3LH4A

Crystal structure of sialostatin l2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
MELALRGGYRERSNQDDPEYLELAHYATSTWSAQQPGKTHFDTVVEVLKVETQTVAGTNYRLTLKVAESTCELTSTYNKDTCQANANAAQRTCTTVIYRNLQGEKSISSFECAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of two salivary cystatins from the tick Ixodes scapularis and the effect of these inhibitors on the establishment of Borrelia burgdorferi infection in a murine model.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Hydrolase inhibitor
molecule keywords Secreted cystatin
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lh4A00
3UL5A 1RN7A 2O9UX 1NB3I 3GAXA 4N6TA 1IV7A 1MNLA 1TIJA 2CH9A 3IMAB 1IV9A 3MWZA 2KXGA 1PFPA 3S67A 4IT7A 5A0OB 1A67A 1FUWA 1N9JA 1CEWI 4ZM8A 1LXEA 1MOLA 3SVAA 1DVDA 1N5HA 3NX0A 3PYJA 1CYUA 5LC7A 2BO9B 1ROAA 1GD3A 2W9QA 1NB5I 2OCTA 1R4CA 1STFI 1A90A 1WNHA 3QRDA 1FA3A 1DVCA 1EQKA 1CYVA 2W9PA 5ELJA 4CCVA 4N6NB 4LZIA 4N6OB 3PS8A 4N6V0 1KWIA 1N5PA 3Q2PA 5ELUA 3LH4A 4N6UA 1M9GA 1YVBI 4TX4A 3K9MC 4N6LA 1GD4A 3KSED 5LC6A 3UL6A 3PXMA 1G96A 5EQLA 3L0RA 3KFQC 4EYCA 4N6MA
chains in the Genus database with same CATH superfamily
1Y4KA 1OHSA 1A2KA 2LYXA 4K1VA 5CF1A 4EBGA 2UX0A 4IPBA 3G4S3 1I2FA 3G16A 1B2SA 1FUSA 3LTCA 1JJ22 1RGLA 1RGAA 2WOHA 4Q53A 3OWSA 1RSNA 3DGNA 4EV2A 5IENA 3S28A 2HMLB 4EV5A 1O7GB 1DMQA 1D6ZA 1FGTA 4WYKB 3F7XA 4LGQA 3WODG 1RN1A 1W5ZA 3PCSA 1EA2A 3DZLA 1Q7HA 1JN5B 1MGWA 1GS3A 4HM7B 3ALAA 1WMPA 1O7MB 3EN1B 2P0XA 2K54A 3SX1A 3X3ZA 5IF6A 2OTL3 2HMNB 3RGAA 3UL6A 1W6GA 3PXMA 1MWSA 2PNCA 3JUPA 1AVLA 1S5AA 4N6MA 3CCJ3 1IVUA 1JNQA 4FCJA 4BTXA 2XRXB 3AMOB 4KZ1A 1NDOB 1GY7A 1US1A 1CQSA 4K61A 1NWWA 2XFSA 2Z7AA 5DRVA 2HMJB 1BIRA 1ASKA 1N9EA 2WO0A 3EJVA 3EN8A 1T2HA 2CG1A 3UNLA 1YJW3 1GD3A 1YVSA 1R4YA 3BU4A 2L1SA 3E99A 4RBNA 3FLJA 1Q9EA 1VQ83 5KP1A 1GSPA 1EKMA 3NQYA 4X2OA 5I97A 3DM8A 1BNIA 1QALA 2RFRA 1VQO3 4HM6B 3JUQA 3CCE3 5JPUA 3CNXA 1RNBA 2CW9A 4HM1B 1IU7A 3B4OA 3S27A 3URPA 1TRPA 1KQS2 4I5QA 3K63A 1BAOA 5STDA 2BIRA 4WFOA 2D1WA 3JUMA 4FMDA 1UCKA 3HI7A 4O02B 5TGNA 1IV7A 1X1YA 1VZZA 1STDA 4DKIA 1VQM3 3FCSB 3WA2X 1VQN3 1W7CA 1RTUA 2HMKB 3CC73 2ZHXB 2H0HA 1GMRA 2SBLA 4HOHA 1VQ43 1BSEA 4HAAA 3HZPA 1T5YA 5AIGA 2ZDJA 3CCU3 1B2UA 1YJ93 3EB8A 2HMOB 2Z76A 4N6OB 3AGNA 1L5GB 1DMNA 2AAEA 3NV0B 1RN4A 1QAKA 1MWRA 4LYLB 1PU4A 1F8NA 4N6LA 3NBBA 4AKZA 1G96A 3NXJA 5BVBA 2KAAA 2W0QA 3A76A 5AYRB 1Q824 3LT8A 4CPKA 2E2TA 4N6TA 1BOXA 4QWTA 4NHFA 2UUGC 1TIJA 2FXTA 2V1LA 4HZBB 2KXGA 1FUWA 1I8VA 2AADA 2FNQA 2GBXB 3D5IA 3LMLA 3PYJA 4WYKA 3G713 1OUNA 1W2B2 3N8BA 4IIAA 4MMXB 1FZUA 1O7NB 4JRFA 2KRTA 3EE1A 4GSPA 4L8PA 5D83A 1D6UA 4XBXA 5JBSA 3QRDA 4HKVB 4O3VA 1JKGA 1E97A 2W56A 5KP4A 1K734 8CHOA 3Q2PA 1A2PA 3N9HA 4RNTA 3I0YA 3V99A 4GB5A 1IVWA 3F8HA 1DMMA 1HZ1A 3IPTA 1Q42A 1DYUA 3HIGA 3FF2A 1QVF2 1OF5A 1GOYA 1O7HB 2YFLB 3AMOA 3FKAA 1NB3I 5IG3A 3T8NA 1VQK3 1MNLA 3CMA3 2BMOB 4OUQA 1IV9A 2F98A 1ULIB 1NU3A 1BU4A 1PFPA 5IW9A 2KF5A 3WOEB 1GYBA 1OF5B 4FR9A 1VQ63 1V74A 4EW5A 6GSPA 5AIHA 2HOHA 1MWUA 1KD14 4G1MB 3KN4A 2OCTA 1GMPA 1GMQA 4O8SA 4XBYA 1TTOA 2YX9A 4RNZA 2W9PA 2BNGA 2P05A 1KWIA 1N5PA 2P38A 3FG1A 1M9GA 2C11A 1W2ZA 1JV2B 1W00A 2ZL8A 1FGMA 3K7CA 1YI23 2IY2A 3FGYA 3B7CA 5IEOA 3CC23 2GSPA 1VQQA 3KCHA 2OOVC 4NPBA 5BIRA 4O2HA 3STDA 4NREA 1LOXA 3X3YA 3OWUA 5A0OB 2CFLA 4AKYA 2KF4A 4R4KA 2Z77A 3NHXA 4HYZA 1IDPA 3MSOA 1DVDA 1N5HA 4FMAA 2F5WA 3F7SA 2BMQB 2IA7A 3QK9A 1DETA 1BRIA 1RGKA 3SEDA 1A90A 5CF2A 1PYLA 3DUKA 1JZOA 3S5CA 3EF8A 2KF3A 1T2IA 1W6CA 2FGTA 4XBTA 3UB1A 2CK3H 3LXUX 1TFOA 1A2VA 2Q07A 1FW7A 2CFKA 1V58A 1YGEA 3OXAA 4N3VA 2WGQA 3K0ZA 3B4PA 1O7WB 4BL3A 1BNJA 3FH1A 3CME3 3OW22 1LOVA 1K41A 4JF8A 1ZX2A 1BSAA 1W01A 2CH9A 1UCJA 3HK4A 1RNTA 1JB4A 1UUWB 1FUTA 1RCLA 3HIIA 3Q3FA 3X3XA 2O3OA 3KKGA 1B2XA 4HM0B 1PY3A 2W2CA 4I4KA 2R4IA 1IQYA 3BNEA 3N54B 1TUHA 4L7KA 1UI8A 1MWTA 1BNSA 5IG0A 1UGIA 1WNHA 4FMBA 2K3DA 1WQLB 2B24B 3X40A 4BTWA 4EC6A 3DMCA 1GY5A 2J8XB 1ISKA 4R1KA 2C4BA 1U8CB 1YVBI 3BLZA 3PZWA 5AIIA 3V92A 3KSED 5IERA 2IUJA 3U1WA 2B1XB 3SYUA 1IQXA 6STDA 1SIIA 2QIYA 2CFGA 3U97A 2MF7A 2E2VA 3ZFZA 1HU9A 3IMAB 2CHCA 3F14A 1OHOA 3WHOA 1X1UA 1CEWI 1I3IA 3GRDA 5JPPA 3O8YA 3WDGB 1RCKA 2I9WA 1J2BA 3I563 2BT3A 2CFWA 3OV4A 4FMCA 2IMJA 1Q864 3DXOA 4X2HA 4BL2A 1DE3A 2GEYA 3CD63 4KVHA 1I3FA 3X42A 1JN5A 3JUNA 1SARA 4LMIA 3LT9A 1BRNL 1IVXA 1E3VA 2CG0A 1ULJB 3LZAA 5AYSC 1RGGA 1KSIA 2KCDA 1WMOA 5KP3A 5BU4A 5FW5A 4EYCA 2F99A 2SARA 1YHQ3 1BRGA 3KE7A 1S723 2A15A 4HM5B 5AI1A 1RRLA 2OTJ3 3SOAA 1ZO2A 5GSPA 3BNCA 3GZBA 1MOLA 1QJGA 2L4VA 3CNMA 2GBWB 2IUKA 3DH2A 1SPUA 3LYGA 1CYUA 2H0IA 4PEJA 2BO9B 1AQZA 2WOFA 2OOVA 4CJNA 3CCM3 4BU4A 3UJMA 1DVCA 2Y73A 1OCVA 1OHPA 4XM4A 1BVIA 1JRQA 2QGUA 4TX4A 3CU3A 1BNGA 2D42A 3JVCA 4MJDA 1AV4A 1OGZA 1Q40A 1QAFA 4J9AA 4LSOA 3S29A 1UW1A 4KT3B 5EQLA 5IG4A 3FZWA 3EHCA 3PGBA 2ML5A 1HKXA 3AHSA 1IVVA 1W4NA 4H61A 3GAXA 2OWPA 4STDA 1RKYA 4J5GA 2XR8B 3EX9A 4IT7A 1OH0A 1OPYA 4J8TA 3OWYA 1UUGB 3RDEA 1QMAA 3F8XA 1FYSA 1M1K4 2BU4A 3HOHA 4MEIA 3VGNA 1JBRA 1JBSA 5FGOA 4LEHA 3LTDA 1JB5A 1OGXA 1RLSA 5CLKA 5HOHA 1RGFA 3CCQ3 7GSPA 2CWVA 4N6NB 2RSXA 3ZG0A 4N6UA 2XGNA 4KFDA 3F40A 3K9MC 4H3UA 2BMRB 3TDGA 1GD4A 5DREA 1Q814 1K8A4 1I70A 1RGCA 4J5KA 1IYYA 1N8QA 1UCIA 5M18A 3OX9A 2F4YA 1G0TA 3CXC2 1BNFA 4HM8B 1ZGXA 2CKFB 1N9JA 4ZM8A 5CXOA 3FG4A 4CDLA 3NM2A 5IG5A 2XH9A 3T8UA 5AEUB 5D82A 3J7Yd 3ER7A 3NQZA 2Y74A 2K0MA 1RGEA 1BUQA 1SQWA 1RMSA 3CCS3 3BNDA 1BSBA 1GOUA 1JZDA 2CX1A 1RDSA 1JBTA 2C10A 4HBRA 2BHMA 1C54A 1BGSA 1WMNA 1BSCA 1TFKA 1U5OA 5RNTA 3RNTA 2W04A 1YGWA 3F9SA 1LNHA 3MPHA 1UGHI 2LQVA 1BNRA 5EEOA 1D6YA 2XSOB 1UI7A 1BRSA 1B21A 3LOYA 1RN7A 3UL5A 2W6JH 1TU5A 1VQ73 4BTYA 4HJLB 4R80A 4XDWA 3BB9A 1EUIC 2CX0A 3D9RA 3LTBA 1QVG2 1LNIA 5M1AA 2YFIB 1Z1SA 2XF3A 3NBRA 1YJN3 1NB5I 1BUJA 1B3SA 1X1XA 3ECFA 1BRKA 3WR2A 1UUVB 1MGRA 2OQEC 4WHAA 1TP6A 3H51A 3KIIA 2CWTA 3K5TA 4N6V0 3LH4A 2XEPA 5AIFA 1RJOA 2XSHB 3WOFB 3GWRA 4U13A 3IJEB 5EVHA 3VSYA 3D4AA 2H0GA 4R9KA 3B8LA 3SLUA 5M19A 6RNTA 5G1KA 2F56A 4K1UA 3FG3A 4RNYA 3AGOA 3GZYB 5HGRA 7RNTA 2PZVA 2YFJB 2CWUA 3MG2A 4ORLA 5BXQA 1RRHA 3NBJA 5LC7A 3BIRA 1B27A 1SIHA 2RNTA 1STFI 3DGOA 4WP5A 3EBTA 1VQ93 1N8R4 1JKGB 1TRQA 2GU1A 3CCV3 1B2MA 1CYVA 2Z6BA 3NM7A 1T3BA 5D81A 1LQGC 1BSDA 2F86B 3DGLA 2W56B 1B2ZA 1B20A 2GEXA 3JUOA 2XGLA 3EBYA 9RNTA 1LOYA 1LRAA 3G0KA 3EC9A 4RZMA 3A5EA 3WMDA 2CC3A 1OACA 1HYFA 1UCLA 3G6E3 4R9LA 3KFQC 2JQ5A 2W03A 3GSPA 1IT8A 1CH0A 3Q90A 4HVNA 1M1XB 5AEWB 4XDVA 5IEPA 2CIUA 2R41A 4HM3B 1BRHA 1TJDA 4L8OA 3V98A 1EG9B 3MG3A 4KFEA 4OK0A 2KF6A 3NUVA 4OVMA 5G1LA 4HM4B 1E3RA 3T0UA 1ROAA 3M8CA 3D5GA 1AVKA 4FCMA 1YIT3 3LTAA 1G02A 2HMMB 5G2GA 3RGRA 4CCVA 1BRJA 2GXFA 1IT7A 2P09A 2ZA4A 2QA43 3KZTA 1W6YA 3MG1A 2M7OA 5LC6A 3I553 3ZG5A 1BNEA 1I0VA 1EQKA 1BANA 1I0XA 3DY5A 3GZXB 4FCZA 8RNTA 2O9UX 2STDA 1LOWA 1W02A 4GHOA 3MWZA 3Q1CA 3SXXA 1NJI4 4EXRA 1RHLA 1EEJA 2QEX3 1LXEA 3G8ZA 2CFDA 2ML6A 1IQ8A 1AR0A 3MHEA 1C7HA 1R4CA 1GOVA 4KFFA 1K28A 3MYTA 1I2EA 3PCRA 1O7PB 1M904 5ELJA 1Q7Y4 2F5MA 1AY7A 1SJWA 2WGOA 5ELUA 1WTHA 1ZS7A 2UGIA 4HZ9B 3VF1A 7STDA 4MMZB 2P0MA 1V57A 3D79A 3L0RA 1X1WA 2IYJA 2INXA 1GY6A 3CPOA 3EQQB 3SOYA 1YNVX 4XB5A 1NO3A 3CCR3 4BIRA 4K90B 3S67A 3X41A 1ROVA 1A67A 1NNVA 1FGRA 2GU3A 1RGHA 3DGYA 3GZRA 3SVAA 3H3HA 4GL6A 1VQ53 3NX0A 5CK6A 1VQL3 3CPW2 1YIJ3 1JB2A 2W9QA 3BNBA 1FGQA 2XFTA 3KSPA 3FF0A 4HM2B 3NV0A 2RBIA 1LQMB 3D3LA 3FSDA 3ROBA 3CCL3 2OQEA 1K9M4 1FA3A 2RGQA 1KC84 4MMYB 3PS8A 2MC8A 1IK3A 1UDII 3MKIA 3CC43 1VQP3 1LVNA 2JDIH 4AEQA 3HX8A 4ILFA 1Q40B 2E2UA 3AHWA 4WWUC 1FGOA 4LZIA 2RCDA 3DGMA 1I2GA 3WA3A
chains in the Genus database with same CATH topology
1Y4KA 1OHSA 1A2KA 2LYXA 4K1VA 5CF1A 4EBGA 2UX0A 4IPBA 3G4S3 3G16A 3LTCA 1JJ22 2WOHA 4Q53A 3OWSA 3DGNA 4EV2A 5IENA 3S28A 2HMLB 4EV5A 1O7GB 1DMQA 1D6ZA 1FGTA 4WYKB 3F7XA 4LGQA 3WODG 1W5ZA 3PCSA 1EA2A 3DZLA 1JN5B 1GS3A 4HM7B 3ALAA 1WMPA 1O7MB 3EN1B 2P0XA 2K54A 3SX1A 3X3ZA 5IF6A 2OTL3 2HMNB 3RGAA 3UL6A 1W6GA 3PXMA 2PNCA 3JUPA 1AVLA 1S5AA 4N6MA 3CCJ3 1IVUA 1JNQA 4FCJA 4BTXA 2XRXB 3AMOB 4KZ1A 1NDOB 1GY7A 1US1A 1CQSA 4K61A 1NWWA 2XFSA 2Z7AA 5DRVA 2HMJB 1N9EA 1ASKA 3EJVA 2WO0A 3EN8A 2CG1A 3UNLA 1YJW3 1GD3A 3E99A 4RBNA 3FLJA 1VQ83 5KP1A 1EKMA 3NQYA 4X2OA 5I97A 3DM8A 1VQO3 1QALA 2RFRA 4HM6B 3JUQA 3CCE3 5JPUA 3CNXA 2CW9A 4HM1B 1IU7A 3B4OA 3S27A 1KQS2 3K63A 5STDA 4WFOA 2D1WA 3JUMA 4FMDA 3HI7A 4O02B 5TGNA 1IV7A 1VZZA 1STDA 1VQM3 3FCSB 3WA2X 1VQN3 1W7CA 3CC73 2HMKB 1VQ43 2SBLA 3HZPA 1T5YA 5AIGA 2ZDJA 3CCU3 1YJ93 3EB8A 2HMOB 2Z76A 4N6OB 1L5GB 1DMNA 3NV0B 1QAKA 1PU4A 1F8NA 4N6LA 3NBBA 4AKZA 1G96A 3NXJA 5BVBA 2W0QA 3A76A 5AYRB 1Q824 3LT8A 2E2TA 4N6TA 4QWTA 4NHFA 1TIJA 2FXTA 2V1LA 4HZBB 2KXGA 1FUWA 2FNQA 2GBXB 3PYJA 3LMLA 3G713 4WYKA 1W2B2 1OUNA 3N8BA 4IIAA 4MMXB 1O7NB 4JRFA 2KRTA 3EE1A 5D83A 4L8PA 1D6UA 4XBXA 5JBSA 3QRDA 4HKVB 4O3VA 1JKGA 1E97A 2W56A 5KP4A 1K734 8CHOA 3Q2PA 3V99A 3N9HA 3I0YA 4GB5A 1IVWA 3F8HA 1DMMA 3IPTA 1Q42A 1DYUA 3HIGA 3FF2A 1QVF2 1OF5A 1O7HB 2YFLB 3AMOA 3FKAA 1NB3I 5IG3A 3T8NA 1VQK3 1MNLA 3CMA3 2BMOB 4OUQA 1IV9A 2F98A 1ULIB 1NU3A 1PFPA 5IW9A 3WOEB 1GYBA 1OF5B 4FR9A 1VQ63 1V74A 5AIHA 1KD14 4G1MB 3KN4A 2OCTA 4O8SA 4XBYA 2YX9A 4RNZA 2W9PA 2BNGA 2P05A 1KWIA 1N5PA 2P38A 3FG1A 1M9GA 2C11A 1W2ZA 1JV2B 1W00A 2ZL8A 1FGMA 3K7CA 1YI23 3FGYA 3B7CA 5IEOA 3CC23 2OOVC 4O2HA 3STDA 4NREA 1LOXA 3X3YA 3OWUA 5A0OB 2CFLA 4AKYA 4R4KA 2Z77A 3NHXA 4HYZA 1IDPA 3MSOA 1DVDA 1N5HA 4FMAA 3F7SA 2BMQB 2IA7A 3QK9A 3SEDA 1A90A 5CF2A 3DUKA 3S5CA 3EF8A 1W6CA 2FGTA 4XBTA 3UB1A 2CK3H 3LXUX 1TFOA 1A2VA 2Q07A 2CFKA 1YGEA 4N3VA 3OXAA 2WGQA 3K0ZA 3B4PA 1O7WB 3OW22 3FH1A 3CME3 1K41A 4JF8A 1ZX2A 1W01A 2CH9A 3HK4A 1UUWB 1JB4A 3HIIA 3X3XA 2O3OA 3KKGA 4HM0B 2W2CA 4I4KA 2R4IA 1IQYA 3BNEA 3N54B 1TUHA 4L7KA 1UI8A 3X40A 4FMBA 1WNHA 1WQLB 2B24B 4BTWA 4EC6A 3DMCA 1GY5A 1ISKA 4R1KA 1U8CB 1YVBI 5AIIA 3BLZA 3PZWA 3V92A 3KSED 5IERA 2IUJA 3U1WA 2B1XB 1IQXA 6STDA 1SIIA 2QIYA 2CFGA 3U97A 2MF7A 2E2VA 1HU9A 3IMAB 2CHCA 3F14A 1OHOA 1CEWI 3GRDA 5JPPA 3O8YA 3WDGB 2I9WA 1J2BA 2BT3A 2CFWA 3OV4A 4FMCA 2IMJA 1Q864 3DXOA 4X2HA 2GEYA 3CD63 4KVHA 3X42A 1JN5A 3JUNA 4LMIA 3LT9A 1IVXA 1E3VA 2CG0A 1ULJB 3LZAA 5AYSC 1KSIA 2KCDA 1WMOA 5KP3A 5FW5A 4EYCA 2F99A 1YHQ3 3KE7A 1S723 2A15A 4HM5B 5AI1A 1RRLA 3SOAA 1ZO2A 3BNCA 3GZBA 1MOLA 1QJGA 2L4VA 3CNMA 2GBWB 2IUKA 3LYGA 1SPUA 1CYUA 4PEJA 2BO9B 2WOFA 2OOVA 3CCM3 3UJMA 1DVCA 2Y73A 1OCVA 1OHPA 4XM4A 2QGUA 1JRQA 4TX4A 3CU3A 4MJDA 2D42A 3JVCA 3S29A 1AV4A 1OGZA 1Q40A 1QAFA 4J9AA 4LSOA 5IG4A 1UW1A 5EQLA 3FZWA 3EHCA 3PGBA 2ML5A 1HKXA 4H61A 1IVVA 1W4NA 1RKYA 3GAXA 2OWPA 4STDA 2XR8B 3EX9A 4IT7A 1OH0A 1OPYA 4J8TA 3OWYA 3RDEA 1QMAA 3F8XA 1M1K4 4MEIA 3VGNA 5FGOA 4LEHA 3LTDA 1JB5A 1OGXA 5CLKA 3CCQ3 2CWVA 4N6NB 2RSXA 4N6UA 2XGNA 4KFDA 3F40A 3K9MC 4H3UA 2BMRB 3TDGA 1GD4A 5DREA 1Q814 1K8A4 1N8QA 3OX9A 3CXC2 4HM8B 2CKFB 1N9JA 4ZM8A 5CXOA 3FG4A 4CDLA 3NM2A 5IG5A 2XH9A 3T8UA 5AEUB 5D82A 3J7Yd 3ER7A 3NQZA 2Y74A 2K0MA 1BUQA 1SQWA 3CCS3 3BNDA 2C10A 4HBRA 2BHMA 1WMNA 1TFKA 1U5OA 2W04A 3F9SA 1LNHA 3MPHA 2LQVA 5EEOA 1D6YA 2XSOB 1UI7A 3LOYA 3UL5A 1RN7A 2W6JH 1TU5A 1VQ73 4BTYA 4HJLB 4R80A 4XDWA 3BB9A 3D9RA 3LTBA 1QVG2 2YFIB 1Z1SA 2XF3A 3NBRA 1YJN3 1NB5I 3ECFA 1UUVB 2OQEC 4WHAA 1TP6A 3H51A 3KIIA 2CWTA 3K5TA 3LH4A 2XEPA 5AIFA 1RJOA 2XSHB 3WOFB 3GWRA 4U13A 3IJEB 5EVHA 3VSYA 4R9KA 3B8LA 3SLUA 4K1UA 3FG3A 4RNYA 3GZYB 5HGRA 2PZVA 2YFJB 2CWUA 3MG2A 4ORLA 5BXQA 1RRHA 3NBJA 5LC7A 1SIHA 3DGOA 4WP5A 1STFI 3EBTA 1VQ93 1N8R4 1JKGB 3CCV3 2GU1A 1CYVA 2Z6BA 3NM7A 5D81A 5IG0A 4N6V0 2F86B 3DGLA 2W56B 3JUOA 3I563 2GEXA 2XGLA 3EBYA 3G0KA 3EC9A 4RZMA 3WMDA 2CC3A 1OACA 3G6E3 4R9LA 3KFQC 2JQ5A 2W03A 4HVNA 1IT8A 3Q90A 5AEWB 1M1XB 4XDVA 5IEPA 2CIUA 4HM3B 4L8OA 3V98A 1EG9B 3MG3A 4KFEA 4OK0A 3NUVA 4OVMA 4HM4B 1E3RA 3T0UA 1ROAA 3M8CA 4FCMA 1AVKA 1YIT3 3LTAA 2HMMB 5G2GA 3RGRA 4CCVA 2GXFA 1IT7A 2P09A 2QA43 3KZTA 1W6YA 3MG1A 2M7OA 5LC6A 3I553 1EQKA 3DY5A 3GZXB 4FCZA 2O9UX 2STDA 1W02A 3MWZA 3Q1CA 3SXXA 1NJI4 4EXRA 2QEX3 1LXEA 3G8ZA 2CFDA 2ML6A 1IQ8A 1AR0A 3MHEA 1C7HA 1R4CA 4KFFA 1K28A 3MYTA 3PCRA 1O7PB 1M904 5ELJA 1Q7Y4 2WGOA 1SJWA 5ELUA 1WTHA 4HZ9B 3VF1A 7STDA 4MMZB 2P0MA 3L0RA 2INXA 1GY6A 3CPOA 3EQQB 3SOYA 4XB5A 1NO3A 3CCR3 4K90B 3S67A 3X41A 1ROVA 1A67A 2GU3A 1FGRA 3SVAA 3GZRA 1VQ53 2OTJ3 3H3HA 4GL6A 3NX0A 5CK6A 1VQL3 3CPW2 1YIJ3 1JB2A 2W9QA 3BNBA 1FGQA 2XFTA 3KSPA 3FF0A 4HM2B 3NV0A 3D3LA 3FSDA 3ROBA 3CCL3 2OQEA 1K9M4 1FA3A 2RGQA 1KC84 4MMYB 3PS8A 2MC8A 1IK3A 3MKIA 3CC43 1VQP3 1LVNA 2JDIH 4AEQA 3HX8A 1Q40B 2E2UA 4WWUC 1FGOA 4LZIA 2RCDA 3DGMA 3WA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL5 A;  1RN7 A;  2O9U X;  1NB3 I;  3GAX A;  4N6T A;  1IV7 A;  1MNL A;  1TIJ A;  2CH9 A;  3IMA B;  1IV9 A;  3MWZ A;  2KXG A;  1PFP A;  3S67 A;  4IT7 A;  5A0O B;  1A67 A;  1FUW A;  1N9J A;  1CEW I;  4ZM8 A;  1LXE A;  1MOL A;  3SVA A;  1DVD A;  1N5H A;  3NX0 A;  3PYJ A;  1CYU A;  5LC7 A;  2BO9 B;  1ROA A;  1GD3 A;  2W9Q A;  1NB5 I;  2OCT A;  1R4C A;  1STF I;  1A90 A;  1WNH A;  3QRD A;  1FA3 A;  1DVC A;  1EQK A;  1CYV A;  2W9P A;  5ELJ A;  4CCV A;  4N6N B;  4LZI A;  4N6O B;  3PS8 A;  4N6V 0;  1KWI A;  1N5P A;  3Q2P A;  5ELU A;  3LH4 A;  4N6U A;  1M9G A;  1YVB I;  4TX4 A;  3K9M C;  4N6L A;  1GD4 A;  3KSE D;  5LC6 A;  3UL6 A;  3PXM A;  1G96 A;  5EQL A;  3L0R A;  3KFQ C;  4EYC A;  4N6M A; 
#chains in the Genus database with same CATH topology
 1Y4K A;  1OHS A;  1A2K A;  2LYX A;  4K1V A;  5CF1 A;  4EBG A;  2UX0 A;  4IPB A;  3G4S 3;  1I2F A;  3G16 A;  1B2S A;  1FUS A;  3LTC A;  1JJ2 2;  1RGL A;  1RGA A;  2WOH A;  4Q53 A;  3OWS A;  1RSN A;  3DGN A;  4EV2 A;  5IEN A;  3S28 A;  2HML B;  4EV5 A;  1O7G B;  1DMQ A;  1D6Z A;  1FGT A;  4WYK B;  3F7X A;  4LGQ A;  3WOD G;  1RN1 A;  1W5Z A;  3PCS A;  1EA2 A;  3DZL A;  1Q7H A;  1JN5 B;  1MGW A;  1GS3 A;  4HM7 B;  3ALA A;  1WMP A;  1O7M B;  3EN1 B;  2P0X A;  2K54 A;  3SX1 A;  3X3Z A;  5IF6 A;  2OTL 3;  2HMN B;  3RGA A;  3UL6 A;  1W6G A;  3PXM A;  1MWS A;  2PNC A;  3JUP A;  1AVL A;  1S5A A;  4N6M A;  3CCJ 3;  1IVU A;  1JNQ A;  4FCJ A;  4BTX A;  2XRX B;  3AMO B;  4KZ1 A;  1NDO B;  1GY7 A;  1US1 A;  1CQS A;  4K61 A;  1NWW A;  2XFS A;  2Z7A A;  5DRV A;  2HMJ B;  1BIR A;  1ASK A;  1N9E A;  2WO0 A;  3EJV A;  3EN8 A;  1T2H A;  2CG1 A;  3UNL A;  1YJW 3;  1GD3 A;  1YVS A;  1R4Y A;  3BU4 A;  2L1S A;  3E99 A;  4RBN A;  3FLJ A;  1Q9E A;  1VQ8 3;  5KP1 A;  1GSP A;  1EKM A;  3NQY A;  4X2O A;  5I97 A;  3DM8 A;  1BNI A;  1QAL A;  2RFR A;  1VQO 3;  4HM6 B;  3JUQ A;  3CCE 3;  5JPU A;  3CNX A;  1RNB A;  2CW9 A;  4HM1 B;  1IU7 A;  3B4O A;  3S27 A;  3URP A;  1TRP A;  1KQS 2;  4I5Q A;  3K63 A;  1BAO A;  5STD A;  2BIR A;  4WFO A;  2D1W A;  3JUM A;  4FMD A;  1UCK A;  3HI7 A;  4O02 B;  5TGN A;  1IV7 A;  1X1Y A;  1VZZ A;  1STD A;  4DKI A;  1VQM 3;  3FCS B;  3WA2 X;  1VQN 3;  1W7C A;  1RTU A;  2HMK B;  3CC7 3;  2ZHX B;  2H0H A;  1GMR A;  2SBL A;  4HOH A;  1VQ4 3;  1BSE A;  4HAA A;  3HZP A;  1T5Y A;  5AIG A;  2ZDJ A;  3CCU 3;  1B2U A;  1YJ9 3;  3EB8 A;  2HMO B;  2Z76 A;  4N6O B;  3AGN A;  1L5G B;  1DMN A;  2AAE A;  3NV0 B;  1RN4 A;  1QAK A;  1MWR A;  4LYL B;  1PU4 A;  1F8N A;  4N6L A;  3NBB A;  4AKZ A;  1G96 A;  3NXJ A;  5BVB A;  2KAA A;  2W0Q A;  3A76 A;  5AYR B;  1Q82 4;  3LT8 A;  4CPK A;  2E2T A;  4N6T A;  1BOX A;  4QWT A;  4NHF A;  2UUG C;  1TIJ A;  2FXT A;  2V1L A;  4HZB B;  2KXG A;  1FUW A;  1I8V A;  2AAD A;  2FNQ A;  2GBX B;  3D5I A;  3LML A;  3PYJ A;  4WYK A;  3G71 3;  1OUN A;  1W2B 2;  3N8B A;  4IIA A;  4MMX B;  1FZU A;  1O7N B;  4JRF A;  2KRT A;  3EE1 A;  4GSP A;  4L8P A;  5D83 A;  1D6U A;  4XBX A;  5JBS A;  3QRD A;  4HKV B;  4O3V A;  1JKG A;  1E97 A;  2W56 A;  5KP4 A;  1K73 4;  8CHO A;  3Q2P A;  1A2P A;  3N9H A;  4RNT A;  3I0Y A;  3V99 A;  4GB5 A;  1IVW A;  3F8H A;  1DMM A;  1HZ1 A;  3IPT A;  1Q42 A;  1DYU A;  3HIG A;  3FF2 A;  1QVF 2;  1OF5 A;  1GOY A;  1O7H B;  2YFL B;  3AMO A;  3FKA A;  1NB3 I;  5IG3 A;  3T8N A;  1VQK 3;  1MNL A;  3CMA 3;  2BMO B;  4OUQ A;  1IV9 A;  2F98 A;  1ULI B;  1NU3 A;  1BU4 A;  1PFP A;  5IW9 A;  2KF5 A;  3WOE B;  1GYB A;  1OF5 B;  4FR9 A;  1VQ6 3;  1V74 A;  4EW5 A;  6GSP A;  5AIH A;  2HOH A;  1MWU A;  1KD1 4;  4G1M B;  3KN4 A;  2OCT A;  1GMP A;  1GMQ A;  4O8S A;  4XBY A;  1TTO A;  2YX9 A;  4RNZ A;  2W9P A;  2BNG A;  2P05 A;  1KWI A;  1N5P A;  2P38 A;  3FG1 A;  1M9G A;  2C11 A;  1W2Z A;  1JV2 B;  1W00 A;  2ZL8 A;  1FGM A;  3K7C A;  1YI2 3;  2IY2 A;  3FGY A;  3B7C A;  5IEO A;  3CC2 3;  2GSP A;  1VQQ A;  3KCH A;  2OOV C;  4NPB A;  5BIR A;  4O2H A;  3STD A;  4NRE A;  1LOX A;  3X3Y A;  3OWU A;  5A0O B;  2CFL A;  4AKY A;  2KF4 A;  4R4K A;  2Z77 A;  3NHX A;  4HYZ A;  1IDP A;  3MSO A;  1DVD A;  1N5H A;  4FMA A;  2F5W A;  3F7S A;  2BMQ B;  2IA7 A;  3QK9 A;  1DET A;  1BRI A;  1RGK A;  3SED A;  1A90 A;  5CF2 A;  1PYL A;  3DUK A;  1JZO A;  3S5C A;  3EF8 A;  2KF3 A;  1T2I A;  1W6C A;  2FGT A;  4XBT A;  3UB1 A;  2CK3 H;  3LXU X;  1TFO A;  1A2V A;  2Q07 A;  1FW7 A;  2CFK A;  1V58 A;  1YGE A;  3OXA A;  4N3V A;  2WGQ A;  3K0Z A;  3B4P A;  1O7W B;  4BL3 A;  1BNJ A;  3FH1 A;  3CME 3;  3OW2 2;  1LOV A;  1K41 A;  4JF8 A;  1ZX2 A;  1BSA A;  1W01 A;  2CH9 A;  1UCJ A;  3HK4 A;  1RNT A;  1JB4 A;  1UUW B;  1FUT A;  1RCL A;  3HII A;  3Q3F A;  3X3X A;  2O3O A;  3KKG A;  1B2X A;  4HM0 B;  1PY3 A;  2W2C A;  4I4K A;  2R4I A;  1IQY A;  3BNE A;  3N54 B;  1TUH A;  4L7K A;  1UI8 A;  1MWT A;  1BNS A;  5IG0 A;  1UGI A;  1WNH A;  4FMB A;  2K3D A;  1WQL B;  2B24 B;  3X40 A;  4BTW A;  4EC6 A;  3DMC A;  1GY5 A;  2J8X B;  1ISK A;  4R1K A;  2C4B A;  1U8C B;  1YVB I;  3BLZ A;  3PZW A;  5AII A;  3V92 A;  3KSE D;  5IER A;  2IUJ A;  3U1W A;  2B1X B;  3SYU A;  1IQX A;  6STD A;  1SII A;  2QIY A;  2CFG A;  3U97 A;  2MF7 A;  2E2V A;  3ZFZ A;  1HU9 A;  3IMA B;  2CHC A;  3F14 A;  1OHO A;  3WHO A;  1X1U A;  1CEW I;  1I3I A;  3GRD A;  5JPP A;  3O8Y A;  3WDG B;  1RCK A;  2I9W A;  1J2B A;  3I56 3;  2BT3 A;  2CFW A;  3OV4 A;  4FMC A;  2IMJ A;  1Q86 4;  3DXO A;  4X2H A;  4BL2 A;  1DE3 A;  2GEY A;  3CD6 3;  4KVH A;  1I3F A;  3X42 A;  1JN5 A;  3JUN A;  1SAR A;  4LMI A;  3LT9 A;  1BRN L;  1IVX A;  1E3V A;  2CG0 A;  1ULJ B;  3LZA A;  5AYS C;  1RGG A;  1KSI A;  2KCD A;  1WMO A;  5KP3 A;  5BU4 A;  5FW5 A;  4EYC A;  2F99 A;  2SAR A;  1YHQ 3;  1BRG A;  3KE7 A;  1S72 3;  2A15 A;  4HM5 B;  5AI1 A;  1RRL A;  2OTJ 3;  3SOA A;  1ZO2 A;  5GSP A;  3BNC A;  3GZB A;  1MOL A;  1QJG A;  2L4V A;  3CNM A;  2GBW B;  2IUK A;  3DH2 A;  1SPU A;  3LYG A;  1CYU A;  2H0I A;  4PEJ A;  2BO9 B;  1AQZ A;  2WOF A;  2OOV A;  4CJN A;  3CCM 3;  4BU4 A;  3UJM A;  1DVC A;  2Y73 A;  1OCV A;  1OHP A;  4XM4 A;  1BVI A;  1JRQ A;  2QGU A;  4TX4 A;  3CU3 A;  1BNG A;  2D42 A;  3JVC A;  4MJD A;  1AV4 A;  1OGZ A;  1Q40 A;  1QAF A;  4J9A A;  4LSO A;  3S29 A;  1UW1 A;  4KT3 B;  5EQL A;  5IG4 A;  3FZW A;  3EHC A;  3PGB A;  2ML5 A;  1HKX A;  3AHS A;  1IVV A;  1W4N A;  4H61 A;  3GAX A;  2OWP A;  4STD A;  1RKY A;  4J5G A;  2XR8 B;  3EX9 A;  4IT7 A;  1OH0 A;  1OPY A;  4J8T A;  3OWY A;  1UUG B;  3RDE A;  1QMA A;  3F8X A;  1FYS A;  1M1K 4;  2BU4 A;  3HOH A;  4MEI A;  3VGN A;  1JBR A;  1JBS A;  5FGO A;  4LEH A;  3LTD A;  1JB5 A;  1OGX A;  1RLS A;  5CLK A;  5HOH A;  1RGF A;  3CCQ 3;  7GSP A;  2CWV A;  4N6N B;  2RSX A;  3ZG0 A;  4N6U A;  2XGN A;  4KFD A;  3F40 A;  3K9M C;  4H3U A;  2BMR B;  3TDG A;  1GD4 A;  5DRE A;  1Q81 4;  1K8A 4;  1I70 A;  1RGC A;  4J5K A;  1IYY A;  1N8Q A;  1UCI A;  5M18 A;  3OX9 A;  2F4Y A;  1G0T A;  3CXC 2;  1BNF A;  4HM8 B;  1ZGX A;  2CKF B;  1N9J A;  4ZM8 A;  5CXO A;  3FG4 A;  4CDL A;  3NM2 A;  5IG5 A;  2XH9 A;  3T8U A;  5AEU B;  5D82 A;  3J7Y d;  3ER7 A;  3NQZ A;  2Y74 A;  2K0M A;  1RGE A;  1BUQ A;  1SQW A;  1RMS A;  3CCS 3;  3BND A;  1BSB A;  1GOU A;  1JZD A;  2CX1 A;  1RDS A;  1JBT A;  2C10 A;  4HBR A;  2BHM A;  1C54 A;  1BGS A;  1WMN A;  1BSC A;  1TFK A;  1U5O A;  5RNT A;  3RNT A;  2W04 A;  1YGW A;  3F9S A;  1LNH A;  3MPH A;  1UGH I;  2LQV A;  1BNR A;  5EEO A;  1D6Y A;  2XSO B;  1UI7 A;  1BRS A;  1B21 A;  3LOY A;  1RN7 A;  3UL5 A;  2W6J H;  1TU5 A;  1VQ7 3;  4BTY A;  4HJL B;  4R80 A;  4XDW A;  3BB9 A;  1EUI C;  2CX0 A;  3D9R A;  3LTB A;  1QVG 2;  1LNI A;  5M1A A;  2YFI B;  1Z1S A;  2XF3 A;  3NBR A;  1YJN 3;  1NB5 I;  1BUJ A;  1B3S A;  1X1X A;  3ECF A;  1BRK A;  3WR2 A;  1UUV B;  1MGR A;  2OQE C;  4WHA A;  1TP6 A;  3H51 A;  3KII A;  2CWT A;  3K5T A;  4N6V 0;  3LH4 A;  2XEP A;  5AIF A;  1RJO A;  2XSH B;  3WOF B;  3GWR A;  4U13 A;  3IJE B;  5EVH A;  3VSY A;  3D4A A;  2H0G A;  4R9K A;  3B8L A;  3SLU A;  5M19 A;  6RNT A;  5G1K A;  2F56 A;  4K1U A;  3FG3 A;  4RNY A;  3AGO A;  3GZY B;  5HGR A;  7RNT A;  2PZV A;  2YFJ B;  2CWU A;  3MG2 A;  4ORL A;  5BXQ A;  1RRH A;  3NBJ A;  5LC7 A;  3BIR A;  1B27 A;  1SIH A;  2RNT A;  1STF I;  3DGO A;  4WP5 A;  3EBT A;  1VQ9 3;  1N8R 4;  1JKG B;  1TRQ A;  2GU1 A;  3CCV 3;  1B2M A;  1CYV A;  2Z6B A;  3NM7 A;  1T3B A;  5D81 A;  1LQG C;  1BSD A;  2F86 B;  3DGL A;  2W56 B;  1B2Z A;  1B20 A;  2GEX A;  3JUO A;  2XGL A;  3EBY A;  9RNT A;  1LOY A;  1LRA A;  3G0K A;  3EC9 A;  4RZM A;  3A5E A;  3WMD A;  2CC3 A;  1OAC A;  1HYF A;  1UCL A;  3G6E 3;  4R9L A;  3KFQ C;  2JQ5 A;  2W03 A;  3GSP A;  1IT8 A;  1CH0 A;  3Q90 A;  4HVN A;  1M1X B;  5AEW B;  4XDV A;  5IEP A;  2CIU A;  2R41 A;  4HM3 B;  1BRH A;  1TJD A;  4L8O A;  3V98 A;  1EG9 B;  3MG3 A;  4KFE A;  4OK0 A;  2KF6 A;  3NUV A;  4OVM A;  5G1L A;  4HM4 B;  1E3R A;  3T0U A;  1ROA A;  3M8C A;  3D5G A;  1AVK A;  4FCM A;  1YIT 3;  3LTA A;  1G02 A;  2HMM B;  5G2G A;  3RGR A;  4CCV A;  1BRJ A;  2GXF A;  1IT7 A;  2P09 A;  2ZA4 A;  2QA4 3;  3KZT A;  1W6Y A;  3MG1 A;  2M7O A;  5LC6 A;  3I55 3;  3ZG5 A;  1BNE A;  1I0V A;  1EQK A;  1BAN A;  1I0X A;  3DY5 A;  3GZX B;  4FCZ A;  8RNT A;  2O9U X;  2STD A;  1LOW A;  1W02 A;  4GHO A;  3MWZ A;  3Q1C A;  3SXX A;  1NJI 4;  4EXR A;  1RHL A;  1EEJ A;  2QEX 3;  1LXE A;  3G8Z A;  2CFD A;  2ML6 A;  1IQ8 A;  1AR0 A;  3MHE A;  1C7H A;  1R4C A;  1GOV A;  4KFF A;  1K28 A;  3MYT A;  1I2E A;  3PCR A;  1O7P B;  1M90 4;  5ELJ A;  1Q7Y 4;  2F5M A;  1AY7 A;  1SJW A;  2WGO A;  5ELU A;  1WTH A;  1ZS7 A;  2UGI A;  4HZ9 B;  3VF1 A;  7STD A;  4MMZ B;  2P0M A;  1V57 A;  3D79 A;  3L0R A;  1X1W A;  2IYJ A;  2INX A;  1GY6 A;  3CPO A;  3EQQ B;  3SOY A;  1YNV X;  4XB5 A;  1NO3 A;  3CCR 3;  4BIR A;  4K90 B;  3S67 A;  3X41 A;  1ROV A;  1A67 A;  1NNV A;  1FGR A;  2GU3 A;  1RGH A;  3DGY A;  3GZR A;  3SVA A;  3H3H A;  4GL6 A;  1VQ5 3;  3NX0 A;  5CK6 A;  1VQL 3;  3CPW 2;  1YIJ 3;  1JB2 A;  2W9Q A;  3BNB A;  1FGQ A;  2XFT A;  3KSP A;  3FF0 A;  4HM2 B;  3NV0 A;  2RBI A;  1LQM B;  3D3L A;  3FSD A;  3ROB A;  3CCL 3;  2OQE A;  1K9M 4;  1FA3 A;  2RGQ A;  1KC8 4;  4MMY B;  3PS8 A;  2MC8 A;  1IK3 A;  1UDI I;  3MKI A;  3CC4 3;  1VQP 3;  1LVN A;  2JDI H;  4AEQ A;  3HX8 A;  4ILF A;  1Q40 B;  2E2U A;  3AHW A;  4WWU C;  1FGO A;  4LZI A;  2RCD A;  3DGM A;  1I2G A;  3WA3 A; 
#chains in the Genus database with same CATH homology
 1Y4K A;  1OHS A;  1A2K A;  2LYX A;  4K1V A;  5CF1 A;  4EBG A;  2UX0 A;  4IPB A;  3G4S 3;  3G16 A;  3LTC A;  1JJ2 2;  2WOH A;  4Q53 A;  3OWS A;  3DGN A;  4EV2 A;  5IEN A;  3S28 A;  2HML B;  4EV5 A;  1O7G B;  1DMQ A;  1D6Z A;  1FGT A;  4WYK B;  3F7X A;  4LGQ A;  3WOD G;  1W5Z A;  3PCS A;  1EA2 A;  3DZL A;  1JN5 B;  1GS3 A;  4HM7 B;  3ALA A;  1WMP A;  1O7M B;  3EN1 B;  2P0X A;  2K54 A;  3SX1 A;  3X3Z A;  5IF6 A;  2OTL 3;  2HMN B;  3RGA A;  3UL6 A;  1W6G A;  3PXM A;  2PNC A;  3JUP A;  1AVL A;  1S5A A;  4N6M A;  3CCJ 3;  1IVU A;  1JNQ A;  4FCJ A;  4BTX A;  2XRX B;  3AMO B;  4KZ1 A;  1NDO B;  1GY7 A;  1US1 A;  1CQS A;  4K61 A;  1NWW A;  2XFS A;  2Z7A A;  5DRV A;  2HMJ B;  1N9E A;  1ASK A;  3EJV A;  2WO0 A;  3EN8 A;  2CG1 A;  3UNL A;  1YJW 3;  1GD3 A;  3E99 A;  4RBN A;  3FLJ A;  1VQ8 3;  5KP1 A;  1EKM A;  3NQY A;  4X2O A;  5I97 A;  3DM8 A;  1VQO 3;  1QAL A;  2RFR A;  4HM6 B;  3JUQ A;  3CCE 3;  5JPU A;  3CNX A;  2CW9 A;  4HM1 B;  1IU7 A;  3B4O A;  3S27 A;  1KQS 2;  3K63 A;  5STD A;  4WFO A;  2D1W A;  3JUM A;  4FMD A;  3HI7 A;  4O02 B;  5TGN A;  1IV7 A;  1VZZ A;  1STD A;  1VQM 3;  3FCS B;  3WA2 X;  1VQN 3;  1W7C A;  3CC7 3;  2HMK B;  1VQ4 3;  2SBL A;  3HZP A;  1T5Y A;  5AIG A;  2ZDJ A;  3CCU 3;  1YJ9 3;  3EB8 A;  2HMO B;  2Z76 A;  4N6O B;  1L5G B;  1DMN A;  3NV0 B;  1QAK A;  1PU4 A;  1F8N A;  4N6L A;  3NBB A;  4AKZ A;  1G96 A;  3NXJ A;  5BVB A;  2W0Q A;  3A76 A;  5AYR B;  1Q82 4;  3LT8 A;  2E2T A;  4N6T A;  4QWT A;  4NHF A;  1TIJ A;  2FXT A;  2V1L A;  4HZB B;  2KXG A;  1FUW A;  2FNQ A;  2GBX B;  3PYJ A;  3LML A;  3G71 3;  4WYK A;  1W2B 2;  1OUN A;  3N8B A;  4IIA A;  4MMX B;  1O7N B;  4JRF A;  2KRT A;  3EE1 A;  5D83 A;  4L8P A;  1D6U A;  4XBX A;  5JBS A;  3QRD A;  4HKV B;  4O3V A;  1JKG A;  1E97 A;  2W56 A;  5KP4 A;  1K73 4;  8CHO A;  3Q2P A;  3V99 A;  3N9H A;  3I0Y A;  4GB5 A;  1IVW A;  3F8H A;  1DMM A;  3IPT A;  1Q42 A;  1DYU A;  3HIG A;  3FF2 A;  1QVF 2;  1OF5 A;  1O7H B;  2YFL B;  3AMO A;  3FKA A;  1NB3 I;  5IG3 A;  3T8N A;  1VQK 3;  1MNL A;  3CMA 3;  2BMO B;  4OUQ A;  1IV9 A;  2F98 A;  1ULI B;  1NU3 A;  1PFP A;  5IW9 A;  3WOE B;  1GYB A;  1OF5 B;  4FR9 A;  1VQ6 3;  1V74 A;  5AIH A;  1KD1 4;  4G1M B;  3KN4 A;  2OCT A;  4O8S A;  4XBY A;  2YX9 A;  4RNZ A;  2W9P A;  2BNG A;  2P05 A;  1KWI A;  1N5P A;  2P38 A;  3FG1 A;  1M9G A;  2C11 A;  1W2Z A;  1JV2 B;  1W00 A;  2ZL8 A;  1FGM A;  3K7C A;  1YI2 3;  3FGY A;  3B7C A;  5IEO A;  3CC2 3;  2OOV C;  4O2H A;  3STD A;  4NRE A;  1LOX A;  3X3Y A;  3OWU A;  5A0O B;  2CFL A;  4AKY A;  4R4K A;  2Z77 A;  3NHX A;  4HYZ A;  1IDP A;  3MSO A;  1DVD A;  1N5H A;  4FMA A;  3F7S A;  2BMQ B;  2IA7 A;  3QK9 A;  3SED A;  1A90 A;  5CF2 A;  3DUK A;  3S5C A;  3EF8 A;  1W6C A;  2FGT A;  4XBT A;  3UB1 A;  2CK3 H;  3LXU X;  1TFO A;  1A2V A;  2Q07 A;  2CFK A;  1YGE A;  4N3V A;  3OXA A;  2WGQ A;  3K0Z A;  3B4P A;  1O7W B;  3OW2 2;  3FH1 A;  3CME 3;  1K41 A;  4JF8 A;  1ZX2 A;  1W01 A;  2CH9 A;  3HK4 A;  1UUW B;  1JB4 A;  3HII A;  3X3X A;  2O3O A;  3KKG A;  4HM0 B;  2W2C A;  4I4K A;  2R4I A;  1IQY A;  3BNE A;  3N54 B;  1TUH A;  4L7K A;  1UI8 A;  3X40 A;  4FMB A;  1WNH A;  1WQL B;  2B24 B;  4BTW A;  4EC6 A;  3DMC A;  1GY5 A;  1ISK A;  4R1K A;  1U8C B;  1YVB I;  5AII A;  3BLZ A;  3PZW A;  3V92 A;  3KSE D;  5IER A;  2IUJ A;  3U1W A;  2B1X B;  1IQX A;  6STD A;  1SII A;  2QIY A;  2CFG A;  3U97 A;  2MF7 A;  2E2V A;  1HU9 A;  3IMA B;  2CHC A;  3F14 A;  1OHO A;  1CEW I;  3GRD A;  5JPP A;  3O8Y A;  3WDG B;  2I9W A;  1J2B A;  2BT3 A;  2CFW A;  3OV4 A;  4FMC A;  2IMJ A;  1Q86 4;  3DXO A;  4X2H A;  2GEY A;  3CD6 3;  4KVH A;  3X42 A;  1JN5 A;  3JUN A;  4LMI A;  3LT9 A;  1IVX A;  1E3V A;  2CG0 A;  1ULJ B;  3LZA A;  5AYS C;  1KSI A;  2KCD A;  1WMO A;  5KP3 A;  5FW5 A;  4EYC A;  2F99 A;  1YHQ 3;  3KE7 A;  1S72 3;  2A15 A;  4HM5 B;  5AI1 A;  1RRL A;  3SOA A;  1ZO2 A;  3BNC A;  3GZB A;  1MOL A;  1QJG A;  2L4V A;  3CNM A;  2GBW B;  2IUK A;  3LYG A;  1SPU A;  1CYU A;  4PEJ A;  2BO9 B;  2WOF A;  2OOV A;  3CCM 3;  3UJM A;  1DVC A;  2Y73 A;  1OCV A;  1OHP A;  4XM4 A;  2QGU A;  1JRQ A;  4TX4 A;  3CU3 A;  4MJD A;  2D42 A;  3JVC A;  3S29 A;  1AV4 A;  1OGZ A;  1Q40 A;  1QAF A;  4J9A A;  4LSO A;  5IG4 A;  1UW1 A;  5EQL A;  3FZW A;  3EHC A;  3PGB A;  2ML5 A;  1HKX A;  4H61 A;  1IVV A;  1W4N A;  1RKY A;  3GAX A;  2OWP A;  4STD A;  2XR8 B;  3EX9 A;  4IT7 A;  1OH0 A;  1OPY A;  4J8T A;  3OWY A;  3RDE A;  1QMA A;  3F8X A;  1M1K 4;  4MEI A;  3VGN A;  5FGO A;  4LEH A;  3LTD A;  1JB5 A;  1OGX A;  5CLK A;  3CCQ 3;  2CWV A;  4N6N B;  2RSX A;  4N6U A;  2XGN A;  4KFD A;  3F40 A;  3K9M C;  4H3U A;  2BMR B;  3TDG A;  1GD4 A;  5DRE A;  1Q81 4;  1K8A 4;  1N8Q A;  3OX9 A;  3CXC 2;  4HM8 B;  2CKF B;  1N9J A;  4ZM8 A;  5CXO A;  3FG4 A;  4CDL A;  3NM2 A;  5IG5 A;  2XH9 A;  3T8U A;  5AEU B;  5D82 A;  3J7Y d;  3ER7 A;  3NQZ A;  2Y74 A;  2K0M A;  1BUQ A;  1SQW A;  3CCS 3;  3BND A;  2C10 A;  4HBR A;  2BHM A;  1WMN A;  1TFK A;  1U5O A;  2W04 A;  3F9S A;  1LNH A;  3MPH A;  2LQV A;  5EEO A;  1D6Y A;  2XSO B;  1UI7 A;  3LOY A;  3UL5 A;  1RN7 A;  2W6J H;  1TU5 A;  1VQ7 3;  4BTY A;  4HJL B;  4R80 A;  4XDW A;  3BB9 A;  3D9R A;  3LTB A;  1QVG 2;  2YFI B;  1Z1S A;  2XF3 A;  3NBR A;  1YJN 3;  1NB5 I;  3ECF A;  1UUV B;  2OQE C;  4WHA A;  1TP6 A;  3H51 A;  3KII A;  2CWT A;  3K5T A;  3LH4 A;  2XEP A;  5AIF A;  1RJO A;  2XSH B;  3WOF B;  3GWR A;  4U13 A;  3IJE B;  5EVH A;  3VSY A;  4R9K A;  3B8L A;  3SLU A;  4K1U A;  3FG3 A;  4RNY A;  3GZY B;  5HGR A;  2PZV A;  2YFJ B;  2CWU A;  3MG2 A;  4ORL A;  5BXQ A;  1RRH A;  3NBJ A;  5LC7 A;  1SIH A;  3DGO A;  4WP5 A;  1STF I;  3EBT A;  1VQ9 3;  1N8R 4;  1JKG B;  3CCV 3;  2GU1 A;  1CYV A;  2Z6B A;  3NM7 A;  5D81 A;  5IG0 A;  4N6V 0;  2F86 B;  3DGL A;  2W56 B;  3JUO A;  3I56 3;  2GEX A;  2XGL A;  3EBY A;  3G0K A;  3EC9 A;  4RZM A;  3WMD A;  2CC3 A;  1OAC A;  3G6E 3;  4R9L A;  3KFQ C;  2JQ5 A;  2W03 A;  4HVN A;  1IT8 A;  3Q90 A;  5AEW B;  1M1X B;  4XDV A;  5IEP A;  2CIU A;  4HM3 B;  4L8O A;  3V98 A;  1EG9 B;  3MG3 A;  4KFE A;  4OK0 A;  3NUV A;  4OVM A;  4HM4 B;  1E3R A;  3T0U A;  1ROA A;  3M8C A;  4FCM A;  1AVK A;  1YIT 3;  3LTA A;  2HMM B;  5G2G A;  3RGR A;  4CCV A;  2GXF A;  1IT7 A;  2P09 A;  2QA4 3;  3KZT A;  1W6Y A;  3MG1 A;  2M7O A;  5LC6 A;  3I55 3;  1EQK A;  3DY5 A;  3GZX B;  4FCZ A;  2O9U X;  2STD A;  1W02 A;  3MWZ A;  3Q1C A;  3SXX A;  1NJI 4;  4EXR A;  2QEX 3;  1LXE A;  3G8Z A;  2CFD A;  2ML6 A;  1IQ8 A;  1AR0 A;  3MHE A;  1C7H A;  1R4C A;  4KFF A;  1K28 A;  3MYT A;  3PCR A;  1O7P B;  1M90 4;  5ELJ A;  1Q7Y 4;  2WGO A;  1SJW A;  5ELU A;  1WTH A;  4HZ9 B;  3VF1 A;  7STD A;  4MMZ B;  2P0M A;  3L0R A;  2INX A;  1GY6 A;  3CPO A;  3EQQ B;  3SOY A;  4XB5 A;  1NO3 A;  3CCR 3;  4K90 B;  3S67 A;  3X41 A;  1ROV A;  1A67 A;  2GU3 A;  1FGR A;  3SVA A;  3GZR A;  1VQ5 3;  2OTJ 3;  3H3H A;  4GL6 A;  3NX0 A;  5CK6 A;  1VQL 3;  3CPW 2;  1YIJ 3;  1JB2 A;  2W9Q A;  3BNB A;  1FGQ A;  2XFT A;  3KSP A;  3FF0 A;  4HM2 B;  3NV0 A;  3D3L A;  3FSD A;  3ROB A;  3CCL 3;  2OQE A;  1K9M 4;  1FA3 A;  2RGQ A;  1KC8 4;  4MMY B;  3PS8 A;  2MC8 A;  1IK3 A;  3MKI A;  3CC4 3;  1VQP 3;  1LVN A;  2JDI H;  4AEQ A;  3HX8 A;  1Q40 B;  2E2U A;  4WWU C;  1FGO A;  4LZI A;  2RCD A;  3DGM A;  3WA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...