3LHDA

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-homocysteine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
253
structure length
253
Chain Sequence
MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase, putative
total genus 66
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3lhdA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lhdA02
3C3PA 4EKGA 3CJTA 3MTIA 2ZZNA 4DMGA 3A7EA 5G02A 3LKZA 4HG2A 1VE3A 4GOND 5CVDA 4HSGA 5T67A 1KP9A 2YVLA 3UJCA 1M6YA 5HIMA 2BZGA 2EJUA 2PWYA 4V0QA 5BXYA 1X1AA 3KKZA 3KQYA 4KW7A 4IV0A 1JQEA 3KQQA 4YUWA 2IH4A 3OFKA 2VS1A 3TMAA 2JH9A 3UJ9A 3FRHA 3R3HA 4G56A 1BC5A 1G38A 4QTTB 4E32A 4QDJA 2HV9A 3NDJA 3E23A 3IYLW 1QYRA 1KHHA 3MQ2A 5E8RA 2ONYA 2AOUA 3EVDA 4OBWA 3LKDA 2PX8A 3AJDA 3NJRA 3ORHA 3B5IA 9MHTA 5CVUA 2C7RA 4FR0A 4WVLA 4F85A 4MWZA 5GIOE 2HR1A 3FYCA 4FGZA 4O29A 3M6XA 1P39A 3KR1A 3OE4A 4X60A 1KXZA 4GOOD 2XVAA 1MHTA 5KQRA 3P9NA 1XDZA 5EKUA 1FPQA 3HA3A 3KQPA 3BKXA 5ICEA 3DP7A 3PT9A 4PIPA 2PVCA 5C1IA 3P97A 2PT6A 1M0EA 1RI1A 3CBGA 1AQIA 4Y30A 2CMGA 2ESRA 2WA1A 3DMHA 4C03A 4XUCA 2PXXA 3MERA 4HGYA 5EHIA 3HVIA 3P9KA 5C0OE 3BWCA 1KPGA 3C6KA 2QRVB 3H2BA 1X1BA 2ZLBA 5GIPE 4YV0A 1R6AA 3KQVA 5B1SA 4ER3A 5BP7A 2QE6A 5LQNA 3R9XB 3T7RA 2JHCA 2ZIEA 4RSRA 5K01A 4YUZA 3M6WA 1WG8A 4HRAA 1EAMA 1QAQA 2VDVE 3A26A 4GC5A 3VC1A 2OZVA 3P9IA 3SSMA 4ER0A 2P3OA 4KWCA 1D2GA 1KPHA 5E8JA 4IV8A 3DTNA 1HMYA 2BR3A 3BGVA 4PYOA 5DM1A 4ER7A 1JR4A 3HA7A 4EQZA 2OXTA 2ZW9A 3SX0A 3UJ7A 5E9JA 1YF3A 2CL5A 1XTPA 2ZBPA 5HIKA 4BY9E 4FS8A 4WXHA 5JUWA 5K0LA 3KPVA 2FK7A 1N2XA 2FYTA 3VSEA 2UYHA 3MHTA 5FWAA 3RODA 2ONZA 1IY9A 2KW5A 3GRZA 1SQGA 1XDUA 2CKDA 1UFKA 5DSTA 1QAMA 4PYMA 5DLYA 4LG1A 5F2KA 3JWGA 2R6ZA 2XYRA 3R0QA 3SR4A 2YXDA 4PYQA 3KPYA 2I7CA 5EZSA 5T64A 2GA9A 3HNRA 2OPBA 3OZTA 3LGAA 5K05A 1YFJA 2G1PA 2AOXA 3P2EA 2FK8A 3ANXA 1SVUA 5EMJA 4AZTA 2P8JA 5F2NA 2AN5A 3GNLA 3TPZA 5K0JA 4RTKA 5E1DA 4PCAA 2GLUA 4PGHA 4QQKA 2PX4A 2OKCA 2P35A 2NNWB 5EEHA 5EQJB 4BP1A 3HCEA 1RI4A 2ZIFA 2JH8A 3LCUA 2AOVA 2QYOA 1Y8CA 3BKWA 3O4FA 2H11A 4RX1A 3VC2A 4YUYA 4ER5A 1AV6A 1NW8A 3UJ6A 4DKJA 4DQ0A 3M6UA 1F3LA 1EIZA 2IIPA 3OE5A 3EPPA 3P2IA 3KU1A 5K0FA 4RTPA 3DXYA 2N47A 5E1OA 3C6MA 3EVEA 3BGDA 4C05A 1EJ6A 4X1OA 4E31A 3TQSA 5CD1A 1YZHA 3VYWA 3ER9A 3GJYA 4RVGA 5EHGA 2FRXA 1JQ3A 3NDIA 4C08A 4Y2HA 2H1RA 4PYLA 5DX1A 4CTJA 5HOQA 5EC8A 1P91A 3GWZA 2ZBQA 4MIKA 4A6EA 1SUIA 4E33A 5CUQA 2ZZKA 1BKYA 1KR5A 3PFHA 1T43A 3M6VA 5DTRA 1NW6A 1P1CA 2O07A 4XUEA 4CTKA 3SM3A 4BLWA 1X19A 4DCMA 1DUSA 4OBXA 3LX6A 4H0NA 3MAGA 1O9GA 3QV2A 5DTQA 4BLVA 4EMSA 5CCBA 1NKVA 5FQOA 2I6GA 2XVMA 2B9EA 3AY0A 3HA5A 4M7RA 3EGIA 1SG9A 5CVVA 3KR9A 3DXZA 5BW4A 4PGGA 4GOLD 2VDUE 5DM2A 5LR6A 3K6RA 4EK9A 3I5UA 4CXMA 2R3SA 4E2WA 3LSTA 2C7PA 3M33A 5KYGA 1QAOA 1R8YA 1RI2A 2AOUB 3FPGA 4GBED 1R74A 3PS9A 1B42A 5GM1A 1FJXA 2XYVA 3WSTA 3PB3A 2PJDA 5K0NA 3OPNA 5U4XA 5E1MA 1AF7A 5IH3A 4RTQA 1VBFA 4E70A 1G8AA 1NBIA 3IV6A 2VP3A 1D2CA 1X1DA 3A7DA 2P41A 5DM4A 1ZKDA 5DXJA 5DT2A 5F2OA 2O57A 5FQNA 2Z6QA 4ATNA 2PT9A 3HVHA 4RV9A 4YMGA 4CKEA 1VP9A 3B7PA 4OQDA 4E30A 2UYCA 5EPEA 3G2MA 1SKMA 2QRVA 1MJFA 2ZSUA 3LCVB 3S68A 2ERCA 4YV2A 4E2XA 7MHTA 4YMHA 1SQFA 4RTMA 3D2LA 1VQ1A 2OBFA 3FUWA 5ICCA 3NW9A 1TW2A 2HTEA 1ZGJA 4FSXA 4RTRA 3BGIA 5LQJA 2AN4A 3KPWA 1F38A 2ADMA 4V0RA 5FA8A 3PLAE 1QZZA 2EJTA 1PRYA 3SVZA 4PCLA 5T6BA 2V7EA 1BOOA 3FYDA 4RYLA 4ER6A 3CJQA 2IBSA 1Q0SA 3BWYA 4CWAA 3BXOA 3NVMB 4U7TB 5EIWA 1M6EX 4FSDA 4OX9Y 1YB2A 2G70A 4GF5A 4R8SA 4FT2A 3FTFA 4LWPA 2PGXA 3AWIA 1XCLA 1G8SA 5HZMA 5K0EA 1YUBA 1DCTA 3ELUA 2ZVJA 3DLCA 5DX8A 3PFGA 1JG4A 4A6DA 3EVZA 5DTMA 2YXLA 3KQOA 1XXLA 3ELWA 1JQDA 2OYRA 4EKIA 3ID6C 2AN3A 3SGLA 2BH2A 3BUSA 5MHTA 2AOTB 2HMYB 5E1BA 2BM9A 1RJGA 2HNKA 3GDHA 5CM2Z 3I64A 4FT4A 4MHTA 3LBFA 4NECA 2O0LA 3FPJA 5CVEA 5CIYA 1I9GA 3CC8A 3CCFA 3KQMA 3UJ8A 1SUSA 2BR5A 1RJEA 2CMHA 4AUKA 1RI3A 3TKYA 4P7GA 2ZIGA 1L9KA 3KR2A 3OU2A 2Q41A 2XYQA 4QPPA 5EZQA 4KIFA 5GWXA 3SMQA 2YXEA 3TM4A 3FUVA 1PJZA 4C07A 3I9FA 1IM8A 2VZ9A 4JXJA 2PXCA 3G7UA 3UJBA 1ORIA 3AXTA 1UIRA 3DUWA 2H00A 2NXJA 5HFJA 1TPYA 1XCJA 4RTNA 2BR4A 2K4MA 1P1BA 3QOWA 1L3CA 1IXKA 1UWVA 2YR0A 3EVBA 2AR0A 4HTFA 4IKPA 4XCXA 5KQSA 2LD4A 3M70A 2ZCJA 2PY6A 2NP6A 3B3FA 3G89A 4KRGA 4QVGA 2GS9A 3P2KA 3KR0A 4C4AA 4C06A 5K0GA 3IEIA 4L7VA 5M5BA 4R8RA 5E2AA 3GRVA 5EIFA 3THRA 4DZRA 1QANA 3TM5A 1VPTA 2NXEA 3EGEA 5H02A 5HEKA 3X0DA 4QDKA 1KYZA 3EMDA 3HCBA 5ERGB 5FADA 4PYJA 2O05A 4HTFB 3LECA 5K8VA 2IP2A 1EQAA 3O7WA 2Y1XA 1I1NA 2QM3A 5DX0A 4C04A 2P7IA 2Z6AA 3UJAA 2UYQA 1N7IA 1RI5A 4RTSA 3U81A 3UBTA 3FPHA 4PINA 2EX4A 2XBMA 3UWPA 3GGDA 4YUVA 4KDRA 3HCCA 2NP7A 4YUXA 1L3BA 4BLUA 3V8VA 2WK1A 4AZSA 5ICGA 3NMUF 2P7HA 4RVHA 4RTLA 5LQUA 5DPMA 3C0KA 3FTEA 4RWZA 3FUXA 1G6Q1 3G2QA 3BWMA 4RVDA 4P7JA 3HM2A 4HH4A 5HIJA 3TKAA 2OB2A 5KVAA 2JHPA 2PX5A 2AOTA 3FZGA 3T7TA 3UZUA 1XVAA 3CVOA 1JTFA 2IGTA 4QTUB 2ORED 3A27A 3E8SA 3T0IA 1U2ZA 3FPFA 4RTOA 3R6TA 4R6XA 3BZBA 1JSXA 3FTCA 1O9HA 4GEKA 3JWIA 3TR6A 3EGVA 2IH5A 2IDKA 4B17A 1JG3A 4GC9A 3FPEA 3B3GA 4DF3A 5P8WA 4PNEA 1NW7A 1WZNA 1FBNA 3O31A 3OFJA 3EVCA 5BW5A 2ZULA 4Z2YA 2GB4A 1KPIA 2C7QA 5JR3A 2Z6UA 2YTZA 5FA5A 5ICFA 1NBHA 3LPMA 3LCCA 3NWBA 2AS0A 3GU3A 1JTEA 3CGGA 2EG5A 1R00A 4KVZA 4CKCA 4U7PB 2NXNA 1JG1A 1NW5A 3I53A 4AZVA 4CKBA 3EEYA 3G5TA 3LDFA 1XDSA 3ER8A 2P3LA 3BWBA 2IDJA 3EVGA 4X61A 2JJQA 5GOZA 5LQAA 2PSSA 5LQCA 1KYWA 3GCZA 3OZSA 4KIGA 3EVAA 5DXAA 3I58A 1YZ3A 1ZQ9A 3HVKA 5D1HA 3FUUA 1VLMA 3HCFA 4ISCA 3SSNA 4EVIA 2AVDA 3MB5A 3Q87B 3OCJA 3FRIA 4PONA 4AZWA 3MTEA 3P71T 4GUAA 5DSXA 5E9QA 3JWHA 4RTJA 4M36A 1WXWA 2YQZA 2VDWA 3UFBA 3KPUA 2B2CA 3PVCA 4R6WA 5DRYA 2DPMA 2UYOA 3CJRA 5EG5A 3TRKA 1I4WA 4GQBA 3EVFA 1NW3A 2ZWVA 3KQTA 4PYNA 4XUDA 5KS2A 2IH2A 2PXAA 4ZTBA 4DM3A 2OO3A 1G55A 3G8AA 3T7SA 3UA4A 4P7FA 4PIMA 1VP3A 2PX2A 3E7PA 3HP7A 4GOMD 2B3TA 1INLA 3UJDA 5CCXA 2GH1A 1R18A 5EKXA 3P8ZA 2OB1A 2IPXA 4X41A 5DWQA 1NV9A 2BM8A 2ZBRA 3AXSA 1N7JA 1JG2A 2FCAA 2B25A 1ZHFA 2AVNA 3P9CA 1RJFA 1FP1D 2EFJA 1NV8A 2V74B 2AOWA 2WA2A 2ZTHA 3JWJA 4P58A 4PYIA 2B78A 4QQNA 3HCAA 3REOA 5K03A 1L1EA 2P40A 4KDCA 1G60A 3NVKI 1R8XA 4HGZA 3UA3A 5EMKA 3LHDA 3A25A 3V97A 3MCTA 5EVJA 2GPYA 5C9ZA 4DA4A 3QOXA 3R24A 4OA5A 5EMLA 2YX1A 1EJ0A 2IFTA 3RW9A 1BHJA 2QY6A 1O54A 3C3YA 1Q0TA 3DOUA 2GAFA 3M4XA 3EEOA 3GRYA 3DLIA 3KHKA 3G8BA 3HCDA 5LQRA 3FTDA 5LQKA 1NE2A 4LECA 3DXXA 5EGSA 5E2BA 5FULA 2NXCA 4HC4A 2O06A 2CWWA 5FHQA 3HTXA 5EEGA 4DCGA 1D2HA 3DMGA 3HVJA 3MCZA 5IKMA 3NTVA 1EG2A 4QVKA 1Z3CA 4M37A 4X63A 4BP3A 1RJDA 1TW3A 3TFWA 2NYUA 4R05A 3TLJA 3CKKA 1JSZA 2E5WA 4FZVA 10MHA 3EMBA 3G2OA 5E9WA 5FUBA 1L3IA 3B3JA 4MQ4A 4UOEA 3ELYA 1XJ5A 1ZG3A 5DM0A 3KQSA 5K0BA 2I62A 5GINE 2ZFUA 4E2YA 1AQJA 3OU7A 2ZZMA 1WXXA 3IHTA 2ZWAA 2PKWA 3GO4A 4E2ZA 2A14A 1KIAA 5FWDA 1X1CA 2PV0A 3ERCA 3GIWA 3PTAA 5FCDA 3KPJA 5DRTA 5GM2A 3RIEA 2PLWA 4PWYA 3G2PA 3G88A 1V39A 3KQWA 3G5LA 1VIDA 4MTLA 4QPNA 3PX2A 3OU6A 5HILA 1ORHA 3LDGA 5CVJA 4POOA 3HEMA 3DMFA 3LBYA 8MHTA 3GRRA 3SXJA 5LSAA 2C7OA 4RVFA 3Q7EA 4FP9A 2DULA 4K6MA 3E05A 2UZ4A 1ZGAA 4OA8A 2I9KA 2FHPA 2PWPA 3DH0A 2IBTA 3THSA 3A4TA 4AX8A 5EOVA 3LL7A 5D1NA 3B89A 3DULA 1OR8A 1YFLA 2PBFA 3DR5A 3L8DA 3PX3A 5HIIA 5GP1A 2YUIA 4YV1A 2HWKA 5EMMA 3SSOA 2JG3A 1H1DA 2G8NA 3K0BA 3MGGA 3FUTA 1FP2A 5FHRA 2G72A 1NT2A 5K09A 2OY0A 2Y1WA 3GXOA 3TOSA 1VL5A 4IWNA 3ME5A 1DL5A 2AZTA 4LWOA 1WY7A 4F86A 3NWEA 3BT7A 2F8LA 3F4KA 4M38A 2JHAA 3GRUA 2P3QA 2FPOA 4P7KA 3LDUA 3ELDA 2P1DA 3OZRA 4OQEA 5K0CA 4F84A 4PYKA 1WS6A 1HNNA 2G71A 5FTWA
chains in the Genus database with same CATH superfamily
2RI1A 3HN7A 1T3SA 1HM5A 2GD0A 3WMEA 4F4JA 2ZTMA 4PAGA 2FR0A 1CULC 2HFKA 2NV2B 4FKZA 1QV6A 2JFYA 1CR5A 1SEVA 2OZKA 2C1XA 5T67A 3MGCA 1MV8A 3GAAA 3UJCA 1JLLA 4IOMA 1Z4MA 4G1FA 5D3QA 5FTNA 1P3Y1 1FSZA 1QHGA 3HKCB 3KKZA 4KW7A 4TYPA 1JQEA 1J1ZA 1PT8A 4YUWA 3OFKA 4LOAA 2LKDA 3FUCA 3KOUA 3K8QA 5DMHA 3R3HA 3EUWA 1AXRA 2OO5C 1QCDA 2H5LA 2VRNA 3MC1A 4XB6B 3H7IA 4PTZA 5D5QA 4X6YA 1JHOA 1ZGGA 2E7ZA 2PD6A 3MGBA 5JRZA 3LFUA 2ZB4A 1ID8A 3RUEA 5DO9A 3V1UA 4GWLA 3ORHA 5AHKA 4INPA 3FGOA 1ZNYA 2Z2KA 1F17A 3V8MA 4BWFB 1QYIA 5CJ2A 3ZXYA 1UAGA 3SC2A 1D6NA 4PR0A 1WF6A 4BGUA 4QJIA 5C1BA 1T0UA 3IP1A 4IVRA 1W4RA 3I01M 4XIJA 1VKZA 5A05A 3UK1A 1MJ5A 1SUBA 4D45A 1TL7C 4WPGA 4P4SA 4P3KA 4Y30A 1E5XA 2RSLA 5AK5A 1G19A 3TB4A 4ZCRA 1R50A 1UPTA 1CUYA 2WINI 3BMOA 3WISA 1D6JA 2HQOA 2ZREA 4TSFD 1Y37A 4PG5A 3E7XA 2VDWB 2C97A 4TZ0A 1R0YA 1B41A 1IFXA 1KOFA 2H1OA 1R6AA 3CLKA 4NICA 2QE6A 3T7RA 5EJ9A 4JK3A 4YUZA 4XLZA 1Y3DE 3ESAA 1JKJA 1BCSA 1Z88A 3SSMA 2WSLA 2X1VA 4DLVA 4NV3A 4RV5A 6GPBA 2EJVA 2RJOA 1S7GA 2ID9A 2MMCA 5SZJA 2J3LA 3AHIA 1E9BA 3KB6A 1OA1A 3C3MA 4G0QA 1KI1A 1UJCA 4U63A 1YVEI 4XFJA 3RC2A 1R6DA 2DT5A 4JI4B 1T26A 3DDZX 4CMBA 2FK7A 3GFGA 2CFTA 3IVCA 5KZMB 1IOWA 1JDBC 4B6GA 5BMVF 3F6PA 3IUEA 5DXFA 3S5JA 3JQFA 1EESA 3BM5A 1YGYA 1YRWA 2C54A 3DBLB 4UFPA 5BSRA 1H8HA 4OHZA 3JAKB 3W5JA 1EJBA 3A4IA 4G8JA 2F90A 1QGUA 2C9ZA 3Q0IA 2VG8A 3BMXA 2Q27A 1WBBA 3F73A 1GKYA 3GNLA 4NCJA 3C14C 5KJ1A 5BNFA 1PT5A 1IBLB 2YMMA 3C4VA 3TKLA 1WCXA 2R1VB 1XMVA 4TYMA 4MIYA 1NKSA 3V33A 1NVFA 3TI9A 1N6HA 2FE1A 2OR3A 4DCCA 3ICOA 4AG5A 2MDTA 1ZK4A 2D4AA 1QGOA 3VR4A 3OJEA 1Q1NA 4DLBA 1XK7A 3M6UA 3STYA 2E21A 1YRLA 4FQ5A 1HTWA 1DKQA 1NMXA 4HAIA 5JSZB 2GEVA 3VOAA 2EZ9A 4BTVA 1ZRSA 3IERA 3L93A 3ZZ0A 4YV7A 1KO5A 1Q2UA 3CNEA 4K26A 2ZYRA 4N6NA 3U3DA 2XKAA 1GUDA 4OHYA 2JFGA 3ER9A 4AKIA 1V71A 3UPUA 5DCWA 3PYMA 4DEYA 1LLCA 1L5VA 1FQJA 4I50F 2PSEA 4IQGA 1M7GA 1ID1A 1RYBA 1TA9A 4ZOBA 4N01A 1PNQA 4MV9A 5DX1A 4HNHA 2ZRAA 3CF4A 3A1TA 3EWIA 3N0VA 1CTQA 1E2IA 2AJLI 3OPXA 3WMGA 1T1EA 4D41A 5EJ6A 4O4IA 1KEVA 1K06A 1X9GA 3TQRA 5FUXA 1JLSA 5HZGA 3PFHA 1T43A 2QL7A 5AQEA 4C30A 5TQ2B 1U81A 1RYZA 2XWPA 3HADA 4R2HA 3S2GA 3SM3A 1PJTA 3V4RA 4EJ2A 5IUJC 2PYIA 4BNTA 2QVBA 5DTQA 3IUNA 5CCBA 4NH0A 1TQ2A 3KDAA 4EJ0A 1M76A 3E22B 3HR8A 1A96A 1HT0A 5I7HA 3OLYA 3VH2A 4DM4A 5HPYB 2ALJA 2HT1A 2WNSA 1E3MA 5LBUA 2DFLA 1RPJA 2C58A 1CJSA 3L7DA 3RC1A 5EJ7A 2PUAA 3WJ2A 1QUFA 5EKDA 2P4QA 1IY1A 1CDZA 1RQGA 4LXYA 1CJUC 4P33A 5LXTA 4QVIA 3QFRA 3ND5A 2C7PA 1IDOA 2G63A 2B5OA 4RO0A 4L51A 2WM8A 3U3ZA 1RLIA 3Q2OA 5L9AA 5B3JA 4WK6A 1C0PA 1SG6A 5K0NA 1GZ7A 3PDJA 3H1EA 4HI0E 5U4XA 3WI7A 3UMSA 3BD7A 4D6PA 4LSMA 3LWBA 2V59A 2RIRA 2VP3A 2YRFA 4N76A 1I8TA 2QN3A 1Q2XA 4CFYA 1MX1A 4M0CA 3CZ9A 4MYCA 5ES4B 3W8DA 4LVUA 1CCWA 3AESA 1C2TA 4JZKA 4CNBA 1OXMA 4FGKA 1J0DA 1YRAA 4A10A 2TECE 4MS1B 4KXYA 2YXPX 2H1HA 4Q4JA 1W5TA 3JQFC 1N8NA 3W4KA 3K09A 3FDZB 1FUUA 1IBMB 4B9AA 2W00A 1FSGA 1IATA 3KFLA 4ERNA 4R2LA 1IG3A 2J09A 3EASA 2HREA 4OQZA 5HCNA 5A6SA 1U9YA 1W5SA 4ZJUA 2LPMA 3W3AD 2J9ZB 3HV2A 1SH7A 3W2HA 4EW6A 3C24A 3WP1B 4GSYA 2X19A 4REOA 2MSWA 5P21A 5JDCA 2OILA 1LWOA 5DF1A 1E2MA 2JCGA 3SE0A 2JFQA 4D6YA 3HU3A 3HHPA 1HG1A 1J0BA 3AWIA 5BN4B 1Z4QA 3UOAB 1LDEA 3G68A 1DC6A 1ZI6A 2HQBA 3L1VA 2WJHA 2PUHA 3EFBA 3P9YA 2NO9A 2VOEA 4CKWB 1OHHA 1L6IA 5BYAA 2VTKA 2Z5FA 1JDPA 3ID6C 5DBFA 3OLZA 2MSDB 1EP3B 2EIXA 4LC1A 1LGYA 4P0TA 4AKTA 4EX6A 5KCMA 5MHTA 3NIWA 2BMFA 2CL7X 3GDHA 3SYTA 5FPSA 5CM2Z 1XQXA 2ODPA 2OV3A 3I64A 3M4JA 3WTBA 7REQB 2JIPA 1NFQA 4FFDA 1BE0A 1U0OC 3G5AA 2C00A 3HRIA 3UJ8A 4F9EA 1RBYA 2V7QD 4U7GA 3MA0A 2RMKA 2XWQA 4G8CA 5L3QA 1OZFA 1S3GA 4DZTA 2ZE6A 3WGMA 2BYTA 1E92A 1YL7A 4HAZA 4BNLA 3FOZA 1RYEA 2CDRA 1N5MA 2IYSA 4MR8A 4KBYA 3HB0A 3QX7A 2HY7A 2CMDA 2IXBA 1N34B 3AO0B 2V4MA 2AFHE 3ICEA 4RAOA 2X8LA 1AX9A 3DFMA 1A9XB 4FDMA 5G0UA 4FX5A 4TRNA 2OOKA 3ZDBA 2FUEA 3FWKA 2X5KO 1OGJA 3QEOA 3WY9A 2H2IA 2B5WA 2HAEA 1VDMA 3GLHB 3K16A 2BBWA 3D4PA 4MMYB 3TOXA 1W7AA 1RQPA 1WABA 4DLRA 2VA8A 2OBYA 5EWLA 5IU6A 3L18A 2CB0A 3UGKA 4C06A 1AZLA 4B35A 1BVUA 4Q9JA 4ZI7B 3AG5A 2BLLA 3E22A 3WGZA 1WVMA 2VDNB 4IEIA 1U7HA 2G1JA 3DWIA 3GPDG 4YBRA 3MM4A 4WZBA 1ZHHA 4ZAXA 3DQZA 4RL6A 1NG1A 5L53A 2JGNA 4Y1GA 1J09A 3FCAA 3GDFA 4MVJP 1KYZA 3OQ1A 4MZXA 4XSHA 4Z7NB 5FAKA 4N39A 5IJ0A 1ZIXA 4BFUA 2PHZA 3GELA 4QGBA 1PFGA 5AI9A 5KNDH 3Q98A 2OCXA 4Q16A 2Y1XA 1ONOA 5DX0A 3KRTA 3NORA 5H1YA 4BUJA 1B3RA 2VXCA 4IQ0A 2UYQA 4OH7A 4WY2A 5CCEA 4W5RA 1YCDA 1NMEA 3SHFA 1K3FA 4E88A 1TLFA 1B74A 1FQKA 1MH9A 3N75A 3KXIA 4Y2JA 4AS2A 4EUHA 4GX2A 3HJHA 1ADCA 3A9SA 1I01A 3NHWA 1OZ0A 4TROA 5CDHA 2KJQA 3HRHA 4XPZA 3SS7X 3WL4A 1ODSA 3ZWCA 5J4YA 1BX1A 3H13A 3IEVA 4YRZA 1ZSYA 2I76A 2PBZA 3IJPA 4B2IA 3Q7PA 4BQEA 1N6PA 4E1AA 4DWOA 3R40A 1TA0A 4Z4QA 3AM4A 1EHIA 3HM2A 2XCQA 3U7QB 1PG5A 2JHPA 5L40A 4UQLA 1TZKA 4IIGA 4KIUA 2GILA 2D2IA 1JKMA 4IV5A 1XD9A 2EKPA 2QAIA 3DMDA 3VKWA 2AXNA 2RAFA 4US2R 4E4YA 2QORA 3DYVA 3RVSA 3MT8A 1NY6A 1AGPA 3NAGA 3FSGD 5MN4A 1RFLA 2AG0A 2OD9A 1ADBA 4LQDA 4R9UC 1FPMA 1JILA 4GC9A 5H9WA 3U19A 4UD2A 4PNEA 1M6VB 1QFSA 2FW1A 1ZIDA 3OFJA 4FJ2A 4KSBA 4UEQA 2IQ5A 2CUTA 5EJ5A 3A2KA 2WPNA 3F97A 3H2KA 1L7PA 2Z6UA 3L4BC 2Y99A 3KAJA 1YMQA 2QLLA 3P9ZA 4GPEA 4M60A 1G8MA 3NWBA 4M0EA 1HE1C 3QGMA 1OKKA 4E5MA 1N6LA 2FU5C 2EG5A 1HDXA 1IEQA 5IEJA 2GNPA 1CF2O 5DWVA 1N2CE 1NUTA 2HN9A 2VYVA 4OB6A 3T94A 4E3ZA 1G21E 5IASA 4AWAA 2VP0A 5KREA 1K5GA 1XZCA 3JVUA 2XTNA 4K81B 5H4GA 1JIQA 1VC2A 4OSOA 1H1LA 2BTQA 4RCYA 5KYYA 2CT8A 5I9SA 1B8UA 1RBMA 4ISCA 4N9QA 4D0SA 4EVIA 5C52B 3PQEA 1DRUA 4C3VA 1K8XB 3FPCA 4QWWA 3HSYA 3MTEA 4PG6A 3VNAA 4QJ4A 3WK5A 1B3BA 4C0BA 3NHKA 5IZCA 4KREA 1YAHA 3CZ5A 1U1EA 4NATA 1W1UA 2REBA 5C5EA 4DYDA 1YRYE 3ZE0B 4I66A 1QMPA 2QW8A 3KQTA 4JX8A 2C07A 2WUGA 5IT5A 4ZTBA 1KK1A 3Q72A 3CF2A 4RVSA 4KXQA 5FEUA 3SQWA 1ELOA 4M98A 1ZVQA 4PGFA 5A4KA 1WW3A 1B1CA 4KFSA 4LGYA 2GD6A 3N3AC 3UJDA 1PW5A 5C5CA 2HJSA 2ZIZA 2P9HA 1Y9JA 1RXEA 2WICA 4UEKA 4XGNA 5DW0A 2J9XB 4CKBB 2BM8A 4IOKA 3S2IA 2NAPA 3A1WA 1GNSA 1YA8A 4KVFA 4NAHA 3EVNA 3RSSA 2AVNA 1TCVA 2EFJA 2CNKA 3PYLA 2AOWA 1NMQA 4D7AA 4DR3B 3HCAA 1JNYA 2OORC 3GFSA 5D6XA 2HU2A 1CQPA 2WWWA 1KEWA 3KUKA 1EWRA 4KDFA 1AKMA 1G60A 4DQLA 1IMOA 3KXDA 3IKMB 4Z0TA 3SVTA 1EG7A 5JSQA 5CFOA 2Q4OA 5EVJA 3A32A 3U3MA 1T1IA 1G6HA 4QYIB 4MRAA 1C0LA 5AW3A 3X1DA 1FC0A 1Z8NA 2FEWB 4MUHA 1ZN7A 4KITB 4BASA 5BMOA 3ZWQA 3IAUA 4DABA 2YFYA 1Q1GA 4S0ZA 4WAUA 2O3TA 2ZKLA 4X85A 4TMVA 4AZ3B 2XCUA 2ZB8A 2QN7A 5ADHA 1W48A 3BJZA 3KKMA 4IM7A 1KMMA 1EG2A 2BKUA 2NO6A 5L6MB 4LVCA 4JUDX 1Z3CA 3PLRA 1Y42X 3ER6A 4R8VA 4Y9SA 4IIVA 1EVKA 4NJMB 2VAVA 4BP3A 4E03A 4BV3A 3Q7TA 4I9UA 1H2ZA 1J5EB 2Y1DA 4B6JA 2I34A 1HEIA 2QV7A 3G2OA 5C31A 1L3IA 5KWJA 1PVOA 1UBRS 3LCRA 3O90A 4BVHA 4XX0B 2OD2A 3I76A 2I6UA 1CRPA 1L7QA 2QVCA 3VMFA 2PSFA 1DAPA 1WSWA 2PKWA 3KE9A 4U3JB 1MV5A 5GTDA 1Z15A 3FPUA 2C5EA 4JVOA 4KWTA 2YOHA 3KSDO 1JXMA 5D3ZA 5GIOE 1DC3A 5EL0A 1V39A 3L04A 4YRPA 2G40A 4L0MA 1T2CA 1E4VA 3MLAA 3VU9A 4LKRA 4A4DA 1H69A 3EEFA 5KKCA 3DMFA 5I5EA 8MHTA 3FRJA 3VHXB 3HR4A 1FFBA 2HLDA 3KDSE 4G26A 1UPBA 5A9TA 1AKRA 1ZP6A 1WETA 1PUJA 2VHEA 1VBMA 1QZTA 1ZIOA 5ENZA 4AG6A 1R0SA 1Z9BA 4XOUA 3WYBA 2WP8J 3N2YA 5TC4A 4F9TA 1PFKA 2ZE8A 3L02A 2ZM6B 2QX4A 3L8DA 4BO7A 3PX3A 1QHYA 5JXGA 2W6JD 2OHXA 4CZ2A 3PGXA 4IZOA 4KPYA 2OFPA 3DLAA 4TTAA 2AMJA 5EHNA 1Z38A 4BKRA 4X8LA 1VKNA 3CUWA 3OZCA 4ARAA 1KMIY 2M9MA 1P0IA 2ZRKA 2DBVO 5JS2A 3OQOA 3FYUB 5C8DA 2GK6A 5A6SB 2QDXA 4Y9UA 2GVZC 3CG0A 4BB0A 3D6FA 1W36C 2P3QA 1SUDA 4EVRA 4I4TF 4HT3B 2LKCA 3N76A 4ODIA 4BRUA 5CA0F 3L5OA 3SY8A 3IVGA 2EFEB 3AKEA 4KH1A 2OBXA 5CLGA 4RPCA 2P30A 1HL7A 1SA0A 1TVEA 2D7JA 3PR3A 4UZEA 4LCBA 4ADSG 5JWRA 1APBA 1K3TA 4EDFA 2OBMA 4LOIA 2HBZA 5IK2D 4DVGA 4NMLA 5J58A 4MYUA 3WLSA 1FNBA 2XGSA 2C82A 3MFYA 4DDKA 3C85A 1FDVA 1J8FA 2DAPA 3X1WA 2DQKA 4PYJA 4X91A 5DKFA 1Z5PA 3W90A 1FDOA 4D4JA 2GXSA 3HVUA 4WXPA 3R9IA 1MB9A 3RLIA 3T3GA 5D87A 1BKDR 3QX9A 1ZD5A 4DV5B 1C7IA 2R79A 3WKCA 2HSZA 1SXGA 2PANA 1U9IC 2XE8A 3MMNA 3O2NA 3UJPA 2WFLB 3AL2A 2Y71A 3ANLA 3HL4A 4NENB 2XHEA 3NPMA 3VAZA 2O8FA 2WF9A 4WEQA 3HSSA 2ROQA 1T3ZA 1P39A 1L4UA 1IHYA 4PF1A 4YRAA 3MBIA 5AVTA 3RS3A 3NKLA 4EB8A 4BYMA 3HA3A 4LJ9A 4C7MA 1FLAA 3KQPA 3GHHA 4K0KB 3JZMA 4A7PA 3QUQA 5EXTA 3AR2A 4Y98A 1ZJ4A 4BLPA 1NI5A 3ZWNA 3UAWA 1RI1A 1EDBA 2Q5EA 7GPBA 3MINB 2IHYA 4K9SA 4DV2B 3RYFA 4GBMA 1I1QB 2F67A 2VPWA 2Z9CA 5TQ2A 1V45E 4H9GA 3CRQA 1YJCA 3OECA 4A15A 4UBMA 2JHCA 3CUUA 3DP9A 4CM9D 5MFZA 3T9AA 3ZD7A 7MDHA 1PD1A 3LD9A 1CQJB 1US8A 2E5FA 3H42B 1WG8A 4GR9A 3TSZA 4MV7A 1AE1A 2OZLA 2NT4A 2Q3BA 4JH0A 1G20A 2J87A 4TUYB 4WVFA 3K72B 4RF3A 5IKOA 4W1PA 2AQKA 3LZDA 3RUCA 4CDGA 1NKTA 2A1TR 2BR3A 2CNLA 1MA3A 2JLYA 2RE8A 1EE9A 1QK5A 1PZGA 4JBYA 1KF0A 3IDFA 2YCBA 3Q6MA 4FIBA 5ALOA 4DHEA 1GZ5A 4F21A 1QH1A 2QK4A 3G0CA 4WXHA 4DBVO 1GITA 3JATB 3SC3A 1GCIA 5D7NA 2JC3A 2VJDA 4QPDA 4QUBA 3RODA 3W4IA 2W4IA 1B14A 1U0HC 2PCLA 3IR5A 2PJRA 1L1FA 1IRIA 5AI6A 3I9LA 4GO1A 3OE7A 4JNKA 4ND2A 3S1AA 3I5YA 3B51X 5BOSB 1U2TA 1ESMA 3D0OA 4GWKA 4YC7A 1ADFA 2OXIA 4L0CA 2PA3A 4MP3A 1MC8A 1CR4A 2J3IA 4YRSA 3AV0B 2BHTA 3FNQA 3L77A 1YKFA 5B4TA 1A5AB 2WV9A 2QD3A 2FN7A 4WDQA 1RC8A 2GPSA 2X4DA 2G88A 3BJRA 3BQMB 2ODNA 4HWRA 4BN4A 4CKXA 2I2DA 4RQAA 2HD4A 1M6NA 1QM5A 2W71A 3ZHZA 5HTOA 4BGEA 4L75A 1CY8A 4QELA 3UJ6A 4DQ0A 5C7YA 4WZ6A 3IAAA 3ADDA 3KL2A 4OU5A 1GFZA 3P2IA 2QMEA 1HLDA 4J2OA 4DA7A 1MC1A 5E1OA 4WUTA 1XVIA 2H8KA 1ZN2A 2ZUBA 4Z4FA 5ARCA 2RGWA 4BV9A 1WB6A 1EJ6A 2FETA 2PZMA 2WU3A 4IXDA 1CB7A 2CW5A 4MKIA 5B58C 5K3BA 4QXPA 1EFLA 1XEAA 3SK0A 5I7RA 3I62A 3ZWVA 2WFAA 1QGYA 1HWYA 5DHSA 2RKOA 4Y2YA 2C5FA 1PNVA 2WM2A 3ABRB 4YONB 5AVWA 3C7CB 2H1RA 4HNTA 1PTJC 2PQ0A 3A37A 5F5XA 1JQBA 2W6PA 5BW6B 4KQHA 1C7EA 1JMYA 1X42A 2GPJA 1I7PA 3RK1A 2NADA 1IWPB 2A84A 1YL5A 4PX2A 3O95A 4XUEA 5CT8A 1SU6A 4V0KA 2B4KA 1W5EA 2CCJA 2XF8A 1HQDA 3UMYA 4A23A 6REQA 2PR2A 1O1YA 3OOSA 1GEEA 4OU4A 3E7FA 1NKVA 3IODA 3OZGA 1BDHA 4Y0AA 1PVDA 4BLTA 5AKIA 4X7PA 2JVJA 2VF7A 3U44A 2LP4Y 5I45A 1QGED 2FZLA 4JP8A 4N4AA 3OM1A 3H4MA 3E9CA 3KZCA 3PJRA 4P2BA 2R8EA 1NURA 3LC0A 2FFJA 1V41E 1PZHA 2WF5A 2FPSA 4MIEA 5JDIA 1SCUB 4DIUA 5KYGA 1TYCA 1LDYA 3M81A 5SY6A 5LDHA 2BGTA 4CQMA 2NNLD 4EA6A 4ZJPA 2O50A 2W5UA 3DJYA 3AVUA 4KO4S 1NXSA 2NUTB 1MAUA 2QJFA 1KS2A 1UJNA 2BDUA 4TTRA 1JFFB 1P9NA 2GZMA 1Y9ZA 2D5BA 5IH3A 3VR2A 3HK2A 2Q0HA 1PTJA 1OGYA 3IV6A 1T0HB 1MDFA 1M54A 2G3YA 3N58A 4BMXA 1H2YA 1XXHB 2JLQA 1CHNA 2QM0A 4KXVA 4Q9IA 3RQSA 1DSSG 1T35A 3IPLA 1A95A 2V98A 3B7PA 3WIEA 3G2MA 1ZH4A 4HSEA 2CCKA 1EVQA 3LCVB 4JBHA 4L16A 4LWQA 5AXCA 4A73A 1NLYA 1KP3A 4JL5A 1NAHA 1NVGA 5C32A 1E0SA 2GK3A 4WNAB 3M9LA 1Q17A 2NPOA 2B4TO 4JT9A 5HKAA 1QHHB 1U8EA 4NQZA 1FRVA 2PV7A 1EDEA 1FSSA 3BXEA 1P33A 1ZMRA 4V0RA 3RTBA 3QSGA 4GXTA 1JAXA 4Z0NA 1M67A 1G2IA 2ZITA 2J7KA 1QB8A 1YE5A 4U2GA 5ALQA 3RROA 4EG8A 3K7EA 1P19A 3NVDA 4ZVRA 1QIKA 4OHKA 1QP8A 4TMKA 2C5AA 3AHCA 1GQYA 4ER6A 2ACEA 5A62A 3K0CC 3FVQA 4WBNA 4KAAA 3QVVA 4NYJR 3VC7A 1W4CA 3VPBA 4DSOA 4GF5A 2IV2X 5AUOB 2IKQA 5IVIA 2ZIXB 4FE7A 3Q0TA 4CVNA 4YBZA 5AI0A 4BO8A 5I01A 1GYRA 4LOLA 1R6BX 2FHSA 5TB5A 3CNLA 2OBNA 3OWHA 3EVZA 3S6JA 4MUBA 5ADVA 2FVYA 2CHGA 2G5PA 2OFWA 4RACA 2B36A 1YT5A 2A0FA 3SGLA 3WIVA 4BAZA 4EKIA 1KEEA 4Z9FA 4LJRA 2FDCA 1WXIA 3HKBA 5E1BA 3FFXA 3KJGA 4GI3A 4OQFA 3K4PA 5A5VA 3MILA 3COPA 4MRSA 5CIYA 1AKYA 2Z9DA 1OTYA 1EWQA 3S7ZA 2XUJA 4E12A 4ZCSA 2CD9A 4EPYA 4EZBA 2VNJA 2DR3A 2WT9A 2WWXA 1OU4A 2X3UA 1WMFA 2FOIA 3GIDA 1JR3E 3OU2A 4IS3A 4KGZA 4MR7B 3FLAA 1YDEA 1PFYA 2YXEA 3FUVA 1RTKA 1L4EA 1PJZA 2YYAA 4OGKA 3JZFA 4OKIA 4K1XA 1GGNA 3W6NA 1B6RA 2GCOA 3O4IA 2PZKA 2NXJA 3DHNA 3PEEA 4ZI5A 5BYBA 5D2CA 3ZH9B 3ZV3A 2E49A 3CR3C 5G53C 4DLWA 1TOAA 1S2NA 3EH2A 4J76A 5A5DA 3A6JA 3SHTA 4R8KA 3HYSA 4DMMA 3IUMA 3OTGA 1HDRA 4HXYA 4I4CA 4DCTA 2CXRA 5AUNB 5AW1A 4Y0VA 1DO2A 2IDZA 4HPXB 3ZWAA 5JBNA 1DINA 3D6NB 1MIHA 2XTAA 4RDXA 3KUDA 4EPRA 1OKKD 2QN9A 2WIDA 1JZQA 4KXLA 4NWIA 1XXHE 4XIFA 1OFUX 1P4GA 5FOWA 4GL4A 3EIEA 2QMYA 4HYQA 4AMGA 2JEYA 1DOZA 4ZCMA 1HKHA 1BN6A 4OHWA 2VIIA 2ZAIA 2QJOA 2BMJA 2IZ6A 2O3SA 1TGYA 4C04A 1GKIA 1TT5B 2A59A 3H65A 2RGAA 4BJHB 4I2NA 1KRWA 2F1KA 3BGOS 3NAQA 1GRQA 1URPA 3H1GA 1L4GA 2EX4A 2JKYA 2GYWA 2A1IA 3B53X 2HGZA 3ZI7A 2VTBA 1TC2A 4E5NA 1A9PA 1R0ZA 1ZBQA 2X3YA 1N5LA 1F6DA 4N5NA 4KR6A 1RKBA 4UXIA 4A8JA 1QH8B 4DQVA 1Y6JA 2L2QA 4Q4JB 3W7AA 4A0HA 2H5IA 3K70D 5JJIA 2O8BB 3HUUA 3LOUA 2Q8NA 4XB1A 2I9PA 3TD9A 3TTTA 1U7UA 4QYMA 3EDCA 3ZI4A 1WJGA 1X7XB 2C5GA 3C8UA 4BFZA 3DT6A 4D8WA 1OTXA 3F3YA 2WIJA 3NTQA 4MVJA 3ZDXB 1QE0A 2I6QA 2VHYA 4Z7QB 4BX2A 4L78A 4CHGA 1SPBS 1S4MA 4K46A 3ZLUA 5CFRA 4R6XA 1B76A 3W5IA 1H42A 2JA1A 3RSZA 3TW4A 4DDVA 4Z8YA 3AK4A 2BDTA 5K3FB 3BB3A 4P3NA 4P4GA 4XVCA 1RIFA 3TLBA 2AN9A 3CVUA 5HMMA 4AP6A 3JQPA 1PLKA 3TLZA 3OX3A 4X84A 4YJ2B 1U9JA 4G0PA 3RC3A 2ZI4A 3WGJA 3C7TA 4DF3A 5EXDA 3AYXB 3IMEA 1V35A 4QT4A 1K75A 1ZGHA 2AKAB 2DCUA 1JKFA 4RMJA 4LGVA 4H35A 1Q77A 2DVMA 1PJ8A 1KR2A 2J3KA 3EW9A 4Z9AA 3WQBA 3FDFA 1CIJA 1OX4B 3U4GA 1H5QA 5F3WB 2FWIA 1EK1A 3BE6A 2E4ZA 2I6SA 1YQ9A 3OO0A 3KC2A 4RZ2A 2KLHA 4BATA 5B7GA 4P5PA 4O4LF 4S2UA 4CLXA 1AMNA 1JI3A 3BRQA 4LQ4A 5HF6A 3MLEA 2OHJA 2QTGA 4P36A 1K6MA 4TTVA 3W06A 4KIGA 4X8HA 3IPYA 4PZ0A 1I5RA 1SHKA 1P0FA 3E27A 1BVRA 4LV5B 3THRA 5DNCA 1M75A 4RKQA 2AVDA 1OX5A 2IF2A 2MU1A 2PGLA 3EZFA 3MUFA 1LSSA 4LBZA 4TPKA 3JD0A 4B2PA 3BOSA 3QBEA 4K1LA 3VX3A 1JU4A 3QPBA 3LUCA 1JAIA 2NO5A 4W9NA 3PC4A 3AEYA 4YAFA 4DY6A 1GOTA 3QXCA 3GY0A 2ZJ4A 4LZPA 4UPVA 1KAHA 1TZMA 3OA2A 4GS5A 5C1PA 2G09A 1KJYA 1OFUA 4JX9A 1YU9A 4NEGA 2J6BA 1R5NA 5C53B 4ZQIA 6ABPA 1P5HA 7ABPA 3PA6A 3CZPA 4FPXA 4KP7A 4IH1A 1GKLA 1BX0A 2OK7A 2PSHA 3SZRA 4EHKA 1I7DA 3ON5A 1T1SA 1G63A 4YCAA 2WHEA 1CP2A 4LSZA 3NWPA 1MAVA 1E2NA 4KQMA 3DO6A 4EECA 1HT2E 4PWZA 3NAZA 4PYKA 3TL2A 4AMUA 5LL6P 2V74B 2BC9A 3NXSA 5H0IA 1U8UA 5HFJA 1Q1AA 3RKSA 1YBMA 3HUFA 2YV1A 3REOA 3RRJA 2HMVA 1HA3A 3LI2A 2RDMA 4MAMA 2XF2A 4X1KB 4B81A 3BRWA 4FGUA 2HO5A 5E9AA 4HNUA 3Q41A 4HGZA 4JJAA 4EG7A 2ECOA 2IEAA 3MBOA 4HDRA 1IHXA 5C9ZA 1RRPA 1KJNA 4PPQA 5DTIA 1VIMA 4XVUA 1I4EB 4KFUA 3R0IA 4YB8A 1JFRA 2C2KA 3KG2A 4H7KA 4IPTA 4IS2A 4LXQA 1JA9A 4P84A 5FO1A 4KXWA 3CTPA 3A9TA 5K20A 1C3OB 2A5GA 3OP1A 1OFIA 3ZLTA 3AEUB 1M2VB 2ZJ1A 3KEOA 5EXPA 4DR1B 2YWCA 2BFBB 3Q12A 3UKJA 4ZC8A 5BN1A 4B3MB 2XOEA 3U5TA 1DHTA 1QIIA 3I4FA 4ND3A 4OREX 5DMXA 4KWHA 5EEGA 4KVGA 1E1QA 2XRMA 1S5PA 3UJ3X 4BRWA 5IS2A 2O8CB 1XFAA 3T5GA 3RFFA 3QVLA 4B6EA 3MQFA 5IABA 1OXKB 1T1GA 2O1XA 3PFBA 4EX7A 1FFYA 4R05A 1USUA 3TZLA 2JH3A 4Z4HA 3B6MA 2ZVPX 1XTBA 2NVUA 2EP8A 2X0NA 1RM5A 2YZKA 5AJXA 5BV0A 4HVCA 2XB4A 3K8ZA 1TYAE 3WNZA 3KUCA 1Y8AA 3S2ZA 3I1IA 4KPEC 3PRJA 2C3YA 2BF4A 2GA8A 2O4UX 5CEFA 1ST2A 2FI1A 4RVNA 4GVPA 3CRVA 3EPHA 2RAPA 2GD2A 5FL3A 1XHLA 2IYEA 3QBJA 1KH2A 4G1CA 3O75A 5JEEA 1N25A 1N6NA 1JIUA 3AM5A 3BE8A 3FNFA 3K1ZA 2NO1A 5AI5A 3Q9LA 5BUCA 4R83A 3SEAA 4Y0NA 4B45A 1WDLA 2DULA 2WZQA 3W9YA 4WA7A 4W6ZA 3SBDA 2UZ4A 3K70B 4FVTA 3JR3A 3WLKX 2FHPA 5KJEA 3DH0A 5INTA 3RK0A 4TKLA 2W6ZA 4K3VA 4NARA 3TOCA 3LY5A 4UAUA 4L15A 1O8CA 4QLAA 4ZZ3A 4FHFA 1DRWA 3JD4A 1Z63A 1AHIA 3E6AA 2WAMA 4PX5A 1XPRA 2IYQA 1CS0A 5CNMA 1P80A 2E48A 2OV6A 1NF3A 3FVWA 2R1ZA 3SYKA 5AW4A 2Y1WA 3VDRA 2C03A 4ZA2A 1ZCAA 3N53A 4AO6A 1FNMA 5FWYA 1T2FA 1I2ZA 1PL0A 2W2QA 2NTYC 3IXLA 3A6LA 4N6OA 4M38A 4EYKA 2DERA 5TQ0B 1UADA 2W2LD 4LAFA 4Q48A 2ERYA 2FPOA 3VV3A 5EZYF 2JLBA 3ZWYA 2GZ3A 1U0FA 1U8FO 3CCBA 1RRGA 1W2GA 1CVRA 1S8NA 2V9ZA 3B7GA 3KM0A 2YWEA 3IRUA 5IKPA 3U09A 1NHWA 4QYXA 3U4HA 2IT1A 4PC6A 4QEZA 1LDGA 4FFVA 3FGPA 1R0LA 5TIIA 4N65A 1KI3A 4I6GA 3DEFA 3R3YA 2WJ3A 4AG3A 2HPVA 4GI5A 3T4PA 1FE8A 2OO5A 3AONB 3H1TA 2DUNA 1G98A 4HAYA 1JR3D 3JQGB 2H4WA 3V7FA 3I9KA 4QTTB 7YASA 1RXYA 2WAAA 2B61A 3DW3X 3W8FA 1KZ1A 3IYLW 3MQ2A 1ZISA 5E8RA 2ONYA 2Q5LA 2GX6A 2WDZA 3O9MA 1T5OA 3TS1A 1GAJA 5CA0A 4ZHQF 3C70A 1EKXA 2FMUA 3CUSA 2C7RA 3DDCA 4F6CA 5DV9A 4HX2A 2XZLA 4ZGWA 1ZX1A 2ET6A 3F9RA 3RJMA 2Q45A 4FGZA 3RJTA 1Y3FE 2VR1A 2XT0A 1RNLA 3IA7A 2M1ZA 2EKDA 1ZUWA 2FN8A 4RKRA 3UCFA 2Q99A 2C98A 4MDHA 1FPQA 4QXOA 5KU7A 4BXOB 4RXUA 3RUFA 5AM2A 2HTFA 2O7SA 1N5RA 2BELA 2VP6A 3BC1A 1V96A 4IFBA 4X6UA 1CWUA 3CV3A 5E7QA 2R62A 2O3QA 3GFTA 1HTTA 4RM3A 1M0EA 1GUAA 4B40A 2HC9A 5AIAA 3OIGA 4HFRA 4XUCA 3MERA 3TL3A 4GKKB 1F20A 1UZLA 1GZDA 5JJBA 2NWQA 1F4LA 2VJLA 2QRNA 2ZQ5A 4J4BA 4LCJA 5AKKA 5KNDD 2HW8A 1JH8A 1I33A 3MF4A 3MRXA 1AY0A 1VI6A 5JZMA 4YASA 4LHEA 2CFIA 3WDSA 2QP9X 4QSHA 1DXOA 3KEMA 4X7MA 4HRAA 3A26A 4GC5A 4GXNA 1O4WA 2GXAA 1V5IA 1VE9A 1NM5A 4HDAA 3T95A 3WZ2A 1E9SA 1D2GA 1X80A 3U0VA 4J0IA 2G08A 1BZYA 2QN1A 1T3GA 3EIHA 3VU1A 3ZPXA 3T1YB 2YHSA 3PXEA 2VSYA 1L5WA 5IDWA 3HA7A 5IWCA 4UM9D 3SLRA 1Z82A 2XD9A 4TM8A 4BYGA 4J03A 4CEIA 2JAHA 2FV8A 2PMFA 2QDKA 2M98A 2WT4A 3LK6A 3NI2A 1U6KA 4HFMA 4IGEA 3PUWA 4PLVA 3VSEA 4AUNA 3M5DA 2IF0A 2AN1A 3FHJA 3QYPA 5FDFA 2EDCA 1Z4IA 3BHJA 3E84A 3H8WA 2R8ZA 2XKJE 4M8IA 4OHCA 2JGLA 3SZLA 4N0DA 5F7XA 4CL8A 3B6EA 4ZAWA 5JQGB 2G28A 6NULA 2XSZD 2WJJA 1UP6A 4EM6A 3LGAA 2R2AA 2G4LA 5I7UA 1V8DA 3ND9A 1WSAA 3DGFC 2QT0A 4KMMA 3SXUA 5ALLA 5IXYA 1EMDA 5LDGA 4EGFA 5J3JA 1K7YA 2GKGA 3GCXA 4WNCA 3TLYA 5AVKA 3CEHA 1I4DD 3BQ9A 4PGHA 4D9CA 4HH1A 2JFOA 3HHEA 5BN5B 3RE1A 3GJSA 3KD3A 4A26A 2JH8A 2WUEA 2FLWA 2PKRA 4QM7A 2LZ0A 5B4VA 1V2GA 4ZMRA 4R1TA 4IIEA 4TXLA 3VH1A 2Q50A 3GJ0A 5ABPA 1QC5B 3DOFA 2ZIVB 3DXFA 3A1FA 2FSSA 3CF0A 1R9JA 3AEQA 2FFQA 2GEDA 1EM6A 3N2LA 2OAGA 4MQFB 2ZUVA 1LI7A 1P81A 3AF2A 3DFKA 3JW8A 1WMEA 2HGSA 1VL1A 3WQRA 1M0SA 1YZHA 1A5TA 1VLJA 3OY7A 1KGSA 3S5UA 4ZDKA 4YALA 3D3WB 3RSCA 4D3XA 2DLDA 1H5NA 4GX5A 2IBMA 1KZ6A 1EDZA 1SJ9A 2OMEA 4UQPA 4FYKA 5EC8A 3U7FB 5DISB 3CPSA 1KH1A 1W5BA 1HDIA 4GMHA 4NEQA 1TQ4A 4ZVLA 3D0KA 5LPNA 1A4IA 4K40A 4QEDA 1ZM3A 2PMWB 3M6VA 2LW7A 2YJ3A 4ZCLA 3CN7A 1JDJA 3EHDA 3C7DB 2QTNA 1KZ4A 3SXUB 2O2CA 4CM4A 4OFZA 1X19A 4GZ6A 5B6CA 1OZGA 3PSAA 3QU5A 2RARA 4G1EB 4OBXA 4O1MA 3VR6H 1SK9A 3UB2A 2SBTA 1JQKA 3M7IA 4BLVA 1L7RA 1V6CA 3D8BA 1ZJWA 5LJIA 1JWLA 3O4HA 4CQMD 3EGIA 1XF9A 2FKAA 1GTSA 1M72A 1NSTA 1WPGA 5LDDC 2XQIA 4GOLD 4KGVA 5G1NA 2P5YA 5LR6A 4MVXA 1VDZA 1L0BA 4EK9A 3ZWKA 1AS2A 1KO4A 3NIFB 4MKHA 2VP9A 3P2YA 4KN6A 5FYDA 5CU7A 4CU2A 3V4SA 3M33A 1YTLA 1OTHA 5LZ2A 4UDNA 4BVEA 2IC5A 3PB3A 1NIJA 2B0CA 5IMBA 4HWPA 5JSUA 3VZRA 3GEIA 4NXNB 3WGGA 2FN4A 2TSYB 2WAYA 1E7SA 4E15A 4DSAA 1KI9A 1TQ8A 4FYPA 2VTEA 1QOZA 4IOJA 2CLEB 4YROA 4CGYA 4EFMA 3HJFA 4DZZA 3OT1B 1KA9H 1V1MB 1RZUA 3FPSA 5EPEA 3RTAA 1PZXA 2QRVA 3QM1A 3DAGA 4EI2A 5HKKD 2XLBA 3CR8A 4F04A 4G07A 4FJ0A 3FUWA 4IAOA 2HJHA 1TCBA 4J1NA 4DBZA 5H59A 3WC4A 5JCZA 2IK8A 4O4JA 4AKGA 3IBCA 3QMMA 2NUAB 4RTRA 2IHNA 3EOZA 2QTCA 1SXIA 4JJKA 3MD0A 1IN6A 1K4MA 1QSGA 3WB9A 5B1HA 1RWNA 1BHSA 1CNEA 1DO8A 2XWBF 1Z2PX 1QYVA 2V7EA 1RRCA 4QYTA 1T9GS 1AIPA 1KS9A 3BK2A 3AR9A 1G291 2HCRA 2QRUA 3HU5A 1R0KA 3NBAA 3PQDA 2XOKA 4MPRA 3WJ7A 2G70A 3CPHA 3F3KA 1XZGA 3EBOA 3HN2A 3PVZA 4B32A 3AW8A 1O7JA 3IMGA 3ZJ5A 4TMWA 1UKEA 4QGGA 2D1RA 3PNLA 5ERYA 1Y3IA 4U9IS 4Z9YA 2XBUA 3I6QA 1ZUIA 3ZWBA 1OASA 3HBJA 3T5MA 4F3YA 2OYRA 4F3NA 1ZSVA 5KNDA 2Q1TA 2QL5A 3LX8A 4JB0A 3DBHB 4N03A 3P2OA 1OSNA 1A9QA 3V9AA 4D9IA 2R1TB 1FTNA 1ORVA 1CUXA 1MQAA 3PWKA 4MHTA 3SKXA 3EPKA 4KQIA 5KQPA 4BUCA 4CG3A 3CCFA 1U02A 1MEEA 3KB8A 5DI3A 1N1EA 1QJ4A 2CE7A 4GOXA 2OT3B 1V37A 3Q4GA 3FM9A 4A9AA 2CZQA 1W36B 2Q41A 1ZU5A 5K45A 3EWSA 3O91A 1IXZA 3D9QX 2F1OA 3E9MA 3E0QA 1DT3A 4L9RA 1XTSA 1N92A 5KDDA 3RS5A 4MYTA 2QG6A 5EUBA 3E48A 3C5HA 2BP7B 2FMXA 1CUZA 3F6BX 3ZY6A 4BQNA 2O54A 5GONF 1H1TA 3OMLA 2O19A 2BFEB 4AVYA 3OPVA 4J0CA 1E63A 2FZCA 2GF0A 4NNJA 3GLSA 3GPIA 2FKNA 5IZ4A 3CEMA 3WRXC 2GJAA 2WU1A 3HPRA 4GLFA 4PHHA 1I4LD 2WZBA 3JTMA 4TQUS 4WXYB 5JXHA 3LPCA 1FP4A 4R8RA 2EEZA 1QFXA 3GG9A 1QHHA 4FILA 4LY3A 2UZ1B 2AHRA 4FI3F 2OESA 1W44A 4LMAA 1E3SA 2YC2C 1NWCA 1WXHA 2EGUA 2EQBA 3PNPA 5I9IA 1CEEA 1T4CA 4I3GA 1DZIA 1DXYA 2MSNA 1JLMA 5CX1B 4CM9A 3EXFA 3U3JA 3JU3A 1A9TA 1XU4A 3MJTA 4IDNA 5JDIC 1U2EA 4NC9A 3O7WA 1EUQA 3NOXA 1G8YA 1GDTA 4DHWA 3GJXC 2AFIE 5M7EA 1DX6A 2GZHA 1Q21A 3DDWA 3K5HA 4L8VA 4JI8B 3L7CA 4FFWA 4PINA 3ENZA 4ZPJA 3ZU4A 1U2QA 1UJ4A 1ZVMA 1Y5LA 2WAXA 3FCUB 4KKVA 2PX6A 4MRNA 5FPQA 4ZEXA 5L3ZA 3VU8A 4TL9A 4UQOA 4GNRA 4F2WA 2JCXA 9ATCA 3HO6A 2AFIA 4B3FX 1SKQA 3MWEB 2GTIA 1SWVA 3OKFA 3G49A 1R3DA 2FB9A 2IVFA 1UMCA 4JP1A 5LLSA 3Q8KA 1C9KA 4QARA 4N48A 4YJFB 2R25B 4C4ZA 5LZ8A 1R10A 5ISMA 4L8YA 2CUKA 2JK1A 4TTIA 3AUTA 3GZTB 4B0PA 1N2IA 5TV2A 3FJYA 4CUKA 2V5VA 1GTL1 5LA6B 1SBZA 5A3SA 1P0PA 1RCUA 2HDWA 3TNDA 2JJ1D 2Q4RA 5HGXA 4RTOA 4RULA 3BIFA 2C04A 4AF8A 3L7OA 3QZUA 4EYQA 1RBQA 4WFKA 2GXQA 5LKAA 1UXJA 2CLMB 3N39C 4LQCA 3DOOA 2AKEA 3KOZA 4JVNA 3FPEA 2I7XA 4E11A 5JAUA 3I28A 4URVR 1FBNA 5CT5A 3ZHCA 4JDUA 2C4NA 5H68A 4JOQA 5TMBA 3T7CA 3KQKA 2XJ9A 2CLFB 3E3OA 4NIMA 4QDOA 5JR3A 2CYAA 1XMJA 1ESCA 1LBHA 1N5DA 4MUYA 4EF4A 3LCCA 4I3FA 4MP6A 3D3QA 2KPOA 2CL6X 3TYXA 4YCNA 4W9RA 1BS9A 3AHFA 3WADA 1UUFA 2JIRA 3IC5A 1D5CA 2ZAMA 2Y8EA 2GEBA 1VG8A 4O2LA 3SQXA 2L42A 2FN3A 2EL9A 4IDCA 4YACA 4X61A 3PYXA 1S2MA 4C4YA 4Z0HO 4L8FA 4LVOA 3I9NA 2ZP1A 3F5QA 1RMTA 2VK8A 1ZQ9A 5LXTF 1CPYA 4KFRA 1VLMA 1JH9A 1ZONA 1OJ7A 1QFZA 2XNCA 4C78A 2HDHA 2XB6A 2REXB 3NDPA 4WFJA 2VJYA 1CUSA 2GN8A 2UYOA 3F7NA 1ULTA 2JFWA 5HCIA 3K92A 5LLTA 4FFSA 2ADOA 4LBYA 3VPFA 2XYHA 3U9TA 4KX3A 2QLTA 3WIUA 4ASUA 4BVBA 5BN3B 2YOGA 1VE7A 2EFDB 2I4NA 4IEFB 2DECA 4L73A 2QJRA 3E7PA 4S1VA 3FGZA 2BEWA 1J06A 2QX6A 3KZXA 4B6OA 5LU9A 1CUDA 5J40A 2ZRCA 3V42A 4UNQA 1Y5IA 4EG5A 5DTEA 3O21A 2C29D 3L9WA 5KTNA 4JBGA 1TTTA 1MVLA 1WVIA 1ZHFA 1P5FA 3KTDA 4I7EA 2F9FA 3NKFA 2MSKA 4OHMA 5E7JA 5AXAA 3UJ9A 4AXBA 2ZEJA 2O59A 1GPMA 2MSEB 1XWFA 4PBSA 3REGA 3OJ0A 2P40A 1OFVA 2QVGA 3PJGA 3QUCA 2XYPA 3FVRA 1EFAA 3RDPA 3TQQA 3FMFA 2WYVA 4XJSA 1L7VC 1Z18A 2IFTA 1JQLB 1QZUA 2JJYA 2A86A 4IHJF 3I3OA 4A92A 4NHOA 2OC9A 2QVLA 4UUBA 1ILEA 2DR2A 1KAEA 3C8HA 2AIRA 2FZ5A 3DLIA 3KHKA 4QOEA 4C9BA 1T4BA 2J48A 3HCDA 4JODA 4XWGA 3FTDA 4H4EA 1NVUQ 4IYJA 4DWJA 4REMA 1VLHA 4TMXA 4RKWA 2AA3A 1YJ5A 3VUEA 1G8KA 3H1FA 1G21B 3K30A 3LVRE 1OWNA 3PI7A 3X43A 3KHTA 3PX7A 3BFPA 2YZ7A 3AUUA 5JPDA 1L8XA 2NYRA 1ZXLA 1AGXA 3DL0A 5CT6A 1YZTA 3EC7A 3VTFA 2H2AA 2XHZA 4FZVA 5JAMA 1HK7A 2GJ4A 3R3WA 2GXUA 1EU1A 1U7ZA 2OVFA 1SC3A 3N6RA 1M1XB 3CG4A 1Y7IA 4HY3A 3R5XA 2OD7A 3W78A 1EK0A 3B12A 3TSWA 1G3UA 3ZE9A 2O52A 5ARBA 2AR9A 2YV5A 2FMFA 3IQHX 3AR8A 3NDRA 1UQTA 1HYBA 1Z7BA 2BFAA 2H1FA 5DRTA 5M29A 2PLWA 5ECWA 3WWOA 3WKDA 4ENSA 4XIIA 1A72A 1GGJA 3CZRA 5CVJA 5AM1A 1E1LA 4Y67A 5JALA 2BKEA 3ILXA 5LOVA 3GJTA 4RVFA 3O8BA 1ZL0A 4I14A 5B64A 1LBEA 4FP9A 4HKTA 3TQTA 5JAOA 4WNIA 4FHCA 3SP1A 1T6BY 5KTSA 2IVZA 4B3RB 2GBLC 2EF1A 4XGIA 4LNAA 1CZLA 1E3TA 3LDAA 3KTOA 3G1UA 1EPUA 2W2TA 5EOVA 3FMIA 2BEUB 5EZYB 3UXHA 4EGJA 1QLWA 2ZR0A 3SS8A 1Z0SA 1ARZA 2DTDA 3DR5A 5CYPA 2WLSA 4DLZA 5GP1A 2YUIA 4LYJA 1RM3A 3VO9A 1HSZA 1ZCBA 2C3MA 1X80B 4X44A 4YJHA 3JZDA 1SCNE 4O8CA 4B74A 1QRSA 2R68A 4FHDA 4N3AA 2CSUA 5GGYA 3JYQA 1RQLA 5JYEA 2PL5A 2EZUA 3QW4B 4PSVA 1JEQA 1SFRA 3B9QA 3JAWB 4OBBA 1WUHS 1J0AA 3FZEA 3R7NA 3KYDA 4KQKA 4Q4DA 5KIAA 3EJ6A 1P7WA 2G80A 1Z33A 4G63A 4IO0A 3F7MA 3IEPA 2WSSD 1HNNA 4EHDA 4B3SB 3T54A 3HGTA 3N2KB 3NIGB 5EJGA 1Z47A 2Q6KA 4EAQA 2F3QA 5BNWA 2WTUA 4H0CA 4PHFA 3MGKA 2ISSD 1Z2OX 5DVZA 4ENTA 1GGKA 4AL4A 4K28A 4DSZA 3KHUA 3OTHA 2CUNA 1WKVA 2AF4C 4UUQA 4BPBA 3VAAA 3BZUA 1IZZA 4ZI3A 4DMHA 4GKAA 5C1OA 3GLVA 1XZLA 2WFMA 3K0FB 4GGMX 4X3OA 1BC5A 2HYDA 2XQJA 4YRTA 3UG6A 1GQFA 5ALDA 5FO0A 4QIHA 2R6JA 4BX3A 1ZGBA 1CKEA 1C14A 3RYIA 3LP6A 4ZAFA 3QJYA 4OLBA 1G5IA 1N3IA 1VYTA 5CURA 1ISFA 2VJMA 3NNDA 3WGYA 1VMDA 2QAGB 3QWBA 3NT4A 4WADA 4O1HA 2CVZA 3P26A 4R7GA 4NJMA 3P9NA 3R20A 1ADJA 3QUBA 4H6VA 1YZGA 3HCOA 3DLHA 2X2PA 3H2SA 5FUVA 3GDOA 1GRVA 1P5RA 1FTGA 1V6SA 3OE1A 4QG7A 3OZIA 1JDVA 4BL5A 2J3MA 3FOCA 4J4TA 2GBGA 3OFND 3PQ5A 1RAEA 3GVCA 2Q5FA 4KUGA 2ODWA 1E77A 1QQBA 1Q50A 1LV8A 1UEXC 2VF2A 4C4OA 1KETA 5C51B 1PBNA 2IXEA 1T0IA 2WR8A 4YV0A 2POQX 3A9RA 4GYYA 4XJXA 1CE8A 1FFSA 5AVUA 2BY4A 1EM8B 3H2GA 1Y9EA 3NCTA 3HXMA 1TJ3A 1R37A 1RPNA 1Q3TA 1Y6GA 3CVXA 4X24A 3AUFA 3DYIA 1KY3A 3WNVA 3RYFB 2NOAA 3HYNA 5JQGF 2R85A 1P7VA 3CHYA 2W2OA 3E9DA 1KPHA 5ITZB 4KO3S 1QXSA 1HMYA 1UP7A 1Z5WA 1WX1A 1X7YA 3BGVA 4H1VA 2W8BB 2GASA 2Q0QA 4LZNA 4YCDA 1LRLA 3M5WA 1YF3A 1RAHA 1C30A 1R5BA 3DHYA 5K0LA 1ZC4A 3DO8A 4GG1A 4JMPA 4QG3A 1SO8A 4QPZA 2BRUA 5HCUA 3UV7A 3UW3A 1M5RA 1FU4A 5B2FA 4A91A 2XTJA 4M8SA 4LG1A 5DLYA 1NBMD 1FY2A 1Y9AA 3OZWA 3INYA 1I1OA 1TFRA 2IOHA 3PDWA 2XMPA 5ITWA 4WV3A 3H2JA 1SVUA 4M6WB 1H8EA 2B98A 1QIHA 2J1LA 2HB6A 1AKNA 3P0FA 1X8XA 2WD7B 3EE6A 5D51S 5T6MA 3TNFA 5BV7A 1AQNA 1IOLA 2CF6A 5CK4A 5I3CA 2ZWOA 4CIDA 5BV8A 3D54D 3P9XA 4DLSA 3RSGA 4ZYXA 1RAFA 4ER5A 1Y80A 3MJSA 5IN5A 1IEXA 1YWGO 3UKOA 4B82A 3EPPA 2FPGA 5JAIA 4F6LA 4JXKA 5TMEA 5JMTA 4CEIB 3ROXA 4RJ2A 1H65A 4J49A 1SZJG 4R1OA 1L8QA 2QYHA 1JHXA 5K3SA 1J07A 5MDHA 3ZBTA 3WMWA 1Z12A 2E87A 4HBZA 5AM4A 4CMJA 5C46F 3D4NA 1ZSNA 1KU0A 3DL2A 4Q82A 5THKA 3OPMA 1T2AA 4R1SA 2VQFB 2XE6A 2H2FA 4U2BA 1QP0A 5L4SA 2I4LA 3LHKA 4FDVA 4J3FA 4D25A 4C43A 2G1UA 1AUOA 3NNNA 1MHPA 5DASA 3W1VA 3G1WA 3MD9A 3BWXA 2ZUDA 4HCJA 1RQXA 2HJ9A 3GLFA 1ORTA 2IS6A 4QPCA 4L5BA 2ZRPA 5SYAA 4JXZA 5T4BA 4MAFA 1GG5A 2XW6A 1LLDA 3GBVA 1PG2A 3LX5A 4XD7D 4YP5A 2CYBA 1UAYA 4H0NA 4INJA 4PCVA 5CLLA 5E7MA 1ECLA 2O7VA 2ZRLA 4YJKA 4Q7KA 5FQOA 2PA0A 2C9MA 1V0JA 2B9EA 3HKCA 3HA5A 3KAPA 4JWTA 4PO3X 4Z4CA 1XKXA 1U3TA 1E3EA 1NR5A 3GJ6A 1X7WB 5HUQA 1M2GA 2CJYA 3EH1A 1KVSA 1SD2A 4LE2A 1W2HA 4IDFA 4ND8A 5DM2A 1XELA 2NT3A 1TO1E 2PRSA 4JLBA 2ZKIA 3WLLA 4D26A 1H0SA 3RKUA 4ZV4A 2EZ4A 4AWXA 1WOMA 2W9XA 3C16C 3O4VA 4DRYA 1Q19A 1QAOA 2YIDA 2AOUB 2OHVA 1H6DA 2GR9A 1D1PA 1R74A 2ZIWB 3DVSX 4KDEA 3SHQA 3WSTA 1P1JA 4BOYA 2PZBA 4BO9A 3ODGA 1WL8A 4PU0A 5DYWA 5D6NA 3RVMA 4CMCA 4J75A 4Q7QA 5KB3A 3LCMA 2HMUA 1KL7A 2PTHA 3EXHC 1X1DA 4LY0A 5DM4A 3N74A 5HUHA 4M89A 4QJ5A 1QG4A 2NZXA 3DBOB 3JQ9A 3AVYA 4PPFA 2UYCA 1VP9A 1MO4A 2VWHA 3MLBA 2CDNA 1SOVA 1TK3A 3RRZA 3VDXA 2X0IA 1NLZA 4M1QA 4CUJA 4YR7A 1Q7GA 9LDTA 1L4HA 2OCIA 3GB9A 2NU6A 4HDNA 3HKBB 1HY3A 1FMTA 5AJYA 1IYZA 1N9KA 2WU4A 5REQA 3QVSA 2EW8A 4NBLA 5SY9A 5JH7F 2XUGA 4LXHA 1NYRA 2YJ6A 3BICA 3MWEA 4EG3A 3DZDA 1ECJA 4RNCA 2DEUA 1XGKA 2BN4A 2YIMA 2VHTA 4TVKA 2PS1A 2DR0A 3AHGA 4UNRA 1PRYA 4KSCA 3QG1A 1V11A 4AP5A 1I3LA 2WMYA 3EGXA 3OPQA 3T8YA 3NHBA 2IEIA 3R7BA 4LYGA 2WTEA 4AYTA 2NXWA 4EY4A 3AHJA 1RHUA 2IBSA 2I67A 5KTKA 2LW6A 3M34A 1QO0D 1PR6A 2HMWA 4II7A 2QRHA 4GAEA 2RHTA 2BFMA 4R8SA 2NSJA 1XNGA 4URHA 3AL0C 1MO6A 1RMQA 1XCGB 4NAVA 5HZMA 3FWNA 3QKSB 2DUJA 4Q05A 1ECGA 1AM4D 3STWA 1X1SA 5DX8A 3VZDA 3QVOA 3BHNA 4A6DA 3HWRA 1CY6A 1Q1EA 2H9YA 2JARA 2YXLA 3QWHA 4K9NA 4KUEA 5DTMA 4EB6B 4IUDS 4L95C 5AK0A 1ICEA 5TGTA 1NJ8A 3V8NA 4UU7A 4FOTA 3OEEA 4WA8A 2BZSA 2F6RA 2JZNA 5A4DA 4OI2A 4YP6A 5BVHA 4RC9A 2IY8A 1MJNA 3AU9A 3O7MA 2YXBA 2NTNA 4I5FA 4W1SA 3JAMA 4W5HA 2JDID 1SUSA 3AWDA 2W2VA 1DBRA 1QF6A 3PRYA 3QQ8A 4M87A 4P7GA 3S0JA 3EGOA 4LOKA 4NBKA 3V2IA 3QKWA 1V1RB 2NPIA 4XEHA 3A4LA 1MRNA 1XQWA 2WQ7A 3ETCA 3ZYZA 3I42A 5FTJA 4JXJA 3LAWA 5JOQA 3O8QA 5CFMA 3ZTWA 3FAZA 1WULS 5J1SB 1NNUA 2XA1A 4LFCB 3EA5A 5BSGA 1H1LB 1UFQA 2BTQB 1RACA 4RKFA 4DPKA 5L3VA 2I3DA 4LDNA 4LTMA 4E13A 5HVNA 1NN0A 1Z4PX 4G67A 2CFCA 2G07A 2XOKD 2P67A 3DE4X 4N18A 3K31A 4PLZA 3TRHA 1K89A 4Q0MA 3GEDA 1T2NA 5TR9A 2NP6A 2VEDA 4CV1A 4BBZA 3BS4A 1X87A 3K4QA 4FZ3A 4EITA 4D9HA 5JSYA 2C5LA 3W1EA 5KJFA 3RTCA 5B7PA 1A1VA 2G17A 1C4KA 4IX9A 4AULA 2QLJA 4G5XA 4U2DA 2D8AA 4DZRA 1UK7A 3TGLA 1GTVA 1TZ2A 4TSKA 1E3WB 3DCNA 4NCHA 5CJPA 3G7NA 2P11A 2NU9A 1P77A 2A1UB 1AT1A 1GCUA 4DNXA 4KLNA 1WKBA 4HTFB 5T3UA 1KKMA 1JJIA 2CNOA 1V26A 1XZNA 2VA9A 3ML1A 4QBTA 4DA9A 3DPSA 1I6MA 1H5UA 3I09A 2Z6AA 4XD2A 4IJWA 3UV3A 4EKEA 2YN2A 4BV8A 4TMTA 2J3HA 4D0NA 1DWUA 4Z51A 1B8PA 1MN6A 1UJ5A 4Q3DA 5GY7A 2Z3WA 2CKMA 1CY1A 3KOOA 4BLUA 2HI0A 4K6FA 1GG2A 3ONDA 4UBOA 2IELA 2P7HA 3VYSB 3IKTA 5DPMA 5FV7A 4XRRA 3FSEA 3WK9A 3EOBI 4JI2B 4RJTA 3IVAA 4LRUA 1E99A 3MWYW 3BWMA 4HF7A 4KYUA 1GTJ1 5G4KA 1L5ZA 3PITA 4RK0A 1TU4A 1VFNA 3EYAA 3V1LA 2AOTA 3FFAA 2IHBA 3ONEA 5ESRA 3RFCA 3CVOA 3C1OA 1HSOA 1NULA 1JEEA 2WOOA 1UJBA 1Y1TA 4OMCA 1P7PA 1CIPA 1JR3A 4I3HA 3I04A 4GVLA 3Q3GE 3ZE1B 1H2RS 5JH7A 3G85A 1F0PA 5EJ2A 2XIQA 4UBLA 3MYYA 2X0DA 2LNDA 2JW5A 1NQAO 2WF8A 4JI3B 3LRXA 1KPIA 4HMOA 4MW6A 4BEWA 2XCRB 2X6TA 5KBYA 4MYDA 1TJ4A 2F59A 2O9JA 4P31A 5AHXA 3PUIA 3I52A 3LXXA 5DNAA 5A0FA 2LXNA 2QY9A 3KV3O 4WLNA 2VYND 3GCDA 2VUIB 2HJWA 4K0RA 3LU1A 4NCKA 4WNAA 1TZBA 3NC0C 1IIRA 2IDJA 2GBLA 3EVGA 2DT8A 6ADHA 2V0CA 2PSSA 1YVUA 2ZTLA 1OWLA 1EK5A 1K0UA 3I58A 3HVKA 3JYLA 1R1DA 2B34A 5EP3A 3L7BA 5GQSA 3LLSA 3IUYA 3PDIA 4YO7A 4IFEA 4W9NC 4PONA 5CW1A 4ILKA 3C2QA 1RYYA 4GZ5A 2EKZA 4U2KA 5F51A 3D6UA 2OCDA 1UBTS 3WLHA 1U9CA 2EP7A 2WYWA 1C2YA 1JFFA 1KVRA 3I5MA 3NM4A 1TQHA 2ZWVA 3A28A 1L7XA 1J24A 1E6EA 3DTTA 4TL7A 3UA4A 1G55A 2C20A 4KO8A 1NPTO 2MCFA 1M6HA 1R8JA 2XMSA 1OYYA 1EUCB 3G2LA 1GG9A 1WZEA 4EB3A 3H4IA 4TQ9A 3U1BA 1XCBA 3WG9A 2IHTA 4UBIA 3ONNA 1ZR4A 2IPXA 5LP6F 3JCZA 2OGSA 2ZBRA 4R01A 3RJ9A 3L82B 1YZNA 4HLDA 1DDGA 2PMBA 3UM9A 1M7BA 4MRRA 2IPNA 5SV2A 2VRWA 3ELBA 5DULA 1KYIA 3UTDA 5CIQA 1DJQA 1Q7TA 1RAGA 4BNVA 1FW8A 3QU4A 3LW7A 2DTEA 4UUMA 3IUBA 3M2TA 1OLXB 4G9BA 3UA3A 5BPFA 1IQUA 4NAUA 3SX2A 4BJ3A 3S3TA 2VXOA 1FFGA 5AJWA 3CUYA 1O5IA 1ZINA 4F1JA 3LUKA 3AFNA 5E2IA 4KUHA 3JYPA 4MI3A 3QYAA 3I34X 1OZAA 4DQDA 1X14A 2IXDA 2VHWA 3IX7A 3AY7A 1ETUA 2BFDA 4LZOA 3CS3A 1L5NA 2UVPB 2WUWE 5JIBA 4CMGA 3OVMA 2GETA 1E5QA 4CGZA 4NQRA 2H2DA 4P93A 5FIUA 1JVSA 1LI5A 3UHAA 1DAOA 2CNNA 3ZE2B 1R64A 4HMPA 4URWR 4AZ0A 3ET4A 4RYDA 3TSYA 1RJDA 3HA2A 1WV0A 1DV2A 1FS5A 1N2EA 2B8JA 4UVIA 3TO5A 4QGSA 5F23A 3EMBA 4EB6A 1S1CA 2AXQA 4FN4A 2NU7A 2M6SA 5JATA 2OGZA 2DWPA 3WYGA 3B8HA 1QH9A 3IDZA 1AQJA 2AMVA 4RHTA 4G5GA 2IS4A 2AK2A 4Q34A 4Q9HA 4RD2A 1N6IA 4BMNA 2EP5A 4JBLA 5BO5A 1Z75A 3UIEA 1AU9A 5D3MA 2ZE7A 1W4ZA 3ORFA 4OJYA 1D7OA 4QPNA 4XGRA 3RVJA 5BOSA 1ZVVA 4A36A 3S70A 1HFKA 4IRMA 2QHXA 3LDGA 4IRUB 3NEJA 2OM6A 3H7AA 1MABB 2IHJA 2ZBEA 1RVDA 4U6SA 4OPMA 4MVWA 3BIWA 4CDMA 4K9DA 3AUSA 5I8ZA 3UQYS 2SKDA 1WDTA 1LK0A 1DG9A 1ESDA 1PUXA 2R4QA 3MXOA 1CQWA 2YCLA 5A5GA 5LWHA 1R3UA 4FFBB 1ISIA 2I4RA 1SHZA 3H6KA 4WLFA 2I65A 1Q6ZA 1J2UA 4INAA 3V1KA 1J49A 1JPUA 3O1LA 1R0XA 2K5UA 4PNHA 3RJZA 5ESXA 1H1DA 1VGVA 3K0BA 3MGGA 3R6GA 3FKJA 3ZWDA 4QFDA 2EGHA 2WG2A 1P6UA 2OY0A 3TOSA 4H7FA 4V0LA 1XDGA 5BQ5A 2CV1A 1WDWB 3S81A 1M3SA 1WHTB 3DCJA 3LUAA 4U5XA 4UCXA 1U0BB 2Z1MA 3FHOA 4F86A 1MB3A 3E18A 1ML3A 4YNBA 1SIUA 3MB8A 3FA2A 1RPTA 2IYTA 3GAMA 3KTAA 3Q8XB 3QPAA 4OJNA 4BNZA 2C7GA 4XWKA 2IOYA 1WS6A 2VNSA 1QLJA 4R2JA 5EMHA 3AFOA 3EMKA 4KWEA 2FJPA 2J3EA 4ARIA 3PQ4A 3O92A 2Y1FA 1T5SA 2HPHA 4XCVA 4DTCA 4FC6A 3HXPA 3PU6A 1ILWA 5TQ0A 3ESQA 3BL5A 2YWDA 3UTCA 5A2GA 5KNCH 2BZGA 3KQHA 3UOWA 2VPTA 3TTVA 2NSYA 4DV6B 3KQQA 3KUXA 1QQTA 1E2UA 2ZQYA 4ZXFA 2XTZA 1P2BA 221PA 2HADA 3FRHA 3JXEA 4UDOA 2HA0A 1JU9A 1E2DA 2IYAA 4IF6A 4O2RA 5BQFA 5G4LA 3JAKA 1CQXA 4LJ7A 3IP6A 5CM9C 5B53A 1WR8A 1A8QA 1JMKC 1UEIA 2MSLA 1Y0BA 1GUYA 2PX8A 3B5IA 3CLTD 3R5SA 4HS9A 4ZDWA 3GLFB 1K7EB 4M1TA 2F1IA 1MAAA 4MWZA 4P3XA 4G0XA 4TZTA 4YTEA 4B3CA 1V25A 5HMLA 5LA6F 3GJ3A 5J4LA 2P4SA 2RI0A 2YMQA 1QZXA 5D01A 2F17A 3ICCA 1CDOA 1MHTA 1G5TA 4JJIA 2KSQA 3F4LA 3ND7A 1Z7EA 3GEMA 4OTZA 4OUDB 1EUYA 3AF4A 3HEAA 4ZVUA 3SF0A 2GUGA 2QYTA 4S1NA 1T8UA 4DYHA 1ORDA 2FE4A 1IK4A 3PGMA 1MJHA 1AQIA 1GN9A 4X1YA 2CMGA 5FR2A 2PMCA 3JQAB 3D3NA 4MS1A 5C0OE 1RR6A 3GR6A 1CUEA 1BCSB 1PQPA 4QATA 1B6TA 3A4MA 1GRNA 5FWXA 1M1NA 3N9IA 2H51A 4HNGA 3PK0A 5K3AA 2EVWX 2NYVA 2YC4C 4AW9A 3UYKA 1TJPB 5K01A 4AY3A 1D1TA 1VJ1A 1SVNA 5IAKA 3M6WA 3I61A 3VDNB 3JQBA 5K8CA 1UK9A 2HLNA 1CHDA 3KYJB 4EA8A 4ER0A 1SAYA 1QKIA 2DBRA 2FZVA 3DLTA 1I7LA 3AM3A 4MS4A 4JUIA 5E8JA 2CXTA 2FWBA 1VJ5A 2UXBB 1NYLA 1NASA 1QLHA 5EJ4A 4QLOA 3PQ2A 4EY3A 4PYOA 1OREA 5MFPA 1KZYC 2X2OA 1N3YA 4LOJA 1W88B 3FCCA 4EQ6A 5LXTB 2C8KA 1RYNA 2ZBPA 3FDXA 3ABZA 4X1IA 5LZ9A 1LKZA 1SPXA 4BY9E 2AEMA 4IQ4A 2HA2A 3AEUA 5BR7A 4MEAA 1OE0A 1HE8B 4CTMA 2QTFA 4GR4A 4KFTA 5JJLA 2HRZA 3MWLA 5DSTA 1UFKA 1LW6E 1XA0A 3UANA 5CMLA 4ZKDA 1VOTA 3HDHA 1J39A 1OIWA 4QBGB 2PRZA 3E2MA 2ZTSA 3O2SB 2Y77A 5K05A 1G2OA 2KLBA 1U8TA 1OIXA 1YFJA 2JF0A 2Q1XA 4U7HA 1I7QB 3L92A 3B13B 1HQYE 2XDQA 3BTOA 3PC6A 1TO6A 4FFRA 1MOPA 3TPZA 4G4SP 2AG5A 2OKCA 3KKPA 3P0EA 3GP3A 4GSLA 4NDNE 4UVDA 4XQEA 2Z4TA 3VVCA 5D5PA 1HBJA 4OK5A 4BN5A 4YCCA 2QYOA 1B1AA 1FNSA 1JLLB 3LT0A 2BHSA 3AUAA 3W6OA 3ACDA 1VPEA 3ADCA 1DVRA 4IVQA 3N6XA 1XEWX 4HUTA 3Q9UA 1DG3A 1DOHA 1DGQA 3HJTA 1U2PA 4RTPA 1CR1A 4ZHSA 4YAUA 3NOQA 1QVRA 2HPZA 1NYQA 3C6MA 2X1LA 3UHOA 1Q3KA 1VE1A 3OIYA 4ME6A 2YRWA 1KI8A 4WK0B 5TSDA 3TTUA 3LTNC 2RONA 4GX1A 5EWJB 4AKHA 2Q0XA 4MQEA 2NLOA 3L0BA 1TTPB 3AVQA 3TG2A 1PJ3A 4RK4A 4JY7A 3A70A 2VRCD 2JFZA 3T0GA 4NG4A 4RY2A 4G97A 1F3OA 1HKUA 2D1FA 2I7DA 1JB1A 2GEFA 3IT0A 1TE2A 2ZBQA 1H85A 4DR2B 4QICA 5DYGA 4JLNA 2R7MA 3P0IA 2OO7A 3K6KA 1WTAA 2GERA 3CNHA 2G83A 1RWVA 3SLKA 1TFUA 3V48A 1CP3A 2ASEA 4ZMBA 2RH4A 2RGCA 1YULA 1RRMA 1O9GA 1NDQA <