3LHDA

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-homocysteine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
253
structure length
253
Chain Sequence
b'MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase, putative
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 66
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3lhdA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lhdA02
3ELDA 3EGIA 2DPMA 3EGEA 2YX1A 5EMMA 1BHJA 3T7RA 2IP2A 3NWEA 3OE5A 5LR6A 2I6GA 1FJXA 1N7JA 3A7EA 3LDGA 2ONZA 3HVJA 5ICEA 2AN4A 2UZ4A 2ERCA 3PS9A 5FADA 3Q87B 5HIIA 1XTPA 2AR0A 2Y1XA 1L3CA 4RTQA 1IXKA 4BLUA 1R6AA 2QM3A 1NV8A 5ICCA 2B3TA 3UBTA 3U81A 5EKUA 2GB4A 3OU6A 4M38A 4P58A 1XDSA 5DM2A 4PONA 3R9XB 5EMKA 1VPTA 5D1HA 3BGVA 3BKWA 3LECA 3M6WA 1KYZA 4GUAA 1T43A 3H2BA 2I62A 4ZTBA 4GOND 3TKAA 2PVCA 4YMHA 1SKMA 4AX8A 1KR5A 3ORHA 4RVFA 2P41A 2AOUA 3GRZA 5F2KA 3R0QA 2JH9A 3GIWA 3EGVA 5KVAA 1G8AA 2IH4A 4P7JA 1V39A 5EZSA 3ELWA 2OO3A 1ORIA 5CVUA 5EG5A 2IH2A 3KPUA 3HCEA 4KIFA 2ZZKA 4EVIA 5DTRA 2YXDA 3UJBA 3FTCA 3AXSA 4R6WA 3DTNA 4M7RA 2CMGA 1R8XA 4GC9A 4CWAA 4E2YA 5E1BA 3UJ8A 5K0BA 3CJRA 4PCAA 5U4XA 3LGAA 4PYOA 3G2MA 3FPHA 4OX9Y 4RTLA 2I7CA 4H0NA 5GP1A 5C0OE 3KHKA 5EMLA 1X19A 3DXXA 3NW9A 2G71A 2Q41A 1NW7A 5K0JA 1F3LA 1VIDA 1ZHFA 4U7TB 1RJDA 1M6EX 2PX2A 4BP3A 4PWYA 4EKGA 1G6Q1 4IWNA 5IH3A 1G8SA 1VE3A 4PYQA 3QOWA 1F38A 4RX1A 1X1CA 3ER9A 2PXCA 3GU3A 4C07A 1Z3CA 2WA2A 3P97A 3HVHA 1TW2A 5LQNA 1R00A 2FCAA 3AXTA 3TM4A 3EEOA 1JG1A 3E7PA 2ZZNA 2JHCA 3KPYA 1BOOA 3K0BA 1QANA 1WXXA 4E33A 2GH1A 2PBFA 3O7WA 4E2ZA 3V97A 2O06A 2JHAA 3OZTA 3FUVA 4X61A 3DULA 5T67A 3TKYA 4MTLA 3THRA 4E70A 3MHTA 1ORHA 1P39A 1RI2A 2ZW9A 3LCUA 4EMSA 4C08A 4F85A 2C7RA 4KDRA 5LQCA 1SG9A 4GQBA 2EG5A 5DRTA 3M4XA 3JWGA 5LQJA 5F2NA 3FZGA 5CCBA 4QTTB 3VSEA 2NNWB 3UJDA 3DH0A 2YR0A 3LSTA 4PYLA 4LECA 1I4WA 5BXYA 2XVAA 4ER6A 3ELYA 5CIYA 3MAGA 4OBWA 4XCXA 2ZFUA 3RODA 1JG3A 2ZIEA 4QDKA 3DUWA 3CKKA 3NDIA 4HC4A 1UFKA 4E31A 5EZQA 2BH2A 2OYRA 1R8YA 1VL5A 2O05A 3FYDA 3SSMA 4RVHA 3P9KA 2Y1WA 4F84A 1JR4A 2CWWA 2PJDA 3VYWA 3HCDA 4RTNA 3MQ2A 1OR8A 1AV6A 3C0KA 1U2ZA 2OB1A 3BWYA 5K0NA 5HFJA 4ER7A 4YV1A 4ER3A 5DX1A 2ORED 4RTRA 2B25A 3GGDA 4QVGA 4RSRA 3FUXA 4GOOD 4HGZA 3AWIA 2OZVA 1DUSA 5K0FA 1G38A 1EAMA 3FYCA 3C6MA 4OQEA 1JTEA 4KWCA 2OPBA 2O57A 4MWZA 5DRYA 2HNKA 3EVBA 5LQRA 4DM3A 2BR3A 2AOTA 2P3QA 2O0LA 3HA7A 3EMDA 5E9QA 3M70A 2C7PA 5FQNA 2PXAA 4M37A 3RW9A 2AOTB 2PGXA 5GOZA 3LDFA 3BWCA 2ESRA 1XJ5A 3SGLA 2UYQA 4RTSA 5T64A 2GPYA 3BWMA 1KXZA 2FHPA 2PV0A 4IKPA 5GIPE 3IEIA 3DR5A 3M6VA 5EC8A 4EKIA 4F86A 2R3SA 3KPWA 3QV2A 3EEYA 3LL7A 4C4AA 1NW5A 4RTOA 4WVLA 4ER5A 3KQQA 2IBTA 3BZBA 3HCBA 2HWKA 3AJDA 5DSTA 3PX2A 1JSXA 1P91A 2FRXA 5HZMA 3HCAA 3FTDA 1EJ0A 4K6MA 4R8SA 7MHTA 3EVCA 4HRAA 5G02A 2N47A 3B3FA 3OFJA 1NT2A 4QPNA 3BT7A 3D2LA 3O4FA 2AVNA 1AQIA 3OU2A 1Q0TA 3GO4A 2AVDA 3DMGA 1JG4A 2YTZA 3ER8A 2NP7A 2IDKA 5K01A 3SVZA 1G55A 1KP9A 3VC2A 3OZSA 1XDZA 2YVLA 4HG2A 1BC5A 4ISCA 4POOA 3TLJA 3EVAA 3TRKA 2R6ZA 1G60A 5EPEA 3FTEA 3GJYA 3KQMA 3UJ7A 1XCLA 5CM2Z 1JSZA 4IV0A 2AOUB 5ICGA 4X41A 3G89A 2ADMA 1EJ6A 2BZGA 5FULA 5FHQA 3UZUA 5E9WA 4R05A 4DCGA 3LBYA 3HA5A 5F2OA 4NECA 1B42A 5K0GA 5DX0A 5EEHA 3WSTA 3C3YA 2B78A 4PYNA 5HIKA 2VS1A 1KPIA 1SUIA 3GRUA 5B1SA 1YB2A 2G70A 5DTQA 1RI4A 4DKJA 4PYMA 5LSAA 3RIEA 5E2AA 5HOQA 2B2CA 3EVZA 1WG8A 2EX4A 5FA5A 2OXTA 3KU1A 3CJQA 5E8JA 2AOWA 5CCXA 3IHTA 1MHTA 3FRIA 5KQRA 2PXXA 4P7FA 3DOUA 3HM2A 2P1DA 3S68A 3TR6A 1IY9A 4FR0A 5FTWA 3LX6A 1NW3A 3NWBA 2P3OA 4QDJA 1NBIA 5EMJA 3OU7A 3R6TA 1YFLA 5BP7A 3PFGA 1XDUA 4R6XA 3A4TA 1QAQA 3LHDA 2JHPA 3M6XA 4GEKA 5M5BA 1D2GA 3CVOA 4FP9A 3K6RA 4PGHA 4RYLA 3NTVA 5FUBA 4O29A 2AS0A 3GRYA 2PX4A 4R8RA 3TQSA 4E2WA 5DX8A 2WK1A 3KR0A 1TPYA 2VDUE 2AN5A 4CKBA 2CKDA 5EGSA 5DXJA 3NDJA 4YV0A 4BLVA 4MIKA 4C03A 2YQZA 4GF5A 4FT4A 3OZRA 5DT2A 3UWPA 2P40A 1NW8A 3P9NA 3UA4A 4HGYA 2I9KA 5FWDA 2Z6AA 5T6BA 5JR3A 1O9GA 4RWZA 1X1DA 3REOA 1D2CA 5HIJA 1QAMA 4UOEA 4QVKA 3P2EA 4PIPA 2GLUA 5CVJA 4GC5A 5EHGA 2P8JA 1NKVA 2C7QA 1VBFA 3OE4A 1PJZA 2ZTHA 4FSXA 4PYKA 2P35A 1RJGA 4P7GA 4XUDA 5E2BA 4PYJA 3MCTA 4C05A 2BR5A 4LG1A 3B7PA 4FGZA 4AZSA 2CMHA 3UJ9A 2FK8A 5ERGB 5GWXA 1X1BA 3I58A 3UJCA 2B9EA 1INLA 1I1NA 3GWZA 5DTMA 4RTKA 3ID6C 5CVEA 5D1NA 3CBGA 4KRGA 2QYOA 3HNRA 4X1OA 4ATNA 5K09A 1QYRA 4Y30A 4CXMA 1P1BA 1EG2A 3KR1A 1FP2A 2GS9A 3I64A 4RTMA 5K0CA 4QQNA 3VC1A 2Z6UA 2ZBQA 5CVDA 2EFJA 3G7UA 1NW6A 2CL5A 3SXJA 4DCMA 5BW4A 3P2IA 4Y2HA 3FPGA 4FSDA 4MHTA 4IV8A 2AOVA 1RI5A 1NE2A 3KQOA 4KW7A 3FTFA 4RVGA 2FPOA 3PT9A 3UJ6A 4DA4A 4YUXA 3GNLA 3E8SA 1RI3A 2H1RA 5HILA 9MHTA 2G8NA 5FA8A 1JQ3A 4OQDA 3T7TA 1ZGJA 1SUSA 2OB2A 2XYQA 2G1PA 5C9ZA 1AQJA 5EHIA 5FQOA 3MGGA 1PRYA 1SQFA 3TPZA 3KQSA 5FWAA 3B3GA 2P7HA 3EVFA 1KPGA 2VZ9A 4OA8A 2ZBPA 1Q0SA 1ZGAA 2BM9A 2P7IA 3SSNA 1JQDA 2IGTA 2ONYA 3KQVA 3I9FA 3NVMB 2ZIGA 5K03A 1TW3A 2ZWAA 3SSOA 4AZTA 5E1MA 4OA5A 2PX8A 2UYOA 5DSXA 1O54A 4YV2A 5LQKA 3DXYA 5FCDA 1NV9A 5DWQA 1AF7A 5CVVA 1DCTA 3T7SA 1SVUA 3DMFA 3SR4A 4YUWA 1VQ1A 3HA3A 1Y8CA 3DLCA 1RJEA 4B17A 5E9JA 3PB3A 3PFHA 3PTAA 2V7EA 3LDUA 2NYUA 3P9CA 3HP7A 3JWHA 4YMGA 2PWYA 1RJFA 4M36A 1KPHA 2H00A 2PLWA 3T0IA 3G2PA 3TM5A 3KKZA 4E32A 3SMQA 3NVKI 3C6KA 1L9KA 1N7IA 4YUVA 3MTEA 3B3JA 3FPEA 3GCZA 2AN3A 3EMBA 3IV6A 5MHTA 3OFKA 4KDCA 1BKYA 3BKXA 3MERA 4YUYA 3B89A 4QPPA 2EJTA 4DMGA 2IIPA 3BGIA 3G5LA 2ZWVA 5GM2A 3EVDA 3DP7A 3I53A 3PX3A 3B5IA 3OCJA 5EEGA 1ZQ9A 2VDWA 3P9IA 2NXJA 3LCVB 4L7VA 5DM4A 3GXOA 3JWJA 1I9GA 4DZRA 5DPMA 5HEKA 5GINE 4MQ4A 3P8ZA 4LWPA 4GOMD 1XVAA 1ZKDA 1YUBA 2EJUA 4BLWA 4RTPA 4BP1A 3M33A 2BM8A 2PKWA 2PY6A 4PCLA 4ER0A 1SQGA 5JUWA 1YZHA 2NXEA 2XYRA 4AZWA 2K4MA 3BXOA 5EIWA 4Z2YA 2FK7A 1FPQA 4GBED 1KYWA 2ZLBA 3AY0A 3F4KA 4HSGA 3TOSA 1WZNA 1XXLA 2AZTA 4V0RA 3UA3A 2ZULA 3O31A 4WXHA 3HVKA 3ELUA 3M6UA 1P1CA 3LKZA 2HMYB 2UYCA 4U7PB 8MHTA 2QE6A 3CJTA 2F8LA 2DULA 3LPMA 1FBNA 2AOXA 4JXJA 2ZIFA 2JJQA 3MCZA 5K0EA 2VP3A 4DQ0A 3LCCA 3KQPA 2HTEA 3NJRA 3THSA 1JG2A 1WY7A 3ME5A 5E1OA 2QY6A 3CGGA 4RTJA 3KQTA 5K8VA 2ZCJA 2PT9A 3BWBA 3IYLW 3C3PA 2UYHA 1YFJA 3R24A 2P3LA 5DM0A 1JQEA 1MJFA 4G56A 2WA1A 3JWIA 3KQWA 5C1IA 1O9HA 5EQJB 1HNNA 3DMHA 3SX0A 4XUEA 4HTFA 3EVEA 1FP1D 1KHHA 3G2QA 3LKDA 3P2KA 5EVJA 5LQAA 5BW5A 2NP6A 2PX5A 4HTFB 2ZVJA 4FS8A 1R18A 2FYTA 2ZSUA 1WXWA 2PWPA 3GDHA 4LWOA 4E2XA 4XUCA 1L3BA 4QTUB 5K05A 3DLIA 4PINA 2OBFA 1IM8A 4FT2A 2Z6QA 2YXLA 4C04A 2OKCA 4FZVA 4PIMA 3TFWA 3HCCA 4PGGA 1L3IA 3A25A 5CUQA 5EIFA 3HVIA 1VLMA 1XCJA 2KW5A 3GRVA 3PLAE 2G72A 3HEMA 4KVZA 4QQKA 3UFBA 1L1EA 3G8BA 3G88A 1JTFA 1YF3A 4EQZA 3FPJA 2NXNA 1EIZA 2IFTA 5ICFA 2ZZMA 3HTXA 2C7OA 2IPXA 3X0DA 3R3HA 2XVMA 3DXZA 4HH4A 2YXEA 3BUSA 4KIGA 1VP9A 2LD4A 3I5UA 5KYGA 5DM1A 1HMYA 3HCFA 2NXCA 3KPVA 5LQUA 2OY0A 1X1AA 2YUIA 2E5WA 3PVCA 3FUUA 5KS2A 3SM3A 2JH8A 2HV9A 2XYVA 1YZ3A 3ANXA 5E1DA 4C06A 5P8WA 1UWVA 5E8RA 5FHRA 3LBFA 1D2HA 3A26A 3P71T 3A27A 3EPPA 5DLYA 4EK9A 2IH5A 3FRHA 2IBSA 3Q7EA 1QZZA 1NBHA 1VP3A 4GOLD 2QRVA 3E23A 3TMAA 3E05A 5EKXA 5CD1A 1M6YA 2ZBRA 3FUTA 3G8AA 2QRVB 1N2XA 5DXAA 5GIOE 3UJAA 2H11A 1R74A 3EVGA 3KQYA 5EOVA 4PYIA 3KR2A 3L8DA 3V8VA 3BGDA 2JG3A 3G5TA 2A14A 2O07A 3NMUF 3GRRA 2PT6A 4X63A 3MB5A 4E30A 5K0LA 3FUWA 2V74B 5KQSA 4A6EA 2BR4A 3ERCA 1ZG3A 2IDJA 1DL5A 4AUKA 4CTKA 1WS6A 2GAFA 2XBMA 1QAOA 2VDVE 2HR1A 3OPNA 4YUZA 5IKMA 3KPJA 4RVDA 4CTJA 2PSSA 4X60A 1KIAA 1UIRA 3A7DA 3CCFA 4OBXA 4CKEA 3G2OA 1M0EA 10MHA 3FPFA 1H1DA 4V0QA 4BY9E 1RI1A 4A6DA 3QOXA 4PNEA 3MTIA 4DF3A 1EQAA 5GM1A 4P7KA 4RV9A 4AZVA 3KR9A 5H02A 5HIMA 4CKCA 3CC8A 2GA9A
chains in the Genus database with same CATH superfamily
3A37A 3ND8A 2G06A 3K16A 2VNIA 2VTBB 3CZRA 1ZK4A 5CK4A 3FD8A 1TM1E 3CG0A 2C5BA 4ME6A 3PS9A 1PNOA 5T8KC 3AF5A 1E99A 2CLKB 2MSCB 1A2BA 2Z4SA 4REQB 1SVMA 1CF9A 3QQ5A 5D51S 4HH1A 5G2OA 1UBMS 4DLSA 3DEAA 3UPTA 3KVYA 1IULA 4GNKA 1S8FA 4GXQA 4PE5B 3O4GA 3MJHA 4L9AA 1GR1A 4ENVA 3VO8A 3TIXB 5JAZA 3VDRA 1JDSA 3ZY4A 9ATCA 1UM9A 3IIKA 1SHLA 5EJ7A 2H1LA 4BFZA 2CK3D 4WJLA 2IT1A 1KR5A 4RELA 4US1R 3VHLB 4B74A 3GT4A 2WT8A 2B4YA 2QF7A 2FPPA 3C7TA 4RF5A 3C14C 1TT5A 2AD5A 3GK3A 5F7XA 1P1IA 2Q7XA 1OXVA 1BWQA 3ZPXA 3H19A 2RAFA 5BVHB 2QT1A 3ZGZA 1Z08A 1US8A 1H23A 2P79A 4NBTA 3FOZA 4RK1A 4HFRA 1ZVVA 1KVTA 4M1QA 2P9QA 5JALA 1V5GA 2HQ1A 1ETHA 4GC9A 1FYEA 3H2YA 3PVSA 2FUG6 3FNHA 3QHPA 2QZJA 1Y89A 1Z7BA 4E2YA 1D5CA 4F1WA 1ZJWA 3QMVA 4Q66C 4RTLA 1Q16A 3H3FA 4PVDA 2OGSA 2JGLA 3VZRA 2F43B 4PAWA 4R4JA 5KTSA 4J16C 5LOVF 2Q5IA 3GLGB 1CNEA 3F6SA 1IYZA 2GYYA 2OM6A 3AINA 3DHEA 3B1FA 3LY9A 1N9GB 3QKRA 3RVLA 3WLKX 2NG1A 5I4KA 1XWWA 1HR0B 2MWMA 1GLNA 3X2FA 2PS3A 3I9KA 4BNIA 1EXWA 4D44A 5BMVB 2PXCA 2VKQA 1E62A 1YR8A 3H1EA 2C4KA 1Y1QA 2RH8A 3IJRA 3X1JA 2ZRCA 4II3A 3E7DA 4KUEA 4QXQA 2BH9A 4FDTA 3HGTA 1QDEA 1TAHA 2JA2A 2R6FA 3HB4X 1Q7EA 4HQLA 4NEGA 4IOMA 3K05A 2FFBA 2PMEA 5KNCA 2Z83A 2LW7A 4HVLA 1UKYA 1YKFA 4J0IA 2QIOA 2IIBA 5CB4B 3OZTA 3OAAA 3Q3HA 5HFAA 3QUSA 3THRA 1F0PA 2HB6A 2VXCA 3PDUA 3N8NA 2CEKA 1MRZA 1Z0SA 4IXDA 2XRZA 4IQ8A 3S29A 1H4TA 1DBSA 3AR7A 4ZVTA 1O97D 3I37X 3M3PA 3I0MA 1DC4A 1E4YA 2JFGA 1MMFB 4WLNA 3TQHA 1F0KA 1Y5NA 4NENA 1L7BA 2O50A 3A9WA 1AT1A 4JXKA 2ZJ1A 4BKQA 2WLSA 4E5UA 3VSDA 4P86A 4EELA 5D3MA 2FE4A 1GM5A 2WIFA 1QC5B 2J4FA 3GCGA 1MXFA 3ORQA 1YA8A 1ZVKA 4FYMA 2CWWA 3GLSA 3DWIA 3FMOB 5ULLA 1XMOB 4HDQB 4OY3A 1XPUA 3N5CA 2PDAA 2D1RA 3UMCA 4B3FX 2ZS7A 4UCQA 5K0NA 1OWPA 5C4GB 5KVCA 1ZM3A 4H2DA 1MDBA 3HDVA 2ZYUX 3HR7A 3KKPA 3Q9SA 1VJ1A 4R1OA 4O3MA 1GZ3A 2CMKA 2OUKA 6CHYA 1HH4A 5T4FA 4MLCA 3KZMA 1YDMA 3K09C 1M7HA 1X7YA 2X8AA 3OCZA 3C3BA 2DUMA 3JALA 4KFRA 2O8FA 2AKAB 5BSTA 1ND5A 2JI9A 5IUJC 4PTZA 3SCZA 4EY8A 2VZLA 4A36A 2VXYA 1SXGA 1PVVA 3LDFA 4K87A 1A7JA 2OE2A 3KOWA 4UFPA 4W1SA 3AERB 1G4UR 3MB8A 4HAZA 2JFQA 3AY3A 3E1KA 4FCVA 5KNBD 2F00A 4FBLA 1R6UA 1N6RA 2QN3A 3NI2A 4JYPA 2J0SA 3V6MA 3R8CA 4NBWA 4RPHA 2IYEA 3EEYA 4GQIA 2XA2A 4TL8A 4WT7A 1VPWA 5C8XA 3V46A 2F3UA 2I22A 1I7LA 1S96A 2WJHA 3S70A 1HRKA 4CEHB 4HGQA 4TROA 3N9IA 1Q0LA 1IPEA 1E3DA 1N8KA 3H7IA 1YVDA 4CKCB 4DR2B 2HY7A 1E5DA 1M3SA 1J8MF 3U4IA 5CJ2A 4QWWA 3V7WA 3K6SB 2JLVA 3O4FA 3BMOA 4UE3S 4X91A 5LA6A 4TV9B 3S28A 1EIWA 5REQB 4C78A 1OILA 4U3JA 5ILQA 1RKXA 2CHUA 2GCIA 2NP7A 4V0OA 4RVUA 2H9AA 2OC9A 2ZP1A 3MJ4A 2FF7A 1DBWA 3HP1A 4RPCA 4XX1A 4PG8A 1PS0A 5AW7A 2YVLA 2KLBA 3T4XA 2AXEA 4PLHA 4TTRA 2XMGA 2Y9MB 1V3TA 4IKEA 3TSZA 2PFSA 1FU8A 2OK8A 4O4JB 1JKJB 3M7IA 4JN6B 4EHNA 3TMKA 3KEOA 1XHFA 3T7AA 2HJVA 3LBYA 4H60A 5F2OA 4RM2A 3HB1A 2X9VA 1CYEA 4NFLA 2EP7A 5HIKA 4ZTZB 4QEKA 1BQ4A 5I9MA 4Q16A 5F21A 4Z1OA 4EPWA 5DTQA 2QMEA 3AT1A 1VA5A 3FB1A 5EE3A 1Q6YA 2JI8A 3FVQA 1WQ4A 3EVZA 1DXYA 2ZUDA 3BCSA 4RMHA 5HOQA 5AVYA 3OOWA 5LC1A 3D8RA 2V6JA 2XQFA 2GPWA 3UWDA 4HUTA 2CUNA 3FZNA 3L06A 5HS4A 3QPUA 2PXXA 3DSRA 3E3AA 2P1DA 3LW7A 3HU3A 1ATIA 1U81A 2NVWA 2FEOA 3D7RA 4M83A 3U3JA 3VPGA 4MRMB 4DARA 4G8CA 1WIWA 2EKZA 1ATZA 3ECCA 2EFYA 5ALSA 5I4CA 1S0UA 2HF2A 3LHDA 2JZCA 4FHZA 1ZXXA 1SCAA 1MH9A 2BSAA 4ZVSA 3U7EB 4FOSA 2IHUA 4JT9A 1VIAA 1XLUA 4M8LA 5DHUA 1T9CA 1L8XA 3IMKA 3H9EO 1I9CA 1U9CA 1D4ZA 1OVMA 1X7WA 4FYWA 2Z5GA 3THYB 3PU6A 3EW7A 2W42A 2RD2A 2K87A 3N8HA 1FUKA 1I1HA 2QQ5A 3KBOA 5CH3A 5DT2A 3KDPA 1YDGA 3U4CA 2JGEA 2XE7A 4CFZA 4N49A 3BMCA 3R4VA 1SZDA 2QRPA 2FZ4A 3REOA 2Q3MA 2NQTA 4YDSA 3W7AA 4DE5A 3NHSA 2WI8A 3P2EA 1RAAA 2CZCA 1YVUA 5IF9A 2GLUA 3STXA 3HU2A 5EHGA 3TUZC 3IQHX 1CS0A 3HEAA 3LVBA 5DBEX 5FTKA 3DEYX 4EPTA 1U11A 2RK3A 2VNHA 3Q1KA 1ZOLA 1SOVA 3EXHB 1JFSA 1T8WA 3VR4D 4JBNA 5C5DA 3WXMA 4AZSA 4WY2A 3UJ9A 3RRMA 2WTXA 2EERA 3TSOA 5BUSA 2OOSA 5IYZF 1KEEA 3ZYCA 5B3JC 3L1HA 4DQXA 3CRQA 3UCEA 1JG6A 2Q4DA 1PFYA 4M7WA 5L3QB 4X1OA 2EDCA 3HZHA 2IHZA 1JAYA 1O2DA 2WUDA 4N0EA 1P1BA 4RHFA 5BUQA 1AF4A 3KR1A 2YNMD 5TPWB 2Q4OA 2D7CA 3CKMA 1JS1X 2R7AA 3G0GA 4ARSA 3JQDA 1RPTA 2FJUA 4OP2A 2X86A 4Y2HA 5BW6B 3FPGA 1RJ9B 1RI5A 3PHJA 3AF1A 5LLTA 2ID8A 2JGMA 2Z6VA 4ENPA 1H8ED 2WVJA 4BB9A 2RI0A 3ZZUA 2ZI5A 4Y6RA 3VKHA 4QHTA 5BVGA 2QQ0A 4RETA 2IS6A 1K0UA 1SOWA 1KMHA 3EQ2A 2VC2B 2A35A 2XYQA 4W5NA 2VHJA 4MYDA 1DXHA 2GLTA 1RMQA 1LJUA 2JI6A 4FOPA 3ZWCA 2PYIA 3EVFA 3C6YA 5H4GA 5KMGA 4Z3OA 3FHTA 2H29A 2HRBA 5HE8A 1CB0A 1GA1A 1GT6A 1C1XA 1Z8NA 3FUCA 4ITVA 4ZU1X 3QA9A 3DA8A 2DERA 5D6WA 3IMFA 3SS9X 3LRXA 2YHIB 4DWOA 2JIQA 1KXJA 1TMGE 2C82A 2XOEA 3FETA 4QUEA 2JFOA 5GMOA 3HYLA 2NQ2C 3GG9A 3HXLA 5EN4A 5EKSA 3X43A 1U8YA 2CDBA 2VWHA 3A1DA 3ZI0A 1DCTA 3TLYA 1R0BA 4ND2A 4MR8B 2JBWA 3DMFA 2VUTA 3KSRA 5PGMA 3WQHA 4DWJA 1KO4A 2LW6A 1T34A 1VGQA 3L7MA 2BC9A 4NKRA 1GLVA 3LZ6A 4OJMX 1GAJA 4PNHA 4CV2A 1X14A 3GLGE 3R5XA 3F3KA 4IIUA 3WHIA 5IU6A 4YMGA 1KK0A 3WL3A 3WGQA 5TJHA 5DKFA 1ZZGA 3N39C 1KPHA 1NVAA 4A15A 1LX7A 3PFNA 1MEJA 3CGWA 3E9YA 1A1SA 3IB6A 1PEKE 3N2YA 2E37A 3KKZA 5EERA 4I8IA 2A8YA 2AKEA 4HEA6 1X13A 1JA9A 2FPLA 4PC1A 5IC4A 3TG2A 3LPNA 2WSIA 4KDCA 4KG7A 1BKYA 1PF7E 1VG1A 3EIUA 4NBKA 3T9DA 3TKLA 4R1QA 4EX7A 1W0JA 2AFIB 3O8LA 1NATA 2L2QA 1U5AA 3LS2A 4P4LA 4RA6A 4UHBA 1UT8A 1ZQ9A 5FTNA 2MINA 1FFAA 2H07A 1KY3A 1LF0A 2OLKA 1U8ZA 1I9GA 1O94D 2RHBA 2WJJA 3GXOA 5DPMA 3BGSA 4MQ4A 4LWPA 3ZD9A 1J8FA 2EJUA 4KWTA 4WTOA 2PKQO 4CFSA 3RS3A 2Q6VA 4H4DA 1O8BA 1S3IA 2BM8A 3JRWA 1WVGA 4V0KA 1SQGA 1YS7A 4X6UA 1ODTC 3FFWA 4AZWA 4JDUA 3KKMA 2FK7A 4K81B 4UBIA 3T61A 2XKJE 3TRJA 3C5CA 3HHPA 3ILSA 3R3UA 1PJQA 4PGFA 3FIJA 1XXLA 4BPBA 1S2NA 3QMPA 3A6ZA 1Y8RB 1L5LA 2JJ1A 1FSZA 2QTRA 4MVJP 4D9IA 3KNZA 2Q4EA 2DCUA 2OHXA 1ZA2A 1C1DA 1K27A 1YKGA 2JI7A 3BRQA 2WUVA 2ZIAA 4MW7A 4BNZA 2VPTA 1MABA 1NXPA 4FZRA 5D00A 4EMUA 3QSGA 1BA2A 2ODWA 3HYTA 5DBHX 4DPMA 4N5HX 3FVWA 4KXUA 2O3QA 2Q4BA 3OSUA 3THSA 4CG3A 4ZAFA 3K70C 3N2KB 1HKUA 2PKCA 1LX6A 4YO8A 1Z6GA 4ND8A 3CUEF 3FPSA 2PL1A 4C1NA 3V4PB 4D3ZA 2WLTA 3FZQA 3IJEB 2XXAA 4BATA 2BBWA 2WUEA 2GEDA 4GRIA 4BZZA 2Z09A 4E5NA 5GZ3A 1DKQA 1UM8A 1M66A 3TCKA 5A06A 4N6OA 4OTZA 1T2EA 4H3SA 3K9GA 3IUJA 5LBIA 4MPDA 5AK4A 1IUNA 4AY3A 2XCSB 2WFZA 1BDIA 1UOQA 5BW5A 3BXGA 3X1XA 3VPAA 4HGPA 1R18A 3A2MA 3GDHA 1UMBB 3NZEA 5KNLA 4QTUB 1SCNE 2GPTA 3EF1A 4IYRA 1BE6A 4G84A 4DQVA 1R6XA 4XI9A 4MW6A 4W5OA 1L5YA 4UBNA 4NMLA 3WIEA 2DJIA 2FN8A 1SRQA 3HWRA 4Y6QA 4A23A 4B3TB 3H1FA 5DZSA 3HL0A 4GM1A 2HM7A 4OBBA 1QGUA 2YCBA 1YF3A 2JK1A 1P8JA 2A0YA 5DTEA 3QF7A 3O3OB 3HTXA 1MQ8B 1P62B 2R85A 3DXZA 3S3TA 4MVWA 1I3CA 4NCHA 4DRYA 3INTA 5KU1A 2JVIA 3ZN2A 3HCFA 4DRXA 3WKEA 3GAZA 1WBDA 1SU4A 2R1TA 1N6IA 2GX6A 4QGHA 4BQOA 4FYIA 2COEA 2VDLB 1G8KA 3FSGA 2OHHA 3NHKA 4F5DA 3H1TA 1MW9X 1VJRA 3ULKA 3JPYA 1R50A 3BFJA 4FKZA 1OXSC 3DZBA 4I08A 5DNAA 1KMNA 3FFTA 1D2HA 1QHHB 3OKCA 1LRLA 2VRCD 4BNGA 2BKVA 1A7KA 4G5SA 4MWBA 1FUUA 1G66A 1GL6A 1Z0ZA 4QX6A 1QGZA 1QZZA 2X6QA 2W6NA 4P7BA 2W2KA 3TBFA 1LRJA 4L0CA 3W4JA 2X0KA 3HUFA 1QPGA 3IAHA 2X58A 4XVHA 3KG2A 4R1NA 5CR9A 4F3RA 4JI2B 1N9ZA 4B1FA 1BWPA 2KI5A 1O96B 3Q3CA 5ALDA 5FTLA 2UVPA 1SZPA 4CKWA 3BQ9A 1W2GA 1C8BA 4AY2A 1SBCA 4X63A 5KOYA 1YI1A 4K3VA 1R5BA 2ZRKA 3COSA 2F1OA 4NESA 4OLFA 4BKMA 1ZMBA 3VSAA 4YRAA 1T4DA 1WCV1 4RXTA 1WS6A 1KSJA 4UUBA 5TMBA 2XBMA 3ZS9A 3N0TA 2Z9DA 3QVWA 4CQLB 5CDYA 3NCHA 4HZUA 2A2ZA 2GYWA 3FNQA 2IKSA 4DADA 4MQLA 1HFEL 1KIAA 3LQYA 4OKNA 3H0CA 4C01A 4S1PA 3BXFA 4H0FA 3SJZA 1R0XA 1RPAA 2EGGA 2I4OA 1SC1A 2P69A 2HJWA 3H75A 4ZYLA 1MTOA 3OKPA 1DRJA 2HBYA 2R68A 3HUDA 3BX1A 3CLTC 4XOIA 4V24A 3DBRA 3GLHA 1X7XA 4XYEA 5GM1A 3UK6A 4A27A 1E6CA 4A16A 2BGTA 3G2KA 5LZ2A 1CUVA 3EOZA 2GJ8A 5BSEA 5KO2A 3AL2A 3EGEA 5EMMA 4I9HA 2H2AA 2VK1A 3NWEA 2VAPA 1QWOA 1S8OA 2JFNA 1FJXA 3QLTA 2ONZA 3DE7X 4KPYA 1NC3A 1ZUIA 3ZV6A 4DMHA 5J59A 4EA7A 5C8YB 3FGOA 2DOKA 3MS2A 5AK0A 1NV8A 1W5SA 5JH7B 5DXFA 1ISHA 4TYYA 2XCLA 3ONNA 4J2TA 1AM4D 2BL4A 2FN9A 4TLEA 1Q15A 2L69A 3VTKA 5LZ5A 2B6HA 4ENWA 1EWVA 1J6UA 1EX7A 3FDFA 4I19A 4HXEB 5FJJA 3U6BA 1JR6A 1IHYA 1R6TA 4MB2A 2Z4RA 3L8FA 3Q2KA 4RK5A 1IIBA 1Y63A 1EGMB 1E9FA 2JH9A 4WERA 2CXHA 3KB6A 4QRDA 1KI2A 4M9CA 1ZCFA 2G5CA 1ZD4A 3ELWA 3WG9A 3W5UA 1R6VA 2QI9C 4OQPA 4L8FA 4RWEA 4KLCA 2L19A 1Y8AA 3CLUC 3VJKA 1PZMA 3KPUA 3UW3A 8GPBA 3GDWA 5DMHA 4URXR 4NDAA 3ZQUA 3Q6NA 1IPFA 4MHSA 1SCUB 3NGXA 1AXEA 5EVCA 1CVLA 2F6RA 1AGRA 2YUTA 3NBQA 2G9UA 1F12A 1H85A 2IYUA 4UDXX 2JFYA 3SZ3A 3EFOB 1E8MA 1G5QA 2QMZA 1K6JA 3LGAA 4ITRC 4YXWD 3SVTA 2DWCA 3LBAA 1ABFA 3QNMA 3ZE7A 4BGVA 3O8OA 4MPRA 4C6SA 3RUIA 3UAWA 3ZEIA 5DE3A 3L6EA 4OYHA 4RMIA 3GJ4A 3PE3A 5LNK1 1S01A 1Y6JA 3EGWA 3PXUA 4HNGA 4R2JA 1VIDA 2XWSA 3U16A 1W85B 1KQPA 5K3FB 1M6EX 3ZE9A 4LNAA 4UPVA 5KEIA 3W5AA 1D9XA 4KN6A 2V7PA 4DR1B 2BWJA 3EPHA 3OQPA 2C92A 5B36A 4PZLA 4IIXA 4CTOA 1E7YA 3RWOA 3E3NA 2I1LA 1HDEA 2O2IA 3VZDA 1LBQA 13PKA 1DAHA 1T35A 4M3NA 4R69A 3HK2A 1L4KA 1FFYA 5I9TA 1W73A 3KJGA 2AJTA 3H4MA 3ILYA 4KXWA 1PQ4A 3ILVA 4QGFA 2HMVA 1AZSC 3AHCA 2TMYA 3A3OA 1GNRA 5J2UF 1DKNA 5AIBA 4LWQA 2HN9A 1W48A 1Y6QA 4RDCA 1U2TA 4ZCTA 2A7QA 3X1ZA 4LCJA 2PRZA 1IN7A 1F4PA 2WPDA 4CMHA 1DRVA 3N2ZB 3L82B 3SMVA 1UIMA 4JUFA 3LP6A 4YDHB 3FZGA 5G3ZA 1YRBA 1ZNYA 4LGMA 2PSJA 3H05A 3LSTA 4ZCQA 2I03A 4LEIA 4FTWA 3QBDA 3I5MA 2X5KO 5AHRA 1I7PA 2ZYWX 4PSAA 4XCXA 4RJKA 1HTTA 2W2LD 4B3DA 3W04A 4EM6A 1ULUA 2I4TA 4MJ3A 2O05A 2YV4A 3A9RA 1Y6GA 1RHKA 4AVYA 4MDFA 2PJDA 1PT6A 1SCJA 2HWXA 2C8LA 3T5MA 2W83A 2LKDA 4JT8A 4F1JA 1D2AA 3W6UA 3N53A 2BHSA 2NSJA 5LCXA 1KZ6A 2EWVA 2A9RA 3NP9A 1I80A 4RTRA 2RE8A 3G3EA 1QR2A 3A8TA 3BTUA 2YCLA 2BFDB 3C3DA 5LYJA 5IKXA 3O2QB 4IR7A 2PHZA 3FDJA 3NHUA 2YHUA 4URHA 4BMXA 1Q44A 5A7GA 1F5NA 4YRFA 1V1JA 3P9RA 4X8OA 1JTEA 2XNDA 4M6WB 1CZHA 3EVBA 4YTEA 1J2JA 1V3QE 1XZKA 4O2AA 1XB2A 3TQOA 1ND6A 1O3YA 3HXPA 5E9QA 5J9FA 3CEPB 1M7GA 3USES 1ONNA 3O92A 3QPWA 4I4LA 2E89A 4G07A 4M37A 1PR9A 2GTIA 3C85A 4AJIA 2ACEA 2D7DA 4PN3A 5TS2A 3PI7A 2OGTA 2UYQA 5F33A 4CCYB 1CR2A 1TZMA 2DJ5A 4OHRA 3DT8A 2VJCA 3QFSA 4ID9A 4S1VA 4UAGA 3SX2A 2XDWA 1E2QA 1RBZA 4HX9A 4MRNA 3H5TA 1DO8A 1OVGA 4AKEA 2RH9B 3HBNA 2GZ3A 2B6NA 1WB5A 3LL7A 3IBCA 1DIHA 4WVLA 3HCBA 4BQQA 3R7DA 3Q15C 3KAKA 1X9HA 4FEAA 4JVSB 4KLRA 3DO6A 3IRVA 2YOFA 1Y48E 2MSNA 3K1TA 1NVTA 4FCCA 1WRBA 4TRMA 2UUCB 1P17A 4JXZA 1SB8A 4DV6B 4H15A 1LDNA 5ES3A 4R9VA 5K4HA 4KVFA 3Q1LA 1JFFB 1YONA 4QYIA 4JWTA 3L0ZA 3QUBA 1QG4A 3QOFA 4LPKA 4XXHA 3BDAA 4CFYA 1A9OA 1H4SA 1IN4A 1D03A 3DZGA 1T15A 1GNPA 2ZVQX 3VR0A 1JP7A 3I1YA 3U0BA 1JU3A 1KP9A 1XZFA 3JASB 3R5JA 4EDHA 4QRIA 1J42A 2B1IA 5TNXA 1DV1A 1O95A 2GZ1A 5F7ZA 2AUNA 2OKGA 3CMCO 1GRRA 5DP2A 4EY4A 2OCBA 1A9PA 4BBZA 4YWHA 2YZ2A 2WJ6A 3QXJA 4I6GA 3ZXYA 3ESZA 4JA2A 4RS3A 2AOUB 2VK8A 2LKCA 4XX0A 1EJ6A 3UANA 2OCXA 2FFQA 2ZIXB 3H5IA 3IOCA 3F6CA 3LDAA 2HL6A 2GEBA 1JEQB 1DX6A 1ZWKA 3T34A 3VU3A 1IY0A 3FYTA 3GJZA 3PQ6A 4O8CA 1Z4JA 1J0CA 2C4UA 2IQIA 2OD2A 1B93A 4U7HA 2VH1A 2I2CA 4OHYA 4HN2A 2K7ZA 1EDEA 4S05A 1ZC1A 2BCGY 2EX4A 4LZAA 2OXTA 3KU1A 3D8HA 3DEJA 1Y6RA 3D43A 3FTNA 3HBJA 4XJTA 5E8JA 4E03A 1LLCA 1N5OX 4UDYX 2H1IA 2MM2A 3NBZC 2PPLA 5EUQB 4YC7A 3L1IA 3OO0A 4XSHA 4J3JA 4QDJA 4GZ6A 4I50B 1OV4A 1NBIA 1K7EB 2OZPA 1ANKA 3K8YA 2EKDA 2IC5A 3OMLA 4JLUA 3MRXA 4ZYYA 2JHPA 3BE6A 4FHDA 3Q8WA 2ZIZA 2J7PD 4IGKA 4KBYA 2ZI7A 4FKBA 4FP9A 3K6RA 1RS0A 1WQ1R 3GEGA 1ARZA 2PX4A 4HDMA 3CX6A 1FX0B 4B8WA 3KR0A 4JR0A 1PW7A 3PC4A 2YWCA 2CKDA 2QSYA 1P0IA 3BL8A 5BQPA 1JJFA 4L2IA 4PCVA 1AXGA 2QNIA 2HA5A 4BIMA 3QX8A 4EUHA 4MIKA 1VCOA 3UYKA 4CV0A 1NW8A 4WKGA 4XQEA 4DQKA 4EYQA 5FWDA 3UMBA 2WSYB 3A9TA 5JR3A 1FB5A 2HUNA 3OWXA 5HIJA 3AFNA 1VBNA 1JMVA 2C58A 4A92A 4PRKA 5FTJA 2J9FB 2Q4RA 2GERA 4OGFA 1KO8A 1AZWA 1Z13A 2JDID 3QHQA 4Z49A 3DP9A 4EHFA 1OKKA 1N5MA 3SF8B 4XM1A 3QKTA 3LY7A 2NU7A 1Q12A 2OAGA 3WL5A 4HDSA 2GRJA 2V3VA 2VHTA 4NE9A 5L3ZA 4EMBA 1GZUA 3RTGA 4F5ZA 3RTEA 2YFQA 3EDOA 3JV7A 4KMSA 4NZMA 2QYOA 5EXSA 3VVCA 3AUUA 1UQUA 2AE2A 3C70A 3R20A 4BX8A 2GTHA 1Q57A 3NBMA 1FP2A 1PG0A 1ZU4A 2R00A 4QQNA 3VC1A 1CIPA 2IPOA 2YINC 2ZOSA 5CVDA 3A0RB 1XRSB 4YCMA 5UKDA 3ZCPA 1OMOA 1SZJG 1Y5MA 4IV8A 4DLKA 1UFQA 1V37A 1YMVA 3LPDA 4IZOA 1MGOA 1OU4A 2IYLD 4F5YA 2RARA 4J6FA 1XDWA 4WKOA 3W5IA 4HX2A 4BB5A 3CLSC 2Q2OA 5JS6A 4ZTUB 1NKTA 3BIOA 4DGSA 4PR3A 3E5HA 3NT4A 5FA8A 4J29A 4EJ0A 5KTKA 1KZ1A 1ZGJA 4FMPA 2F1RA 4HDCA 4M1EA 4CDMA 3REQA 1A88A 1MOQA 1KVRA 2ZUWA 4K3UA 5KYXA 2AQIA 3TPZA 3W9UA 2GWHA 1IIRA 3HA2A 1RMTA 4EZIA 1ZGAA 4M7PA 2RGUA 4LOJA 3SSNA 2P9FA 5GAJA 4KMMA 4Q03A 1Q7TA 4RA9A 3DFIA 1AKEA 4JBYA 4LXGA 3KQNA 3T9AA 3GAFA 5IVKA 1XOIA 5E1MA 3G2LA 1Y0BA 5LZ4A 1ABBA 1XK6A 3RSHA 4UPEA 4C7KA 4KH0A 2XGGA 5FCDA 2PWBA 1ENOA 2J9GA 2C2OA 3WL8A 2JGDB 5L4LA 1OZGA 4CLRA 3D9QX 4O6VA 4BYGA 1E64A 1JVNA 4IXNA 3WBJA 1YGPA 3WJ7A 3DL4A 1VBKA 1TL7C 3JQEA 3L8HA 4NCKA 4BUZA 4XRGA 5J4LA 3DBOB 3K9LA 3KJXA 1JKIA 4JYZA 1E1NA 4UULA 5DDIP 4COOA 3G59A 1SHKA 1PX2A 4JDPA 3B3QA 2QUAA 5FPPA 2H00A 1HT3A 1EE9A 4AX4A 3BTOA 3CRW1 121PA 3HKDB 3TLGA 4FVTA 2RH4A 4D0RA 4MVJF 2QYHA 4ES6A 5KINB 3WDSA 2AW5A 5T3UA 1HDCA 1W30A 1YB4A 2VHUA 4HLCA 1E2LA 4KJZA 3DVAB 1A50B 3PNOA 2Q3CA 4GYKA 5AW6A 1MVNA 2E21A 3NASA 1JKFA 4DLNA 3VHRA 5GM2A 4MWSA 3U19A 5TGZA 4JZYA 4MUXA 5GGYA 4X62B 4K6CA 2BT4A 1RQNA 3S2ZA 3TLZA 4CEJB 5FJIA 1W4ZA 1RQLA 1RVV1 2GD2A 1YUBA 4KE9A 4V2IA 5KTRA 1XKLA 4JC8A 4OVKA 1QTRA 4K28A 4PCLA 4I4IA 2VDJA 3GLIB 1YZHA 4LI0A 3SEAA 1J5XA 2IZ7A 2X5NA 4WH0A 4U8HA 1FOEB 2A7XA 2JZNA 1CEYA 3KOYA 2R4UA 3PI6A 3E61A 1C0PA 1QO7A 3D4PA 3M0EA 3QENA 2JGIA 1S9DA 1KFCB 4NZYA 1UBGA 3AGPA 4PPNA 5EPPA 2IXTA 3WLEA 1E59A 3GR6A 3H2ZA 2YWBA 3NHPA 3QKIA 4BUJA 2PBZA 4D8XA 3D81A 4UHHA 2A84A 2B8JA 3PNQA 4C0HA 5IM4A 2WILA 1RCFA 4RJIA 2P2ZA 4O2LA 5K0EA 2X3FA 1E2KA 2PZJA 4R3UC 1PLJA 1I7QB 5B7QA 1QG0A 3NJRA 4GVXA 2NPOA 1OFHA 2HMWA 5AKGA 2C99A 3WS7A 2XWQA 5ITSA 5EKDA 3S7TA 3CGGA 4XTRA 1QLWA 1TE2A 2PS0A 5K8VA 4P0QB 2FEXA 3S5JA 1DIBA 3P9PA 3R24A 2ZYSA 2FWBA 4DUGA 3MZ0A 5F73A 4D43A 3NHJA 3DDHA 2BP7A 3NBFA 1UBHS 1QH9A 2BKUA 3ET5A 2WP0A 3M82A 5IN5A 1MEEA 1FE8A 2QZ9A 1A2OA 2VHEA 3V2GA 4HDNB 4D74A 5BN1A 1FP1D 2AFHE 5HUJA 3HY6A 1EPUA 4MW0A 4DJFC 4C7BA 1OBVA 3E9ZA 3AW8A 4K9QA 4EG3A 4DMKA 5E3IA 4QGAA 7YASA 1JWLA 3YASA 4GPBA 4CIYA 1IBMB 5IT5A 1KVSA 4LS3A 5F1OA 4DV7B 2QR5A 4PGGA 4N5LA 3L43A 4L6IA 1YVPA 3HVIA 1VLMA 1N5DA 2H4ZA 4BBPA 2G72A 3C4JA 3RG2A 2CNBA 3L7IA 5K20A 1E5QA 1LI4A 4MS4A 1UBEA 4KE6A 1RBYA 1CZRA 3RKSA 4DL9A 4EQZA 4XKJA 1V11B 3OCXA 1KKLA 5JAUA 3OQHA 5BNIA 2ZZMA 3RUFA 2QK4A 4EB6B 1M33A 4K9OA 3SXUB 3J80A 2X4IA 5KNCH 2YIVX 3G5UA 2XKKA 4IJUA 1LDMA 5HTOA 1UEJA 5JSZA 1YNSA 2PS9A 3FH0A 3LA8A 4B8YA 5ARBA 2WFLA 2AEMA 1DAMA 5A4MS 1Z15A 4CGYA 3A26A 5DLYA 2J0VA 4NS1A 2ZRLA 3B1WA 3ZDQA 2B7CA 4RADA 2O8CB 4D4GA 2W4MA 4Z4CA 3UENA 3TH5A 4PQYA 4YRLA 4TTJA 3QMWA 1M2HA 2AXPA 3DE4X 4PLWA 4IJ5A 3QQ8A 1FCJA 2Z1MA 4FEEA 1AD2A 1N2XA 1Y5IA 1FSSA 5DXAA 4A0HA 5AVVA 5AW4A 3OA0A 3PDIB 2R11A 3T4UA 3L8DA 3SY8A 1QH8A 3TW0A 4ALNA 2R5FA 4NMXB 3L7BA 3O8CA 5JC1A 2DVMA 1FQJA 1I51A 3H8SA 3RSSA 3NTLA 1R6DA 5C1BA 2FETA 2ANCA 2IDJA 3IEPA 3UAZA 4C88A 3KD2A 1QAOA 4PQEA 3U60B 2FEAA 2PZAA 4JJKA 2XB4A 2DFNA 4MUNA 4NEHB 4ZP1A 3WWPA 3RJ5A 1FFEA 3TJRA 2HDOA 1M0EA 5JNTA 2W90A 1V5IA 4BVHA 3FCEA 3R9IA 4EHKA 5B1YA 2YIJA 4GWGA 5J5AA 2FOXA 3B85A 3ZXIA 1L4YA 1ENZA 1WVIA 1JAHA 5EWJA 1JR3A 4GXNA 4AZVA 1G7RA 3TR0A 4B3JA 1EFUA 1TM5E 2QTVA 3ACDA 2JFZA 2GBLA 3UC9A 2X8JB 1QHSA 1KI4A 4HR7A 4RJLA 3KL2A 1N7JA 1P4JA 1U0SY 3A1EA 1GG2A 2G77B 5FLXA 2XUGA 1RD4A 1QF9A 2V0NA 4RCZA 4BQEA 4TTAA 4XM2A 1OH8A 1FDVA 3O9ZA 5DNDA 5JQGA 2C2WA 1TMYA 4M38A 1BX3A 3RUDA 3EF0A 2OXFA 3FPTA 2HXGA 1MU0A 1NN3A 1G3QA 2ZQZA 3ADOA 4WEQA 3BH7A 1B1AA 3TTWA 2WM9B 5BUZA 3BAZA 1XQVA 4HWPA 1OV6A 1PUXA 3JPWA 3KELA 1Z56C 3N86A 1OXMA 2AKYA 2C78A 4OHBA 2JFPA 4N3NA 4HJRA 1DPFA 5BSUA 5EIEA 1HNWB 5JMPA 4L02A 4PAQA 1NVWQ 1UBSB 4PRLA 4R1UA 1W5EA 1FRQA 2JFFA 2VYCA 1JPVA 3SF0A 3E3LA 2FGKA 3SC2A 1XPRA 1DT5A 1PJBA 4H27A 2WYWA 3FY4A 4KIFA 4ZAWA 2IH2A 3ESXA 4GBGA 2VYFA 2X7XA 3QXGA 4IX1A 5ERXA 3Q8MA 2VI5A 3B1ZA 2DTXA 1K4YA 2JLBA 4K86A 3TJMA 3V1LA 2NUPA 4ENSA 1IUKA 1UC9A 1T8RA 3CLHA 3SC6A 4AXBA 2OV1A 4RVCA 3G0IA 4UZSA 3T1HB 1LTKA 4XLLA 2OHVA 1E4EA 3AIKA 4A0FA 3DXXA 1WSDA 1NJ6A 1A4RA 4Q37A 4Q0MA 4EW1A 4F5WA 1RLMA 2RDMA 3ZCVA 3NYRA 1HXHA 3I30X 3PXAA 1RJDA 1YK1A 2RHJA 1DBIA 1OLXB 3RT1A 4UBLA 1G8SA 3QOWA 1D2RA 2IEYA 3K0CA 3LM8A 3RSCA 1OCEA 3LUGA 1MAVA 1JXOA 3S40A 2ONCA 3OHSX 5LQNA 1D5WA 5K8LA 1F8YA 1Y80A 3EEOA 2ZZNA 3KPYA 1WR8A 2BUBA 3ET4A 2XYGA 3I72A 3CRRA 2VJDA 3OJXA 4C4TA 1IZ0A 3O2SB 1A9QA 1PKXA 2RC6A 3TW4A 3SJCA 3HJGA 2IS1A 3EGXB 2VJYA 3FUVA 3IP7A 4KQMA 4LSZA 4C1BA 1F51E 1KP2A 1QM5A 5HM6A 5LB2A 2VDNB 3BWDD 2PZ8A 4AP5A 3OC0A 2NTYC 4BFCA 3F3MA 5AXBA 1YS6A 1KH2A 4Z0PA 1V3VA 3JWGA 1QB8A 4JYBA 1ECLA 1VCNA 1SXHA 4F12A 3AVXA 4EYKA 5FB3A 1U4NA 4KNVA 4L16A 2CDAA 4M7OA 2PSFA 4W8HA 3DONA 4AD8A 1DUIA 2AJDA 3MAGA 3KXPA 5ALQA 1HG0A 3QU2A 4JLWA 4IP0A 4BLSA 5EZQA 4E1AA 1SVIA 3SSMA 4KKVA 4UMEA 1F0NA 1M74A 3UWMA 4CL8A 3OE7A 4QXPA 1AMOA 1S6YA 2C4MA 3CRZA 4BQPA 1PN3A 4D5EA 1AN0A 2OCGA 4M9RA 5H59A 1Y8ZA 4D25A 5CDUA 3FTPA 1H8HA 2VDOB 4D4MA 4J0KA 2M1ZA 4EP1A 4QVGA 2C3OA 2IU4A 1GCAA 3F7MA 3JD3A 1ZJJA 2R1UA 4JJIA 1BNCA 3PITA 3QA3E 3GLIE 4NS4A 3ZHBA 3HJFA 4S1OA 5TR9A 2W6CX 1G38A 1Q0HA 3FYCA 5JADA 1ECBA 3D7LA 4TYMA 2VJMA 4NJMB 5ESRA 3KYJB 4Q3LA 1H2BA 2B4TO 2BR3A 5JYDA 4Z51A 2O0LA 4OUDA 4W1QA 4GMKA 4DLTA 2IODA 4YHBA 1VI5A 4I6EA 5EINA 3LW8A 3HCOA 1GU0A 3PPYA 4BMYA 3ZHZA 3BTVA 5AM0A 3L8GA 1TC1A 2NLOA 3EHEA 5K0TA 3L4JA 1EFAA 4J1TC 1LVHA 1U1FA 2TMDA 1XD2A 1IY1A 3ETLA 5AK5A 5BW8A 4H77A 3JSXA 1XI2A 1TCUA 1N75A 1Y1KE 2PX0A 4FPXA 3UGQA 1ZM7A 2P9EA 4RTOA 3Q7PA 6PFKA 4Y1FA 3EISA 3KQQA 5JNUA 3BREA 3H5RA 2X9GA 5DP1A 3F6RA 1OX6A 5DGXA 1IWBB 1C9NA 3AESA 1POXA 3TI7A 3OFND 1D4AA 3U9SA 1OZFA 3E7FA 2DHQA 1Z6PA 2I2AA 2ZWIA 1B41A 4LYFA 5BN5B 1FQWA 3U7QA 1BMDA 1IEVA 4N65A 5SICE 1P3DA 1RZUA 1P72A 2AGVA 1QCSA 2CLCX 3LA6A 3L9WA 1MT0A 1NLFA 2CYBA 1SVNA 5IM5A 4UBJA 4IMIB 3DB1A 3ER8A 3H2GA 1KH1A 3FNRA 4H7IA 5DYTA 1KWKA 3TGLA 4ZRDA 1CUDA 2P2SA 1XDZA 2VDKB 3OZSA 5EFZA 2Q2VA 2VYQA 2HXYA 1E0DA 3HWWA 3PR3A 4HAUA 5A4AA 3ZIAA 3H1GA 2E4VA 1MO5A 2J3IA 4FDMA 4K8OA 5FKJA 4D79A 2C3YA 5HDQA 3U7JA 3FKSA 4TYQA 4ZDWA 5BRAA 1I32A 1Q2UA 4FSHA 4J0JA 4OQZA 5ICGA 1BHSA 5KBYA 2DG2A 2VT7A 1U80A 2CHEA 4M0UA 4ZVPA 3VPSA 4DCGA 1WULS 2ODAA 3JWPA 4YMWA 4DNPA 1QFXA 1C29B 5AW0A 1SIWA 1Z6TA 2X1MA 4IQGA 3I1JA 3WZ2A 4BN5A 5KUTA 2FOIA 1KZ4A 1T25A 4MCHA 4OOEA 1SXJB 1QE0A 2JFWA 2IYXA 3O8DA 4QXAA 2C1EA 3RTAA 3GLTA 2VPWA 3CBQA 4JP1A 3TMYA 3ZDYB 3OKAA 3D5TA 1DIAA 3KT8A 1JSRA 4NU5A 4D8UA 1T5OA 3T0FA 4A0QA 2IYAA 1TUGA 1YIDA 5JDIC 3D54D 5AQ1A 5A7HA 4IEIA 5JVDB 2CD9A 3WGKA 4AF7A 5HKKD 3E1SA 4PPYA 1K4MA 2HA0A 3OPQA 3LNCA 3OPVA 3QI2A 5CJJA 2QE7D 1N2CB 1ZN7A 2FWMX 2HSEA 4ZQHA 3ZLBA 4X9XA 1VJCA 2ONJA 4GEKA 4ZOLB 1G291 1KMMA 3TLMA 1HEUA 3ZGOA 4HO1X 5B6PA 1HDIA 2CV2A 3H9UA 2AC7A 3H9CA 3L7CA 4DIKA 4J76A 5B30A 1APBA 1YJ5A 5ILOA 2RGWA 4O4IB 1CY7A 1TPYA 1TEZA 2CHVA 4YNBA 2VF8A 4I55A 3SEZA 4IG4A 4F4FA 1TOAA 3ORYA 5BOSA 1JEYB 1G3IA 3GEEA 2JI4A 4C03A 4MW4A 4D92A 2Z9BA 4UREA 3WTCA 2I2BA 3IBYA 5HGXA 3NCTA 1BXKA 4TMKA 3WMXA 1VPLA 4A8TA 3CVWA 4NJOA 3V7NA 4A6PA 4O4HA 3QKSA 4JGBA 1A8QA 1GG5A 1Q7CA 1B26A 2RGYA 2WF6A 3P19A 1Z5ZA 4FW8A 2Q49A 4ITUA 4TMYA 1NUAA 4W7SA 1XBTA 5JMOA 1QIHA 2C7QA 1U2RA 2EWMA 2ZTHA 3C8ZA 1N4AA 1UADA 4KXNA 4RACA 5ALWA 1PL6A 1Z4LA 4Y18A 1NVDA 1PL8A 2OZLB 1SOUA 2OG1A 4JYMA 5HJ7A 4QUBA 3EZ6A 1YRAA 1K9VF 3IKLA 4IFBA 3ZNPA 5JZ9A 3W1VA 1CXZA 1PT9A 3GBSA 4HDKB 2ZWPA 4NPCA 4OH1A 1F1BA 2BI8A 2FUG1 3BCHA 3VAZA 1FRNA 3B48A 2WD7B 4BLTA 2D0OB 4A10A 3NDRA 3QELA 2IOHA 4NDNE 5DW3A 1MDFA 2WUWE 3K1YA 3ANTA 4R8VA 1QFYA 1NW6A 1XZBA 3UT5A 2RHOA 1CG6A 3NRJA 2P2DA 3W77A 4YONB 4K8RB 5CFRA 3NNNA 4RVGA 5IEBA 3QRWA 1RCTE 4MB0A 5KSYA 2J6HA 3M5WA 1BOFA 2W2XA 4YUXA 1KE2A 2H1RA 4D8TA 1NP7A 4WGGA 3URMA 1HZZC 3DL7A 1AY0A 2FSVC 4JX9A 4MJXA 4HPWA 3UMMA 1S8NA 2R86A 1GRNA 4O8ZA 3FCSB 2PGDA 4R2IA 1XTBA 1Z88A 4DLYA 5C9ZA 1IQ0A 1JFRA 4K9SA 2TECE 1M2NA 4YAFA 1PRYA 2C42A 1W4RA 3RI3A 3TD9A 2C5LA 2BSQA 3LY5A 4PQGA 5DCWA 4ARAA 5LBUA 2B3DA 3H5OA 1HZZA 2A6PA 2FSVA 2DBYA 4HRYA 1K8RA 4QDUA 1CK4A 2EATA 2Z1NA 4WDQA 3WI7A 3ABOB 2Q1DX 2GFIA 1ACLA 3AP3A 3O8QA 3FOBA 3O1IC 4J2OA 3ZUGA 2UYOA 1TQ4A 4AIIA 2XUHA 1FP7A 2WJWA 3ANNA 1QKKA 1MTZA 2C2XA 2YYZA 4MAMA 5CXSA 2PGLA 4ZGWA 4GE3A 2WICA 3FI9A 4G5RA 4CIAA 2QA5A 1DQZA 4LC9A 1G2IA 3CZ9A 3CZ4A 4HATA 5E9JA 2XYPA 2NUBA 4HH0A 5SYMA 2RG1A 1HE8B 3UAVA 2Q3FA 1OHHD 1EUQA 2AWOA 3U37A 3RFTA 3LUDA 4S1NA 5IC6A 4AYXA 3KB2A 2I7DA 4I46A 3EDCA 4C9BA 1GKYA 4HZGA 4QUIA 4HOYA 4D0SA 2HDHA 4FGUA 4F2WA 4ERXA 5IDXA 3NVKI 3TLBA 4GIBA 1L9KA 3LV8A 1NTOA 5JAOA 2ZS8A 3MTEA 5FEUA 1T8SA 3MBKA 4LC0A 4QATA 1DO2A 2VTBA 1WD7A 1D6SA 1LU9A 3L6DA 2WIKA 3NBXX 4QHSA 3VRHA 4I6JA 4N41A 2EJTA 2IIPA 4REQA 2CXPA 1SHZA 1N9KA 2RB4A 2QZSA 3QEJA 5EEGA 1AURA 4ED9A 1JJVA 4L7VA 2HSZA 4B6EA 4CM9A 4YPFA 5CNIA 2X42A 3A6KA 3G82C 4TWAA 3VJMA 5F4BA 2PUBA 3DDSA 2H4WA 1CDOA 1NVGA 2WKSA 3L9XA 4MNTA 5ALKA 2FMXA 4PANA 1WEHA 3B13B 2JV2A 2QUIA 3BS4A 3NC4A 3SEQA 3HS3A 3D3NA 1ZHHA 1KYWA 5FO1A 4E08A 2I1WA 2IOFK 3LDHA 3PXXA 4GVPA 4JVNA 2PWZA 4IVQA 4WXHA 4FYVA 2QTGA 3CT6A 4GSLA 3NRCA 1Y5RA 2H5JA 4O1HA 5BVHA 4G5HA 4DJAA 4Z7QB 3KWFA 2NZVG 3VR6D 2BE9A 3AQ4A 4JGGA 3X3HA 3LBIA 1Y4ZA 5KNDA 2WW8A 2D1SA 1CC1S 5CHEA 3VU1A 1JG2A 1AH2A 3C7CB 2F43A 1I30A 2WE8A 2H0AA 3C8HA 3F78A 1ZONA 3SFVA 1PEDA 1DHTA 1JWBB 1EBFA 3ZVRA 3GLGA 1IHDA 3GN1A 2TSYB 4BNHA 4G56A 3WHKA 5IG2A 1YS2X 5FWNA 4G8BA 2NTJA 2Q3DA 1A04A 5IAJA 3E5MA 3V1MA 5BMVA 2J09A 1HLPA 1XTIA 1HT1E 2QNBA 1G16A 4LNHA 4UUQA 1GUAA 3DE0X 2HD4A 3OLQA 2PX5A 4KACA 4W8GA 3AL0C 2B5WA 3KKKA 1VLQA 3B9QA 4G1CA 4B7ZA 5AJUA 1L7AA 3OTIA 1GFZA 3DFMA 1P3JA 3EZ7A 2Q1XA 4E4RA 1ZUD1 2IXGA 3O84A 5L3RA 2FN4A 2ZSHA 4UNQA 2GILA 1C3OB 4YP5A 4R7GA 5CB4A 4B0PA 3EZYA 2Q3HA 1J1ZA 5EIFA 1AUOA 1DAGA 1I5RA 3TQTA 4FMCB 3WLQA 3KM0A 2NZ8A 2GNAA 1JDNA 3K2BA 2DR3A 4FD2A 4TMZA 4BP8A 3ZVMA 4XPZA 5D3ZA 1OI7A 3H11B 1KQFA 1W88B 5I7SA 2DMRA 1AKTA 5JNRA 2BJHA 2G4VA 1D1PA 5KOIA 1MQSA 4LHZA 3VM6A 2A9KA 1THZA 2QAGC 3F5QA 4IXWA 1KKMA 1Z73A 1E2JA 1IRXA 4R5HA 1ZD2P 3TLAA 3H5LA 3IKJA 4C3UA 2OYSA 1DQSA 3KTFA 4WK4B 5JTUA 1AGYA 1QC5A 2QG4A 1JFVA 2XYVA 5F23A 4QD3A 2CMDA 2V97A 2Q2WA 2DB3A 4A73A 5FX2A 3G7NA 3H7AA 1ZH6A 5BR4A 2IHVA 3QZUA 1UP7A 3CNNA 4IOLA 4LOAA 4Z7JA 3DLTA 2AMJA 1WETA 4C6RA 2QRVA 3E23A 1YZYA 3CSUA 1BE8A 4ZANA 1DX9A 1JR2A 1TVCA 2XE6A 4CVNA 1V4VA 1PJ3A 1QSGA 1QH0A 4FDVA 3OEHD 4IUDS 1UBJS 5EOVA 4JIGA 4J0HA 1Z07A 3BGDA 2Q9BA 1FW8A 4P36A 2PH5A 4U7JA 3BBPA 8ABPA 2V7BA 4QIHA 5JU6A 1QKIA 2JCVA 1NP6A 2PRJA 3CN7A 4G37A 1YHZA 2X6RA 4A6EA 1XK7A 3IXMA 2UXDB 3ZDBA 2O5CA 4RL4A 2GM5A 3D0RA 4S35A 2ZB2A 3MUFA 2V4UA 4GLJA 4YJHA 2XMRA 2WEKA 3MTGA 4IHJF 2IY9A 1EP3B 3AERA 2AI1A 2PMWB 4EGQA 5ADHA 5JNSA 1QPZA 1X3LA 1RHMA 1N2CE 3DZKA 2BFNA 3A7DA 4D8YA 5KTNA 2YXBA 3BQMB 3IX7A 4XVCA 1CJVC 4BY9E 4CBVA 4DILA 1PTKA 3L7OA 1M34E 4CEHA 2PSHA 5B4VA 1N4DA 3PDWA 1SCQA 3IHKA 1GFWA 4N82A 3F49S 2GBIA 4CKCA 1S2OA 3NIGB 2UVQA 3O1JC 5FL3A 2B34A 1UP6A 4LHWA 1BU5A 3K6SA 2DPMA 4XD7D 2UXCB 5AKYA 4YAIA 5LR6A 3R74A 3DBHB 4G5QA 2VEOA 1ICIA 1E20A 1M2OB 4NSNA 2JAOA 5REQA 4KLNA 4NMWA 3IC5A 2AFVA 5B1EA 3KOOA 1JBQA 4QTXA 3EC2A 3Q72A 4LZJA 5CX1B 3UUEA 2YOHA 4I9GA 3KVVA 1VXRA 4HNRA 3AKCA 5HTKA 4B82A 4UOZA 4E5PA 1VSTA 2H4FA 2ZANA 4JL5A 4FX5A 2XUQA 1R0ZA 4WK0B 2W5UA 5HJ5A 3FA2A 4D8VA 4GPTA 1X38A 1FZQA 1Z2AA 3I5YA 1GFSA 2VG8A 4O4JA 1ZO8A 1QQ7A 1JKJA 3I34X 1T5HX 2QPLA 1WMBA 3QLVA 4UU8A 4KWIA 2H57A 1G8AA 2OT3B 4AKSA 1V39A 3GLVA 3WLAA 4DT1B 4Q1VA 4UNPA 1IHUA 1BX0A 3B3AA 1MCZA 1K1EA 2B4RO 1DFGA 1WCWA 2YQ5A 4IIVA 4NYJR 4R1MA 3PV0A 1GGKA 3HCEA 1W2WB 1YBFA 4G1EB 5CA1A 3K9WA 1DG1G 2YJGA 4I1IA 1VL1A 2IUEA 4YLEA 4KWEA 1M0TA 2CMGA 4YPVA 1Q74A 1C30B 1C7ZA 1M6NA 1YAJA 1G8HA 1Q1GA 1TZCA 5U4XA 3UKOA 4DV5B 1OREA 2I0FA 2I76A 1PVDA 1DQRA 1PK7A 2BM1A 2FRVA 1TJNA 3HJTA 2A67A 4CL3A 5A1JA 4MRMA 4QDOA 4NHOA 3L0IB 4TWJA 1CERA 1D0IA 2WYIA 4HEA1 2WJVA 4HLQB 5LP6B 4ZEXA 4F8JA 2E87A 1ORDA 1OFUX 4TWZA 5GTDA 5IKPA 2CXUA 1G6Q1 2AR7A 3B7GA 1IK4A 4GU5A 4M1OA 3KBBA 3TNDA 1WSBA 2XB9A 1G9XA 1ZGCA 2C5EA 3GU3A 2WTNA 1KFKB 2Q1SA 3OICA 4NV1A 1KZGB 4UXIA 2X0IA 4BMDA 2ZBUA 3P97A 4INAA 2QZ4A 3RU3A 4BO8A 4C07A 5C7IO 3IL2A 3TM4A 4C7OB 3RANA 2WKQA 4ZT6A 4MQEB 2Z2ZA 3KJNA 2XMBA 5D5PA 2A59A 1E0AA 4DA0A 4Y8VA 4E33A 3CEAA 4RK6A 1ZD1A 2GA8A 4ZI7B 4RM3A 1DJNA 1P5FA 2W6ZA 4LF9B 1GGNA 2Q5QA 2XQGA 1WE2A 1J9GA 2ZW9A 3B5EA 3I9MA 2JAPA 4R2HA 4C08A 4JB2A 3BA6A 4D41A 1V8ZA 4CM8B 3VZPA 221PA 3OCCA 1YKSA 4AO8A 3EXHA 3CV3A 2MTBA 3Q11A 1Z62A 4O0MA 5FL7A 3ZBPA 5J1SB 3RYIB 2C0QA 2VCEA 3P1JA 2V9CA 7GPBA 2J30A 2J07A 2QX9A 4ZHQB 1Y7PA 4PYLA 4TV9F 3OLVA 2CUTA 5BSVA 3R6WA 2YWRA 2FX2A 3IAUA 3WL6A 4MVJH 1KQNA 1NLYA 5L3QA 3MELA 3HMQA 2XQJA 1WKVA 5CPFA 5HUHA 5LU9A 2YW2A 3G1TA 4AN4A 1X8XA 3WLRA 2WJZB 4YJKA 1L4EA 1FSPA 1UMCB 3GCWA 1H2AS 3HYSA 3PQ4A 3FKJA 1XXHB 1Y7HA 2WU4A 3BJRA 3UTDA 5IAEA 1E63A 1NSTA 4LX8A 1JDVA 1RJ9A 2GZDA 1A8HA 2LRHA 3WLOA 1P4GA 3JVUA 2A5GA 3VR3A 1EXVA 3K35A 4RKFA 5CB0A 2AT1A 4GOOD 1TYEB 2PNJA 3GVHA 1Y3CE 2W6QA 4FJ2A 4IGIA 5J23A 4PHHA 4RHTA 3EUAA 1ZI8A 4LHVA 1GUFA 1TJYA 4MWZA 5LQRA 3WB1A 5BUCA 2OBBA 2VT6A 2P6PA 4P0PB 1E9RA 1BZYA 1TCBA 2A9JA 4UMVA 1S2LA 3SDZA 5HQ3B 4MPPA 1R8SA 3A4MA 3CKLA 4P5PA 5DF1A 1ZNQO 2PGXA 1FLNA 4CDNA 3U09A 4OU5A 4QXMA 2C57A 4LYJA 1CV2A 1MBZA 5T41A 3SGLA 4R84A 4D9NA 2YHIA 4ALLA 1ZD8A 1KXZA 1XNGA 2DUWA 2OILA 2BLNA 1WXHA 4PX5A 5GIPE 1DEXA 3K9NA 1TZKA 1OIXA 2FEPA 3MWYW 2UZ1B 4D4JA 5JIBA 2EFHB 3KOZA 5KTPA 1JQ5A 2ZB8A 1NW5A 1U0EA 1GWNA 2AYXA 4MR8A 2WTAA 3T3PB 821PA 2RBGA 3GEHA 4ZYWA 1JLRA 3CZ5A 3R5HA 4UZFA 5EAIA 3ZU6A 1AQYA 1Z6ZA 5K6RA 5E3HA 3GHHA 1HORA 3PX7A 2WWXA 1BFKA 3WVNA 5ADUS 3AILA 4ZO6A 2PUWA 4KCGA 3BQNB 4RLQA 2QVGA 3SNHA 4DBZA 4X3OA 3ZHUA 3OU2A 3WK5A 4R81A 1UXOA 2KBEA 2BFWA 3GARA 5TX7A 5JCJD 2YTZA 1ZN2A 5K01A 4XIFA 3MMXA 5LBTA 1Y81A 3OD1A 2VHWA 2EXXA 4OH7A 3NBYC 4ISCA 2Q1TA 2VT2A 2WE7A 3B6IA 1ZD5A 4P9NA 5E4YA 5KNCD 2AMYA 1HETA 2AFIA 3ITEA 3BZUA 2I66A 1T5SA 1EG7A 3GJYA 4WLOA 4ZODA 1L9XA 1MOSA 3V8NA 4DR6B 1JSZA 3O2NA 5FORA 3WGTA 1NFQA 5IX8A 4BNJA 3THXB 3BD8A 2C1ZA 2ZDHA 3SE0A 2BZGA 4J7UA 1DVRA 2Y67A 5BR8B 2MYTA 4QGGA 2C8KA 2QVBA 2I3AA 3LOPA 3H6KA 5IBQA 2HO4A 3WSTA 1E5VA 3RAJA 4LQ4A 1B8OA 1R4ZA 2WMYA 5B1SA 1RI4A 1M2GA 5CW2A 3TB6A 1UQRA 2R0QC 2C9MA 3RIEA 5FNZA 2ZE5A 4F2DA 1P7PA 4EFNA 1NZFA 3D8SA 1Y8RA 3IAS6 5MF6A 4JC5A 5LZ8A 3M5PA 4P7FA 3DOUA 2P75A 1M73E 2HJ9A 2M6SA 4WBSA 2O48X 2WOOA 3MWEB 1L1RA 2NZ2A 3QWZA 5JSFA 3LWZA 1KAHA 3L8CA 2ZYGA 1H9BA 5M5BA 3OQIB 4D3SA 3D6TB 4G41A 2SKDA 2VQ3A 2XH8A 1T9ZA 2NGRA 2CLMB 4KYTA 1MVOA 2OYCA 5ITVA 1O1YA 3N2KA 2B1RA 1IE3A 3QPAA 1P33A 2AN5A 2J6BA 4R51A 1ZN9A 4YV0A 1ORRA 3B70A 1C0IA 3ZHOA 4UW9A 3C1OA 3WGMA 1EVKA 2HJGA 3FYUB 3UWPA 4XQGA 2Z4TA 3HDGA 2B2XA 3GEDA 2JGFA 2HPVA 2C0PA 4RU1A 2UUAB 3STWA 4YCDA 3ZX5A 1K7YA 4LFBB 4C06A 3SYKA 4MLPA 2VSOA 5CCEA 4YHHB 4PIPA 1UMBA 5FUVA 4DW8A 3ON5A 3GT7A 4OSOA 4P08A 2WJIA 3MGAA 2GJ4A 4Q93A 1SD1A 2W7TA 3OE4A 4G0MA 4MYUA 4QU0A 3DOFA 5D01A 1E9AA 2IYPA 4RDIA 3QH4A 4P7GA 1KTIA 4PGAA 4S12A 4J0DA 4JBIA 4HNUA 1ZH8A 1H2RS 1P29A 1M2VB 3DJYA 3FJ1A 4CF7A 3ZJUA 2R8BA 1KEZA 1TO2E 4QA9A 4OHKA 4WNIA 3HNRA 3H2IA 5KYKA 4MDYA 1KDVA 3PC6A 1KRWA 2RAPA 3MT7A 3M9XA 1P2GA 1MOPA 3L7AA 5CRIA 1GQ2A 2Y2VA 3DEFA 1ZJZA 3GYGA 2PNFA 3ABQB 4CHTA 1LI5A 5HR5A 3FSEA 1NSYA 2QRZA 4KW7A 2K2QB 1QOPB 3CX7A 3HFRA 4LE1A 1RYEA 4FW9A 3V4VB 1QHHA 4WX2B 4WAUA 3H1PA 4B4DA 2FFRA 2CDRA 4QNRA 3SQMA 3LTNC 1HL3A 3R7NA 1OFUA 2LIPA 3TOVA 2C2KA 4BMNA 2G1PA 4OXQA 5FQOA 2HC9A 1WPGA 1SQFA 3WNVA 1CB7A 1E3SA 5HOEA 2HGZA 4OA8A 2XDPA 4QDXA 4Q3NA 1IUPA 1JQDA 4R9RA 4GBMA 3VOBA 3QI7A 1F14A 5K03A 2QMUA 4RY8A 4Y6OA 3SYNA 1OTXA 3BMNB 1DC7A 2HXSA 5KHLB 5KQMA 1E1KA 1DXOA 2FMUA 2HV8A 2J6CA 3CXRA 3RS0A 4CM4A 4AG5A 2WJ3A 3U39A 2J5KA 2PUVA 3EA0A 3WLTA 2VP9A 2D06A 1XMSA 5DH9A 4MK4A 1E1YA 4BO5A 4R0MA 1U6KA 2F1JA 4IFTA 1NRIA 1SUWA 2ORIA 1RHRA 4V3BA 4EA6A 4ZCIA 5D5QA 2O2ZA 4EY5A 3UM9A 4MV0A 2MSEB 4WZBE 1E6EA 1OBHA 3QQPA 5JPIA 1IXSB 4ZT2A 4C0BA 4FIBA 5TDHA 4EI7A 4E5KA 5BRJA 3KOUA 3HP7A 3VMFA 4X24A 2FX3A 5BURA 2EZ9A 3SM9A 1K86A 4FFVA 3P0EA 4PF1A 2CXTA 3T0IA 1T91A 4G67A 2R62A 2XMQA 4MW2A 4RDXA 3GP5A 4OQYA 1NMZA 3C2QA 3O4JA 2JIZD 2YZNA 4CIWA 1HTBA 3FPEA 3SQXA 1CQZA 3EZNA 1M0SA 4EVSA 5FBVB 1DBRA 5C8YA 1E66A 4A1OA 3E3MA 3N7AA 3RHFA 2NU9B 3O5AA 2WTEA 3RKUA 5JH7A 3GF4A 1BGVA 5AH0A 1LNSA 1GARA 3NANA 3LCVB 3NKLA 4LYEA 3RABA 3SI7A 2B92A 2R6DA 1WSWA 3VJLA 5HEKA 2I87A 1N8TA 5KTOA 4GOMD 2X0DA 4JAVC 1O89A 1ML3A 1ZJ5A 5IJWA 3UHOA 4Z9BA 4D6YA 1Q84A 5IDYA 3HL4A 3HY4A 3LLMA 4X1KB 4NAVA 1FXSA 2Q45A 4UQOA 1XZMA 3OZAA 2ZUTA 2PLFA 3IP9A 1IXRC 3TDKA 4CLDA 4V0RA 3FX2A 4BZWA 3ACCA 4U1RA 2A9VA 2JFUA 2GVNA 4LQDA 4EJMA 2VXBA 3PXCX 4W4TA 4XASA 1SCUA 3CJTA 1N32B 2CL0X 4MV5A 3T1QA 1H2YA 3ECSA 5IKEA 4F3CA 2BJVA 3MG9A 3EFOA 3DGFC 4JQSA 4GKJB 4V1CI 3EA5A 3KQLA 2N46A 4ZMRA 4B2LA 1AKYA 4OYLA 4C0LA 2JAQA 1I94B 4D3FA 3TWOA 4OXRA 2YJTD 4YBZA 2QBYA 2DAPA 1UKCA 5A0VA 1HFWA 5F1PA 4DBLC 1W85A 1YIAA 3IVRA 2W58A 1KYTA 5K3FA 3P0RA 3CISA 4CG1A 1EFHA 4LF5B 5IAKA 3IVAA 2PFKA 2IKQA 3LT1A 3PUWA 5C1IA 5ALIA 4YAKA 3DMHA 3F96A 4Q9JA 1PFWA 1A7AA 2A58A 2EW8A 3RBXA 1NG9A 3EVEA 3C5WP 1E3LA 1KHHA 1R4MA 3HFSA 4FOOA 5BYJA 3VR2D 3MILA 4UQPA 4GVLA 2ZVJA 1KDRA 1DO0A 4AUMA 1L5MA 1NOJA 4B5LA 1E1QD 4JOSA 3PENA 4A0RA 3STHA 4QUKA 4Z0HO 1KGSA 4G1VA 3INYA 2O1WA 1S7GA 3CNOA 1NVVQ 1ZOSA 2C3UA 4EZEA 1CZ4A 2OKCA 4C04A 4BU1A 3PFBA 4UNRA 2J48A 1DT3A 3NJ8A 4UFNA 2GKSA 1H6AA 3WICA 5DBOA 2WWVD 5FOWA 1P1FA 2CJWB 2HLDD 3GQBB 4RY0A 2AG6A 1QYDA 1JTFA 4RMGA 2B7BA 1MO3A 2NXNA 5ETJA 2IFTA 1ZK1A 4D4KA 2AB0A 5TT0A 3ZTTA 4HH4A 2DZDA 3IT1A 4KN5A 2LD4A 2VNAA 2XWBF 4J9VA 4KJXA 4A2WA 5CG1A 2PX3A 4OG2A 4KVAA 5BQ5A 1D09A 2GZRA 3PVCA 4YLYA 1X86B 4GP7A 2JH8A 1ADBA 1VGVA 3GJ6A 2NV6A 2A1UB 1WP4A 1XF1A 2I7XA 2GYVA 4IZIA 3O82A 5MGNA 1W36C 2HK8A 1W0JD 3FPLA 1IDN1 2DKFA 3OUZA 4J4HA 2YN0A 2FKNA 3BSYA 2HHLA 3T3DA 3V4FA 1EKXA 1YCGA 4Y6PA 1ORTA 1RZRD 4MV9A 2OO5C 1EB9A 5DHTA 1WBBA 1T0PA 2BFDA 3UK2A 1E69A 2C54A 2H11A 3GMTA 2IX9A 3KQYA 3ZZMA 3KR2A 2C2HA 2KX7A 3AEUA 3G9TA 1BQEA 2VA9A 2Z9CA 4O4LF 4EPRA 2A14A 2Q50A 1U0OC 4DR5B 4M6WA 4B3RB 3MB5A 5IC5A 3MJCA 3FUWA 3RIGA 2P6RA 1Y9JA 4JNKA 4KLAA 3RVJA 2BR4A 3GFVA 4LYAA 1ZG3A 2ECOA 4NZPA 3VC3A 3FWHA 2BEVA 3PRKE 4CTKA 5EIBD 2DXIA 1V45E 4JP2A 2BFCB 5EJ5A 2MM0A 3O3CA 5FAXA 4EY6A 3Q3GE 1K6MA 4M49A 4CCYA 4DPKA 4YJ3B 5HG0A 4PRYA 3UOGA 3KPJA 1TX4B 4GPEA 4A2PA 4C0XA 4F5EA 4TZ0A 3UB4A 4DSTA 4X60A 1XFAA 4UDNA 1M5TA 3P2JA 1E7RA 2HEIA 5G0WA 3RD5A 1H1DA 1WA5A 1A97A 3HBMA 5G53C 2DU8A 1Q1EA 4M76B 5I7EA 4NRDA 5G0UA 1P7VA 2PCLA 2ZXUA 1JEOA 3K6KA 3QVLA 5AXAA 4YAGA 1IATA 2IPMA 3PC8A 1TTQB 2O4CA 1QK4A 3TN7A 1JFFA 3K1AB 1LQUA 3K4QA 3M89A 3A7EA 2IOFA 2ZG6A 2JARA 1M2EA 1YQGA 1EWKA 4DV3B 2Y1XA 4TWRA 1L3CA 3ZY5A 4BLUA 4IDCA 4XGQA 2V7UA 3ROZA 4I4CA 3H65A 1IBCA 2YH2A 3MJVA 2VJBA 3GHYA 3JASA 4QXOA 3X1YA 3GG2A 1JE0A 4A4DA 4BAGA 2WIAA 1GG8A 2VQFB 4MWTA 3OF3A 5D1HA 1KNQA 4MV7A 4LZWA 1NMEA 2C7GA 5BT9A 1QZXA 1B74A 2C5FA 2IUYA 4FFDA 4GUAA 3JAWB 1XCMA 2E5LB 3QOYA 3MIIA 2AOUA 3AUJB 3RROA 3B1KA 2DPGA 1Z6XA 1RPJA 2ZIXA 3PIDA 1PTJC 4E22A 4OLHA 5C52B 1Z5UA 2OD9A 2GWRA 4NAHA 1JEQA 3AKZA 3JYHA 5JRJA 4CM7A 2H7YA 3DTVB 4UHCA 5I4IA 3T0GA 1HLFA 4YFVA 1Y82A 2HJHA 2YYSA 1DV2A 1T1RA 3IAFA 2YRXA 1WVMA 4JX8A 3EXG2 3WNDA 4LKRA 1VMAA 3K3PA 1PTJA 4F11A 2O3UA 5SY6A 4OX9Y 2XB2A 3ZCRA 1O6BA 5C0OE 2GPSA 3VYUB 4W9NC 2I7TA 3VZCA 4I50A 4B9EA 4ZK6A 4OHCA 4TV8B 5JTTA 3PVZA 4BASA 1GO2A 1KK2A 3E58A 2XUOA 4ALIA 5ALNA 2O2JA 4ZOCA 2CF5A 4LCBA 5JE8A 3S81A 3A9SA 3KSDO 2PUEA 3ZU5A 3RC7A 1Z5WA 4BOYA 3TL3A 1FX0A 4W9NA 1ESNA 1GN9A 5BWMA 4JP3A 4JL6A 1F4VA 2LGJA 1YRWA 4KFTA 1VYVA 4DN6A 4Y1GA 5I7VA 1KFEB 3EY9A 1BOOA 4CMAA 4MVJI 4PG4A 4XDYA 4EJSC 1SQ5A 2F4NA 2X76A 2XAUA 2O06A 3O4IA 4JCOA 4E2ZA 1ADJA 1SU7A 2XQKA 3FWPA 4CV1A 3KJQA 2P2GA 2CWDA 4FNOA 2QX4A 4UE2A 2J9FA 1ORHA 1RI2A 3IJ5A 4GP9A 3QU7A 1PU2A 2Z5FA 4N0QA 2Q5CA 5HPYB 2QQGA 2WB4A 5CT9A 4CR8A 3WQRA 1AKRA 5DRTA 1X8JA 3SF8A 3TSCA 2ZYVX 3EE6A 5SYNA 4EB3A 4KO4S 4RDHA 5IAGA 2NNWB 4DJ5X 3WLJA 5A2GA 4HNVA 3GI1A 3OM9A 3OJFA 4FYXA 3QSYA 1X42A 2MMCA 3ELYA 2P0YA 1P0FA 2XR1A 1ECFA 3FDIA 4ZAZA 3JQCA 1D8TA 1Q0PA 3IS3A 1NL3A 4OQLA 1U3VA 5FEMA 5KX5F 3NO4A 4F84A 1TNDA 3KB1A 4YLGA 3L6RA 3FZYA 4KIJA 3VH3A 2H0QA 1Z0KA 4KR6A 5AOBA 4YQZA 4XH9B 4AC9A 2VN8A 3KTDA 4KC0A 1M8FA 3QV1A 4TT3A 3U5TA 4RSRA 3GZNB 5FPSA 1XVIA 4YH1A 1W1UA 4RC9A 1YE3A 4UZEA 3DE3X 2IHJA 5CA0F 3I2HA 4YP6A 5LZ7A 4BBJA 2J0UA 2VF4X 1SMKA 3S2IA 3A9VA 3TRFA 2ZR0A 4HTAA 3WOVA 2VOJA 4KWHA 5DYIA 3JQBC 3HB9A 2GGSA 3M70A 2EQBA 4OAOA 2AV6A 4MB6A 1MJGM 4AKTA 5ITWA 2BGWA 5HNKA 2O8FB 4JBLA 4IEFB 3CF4A 3A2LA 3NXSA 1NY5A 5EP1A 5KKAA 4C4SA 2Z5VA 3GJ8A 2GLXA 1U2GC 2H2IA 3ZHTA 1R6BX 1UZNA 1N0IA 1Y4AE 2JGDA 4DJDC 1WM1A 3ABSB 3FKQA 3U62A 3DAYA 3QFCA 4UHDA 2OMEA 1BVRA 1UZLA 1NBME 1YBVA 2X41A 1PQYA 1Q0RA 3Q41A 3HWSA 3OETA 1R66A 1Q22A 2RIRA 3HCAA 3P9ZA 4L3VA 4NC9A 2FX5A 4HXFB 4PVCA