2GBWB 3H3HA 1DVDA 1W6CA 5KP1A 3GAXA 1FGOA 1O7NB 3WA2X 3KKGA 3SXXA 4QWTA 3U1WA 3I563 4GL6A 3MHEA 4OUQA 3L0RA 1FUWA 1OHSA 3T8UA 3LMLA 3F7XA 3H51A 1JKGA 1VQ83 7STDA 3MYTA 4KFDA 1TFOA 3CC23 4RNYA 2FXTA 1F8NA 4OK0A 1OF5B 2HMNB 3PXMA 3TDGA 4ZM8A 3LTCA 3K7CA 3KZTA 4N6NB 5LC6A 4K1UA 3CME3 3STDA 2QGUA 1WMNA 3BB9A 2W9PA 4K61A 5D82A 3N9HA 2KRTA 3MG3A 1K41A 5IG3A 4G1MB 3DY5A 4N6V0 5IF6A 4J8TA 3Q90A 1JB5A 5IG0A 4HM5B 1SPUA 5CK6A 4L8PA 1OH0A 4ORLA 4N6UA 5G2GA 2OQEA 3DGMA 3T0UA 3AMOB 5IEOA 2Z6BA 1A2VA 4BTXA 2CW9A 3HZPA 1A2KA 3EBTA 2PZVA 1Z1SA 1JJ22 3M8CA 4EBGA 2FNQA 3FGYA 3E99A 3FG4A 2MC8A 3OX9A 2RCDA 5KP4A 1NO3A 3HIGA 4XDWA 3I553 2CWUA 2XFSA 5EQLA 1S723 1OACA 4FCJA 1RRLA 5ELUA 3EE1A 3BNEA 3CCE3 3CCR3 2CFDA 1HKXA 1M1K4 1QAFA 4J9AA 2BO9B 2C10A 3KSED 3KFQC 4O8SA 4AEQA 3GZBA 1UUWB 2QA43 3J7Yd 2P0XA 1VQK3 3LXUX 4HZ9B 4X2OA 5LC7A 3SOAA 1YJN3 2MF7A 3FG1A 4NREA 2CHCA 1D6UA 3KSPA 2LYXA 4O02B 3WODG 2B1XB 2JDIH 2P0MA 1IQXA 3T8NA 3CCV3 3FF0A 2XF3A 3IJEB 3EHCA 2QEX3 2W56B 2GU1A 1U5OA 2E2VA 2XSHB 5DREA 2F99A 2F86B 2XFTA 2ML6A 3EB8A 3O8YA 1M904 3EF8A 1AV4A 2W03A 2BHMA 5IG4A 3KIIA 3X42A 4BTYA 3CU3A 3OV4A 1O7WB 5IEPA 1W6GA 3NBRA 5JPPA 1IK3A 4H61A 4XBXA 1WMOA 3WA3A 4KVHA 1CQSA 1DMNA 4FCMA 3F8HA 3NM2A 2W2CA 1YJW3 3LYGA 5CLKA 4WHAA 3CCU3 1VQP3 3F9SA 5AYRB 4EYCA 1LVNA 3HK4A 4HJLB 4AKZA 3QK9A 4U13A 3CCS3 4AKYA 2ML5A 3D9RA 3CC73 3BNCA 2CC3A 3CPW2 4EXRA 1G96A 3SVAA 4N6TA 3MWZA 2F98A 3B4PA 1W01A 1ZO2A 2D1WA 1D6YA 2W0QA 4MEIA 1YIT3 3GZXB 1OUNA 2P05A 1S5AA 5FGOA 3X3XA 3JVCA 4PEJA 4FCZA 3WOFB 2FGTA 1ULJB 1VQL3 4WP5A 2WO0A 3G8ZA 3MSOA 2KXGA 3MPHA 4IIAA 1JN5A 1JNQA 3NBBA 5EEOA 2XRXB 1SQWA 1CEWI 2WGOA 1JKGB 3K0ZA 3QRDA 2CFLA 3JUQA 4KFEA 1Q7Y4 1KQS2 1FGQA 3UNLA 1GS3A 2RFRA 1SIIA 1STFI 1YHQ3 2IMJA 2QIYA 2OOVA 3LTBA 3CCJ3 5CF2A 3DGOA 5AEUB 4HM2B 1IVWA 1R4CA 1NB5I 1C7HA 2HMOB 3NX0A 1QAKA 1N5PA 4N3VA 4HM3B 1GYBA 1VQ63 4MMYB 2BMQB 1Q40A 3FF2A 1K734 3CPOA 1WMPA 3G0KA 1AVKA 1JB2A 4HM1B 4XM4A 3SX1A 1D6ZA 1FGRA 1ROVA 2GEXA 1STDA 4HM7B 2KCDA 3SLUA 4WYKA 3BLZA 2OOVC 3NHXA 2Q07A 3BNDA 2CK3H 5CXOA 1CYVA 2V1LA 1IU7A 4EC6A 1PU4A 3FKAA 2XGNA 3UJMA 4FR9A 1N8QA 3OXAA 4LEHA 3EC9A 5IERA 5IG5A 1QVG2 1EA2A 4RZMA 1IVVA 1TP6A 2RSXA 2WOFA 4RNZA 2CFWA 2IA7A 1Q814 2WOHA 3DZLA 1V74A 3HI7A 2WGQA 1IT8A 4FMCA 2CH9A 4R80A 3V99A 2YFLB 5IENA 3F14A 3SOYA 1WTHA 1K28A 1KC84 3HIIA 3FCSB 3EN8A 3FZWA 1W00A 3JUPA 1W4NA 1W2B2 2BMRB 3PCSA 1J2BA 5AYSC 3K9MC 4N6MA 3V92A 3DGNA 4L7KA 4JF8A 4NHFA 1AVLA 2HMJB 1TUHA 1NWWA 8CHOA 3NUVA 2ZL8A 2I9WA 3NQYA 1TIJA 3CCQ3 1LNHA 3EJVA 1Q824 1EG9B 3CXC2 2M7OA 2INXA 1NU3A 4TX4A 4R9KA 3EBYA 2CG1A 1LOXA 1HU9A 5ELJA 2ZDJA 4KZ1A 1OHOA 1Q42A 2HMLB 3WMDA 2HMKB 1DMQA 2K54A 2OCTA 3RGRA 4N6LA 1YGEA 1GY5A 3X40A 3JUMA 3EN1B 3VGNA 4R4KA 5EVHA 2STDA 2A15A 3D3LA 3FSDA 1QALA 3PCRA 3S28A 3VF1A 1VQO3 6STDA 1W02A 3N8BA 4Q53A 3X41A 1RKYA 1A67A 2YFIB 1VQ93 1RJOA 2XGLA 4GB5A 3ROBA 3LOYA 1TU5A 3NV0A 1GY7A 2BNGA 1ROAA 2BMOB 2IUKA 3JUNA 2YFJB 1K8A4 5DRVA 5IW9A 5AEWB 1W2ZA 4WFOA 3GWRA 4HYZA 3LZAA 1JN5B 1EQKA 1CYUA 3WOEB 4HBRA 4MMZB 2HMMB 5AIFA 5KP3A 3CMA3 2P38A 2OTJ3 1N5HA 2JQ5A 1YVBI 1O7HB 3OWSA 3GRDA 5AI1A 3NXJA 3F40A 1VZZA 1IQYA 1US1A 2LQVA 1W5ZA 4FMDA 1JRQA 4XDVA 3G4S3 3X3YA 3RGAA 4KFFA 1UW1A 2GBXB 1IQ8A 3F8XA 4MJDA 1Q40B 3PS8A 4EV5A 5CF1A 1WNHA 2W6JH 1WQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9J A;  1PFP A;  3Q2P A;  1KWI A;  2CH9 A;  1A90 A;  1IV7 A;  2O9U X;  3K9M C;  4N6M A;  4LZI A;  4EYC A;  1GD3 A;  5A0O B;  1DVD A;  3GAX A;  1TIJ A;  3SVA A;  1G96 A;  1MOL A;  1LXE A;  3L0R A;  3LH4 A;  3MWZ A;  4N6T A;  1FUW A;  1IV9 A;  3PYJ A;  4TX4 A;  4IT7 A;  5ELJ A;  3UL6 A;  4ZM8 A;  3PXM A;  2OCT A;  4N6N B;  4N6L A;  5LC6 A;  3S67 A;  4N6O B;  2KXG A;  3UL5 A;  2W9P A;  4N6V 0;  3IMA B;  1CEW I;  1A67 A;  4N6U A;  4CCV A;  3QRD A;  1RN7 A;  1STF I;  1ROA A;  1M9G A;  1R4C A;  1NB5 I;  3NX0 A;  1N5P A;  1FA3 A;  1EQK A;  1CYU A;  1GD4 A;  5EQL A;  1DVC A;  5ELU A;  1MNL A;  1N5H A;  1YVB I;  2BO9 B;  3KSE D;  3KFQ C;  1CYV A;  5LC7 A;  2W9Q A;  1NB3 I;  3PS8 A;  1WNH A; 
#chains in the Genus database with same CATH topology
 2O3O A;  3X3Z A;  1PFP A;  1YI2 3;  4HM6 B;  4LMI A;  2IUJ A;  3FG3 A;  2E2U A;  3FLJ A;  4WYK B;  1M1X B;  2F5W A;  4I5Q A;  1KWI A;  4J5K A;  3ECF A;  1RCK A;  1BRH A;  1IT7 A;  1IV7 A;  1W7C A;  5G1K A;  5STD A;  2XEP A;  3MG1 A;  1O7G B;  4H3U A;  4OVM A;  5M19 A;  5I97 A;  3CC4 3;  2PNC A;  3A76 A;  1JBS A;  4WWU C;  1AR0 A;  2GU3 A;  1ISK A;  1BSE A;  1I3I A;  1OF5 A;  4X2H A;  3KE7 A;  2B24 B;  2AAD A;  4L8O A;  2SBL A;  5HOH A;  4XBY A;  3OW2 2;  1QMA A;  5AII A;  1GD3 A;  3I0Y A;  3HX8 A;  1G0T A;  1TFK A;  2GEY A;  3LTD A;  3K63 A;  4CDL A;  5AIG A;  3S5C A;  3B8L A;  1UGI A;  1EKM A;  1MOL A;  1LXE A;  3LH4 A;  1O7M B;  4HZB B;  2CWV A;  4LGQ A;  4XB5 A;  2Y73 A;  1YJ9 3;  1VQN 3;  1GY6 A;  3EQQ B;  1IV9 A;  1OPY A;  2UX0 A;  3PYJ A;  4K90 B;  5M18 A;  3AMO A;  3CCL 3;  4IT7 A;  4JRF A;  1NJI 4;  1MWS A;  3MG2 A;  1BNI A;  1ASK A;  2D42 A;  1ZS7 A;  3PZW A;  1E3V A;  4CPK A;  4HVN A;  1R4Y A;  1I2E A;  3UL6 A;  2Z7A A;  3AGO A;  4HKV B;  3CCM 3;  1U8C B;  3CNX A;  1DYU A;  1SJW A;  2R4I A;  2CFK A;  3UB1 A;  6GSP A;  1E3R A;  3S67 A;  1JB4 A;  4N6O B;  1OCV A;  1NDO B;  1QJG A;  1I3F A;  2CFG A;  3GZY B;  3DM8 A;  4LSO A;  3UL5 A;  3FH1 A;  1VQ7 3;  3CD6 3;  3IPT A;  2OQE C;  3NQZ A;  5BVB A;  3F7S A;  2H0G A;  3IMA B;  1JV2 B;  3KN4 A;  2E2T A;  3VSY A;  2XSO B;  1B21 A;  1TRP A;  1L5G B;  4CCV A;  1GOY A;  2BT3 A;  1RN7 A;  4IPB A;  1GMR A;  2CWT A;  1Q86 4;  1IVU A;  5JBS A;  3G6E 3;  1UUV B;  1YJN 3;  1RGH A;  3DUK A;  1BGS A;  1OGX A;  3ALA A;  1V58 A;  1I8V A;  1CH0 A;  1M9G A;  4HM8 B;  3U97 A;  1OHP A;  1K9M 4;  2K0M A;  2CG0 A;  4FMB A;  2L1S A;  4XBT A;  2RBI A;  1FA3 A;  2GXF A;  4HAA A;  3K5T A;  4STD A;  4MMX B;  1GD4 A;  4GSP A;  4I4K A;  5RNT A;  3OWY A;  1DVC A;  1B20 A;  2AAE A;  1ZX2 A;  2W56 A;  3B7C A;  5AIH A;  1GOU A;  1Y4K A;  3MKI A;  3DMC A;  1MNL A;  1MWR A;  3CNM A;  3LT9 A;  3NV0 B;  2HOH A;  5HGR A;  2RNT A;  3BNB A;  3G71 3;  2CIU A;  1N9E A;  2F56 A;  1A2P A;  3D79 A;  1IDP A;  5D81 A;  2RGQ A;  1BVI A;  4BIR A;  3B4O A;  1YIJ 3;  1MWU A;  1AY7 A;  1RDS A;  1VQ5 3;  3SED A;  1VQ4 3;  1E97 A;  5JPU A;  1MGW A;  4RBN A;  1N8R 4;  1BSD A;  3RDE A;  1BUJ A;  2Z76 A;  4EV2 A;  2W9Q A;  3PGB A;  2KAA A;  4HM0 B;  4O3V A;  3Q3F A;  1KSI A;  1NB3 I;  3NBJ A;  1T3B A;  2Z77 A;  3GZR A;  4O2H A;  2K3D A;  4FMA A;  5GSP A;  2Y74 A;  1T5Y A;  3WR2 A;  3S29 A;  7GSP A;  1UI7 A;  3JUO A;  1O7P B;  1QVF 2;  1GMP A;  2XH9 A;  1N9J A;  3Q1C A;  1BU4 A;  2XR8 B;  3LTA A;  5TGN A;  1W6Y A;  2OTL 3;  3S27 A;  4K1V A;  3DXO A;  1OGZ A;  5D83 A;  3ER7 A;  3Q2P A;  4R9L A;  1B2U A;  1FGT A;  1B27 A;  1X1X A;  3EX9 A;  1IVX A;  1A90 A;  5FW5 A;  1BUQ A;  3DGL A;  3OWU A;  3G16 A;  1VQM 3;  3AHW A;  3NM7 A;  1SAR A;  3LT8 A;  1FGM A;  1PY3 A;  2P09 A;  2UUG C;  2C11 A;  4HM4 B;  2CKF B;  1ULI B;  2O9U X;  2L4V A;  1DMM A;  2H0I A;  3WDG B;  3ZG0 A;  1SIH A;  1VQQ A;  2OWP A;  4R1K A;  5BXQ A;  1KD1 4;  1IYY A;  1UI8 A;  3N54 B;  1MWT A;  2YX9 A;  4GHO A;  4LZI A;  3V98 A;  4BTW A;  1JBR A;  1JZO A;  2W04 A;  1RRH A;  4J5G A;  5A0O B;  1MGR A;  2GBW B;  3H3H A;  1DVD A;  1W6C A;  1B2X A;  5KP1 A;  3GAX A;  1FGO A;  1O7N B;  3WA2 X;  2H0H A;  3KKG A;  3SXX A;  4QWT A;  3U1W A;  1HYF A;  3I56 3;  4GL6 A;  3MHE A;  4OUQ A;  3L0R A;  1FUW A;  1OHS A;  2C4B A;  1B2M A;  3T8U A;  3LML A;  3F7X A;  3H51 A;  1JKG A;  1VQ8 3;  7STD A;  3MYT A;  4KFD A;  1TFO A;  3CC2 3;  4RNY A;  2FXT A;  1F8N A;  4OK0 A;  1BRJ A;  1OF5 B;  1GOV A;  1AQZ A;  2HMN B;  3PXM A;  3TDG A;  4ZM8 A;  3LTC A;  3K7C A;  3KZT A;  1FZU A;  4N6N B;  1BNE A;  5LC6 A;  4K1U A;  2SAR A;  1X1W A;  3CME 3;  3STD A;  2QGU A;  1C54 A;  1WMN A;  4BL2 A;  3BB9 A;  1GMQ A;  2W9P A;  2BU4 A;  4K61 A;  3N9H A;  5D82 A;  1LOW A;  3ZG5 A;  2KRT A;  3MG3 A;  1K41 A;  5IG3 A;  4G1M B;  3DY5 A;  4N6V 0;  3A5E A;  4J8T A;  3Q90 A;  1LNI A;  1JB5 A;  5IF6 A;  5IG0 A;  4HM5 B;  1SPU A;  5CK6 A;  4L8P A;  1OH0 A;  4ORL A;  4N6U A;  5G2G A;  2OQE A;  3DGM A;  3T0U A;  1X1Y A;  3AMO B;  5IEO A;  2Z6B A;  1A2V A;  4BTX A;  2CW9 A;  3HZP A;  1A2K A;  3EBT A;  2PZV A;  1Z1S A;  1JJ2 2;  1NNV A;  3M8C A;  4EBG A;  2FNQ A;  3FGY A;  3E99 A;  3FG4 A;  4KT3 B;  2MC8 A;  3OX9 A;  2RCD A;  5KP4 A;  1NO3 A;  1RMS A;  1RN4 A;  3HIG A;  1ZGX A;  4XDW A;  3I55 3;  2CWU A;  2XFS A;  5EQL A;  1S72 3;  1OAC A;  4FCJ A;  1RRL A;  5ELU A;  3EE1 A;  3BNE A;  3WHO A;  3CCE 3;  3CCR 3;  2CFD A;  1HKX A;  3URP A;  1M1K 4;  1QAF A;  1RNT A;  2BO9 B;  2C10 A;  3BU4 A;  3KSE D;  3KFQ C;  4J9A A;  4LYL B;  4O8S A;  4AEQ A;  7RNT A;  3GZB A;  1UUW B;  2QA4 3;  3J7Y d;  2P0X A;  1VQK 3;  3LXU X;  4HZ9 B;  1RGG A;  4X2O A;  5LC7 A;  3SOA A;  2MF7 A;  2KF5 A;  3FG1 A;  1HZ1 A;  2CHC A;  1D6U A;  3KSP A;  4NRE A;  2LYX A;  4O02 B;  3WOD G;  2B1X B;  2JDI H;  2P0M A;  1IQX A;  1LQG C;  3T8N A;  3CCV 3;  3FF0 A;  2XF3 A;  3IJE B;  3EHC A;  3HOH A;  2QEX 3;  2W56 B;  1TTO A;  2GU1 A;  1B2Z A;  1U5O A;  2E2V A;  2XSH B;  5DRE A;  2F99 A;  3D5I A;  5M1A A;  1RGF A;  2F86 B;  2XFT A;  2ML6 A;  3EB8 A;  3O8Y A;  1X1U A;  1M90 4;  1B2S A;  1AV4 A;  3EF8 A;  1UCJ A;  2W03 A;  2BHM A;  5IG4 A;  3KII A;  3X42 A;  4BTY A;  1BNG A;  3CU3 A;  3OV4 A;  1DET A;  1O7W B;  5IEP A;  1BSB A;  1W6G A;  3NBR A;  5JPP A;  1IK3 A;  4H61 A;  4XBX A;  4NPB A;  1I2G A;  1WMO A;  4HOH A;  3WA3 A;  3DGY A;  1UCK A;  4KVH A;  1CQS A;  1DMN A;  1DE3 A;  4FCM A;  3F8H A;  3NM2 A;  2W2C A;  1YJW 3;  3LYG A;  5CLK A;  4WHA A;  3CCU 3;  1VQP 3;  3F9S A;  1UCI A;  5AYR B;  4EYC A;  1LVN A;  3HK4 A;  4HJL B;  4AKZ A;  3QK9 A;  1Q9E A;  1PYL A;  1FW7 A;  1YVS A;  4U13 A;  3CCS 3;  4AKY A;  2ML5 A;  3D9R A;  3CC7 3;  3BNC A;  3D4A A;  2CC3 A;  1FUS A;  3CPW 2;  2KF6 A;  4EXR A;  1G96 A;  3SVA A;  4N6T A;  3MWZ A;  6RNT A;  2F98 A;  1B3S A;  1W01 A;  1ZO2 A;  1EEJ A;  1D6Y A;  1BSA A;  2D1W A;  2W0Q A;  3B4P A;  4MEI A;  1YIT 3;  3GZX B;  1OUN A;  2P05 A;  1S5A A;  5FGO A;  3X3X A;  3JVC A;  2ZA4 A;  4PEJ A;  1BRI A;  4FCZ A;  3WOF B;  2FGT A;  1RSN A;  1ULJ B;  1VQL 3;  4WP5 A;  2IY2 A;  2WO0 A;  1BOX A;  3G8Z A;  3MSO A;  4CJN A;  1YNV X;  3BIR A;  2KXG A;  3MPH A;  4IIA A;  1JN5 A;  1JNQ A;  2UGI A;  3NBB A;  5EEO A;  2XRX B;  1BRG A;  1SQW A;  1CEW I;  1I2F A;  1TRQ A;  1TJD A;  1RGC A;  2WGO A;  4RNT A;  1JKG B;  3K0Z A;  3QRD A;  2CFL A;  3JUQ A;  4KFE A;  1LOY A;  1Q7Y 4;  1KQS 2;  1FGQ A;  3UNL A;  1GS3 A;  1SII A;  2RFR A;  1STF I;  1YHQ 3;  1UCL A;  2IMJ A;  2QIY A;  2OOV A;  3ZFZ A;  1EUI C;  2F4Y A;  2ZHX B;  3LTB A;  5CF2 A;  3CCJ 3;  3DGO A;  5AEU B;  4HM2 B;  1IVW A;  1R4C A;  1NB5 I;  1C7H A;  2CX0 A;  1BSC A;  2HMO B;  3NX0 A;  1BRN L;  1QAK A;  1N5P A;  4N3V A;  4HM3 B;  1GYB A;  1VQ6 3;  4MMY B;  2BMQ B;  1Q40 A;  3FF2 A;  1K73 4;  3CPO A;  1WMP A;  3G0K A;  1AVK A;  1JB2 A;  4HM1 B;  4XM4 A;  3SX1 A;  1D6Z A;  1FGR A;  1BRS A;  1G02 A;  1ROV A;  1STD A;  2GEX A;  2KCD A;  4HM7 B;  3SLU A;  2IYJ A;  4WYK A;  1RNB A;  1BRK A;  3BLZ A;  2OOV C;  1YGW A;  3NHX A;  2Q07 A;  3AHS A;  3BND A;  2CK3 H;  5CXO A;  1CYV A;  2V1L A;  1IU7 A;  3D5G A;  4EC6 A;  1PU4 A;  4BU4 A;  3FKA A;  3KCH A;  2XGN A;  8RNT A;  3UJM A;  4FR9 A;  2GSP A;  1BNS A;  1N8Q A;  3OXA A;  4LEH A;  3EC9 A;  5IER A;  5IG5 A;  1QVG 2;  1EA2 A;  4RZM A;  1IVV A;  1TP6 A;  1LQM B;  2RSX A;  2WOF A;  4RNZ A;  2CFW A;  2IA7 A;  1Q81 4;  1RGA A;  2WOH A;  1V74 A;  3DZL A;  2WGQ A;  1IT8 A;  3HI7 A;  2CH9 A;  4FMC A;  4R80 A;  2YFL B;  3V99 A;  5IEN A;  3F14 A;  3SOY A;  1WTH A;  1K28 A;  1RLS A;  1KC8 4;  3HII A;  2J8X B;  3FCS B;  1RCL A;  3EN8 A;  3FZW A;  1W00 A;  3JUP A;  1W4N A;  1UGH I;  2F5M A;  3GSP A;  2BMR B;  3RNT A;  3PCS A;  1UUG B;  1W2B 2;  1J2B A;  5AYS C;  3K9M C;  4N6M A;  3V92 A;  3DGN A;  4L7K A;  4JF8 A;  1JBT A;  4NHF A;  1AVL A;  1RGE A;  2HMJ B;  1TUH A;  1NWW A;  8CHO A;  3NUV A;  2ZL8 A;  2I9W A;  3NQY A;  1TIJ A;  3CCQ 3;  1LNH A;  3EJV A;  1RTU A;  1BNJ A;  1RGL A;  1Q82 4;  1EG9 B;  1LOV A;  1V57 A;  3CXC 2;  2M7O A;  2INX A;  1NU3 A;  4TX4 A;  4R9K A;  3EBY A;  2CG1 A;  1LOX A;  1HU9 A;  5ELJ A;  2ZDJ A;  4KZ1 A;  1GSP A;  1OHO A;  1FYS A;  1Q42 A;  2HML B;  3WMD A;  1I0V A;  2HMK B;  4DKI A;  1DMQ A;  1JZD A;  2K54 A;  1BAO A;  2OCT A;  3RGR A;  4N6L A;  1BNR A;  1YGE A;  1UDI I;  1GY5 A;  3X40 A;  3JUM A;  3EN1 B;  3VGN A;  4R4K A;  5G1L A;  5EVH A;  2STD A;  3AGN A;  2A15 A;  3D3L A;  3FSD A;  1QAL A;  3PCR A;  3S28 A;  3VF1 A;  1VQO 3;  6STD A;  1FUT A;  1W02 A;  3N8B A;  4Q53 A;  3X41 A;  1RKY A;  2KF3 A;  1RN1 A;  2YFI B;  1A67 A;  1VQ9 3;  1RJO A;  9RNT A;  2XGL A;  4GB5 A;  3ROB A;  2KF4 A;  3LOY A;  5BIR A;  1TU5 A;  3NV0 A;  1GY7 A;  2BNG A;  1ROA A;  1BAN A;  2BMO B;  2IUK A;  2R41 A;  1T2H A;  4BL3 A;  1I0X A;  3JUN A;  4ILF A;  2YFJ B;  1K8A 4;  5DRV A;  5IW9 A;  5AEW B;  1W2Z A;  4WFO A;  1I70 A;  3GWR A;  2BIR A;  4HYZ A;  4EW5 A;  1BIR A;  1JN5 B;  3LZA A;  1EQK A;  1CYU A;  3WOE B;  4HBR A;  4MMZ B;  2HMM B;  5AIF A;  5KP3 A;  3CMA 3;  2P38 A;  2OTJ 3;  1N5H A;  2JQ5 A;  1YVB I;  1O7H B;  3OWS A;  3GRD A;  5AI1 A;  3NXJ A;  3F40 A;  1VZZ A;  3DH2 A;  1IQY A;  1US1 A;  2LQV A;  1W5Z A;  1RGK A;  4FMD A;  1JRQ A;  4XDV A;  1BNF A;  1Q7H A;  3RGA A;  3X3Y A;  4KFF A;  3G4S 3;  1UW1 A;  2GBX B;  1LRA A;  1IQ8 A;  3F8X A;  1T2I A;  4MJD A;  1Q40 B;  3PS8 A;  4EV5 A;  5BU4 A;  5CF1 A;  2CX1 A;  1RHL A;  3SYU A;  1WNH A;  2W6J H;  1WQL B; 
#chains in the Genus database with same CATH homology
 2O3O A;  3X3Z A;  1PFP A;  1YI2 3;  4HM6 B;  4LMI A;  2IUJ A;  3FG3 A;  2E2U A;  3FLJ A;  4WYK B;  1M1X B;  1KWI A;  3ECF A;  1IT7 A;  1IV7 A;  1W7C A;  5STD A;  2XEP A;  3MG1 A;  1O7G B;  4H3U A;  4OVM A;  5I97 A;  3CC4 3;  2PNC A;  3A76 A;  4WWU C;  1AR0 A;  2GU3 A;  1ISK A;  1OF5 A;  4X2H A;  3OW2 2;  3KE7 A;  2B24 B;  4L8O A;  2SBL A;  4XBY A;  1QMA A;  5AII A;  1GD3 A;  3I0Y A;  3HX8 A;  1TFK A;  2GEY A;  3LTD A;  3K63 A;  4CDL A;  5AIG A;  3S5C A;  3B8L A;  1EKM A;  1MOL A;  1LXE A;  3LH4 A;  1O7M B;  4HZB B;  2CWV A;  4LGQ A;  4XB5 A;  2Y73 A;  1YJ9 3;  1VQN 3;  1GY6 A;  3EQQ B;  1IV9 A;  1OPY A;  2UX0 A;  3PYJ A;  4K90 B;  3AMO A;  3CCL 3;  4IT7 A;  4JRF A;  1NJI 4;  3MG2 A;  1ASK A;  2D42 A;  3PZW A;  1E3V A;  4HVN A;  3UL6 A;  2Z7A A;  4HKV B;  3CCM 3;  1U8C B;  3CNX A;  1DYU A;  1SJW A;  2R4I A;  2CFK A;  3UB1 A;  1E3R A;  3S67 A;  1JB4 A;  4N6O B;  1OCV A;  1NDO B;  1QJG A;  2CFG A;  3GZY B;  4LSO A;  3DM8 A;  3UL5 A;  3FH1 A;  1VQ7 3;  3CD6 3;  3IPT A;  2OQE C;  3NQZ A;  5BVB A;  3F7S A;  3KN4 A;  3IMA B;  1JV2 B;  2E2T A;  3VSY A;  2XSO B;  1L5G B;  4CCV A;  2BT3 A;  1RN7 A;  4IPB A;  2CWT A;  1Q86 4;  1IVU A;  5JBS A;  3G6E 3;  1UUV B;  3DUK A;  1OGX A;  3ALA A;  1M9G A;  4HM8 B;  3U97 A;  1OHP A;  1K9M 4;  2K0M A;  2CG0 A;  4FMB A;  4XBT A;  1FA3 A;  2GXF A;  3K5T A;  4STD A;  4MMX B;  1GD4 A;  4I4K A;  3OWY A;  1DVC A;  3B7C A;  1ZX2 A;  2W56 A;  5AIH A;  1Y4K A;  3MKI A;  3DMC A;  1MNL A;  3CNM A;  3LT9 A;  3NV0 B;  5HGR A;  3BNB A;  3G71 3;  2CIU A;  1N9E A;  1IDP A;  5D81 A;  2RGQ A;  1YIJ 3;  3B4O A;  1VQ5 3;  3SED A;  1VQ4 3;  1E97 A;  5JPU A;  4RBN A;  1N8R 4;  3RDE A;  2Z76 A;  4EV2 A;  2W9Q A;  3PGB A;  4HM0 B;  4O3V A;  1KSI A;  1NB3 I;  3NBJ A;  2Z77 A;  3GZR A;  4O2H A;  4FMA A;  2Y74 A;  1T5Y A;  3S29 A;  1UI7 A;  3JUO A;  1O7P B;  1QVF 2;  2XH9 A;  1N9J A;  3Q1C A;  2XR8 B;  3LTA A;  5TGN A;  1W6Y A;  2OTL 3;  3S27 A;  4K1V A;  3DXO A;  1OGZ A;  5D83 A;  3ER7 A;  3Q2P A;  4R9L A;  1FGT A;  3EX9 A;  1IVX A;  1A90 A;  5FW5 A;  1BUQ A;  3DGL A;  3OWU A;  3G16 A;  1VQM 3;  3NM7 A;  3LT8 A;  1FGM A;  2P09 A;  4HM4 B;  2C11 A;  2CKF B;  1ULI B;  2O9U X;  2L4V A;  1DMM A;  3WDG B;  1SIH A;  2OWP A;  4R1K A;  5BXQ A;  1KD1 4;  1UI8 A;  3N54 B;  2YX9 A;  4LZI A;  3V98 A;  4BTW A;  2W04 A;  1RRH A;  5A0O B;  2GBW B;  3H3H A;  1DVD A;  1W6C A;  5KP1 A;  3GAX A;  1FGO A;  1O7N B;  3WA2 X;  3KKG A;  3SXX A;  4QWT A;  3U1W A;  3I56 3;  4GL6 A;  3MHE A;  4OUQ A;  3L0R A;  1FUW A;  1OHS A;  3T8U A;  3LML A;  3F7X A;  3H51 A;  1JKG A;  1VQ8 3;  7STD A;  3MYT A;  4KFD A;  1TFO A;  3CC2 3;  4RNY A;  2FXT A;  1F8N A;  4OK0 A;  1OF5 B;  2HMN B;  3PXM A;  3TDG A;  4ZM8 A;  3LTC A;  3K7C A;  3KZT A;  4N6N B;  5LC6 A;  4K1U A;  3CME 3;  3STD A;  2QGU A;  1WMN A;  3BB9 A;  2W9P A;  4K61 A;  5D82 A;  3N9H A;  2KRT A;  3MG3 A;  1K41 A;  5IG3 A;  4G1M B;  3DY5 A;  4N6V 0;  5IF6 A;  4J8T A;  3Q90 A;  1JB5 A;  5IG0 A;  4HM5 B;  1SPU A;  5CK6 A;  4L8P A;  1OH0 A;  4ORL A;  4N6U A;  5G2G A;  2OQE A;  3DGM A;  3T0U A;  3AMO B;  5IEO A;  2Z6B A;  1A2V A;  4BTX A;  2CW9 A;  3HZP A;  1A2K A;  3EBT A;  2PZV A;  1Z1S A;  1JJ2 2;  3M8C A;  4EBG A;  2FNQ A;  3FGY A;  3E99 A;  3FG4 A;  2MC8 A;  3OX9 A;  2RCD A;  5KP4 A;  1NO3 A;  3HIG A;  4XDW A;  3I55 3;  2CWU A;  2XFS A;  5EQL A;  1S72 3;  1OAC A;  4FCJ A;  1RRL A;  5ELU A;  3EE1 A;  3BNE A;  3CCE 3;  3CCR 3;  2CFD A;  1HKX A;  1M1K 4;  1QAF A;  4J9A A;  2BO9 B;  2C10 A;  3KSE D;  3KFQ C;  4O8S A;  4AEQ A;  3GZB A;  1UUW B;  2QA4 3;  3J7Y d;  2P0X A;  1VQK 3;  3LXU X;  4HZ9 B;  4X2O A;  5LC7 A;  3SOA A;  1YJN 3;  2MF7 A;  3FG1 A;  4NRE A;  2CHC A;  1D6U A;  3KSP A;  2LYX A;  4O02 B;  3WOD G;  2B1X B;  2JDI H;  2P0M A;  1IQX A;  3T8N A;  3CCV 3;  3FF0 A;  2XF3 A;  3IJE B;  3EHC A;  2QEX 3;  2W56 B;  2GU1 A;  1U5O A;  2E2V A;  2XSH B;  5DRE A;  2F99 A;  2F86 B;  2XFT A;  2ML6 A;  3EB8 A;  3O8Y A;  1M90 4;  3EF8 A;  1AV4 A;  2W03 A;  2BHM A;  5IG4 A;  3KII A;  3X42 A;  4BTY A;  3CU3 A;  3OV4 A;  1O7W B;  5IEP A;  1W6G A;  3NBR A;  5JPP A;  1IK3 A;  4H61 A;  4XBX A;  1WMO A;  3WA3 A;  4KVH A;  1CQS A;  1DMN A;  4FCM A;  3F8H A;  3NM2 A;  2W2C A;  1YJW 3;  3LYG A;  5CLK A;  4WHA A;  3CCU 3;  1VQP 3;  3F9S A;  5AYR B;  4EYC A;  1LVN A;  3HK4 A;  4HJL B;  4AKZ A;  3QK9 A;  4U13 A;  3CCS 3;  4AKY A;  2ML5 A;  3D9R A;  3CC7 3;  3BNC A;  2CC3 A;  3CPW 2;  4EXR A;  1G96 A;  3SVA A;  4N6T A;  3MWZ A;  2F98 A;  3B4P A;  1W01 A;  1ZO2 A;  2D1W A;  1D6Y A;  2W0Q A;  4MEI A;  1YIT 3;  3GZX B;  1OUN A;  2P05 A;  1S5A A;  5FGO A;  3X3X A;  3JVC A;  4PEJ A;  4FCZ A;  3WOF B;  2FGT A;  1ULJ B;  1VQL 3;  4WP5 A;  2WO0 A;  3G8Z A;  3MSO A;  2KXG A;  3MPH A;  4IIA A;  1JN5 A;  1JNQ A;  3NBB A;  5EEO A;  2XRX B;  1SQW A;  1CEW I;  2WGO A;  1JKG B;  3K0Z A;  3QRD A;  2CFL A;  3JUQ A;  4KFE A;  1Q7Y 4;  1KQS 2;  1FGQ A;  3UNL A;  1GS3 A;  2RFR A;  1SII A;  1STF I;  1YHQ 3;  2IMJ A;  2QIY A;  2OOV A;  3LTB A;  3CCJ 3;  5CF2 A;  3DGO A;  5AEU B;  4HM2 B;  1IVW A;  1R4C A;  1NB5 I;  1C7H A;  2HMO B;  3NX0 A;  1QAK A;  1N5P A;  4N3V A;  4HM3 B;  1GYB A;  1VQ6 3;  4MMY B;  2BMQ B;  1Q40 A;  3FF2 A;  1K73 4;  3CPO A;  1WMP A;  3G0K A;  1AVK A;  1JB2 A;  4HM1 B;  4XM4 A;  3SX1 A;  1D6Z A;  1FGR A;  1ROV A;  2GEX A;  1STD A;  4HM7 B;  2KCD A;  3SLU A;  4WYK A;  3BLZ A;  2OOV C;  3NHX A;  2Q07 A;  3BND A;  2CK3 H;  5CXO A;  1CYV A;  2V1L A;  1IU7 A;  4EC6 A;  1PU4 A;  3FKA A;  2XGN A;  3UJM A;  4FR9 A;  1N8Q A;  3OXA A;  4LEH A;  3EC9 A;  5IER A;  5IG5 A;  1QVG 2;  1EA2 A;  4RZM A;  1IVV A;  1TP6 A;  2RSX A;  2WOF A;  4RNZ A;  2CFW A;  2IA7 A;  1Q81 4;  2WOH A;  3DZL A;  1V74 A;  3HI7 A;  2WGQ A;  1IT8 A;  4FMC A;  2CH9 A;  4R80 A;  3V99 A;  2YFL B;  5IEN A;  3F14 A;  3SOY A;  1WTH A;  1K28 A;  1KC8 4;  3HII A;  3FCS B;  3EN8 A;  3FZW A;  1W00 A;  3JUP A;  1W4N A;  1W2B 2;  2BMR B;  3PCS A;  1J2B A;  5AYS C;  3K9M C;  4N6M A;  3V92 A;  3DGN A;  4L7K A;  4JF8 A;  4NHF A;  1AVL A;  2HMJ B;  1TUH A;  1NWW A;  8CHO A;  3NUV A;  2ZL8 A;  2I9W A;  3NQY A;  1TIJ A;  3CCQ 3;  1LNH A;  3EJV A;  1Q82 4;  1EG9 B;  3CXC 2;  2M7O A;  2INX A;  1NU3 A;  4TX4 A;  4R9K A;  3EBY A;  2CG1 A;  1LOX A;  1HU9 A;  5ELJ A;  2ZDJ A;  4KZ1 A;  1OHO A;  1Q42 A;  2HML B;  3WMD A;  2HMK B;  1DMQ A;  2K54 A;  2OCT A;  3RGR A;  4N6L A;  1YGE A;  1GY5 A;  3X40 A;  3JUM A;  3EN1 B;  3VGN A;  4R4K A;  5EVH A;  2STD A;  2A15 A;  3D3L A;  3FSD A;  1QAL A;  3PCR A;  3S28 A;  3VF1 A;  1VQO 3;  6STD A;  1W02 A;  3N8B A;  4Q53 A;  3X41 A;  1RKY A;  1A67 A;  2YFI B;  1VQ9 3;  1RJO A;  2XGL A;  4GB5 A;  3ROB A;  3LOY A;  1TU5 A;  3NV0 A;  1GY7 A;  2BNG A;  1ROA A;  2BMO B;  2IUK A;  3JUN A;  2YFJ B;  1K8A 4;  5DRV A;  5IW9 A;  5AEW B;  1W2Z A;  4WFO A;  3GWR A;  4HYZ A;  3LZA A;  1JN5 B;  1EQK A;  1CYU A;  3WOE B;  4HBR A;  4MMZ B;  2HMM B;  5AIF A;  5KP3 A;  3CMA 3;  2P38 A;  2OTJ 3;  1N5H A;  2JQ5 A;  1YVB I;  1O7H B;  3OWS A;  3GRD A;  5AI1 A;  3NXJ A;  3F40 A;  1VZZ A;  1IQY A;  1US1 A;  2LQV A;  1W5Z A;  4FMD A;  1JRQ A;  4XDV A;  3G4S 3;  3X3Y A;  3RGA A;  4KFF A;  1UW1 A;  2GBX B;  1IQ8 A;  3F8X A;  4MJD A;  1Q40 B;  3PS8 A;  4EV5 A;  5CF1 A;  1WNH A;  2W6J H;  1WQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...