3LHDA

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-homocysteine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
253
structure length
253
Chain Sequence
MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase, putative
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 66
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3lhdA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lhdA02
3KR2A 4YV0A 2XVMA 4C03A 5BXYA 5E1OA 5T64A 3SXJA 4EMSA 2G1PA 2PT9A 3FYCA 2YUIA 3FUTA 4OQDA 3VYWA 5EHIA 5E2AA 3PFGA 3UJ9A 3A7EA 2ONYA 3P9KA 3KPWA 2GB4A 3GRVA 1NW5A 4RVFA 4X61A 2B3TA 2E5WA 3AXSA 1P39A 4E32A 3LCUA 3PVCA 3SGLA 4DCGA 4GQBA 1JQ3A 1VL5A 3DLIA 3MGGA 1N7IA 5CCXA 3ELUA 3EVZA 1KPIA 1NV8A 2UYCA 2Z6AA 3PX3A 3LX6A 4EKIA 1NE2A 3NWEA 4RTPA 4PYKA 3G5LA 1NBIA 3KR9A 2VP3A 1JSZA 2P3OA 1B42A 1NKVA 3OPNA 4MHTA 5DTQA 1KIAA 2AS0A 2HWKA 3EPPA 1R8XA 3ID6C 1VQ1A 3PX2A 3DMGA 5MHTA 3C6MA 3AY0A 3HCCA 5EMLA 1EJ0A 3UWPA 3KPJA 5M5BA 1FJXA 4K6MA 2ZWVA 1G55A 3IV6A 4GOLD 1SVUA 2YXLA 3KQWA 3LBYA 5FTWA 4OBWA 3C0KA 4AZTA 2C7QA 9MHTA 2IH4A 3HCDA 5E9WA 5DM2A 5FHRA 5ICEA 2ADMA 2ZVJA 2FHPA 2YXEA 5CD1A 1WZNA 3SR4A 4EK9A 5B1SA 4H0NA 5FCDA 4KRGA 1RJDA 4PYQA 2FCAA 4OA5A 3GRRA 5EKUA 4RTNA 4PYMA 2OY0A 3EVFA 3FTFA 3KQOA 2PKWA 2NYUA 3P2KA 2EG5A 3BWMA 4ZTBA 4XUEA 1R8YA 4P58A 2NNWB 2JH9A 3ELDA 2EFJA 3THSA 2FK8A 3QOWA 4CKCA 2PX4A 5CVDA 5ICGA 3LPMA 2P40A 5ICCA 2JHAA 3P8ZA 1EIZA 1XJ5A 4HC4A 4PCAA 4WVLA 4C08A 4YUYA 5BW5A 10MHA 5K0LA 3GO4A 4IWNA 1SUIA 2O05A 3P71T 3DULA 3FPJA 5EOVA 4CKBA 3BWYA 1NW6A 4RWZA 1KR5A 4OQEA 4Z2YA 3NVKI 1FPQA 4CTKA 1G6Q1 2IH2A 1QANA 2GAFA 3LHDA 5LQNA 2HMYB 3X0DA 2NP7A 8MHTA 2FYTA 5KQSA 1KYWA 3HVKA 4ISCA 4O29A 3FPFA 5FULA 3SM3A 2ORED 3KR0A 2ERCA 1FBNA 1YB2A 2PXXA 5F2NA 1TW3A 4PYNA 1RI1A 3EMBA 4UOEA 2IPXA 1WG8A 4E33A 2UZ4A 2V7EA 5HEKA 3TRKA 2Z6QA 2IDJA 4M37A 1Q0TA 5LQCA 3ER8A 2DULA 3MTEA 3A25A 2PBFA 3T0IA 4EKGA 5EMMA 1JTFA 5DX0A 3CCFA 5LQUA 2AOXA 3BGVA 2GA9A 1TPYA 3G2PA 3OFKA 4LWOA 4DF3A 3KPYA 1X1AA 3G2QA 2PX2A 3TKAA 3UJCA 5DLYA 1UWVA 3L8DA 4BLVA 4WXHA 1BHJA 1DL5A 1VIDA 2UYOA 4X1OA 5DX8A 5DSTA 1V39A 1QAMA 3M6WA 3OZTA 4HGYA 1VE3A 1NW7A 1BKYA 3P2IA 2AOWA 1XXLA 3TR6A 3TLJA 3HA5A 4EQZA 1X1DA 3GWZA 5ICFA 2VDVE 3R0QA 3GNLA 1P1CA 4ER0A 3EEYA 2QYOA 5CVVA 1QAQA 5FWAA 5LSAA 3B3GA 2YX1A 3DXYA 2I6GA 2P35A 2PVCA 3OZRA 5K0CA 5LQJA 3KPVA 3HCEA 4U7PB 4DM3A 2C7PA 3GRYA 4C4AA 3V8VA 4GOMD 5F2KA 3HVJA 2WA2A 1IM8A 2PX5A 4XUDA 1UFKA 4AX8A 4R6XA 4R8RA 3DOUA 5DWQA 5FQNA 5K8VA 5D1NA 5LQRA 4MTLA 5HIJA 7MHTA 1L9KA 3FRHA 4M36A 3SSNA 2OPBA 3NWBA 5E1BA 3EGIA 2GH1A 2O07A 4GF5A 3HCAA 1AQIA 2AN4A 4MIKA 5DTMA 1UIRA 3BXOA 2ZIGA 1O9GA 2ZZKA 4RTLA 2QY6A 4PCLA 2ZBQA 3MB5A 4RTKA 4CWAA 1PRYA 1ZQ9A 3P9CA 3FTEA 3A26A 1KPHA 5K0NA 1NT2A 5C9ZA 1JTEA 2PXCA 3FTCA 1G60A 5DRTA 3QOXA 3GDHA 3E23A 3BZBA 3D2LA 5CVEA 4C05A 1ZG3A 2ZZNA 2FPOA 2H00A 4YUWA 3IYLW 2C7OA 3MCTA 3BGIA 3KHKA 3JWHA 5EKXA 3FYDA 3CVOA 3DXXA 1EG2A 3S68A 3M6VA 1X1BA 4JXJA 3I58A 3C3PA 3HA7A 2O57A 3UZUA 4L7VA 3B7PA 3GRUA 4E2XA 2LD4A 2G72A 3PS9A 3I9FA 1Z3CA 5FA5A 4GC5A 3KQQA 5K09A 4RTJA 5LQAA 1YUBA 3UJ8A 4P7FA 3LCCA 2HTEA 5DM0A 1NBHA 1R74A 4DMGA 3KPUA 1XTPA 2ZWAA 2A14A 3GIWA 3LKZA 4ER7A 2IBTA 3G5TA 1L3IA 5GM1A 1M0EA 2HNKA 2P7IA 3KU1A 5DSXA 3G2OA 5CUQA 2PWPA 3EGVA 1NW8A 4X63A 2PXAA 1SQGA 2BR5A 2Q41A 2AR0A 4PGGA 5DM4A 4PNEA 2EX4A 3CJQA 4QDKA 5HIKA 2CL5A 2ONZA 5EHGA 3SMQA 1YFLA 3OU2A 1X19A 2UYHA 2QRVA 3P2EA 4OX9Y 1VP9A 1XDZA 5EG5A 1I1NA 4P7GA 5EMJA 5EZQA 1PJZA 4XCXA 5GWXA 5GP1A 4F86A 1R6AA 1XDUA 3LDFA 2WA1A 3OFJA 4RV9A 1P91A 2VZ9A 3TFWA 2BR3A 3KQYA 3THRA 3UJDA 2P1DA 3LBFA 5DXJA 2AOVA 3O4FA 2ESRA 3UBTA 4R8SA 4FSDA 4RYLA 5C1IA 2IH5A 3Q87B 4E31A 1T43A 2H11A 3LCVB 2GS9A 4E2ZA 2BM8A 5EEHA 5EQJB 2AOUA 2I62A 4PWYA 4PONA 1SKMA 4E2WA 3G8BA 2R3SA 1QYRA 3NJRA 3OU6A 1JQEA 2PWYA 5FADA 3G8AA 5K03A 3E8SA 5E2BA 5KVAA 2PT6A 1DCTA 5IKMA 2P3LA 2XYVA 2NXJA 3GGDA 1I9GA 2G71A 2IP2A 3A7DA 3DP7A 3U81A 4R05A 2QRVB 5K05A 5U4XA 2BH2A 1IY9A 4PINA 3UFBA 1JG3A 3BKXA 3LECA 5HILA 2IDKA 3IHTA 4YUZA 2EJTA 3DLCA 1RI2A 4PYLA 3UA3A 2ZBPA 2VDWA 4KWCA 5K0FA 5EIWA 3O31A 3BGDA 1FP1D 4GC9A 3SVZA 4A6DA 4YV2A 3ELWA 2PLWA 5FA8A 4R6WA 5JR3A 2YVLA 1H1DA 1QAOA 5D1HA 3EVDA 3FPHA 3LDGA 5T6BA 2BR4A 4KDRA 3OE5A 3AWIA 3E05A 3O7WA 3ER9A 3G2MA 4PIPA 3ANXA 4KW7A 3EEOA 1VP3A 2AOUB 2PV0A 3F4KA 3R24A 4FZVA 5CVJA 3UJAA 4C07A 2JG3A 1R18A 1RI3A 2KW5A 3VC1A 5HOQA 2VDUE 1VPTA 3CC8A 4G56A 5F2OA 5T67A 1KPGA 3OU7A 3HCBA 3LKDA 3HP7A 5HIMA 4F85A 5HZMA 3VC2A 3EVBA 2I7CA 4RTRA 4QDJA 3UJ7A 2JHPA 3K0BA 5DX1A 4BP3A 3MCZA 1M6YA 3NDJA 2AN5A 4EVIA 4ER3A 3HTXA 3ELYA 1BOOA 2NXCA 2ZTHA 5EZSA 5FHQA 3NMUF 2OXTA 2ZW9A 4U7TB 3QV2A 1WS6A 4C04A 3I64A 4QPNA 3AXTA 2ZBRA 2XVAA 4PGHA 5EMKA 1N7JA 3TQSA 4GBED 4P7KA 1D2CA 1NW3A 1SQFA 3SSMA 5CCBA 3SX0A 2B9EA 4HRAA 5LQKA 4BY9E 2B78A 3WSTA 4BLUA 3PB3A 3HNRA 5EIFA 1EJ6A 4ATNA 5E1MA 1R00A 3BWBA 1ZKDA 3BWCA 5GM2A 3SSOA 2HR1A 3ME5A 3P9IA 4QVKA 1FP2A 5ERGB 4B17A 3TM5A 1YZ3A 3MHTA 2I9KA 2JHCA 2PJDA 2JH8A 3OE4A 5EC8A 4IKPA 1XCJA 5LR6A 2ZCJA 3JWJA 1KYZA 2PSSA 4GOOD 5FQOA 1TW2A 4FP9A 1ZHFA 5K0JA 3REOA 4AZSA 2FK7A 2PGXA 5BW4A 4ER5A 5K01A 3CGGA 1AQJA 3KKZA 3GU3A 1HMYA 4HTFA 1QZZA 1OR8A 3T7RA 1DUSA 3B5IA 4YMHA 4HSGA 5E8RA 1MHTA 2IFTA 4RTSA 3M6XA 1IXKA 2P3QA 3CJTA 4E70A 1XDSA 4FGZA 3B3JA 2G8NA 3GXOA 5E1DA 2BM9A 5HFJA 2OB2A 3FUWA 2B25A 1ORHA 1L3CA 4QTUB 2ZLBA 3V97A 1G38A 2YR0A 4DCMA 4YMGA 3BKWA 2QE6A 5E9JA 1INLA 2XYRA 2F8LA 5GINE 4RTQA 3HM2A 3DH0A 2G70A 3FTDA 3C3YA 4RVHA 2N47A 4RX1A 3G89A 3FUUA 3JWGA 4QQNA 3EVCA 2PX8A 3DTNA 3DXZA 1KXZA 4GEKA 3HCFA 3NTVA 2NP6A 1MJFA 1SG9A 4RTMA 4QTTB 2P41A 2OYRA 3LSTA 4CTJA 1JR4A 2IIPA 5E8JA 1G8SA 5KYGA 3G88A 3PFHA 4AZWA 2AOTA 4MQ4A 3MAGA 3OCJA 1EAMA 2YXDA 3CJRA 4OA8A 3DMHA 5GOZA 4DA4A 2C7RA 4AUKA 3PLAE 5EVJA 3A27A 4QPPA 2BZGA 4RVGA 4HTFB 4DQ0A 4LG1A 2P8JA 2ZFUA 3MQ2A 3FPGA 5EEGA 1YF3A 3R9XB 3DMFA 1RJGA 4BLWA 1YZHA 4LWPA 2Y1WA 3FRIA 3R3HA 5DPMA 3TMAA 1Q0SA 3AJDA 4FS8A 1M6EX 4M7RA 2OBFA 3TM4A 2AZTA 3K6RA 4NECA 5IH3A 5CIYA 2YQZA 1KP9A 2OKCA 1KHHA 2YTZA 3A4TA 3BUSA 1VBFA 3DUWA 3NDIA 2CKDA 5GIPE 5P8WA 4FT4A 3LDUA 2K4MA 3P9NA 4YUXA 1AF7A 1JSXA 1P1BA 4PIMA 5GIOE 3NVMB 2ZIEA 3EMDA 1ZGAA 4GOND 3OZSA 5C0OE 2CMGA 5K0EA 3RIEA 1X1CA 2ZZMA 5FWDA 2NXNA 3NW9A 1NV9A 3I53A 4HGZA 1D2GA 1RJEA 2IGTA 4KVZA 4QVGA 4RVDA 4Y2HA 2XBMA 1BC5A 3CBGA 4E30A 4CXMA 3H2BA 5EPEA 2Z6UA 1ZGJA 1G8AA 4YV1A 5FUBA 1JQDA 2Y1XA 2AOTB 3RODA 4E2YA 1JG4A 2VS1A 3FPEA 3TKYA 1XCLA 3GRZA 4Y30A 2ZSUA 3EVEA 2ZULA 5K0GA 3B89A 3JWIA 2AVDA 1EQAA 1O54A 5HIIA 2NXEA 5DTRA 5H02A 4PYJA 4X60A 5CM2Z 1I4WA 4BP1A 3Q7EA 3LGAA 5CVUA 2EJUA 2CWWA 3HVIA 5DRYA 5G02A 3TPZA 3EGEA 2IBSA 1WXXA 4V0QA 5DT2A 1JG1A 2O06A 4HH4A 1WY7A 2WK1A 2B2CA 3B3FA 4KIFA 3KQSA 3E7PA 1F3LA 4RTOA 3GJYA 5BP7A 4A6EA 4LECA 1Y8CA 5JUWA 2HV9A 3EVAA 3PT9A 1D2HA 4IV8A 4PYOA 1WXWA 3M70A 5DM1A 1JG2A 5DXAA 4POOA 4V0RA 3T7SA 1N2XA 2AVNA 3VSEA 3IEIA 4DKJA 2QM3A 4QQKA 2CMHA 4GUAA 5EGSA 2FRXA 3ERCA 3BT7A 3FUVA 2JJQA 3MTIA 5KS2A 3TOSA 4CKEA 3PTAA 2UYQA 3G7UA 4FSXA 3GCZA 3UJ6A 2GPYA 2V74B 4X41A 2H1RA 4KDCA 1SUSA 1ORIA 4PYIA 3M33A 4C06A 3FUXA 1AV6A 1F38A 4P7JA 5K0BA 4ER6A 2OZVA 1RJFA 3KQMA 4FR0A 5E9QA 3UA4A 3DR5A 1HNNA 2P7HA 3KQVA 4M38A 3KQPA 4IV0A 5KQRA 4MWZA 3HEMA 3ORHA 1YFJA 2O0LA 2PY6A 3RW9A 4OBXA 2GLUA 3HA3A 1VLMA 4AZVA 4F84A 4FT2A 3T7TA 2XYQA 2OB1A 3R6TA 3LL7A 1O9HA 3HVHA 2DPMA 3I5UA 3KR1A 3M4XA 1L1EA 3MERA 4YUVA 2AN3A 1XVAA 3EVGA 1L3BA 4HG2A 3C6KA 3FZGA 3P97A 2OO3A 3KQTA 4KIGA 3UJBA 1RI4A 1U2ZA 3CKKA 2ZIFA 1RI5A 4RSRA 4DZRA 3M6UA 4XUCA 2R6ZA
chains in the Genus database with same CATH superfamily
4TV9F 2WHPA 4CCYB 1M7HA 1I3NA 3OEYA 4L16A 4L4XA 2GJ8A 3UFXB 3H1FA 2FG7C 5D3ZA 4CIBA 3O2SB 4HLDA 1KEEB 2A30A 2FSUA 4GM1A 4WN9A 4B3HA 3FHCB 4DKXA 3P9KA 3CX4A 4YBZA 3WAKA 3LAWA 1WU7A 1Y8AA 5DTEA 5EIAA 3ZHOA 1GILA 3FD8A 3LP6A 1D7OA 3QWFA 4IFBA 4RVFA 4J1NA 3AXSA 3BGWA 3WIDA 4YECA 4MHTA 2EC5A 2ZJ8A 3LCUA 4BFSA 3NS7A 4ACBA 4DEYA 2ZGVA 1ESDA 1J23A 2R87A 3NOQA 4L50A 4XVUA 2YIDA 4YAFA 3ANNA 2NZYA 3WLMA 2IIQA 2Y6UA 1N6RA 1NIJA 2OR3A 3KOWA 3NBQA 4Y6QA 3T5GA 3JALA 1XX6A 3D59A 4LDQA 3Q85A 1DX9A 4TTPA 3IPXA 3EPPA 3AEXA 5G0WA 2YZ7A 4R2XA 2X9VA 3U6BA 4YPVA 2QD5A 3PJEA 2JLUA 1YRWA 3KPJA 3B6ZA 2REQA 4KH0A 5H83A 3CWCA 2ONKA 5DK6A 3V7YA 4DG5A 4JLNA 2BSQA 2AL7A 2ILVA 3O0TA 4B3XA 1UXHA 2X5JO 3B2EA 5CJPA 1Z15A 1UJBA 2FP3A 2YXEA 3JWPA 3LUJA 3BMXA 2OFPA 4BAUA 4JV5B 1KE2A 2D6FA 2ENUA 1BEEA 2MOKA 2D0IA 3A2KA 1P18A 4PYMA 4A8PA 3T3OA 3FTFA 1T5HX 2HA5A 2ZSIA 4LJ5A 4D80A 2XMGA 3ZHXA 4ZTBA 5ADWA 3R3XA 3UT6A 3PNPA 1PR2A 1VJ5A 2JH9A 3NZEA 4RS4A 4LHWA 4WZZA 1FYXA 3AIOA 5KPJA 5LDGA 1U11A 4OKSA 1CPYA 2HXGA 2JHAA 2VG8A 3P8ZA 3ZJ4A 1HTTA 5EOVA 3HL4A 3P2OA 5M34A 1IZ9A 1FYVA 1O4WA 1YT5A 2F1JA 1ZIOA 2OCLA 1O95A 2OV3A 3B20A 3IDOA 3KFVA 2XZPA 4KG7A 4OQEA 3EVTA 1FPQA 3ET4A 2H1CA 2I55A 4IY1A 4QXPA 4CTKA 4V0SA 5HF6A 1QF7A 3PC7A 4DMCA 3GQVA 4BNJA 4FYHA 2JFFA 4MGKR 1XNJA 3QBDA 4H0FA 1Y6JA 3G59A 2EDCA 2X14A 5EINA 3EBLA 4KX5A 4BUZA 4W6QA 4XRRA 1AC5A 5CPBA 1S2OA 3N28A 1USKA 4DDKA 4D41A 2GJAA 3QFCA 3DL7A 1Y5IA 1GQOA 1S7CA 4YJFA 1JFFA 3NIDB 1QBGA 3QX7A 4E33A 4L3WA 3E5RA 4YMVA 1TB4A 2NUBA 2H4JA 5IUJC 4B3FX 4R3NA 4PLHA 5G2OA 3ZIAA 2HT6A 1CQZA 4ITUA 1CJUC 3AIMA 2XDQA 3R5JA 4JDUA 2IYAA 1NVKA 3BB3A 3ZDDA 1CVLA 3BF7A 1Z4KA 4BLVA 4WECA 3ZU5A 1BHJA 4C0SA 5L6MB 3HJRA 1K5HA 3ZHVA 4XM0A 1W0CA 1G6KA 2W22A 4GLOA 1K4MA 5DSTA 1KQOA 4UM9B 2B94A 2ASEA 4MR7A 5AVSA 1C50A 4RV5A 3B6JA 3KJEA 1X9HA 2AOWA 4JIGA 4UBNA 2OQVA 4CUJA 4HLUC 3ZJ5A 2Q1SA 1HEYA 1WA5A 2QOEA 1X1DA 1RYBA 2CF5A 3ETLA 3K8YA 2CEKA 3EEYA 1B74A 3ZVNA 1G5QA 2O1XA 4PO1A 1GCIA 3LUPA 5AJTA 2ZR7A 2JAPA 4KHPB 1ZC1A 2JJ2A 3DXYA 4D0LB 2P35A 3PFNA 4MVJE 4RA9A 4UBKA 3U4HA 3N07A 2GXUA 2QQGA 3ZQ4A 3F6YA 4X5OA 3V8VA 3M5CA 2E4XA 1ZHHA 2OK8A 3ODPA 1OU0A 4IUBS 4FYIA 2XF2A 2YZNA 3B1WA 5FPTA 1AQYA 1ESCA 1LDYA 1K68A 2GJ4A 3HP1A 4L8YA 2QUKA 2DR3A 4JJ7A 4ZVSA 5A03A 3AVQA 5D1NA 4YMLA 2WINI 2AFHA 2BMWA 4K46A 2Z8YA 4M1ZA 1Y34E 3EJ6A 4FFDA 1Q12A 1YWGO 2JK1A 4OPMA 3ZWQA 5ECDA 4ZCMA 3LLVA 5E4TA 4Y18A 3FX2A 4LY9A 3ORSA 2FA9A 1KEZA 1UDCA 5LXTA 1Z82A 5DVZA 1UZAA 2B36A 3H5LA 5LLSA 2XB8A 3BEDA 3FBTA 4G5SA 5EI5A 3R23A 1BD4A 4CF4A 2QVYX 3KTAB 1U02A 1G6HA 2J5XA 2NQ2C 5K8UA 3EXG2 1K89A 1KPHA 4B80A 3VI3B 2WWWA 4NZ9A 2VCYA 2J7PD 2VQDA 4KR3A 4GMFA 1COWD 2UDPA 3OEEA 1K6EA 3RU7A 1WHTA 2FPOA 5EGNA 3BN3A 3BICA 3ENZA 3H11A 5JO9A 3JAMA 3F98A 2NU9B 1XIVA 3QPCA 2R85A 2HU8A 4TTJA 3UJ3X 1T3TA 2D3TA 3A6JA 1GPLA 3KJNA 4L1KA 2C95A 1EE9A 3V2HA 5KZMB 3IX7A 3MBIA 4RA6B 5EE9A 2DMRA 2UYGA 3G68A 1JEQA 5GJWC 3UZUA 5IHPA 3GRUA 3HYSA 4KQWA 3W5IA 5I7RA 5HS6A 3I9FA 1EK1A 3X2SA 4E1BA 2FXIA 4BECA 4QJ3A 2F55A 3KQQA 4CQLA 5HQ3B 3OAAA 3E8MA 4JEMA 4Z9AA 3C7TA 4IPTA 4MRAA 4QOSA 3CRW1 3QHPA 4JP5A 2XNSA 5DM0A 1KEKA 4RENA 4K5QA 1VTKA 1LNZA 3KPUA 5AK3A 3QBEA 3KLOA 1BDHA 3WZMA 5AW6A 3N6RA 1MC1A 1SXGA 2J9FB 5T7BA 2I4IA 4UHJA 1M1NB 2WUDA 4ZOLB 2JJ1A 3L93A 1UKZA 2IEAA 3DFZA 4M55A 4TMKA 1UQRA 1DCMA 3NWJA 1UBSB 1VOTA 2Q41A 1WUIS 4U39A 1ZLXA 5DM4A 4EJFA 4NU8X 3KUDA 5CT8A 3IERA 3CLHA 1V5WA 1FX0B 3KIPA 5F12A 5FUYA 4Q9DA 3BFPA 4GPD1 3H4TA 5HMLA 3ONFA 5A3QA 3PEFA 1G64A 2VNJA 3E3AA 5EMJA 4BOYA 5K0TA 4LYYA 3EJWA 4ZYWA 3KQKA 1XDUA 3OFJA 3WJAA 1M2KA 4ARCA 3DKIA 3D3NA 3OO0A 4MR8B 5HTKA 4L4YA 5JH7B 5KWSA 3E22B 2ATXA 4YB8A 1DOZA 5DXJA 2FH5B 2I6QA 2RHMA 4NBLA 4RELA 1PX0A 4WOKA 3X3HA 1J25A 2YCBA 1I24A 3PYXA 1NU8A 3NHJA 4FSDA 2XMDA 4PZLA 3F6PA 1PBTA 2CLFB 2FPLA 5T6MA 4EARA 5EEHA 1XCBA 4HDCA 6CHYA 4RQAA 4EB6A 4E2WA 3E9MA 3IUSA 3FJ1A 2AG0A 1J21A 3NJRA 2BM0A 4U0JA 4YRJA 3QSYA 2BGIA 3DFFA 2FW8A 5BPHA 1XDWA 2ZUBA 1KJQA 2I3AA 3BJRA 1PEDA 2PSJA 5HFAA 2HO4A 5AVJA 4D81A 2Q2OA 2PWAA 1E1CB 1ULAA 5B6IA 4WV3A 4U7DA 1LNSA 5TX7A 1OTHA 4BLTA 1JVNA 2XODA 1GZHB 4MV3A 3RVBA 2VHYA 1KA9H 1ODCA 1HSOA 4IMRA 2XOKA 3BJZA 5HPYB 1VIVA 2FN9A 4URHA 1FP1D 4CN9A 4Y9TA 4A6DA 1B8PA 4JI3B 3AOGA 4KGZA 5D1HA 1UJCA 3S7ZA 4EY5A 4AW9A 2BR4A 2PEZA 1AK1A 2FZ4A 4FE3A 3ER9A 3L1KA 1JBEA 1NBME 4EMBA 3BRSA 4DGSA 1WOYA 3MM4A 3F4KA 4FZVA 4S1TA 5THQA 1X38A 1L7MA 2C29D 5DM70 5KQPA 1WU8A 2VDUE 3QJGA 5HXAA 5J63A 4PTZA 3HCBA 4ZGBA 5IVKA 2YVUA 3DDOA 1TVCA 2PL3A 4LZOA 2PLAA 4RHUA 3D2BA 4QDZA 1JBKA 1T1IA 1V16B 4BIIA 4Q3CA 1K7EB 3BRWA 1K6XA 2MHCA 4BE9A 3I04M 3PQ6A 4BTVA 3SEFA 5C5CA 4I7EA 5FTKA 5CYPA 3IAXA 2NXCA 2YJZA 2Q2NA 1ZNQO 4CU2A 2ZI6A 1HZJA 1R4MB 3B1KA 1RZ3A 1KJZA 4IDDA 5HCNA 1MENA 1NI5A 3SK0A 1G7RA 4FQ8A 1FRNA 3O74A 3IFSA 1MVNA 2BE7A 1Z5VA 2HNAA 4HTAA 5CTJA 5LJLA 2R1TB 5LQKA 3L06A 5CD9A 1TYCA 4CZ2A 1ZW1A 4CMKA 3OI7A 4JYAB 2I65A 4QD3A 3I2GA 3BWBA 1P7PA 4H60A 1WV0A 2KM1A 3W4IA 4L74A 2RC6A 3GVPA 3IT3A 1D2MA 1QB8A 4YACA 3ZWWA 3O9MA 2IU4A 3RT7A 1ZHOA 1X7ZB 2FQWA 1IY1A 2C97A 4FBLA 3ZY3A 2O3RA 1OAOC 1ZL0A 4IICA 3ESXA 3FHOA 1C4OA 4IXMA 4JU9A 4IDNA 1T4DA 4I1RA 4B9EA 4H1UA 4GPEA 5JJ5A 2PSSA 5C4GB 4WT7A 3GK3A 1RM0A 3ZGLA 4R2WA 1B0PA 2CNDA 1PQUA 1XA4A 2A9JA 1W76A 3ZOKA 3ZVKA 2BKLA 3VC7A 1GG8A 3JZMA 2EOAA 3CWZA 1OR8A 4MQBA 2I7TA 2DY1A 3GUVA 3KSBC 2ZWMA 3EC1A 4TWIA 4FGZA 1DJQA 2G8NA 1RQNA 1NN5A 5F35A 3U4GA 4MDEA 3UUGA 5G4KB 2PRKA 1X7WB 3FUWA 1V5IA 3V97A 4BHTA 1J7JA 2ZPUA 1Y4UA 3FPLA 3E2MA 1W7AA 2QL7A 2HRQA 1Y3HA 3OIFA 4NIMA 4BRSA 4EL0A 5CCEA 3P7MA 3RVSA 2HCFA 3QPAA 4N6OA 4EB3A 3EC7A 3KEFA 3AEQA 3EZFA 3KD2A 4KNWA 3QTTA 4I1SA 2O8EA 4AROA 5HUJA 4H6VA 4R01A 4EY8A 1DLIA 1NONA 3L7BA 3V48A 1G8SA 3R9WA 2P5SA 5HE8A 3FNIA 1M5UA 1MV8A 2FSVC 2VAVA 3AF1A 4OAPA 2A0UA 2HIHA 3TSAA 4AZWA 5CDTA 2IYSA 3TRHA 2B69A 3CJRA 4XQGA 3RBXA 1BMQA 1E2JA 3ZWCA 4RVGA 4EFMA 4BRZA 4XR9A 3LLSA 3V2UA 2HJHA 1C4KA 3O3NB 1N3IA 3REQB 5J9FA 3RADC 3W2EA 3DLHA 3R3HA 3FYUA 1R10A 3GLFA 3ZCQA 4D8WA 1ZKMA 3KKOA 3DWFA 3EIFA 1QTNA 4PX2A 2H1LA 5IVIA 3ZH9B 3EISA 4PZZA 621PA 1SA0B 3H87A 5CH8A 4ZQBA 5IZCC 1P62B 1NMQA 2VQ6A 5I7VA 1RKXA 1XZHA 1CUJA 5DW3A 2JLRA 4PPYA 1NNUA 2Q6IA 3TZHA 1J39A 3A58B 1JXAA 5FWDA 1NFQA 3PCXA 4BFZA 5C8ZA 1J5PA 4QVGA 1R5NA 3DDCA 2J0QA 3JSXA 1D6NA 2YQ5A 5HBGA 4BPRA 3RIHA 1OYYA 2RBGA 4W9NC 3KQHA 1G3RA 5BSKA 2V3CC 2VS1A 2BGKA 4L9RA 1HMPA 3L82B 4MV9A 1GU7A 3A1FA 2A9PA 1K8ZB 3QEMB 4XIJA 5BR7A 1QSGA 5JMWA 3VTKA 2EZTA 4IKOA 9LDBA 2CVZA 2N1BA 3PR3A 4QT0A 3TPFA 3DHNA 4OQYA 4BP1A 3K9CA 4WCDA 3GG2A 5FL7D 1XZJA 3ZJUA 3RU2A 2W48A 1P0IA 3EQ2A 4V0QA 5DT2A 4YJ3B 5FTJA 1YSCA 4Q4LA 1M67A 1N3LA 2J6CA 4HGPA 4KL8S 2J0UA 2QGZA 3R41A 3I73A 1NE7A 1D2HA 3QVKA 3M70A 2ZITA 4WBSA 1JZTA 4CTMA 5JNVA 2RDMA 1CF2O 2X0KA 4XD2A 3SQMA 2DSNA 3VSEA 5JVDF 4JNKA 1XN4A 1U3CA 4K6OA 3HNOA 1IIBA 1CZHA 3UJHA 3ZDYB 5IMSA 5HKOA 3BT7A 1WB5A 1XL0A 3KUCA 4ZHQF 4C0QC 4FFRA 3DDUA 4Y0AA 2XT0A 2JLQA 2QQ0A 1PR0A 4ZZ3A 3FCYA 3PGJA 2PMCA 1SCQA 5JZMA 5JY6A 3WHPA 4ETIA 1SELA 1NF3A 4PEVA 4UEOA 3WR5A 3MB8A 4D46A 4ZQFA 2YHUA 1E9AA 1NDQA 1O77A 3ANYB 2IZZA 1GU1A 3GLHB 4Y6GB 5EY5B 4B4WA 4PNHA 2WJVA 2LPMA 1G7SA 1Z16A 3ADPA 3AL2A 4KUHA 4RWEA 2QN1A 4G4SO 4HGQA 3E3OA 1EA5A 2CUTA 3HVHA 1JT9A 2DUJA 1GSIA 1CQPA 1N8SA 1HEIA 1G21B 1PP4A 3A2LA 1Z0AA 2WJAA 4AY2A 4HNVA 1P3Y1 3KAQA 1RXYA 1F1BA 1V5EA 2AF3C 2FRDA 2QN9A 2WVGA 3BQMB 3G85A 4JWKA 2JEYA 4PZPA 4AM8A 2LRHA 3H84A 3M0EA 1GLGA 1U2ZA 2O0HA 1R8JA 3MA0A 3Q40A 3OIGA 5C52B 3F6BX 2GSWA 3IE2A 3PE4A 2QJFA 4HNSA 4PG7A 5J5VA 4YV0A 2K7ZA 3GZNB 2ZBUA 3O90A 1JSRA 1DO8A 2X0JA 2Z2IA 4NEQA 3C6QA 4TMXA 1ML3A 3U40A 1Z8NA 4BQOA 4EMSA 2G1PA 2Y0CA 1Z0ZA 2NTYC 2ZCUA 2H8KA 4EUNA 2NACA 4V1CB 1I6LA 2XOXA 3R9XA 4II3A 3WB0A 2VOEA 1C9EA 3IAUA 5CLJA 2ZU0C 3AERB 1D4OA 3B7WA 4PHGA 4AF6A 4CDMA 1A9XA 3K4PA 4R7GA 3EVNA 5J5CA 3AT1A 4A1OA 4JUBA 1OPRA 4HZUA 2J41A 4X20A 4UUMA 2OXCA 4O4LF 5MF6A 3MGGA 4WX2B 4LF4B 3IOYA 1IDN1 4GKBA 4PQGA 5JSFA 5IKXA 1KPIA 3PD0A 2UYCA 4YWJA 1B3RA 2RKWA 1Q91A 3B1JA 3RSLA 4WASA 2QVZX 3H8JA 3OTIA 1RFGE 3FMIA 4QGGA 3CEHA 1L4HA 5ITZA 1PVVA 4U2BA 3O21A 2I0FA 4NS4A 4KO8A 2FX3A 4N8SA 5CW2A 3MJ4A 4RXTA 5FRDA 2R1ZA 5JFGA 3K8OE 3CW2A 2VK1A 3EHEA 1J90A 5CW1A 3AVTA 4MGHA 1GCAA 1ZH4A 1CJBA 3AY0A 1C8LA 1EJ0A 2PZAA 1SXIA 2OXFA 4GQAA 1UJ6A 3AVOA 4K6MA 4GOLD 2XB6A 5ALFA 3V4SA 1FJXA 1FSFA 2HLDD 4OLJA 4UJ5A 5IN5A 3DE7X 1W59A 1GTG1 1LQUA 3ISVA 1M8JA 3TZBA 1CY8A 2BWJA 1XNRB 1LK7A 3SYNA 4KP7A 2CDCA 4PE5B 1RFLA 5FCDA 3ZVRA 4KRGA 5LOVA 2C4NA 1FFYA 1TOAA 1IN1A 4BEJA 2Q6OA 4RBNA 3P2KA 1V26A 3CBQA 3UTDA 4ENUA 1MT3A 2Y4NA 1C1XA 3D8HA 3FKQA 4NJEB 4OLFA 1I7PA 1XZEA 1ZN9A 3LRTA 3G5MA 3GBPA 1E98A 5F33A 4JR2A 1DP4A 3PQ3A 5LCXA 3WYGA 2MINB 2E48A 3TW6A 1U8UA 2PUVA 4EECA 2YW9A 3MCUA 1Y8QA 3NIWA 2C20A 3IBTA 3D7RA 4XFKA 3P71T 4GG1A 4P3NA 1MAUA 2AWOA 3EW9A 4M1YA 3MWYW 4JKYA 3WG9A 2CNOA 2WVAA 1W96A 1JA0A 1MX3A 3LHDA 4CHGA 4D9FA 3MLAA 1FJGB 3VV2A 4F6LA 3KWMA 4JI0B 5FBQB 3DHWC 3X0DA 3QU5A 1OT5A 2A0YA 3AKCA 1GQ2A 2ZYDA 5KNLA 2ZE7A 5FULA 2XA1A 4N7BA 1JEDA 3T06B 4M1TA 1TT5A 4H16A 4MQFB 4EFLA 4M1OA 1S1MA 4M9SA 3X1DA 1SO8A 1OUMA 1UJ4A 2IPXA 2W8BA 2XVXA 3GMSA 3RFVA 1NA5A 4QWMA 5HEKA 2WUVA 2Q1TA 4NE7A 4OUDB 4KE9A 1T8RA 3O2JA 2XMPA 1N7HA 1V1MA 1SD1A 2DWCA 2VJCA 2Y68A 3E0XA 2AOXA 1TF2A 2OGTA 3H99A 3IOEA 4IVRA 4Q93A 4D43A 1GD1O 2W2QA 4OGKA 1KMIY 4MP8A 1O96B 4AN1A 5IJXA 3F3MA 2YJ5A 3HZOA 1QO9A 3DXFA 3KOUA 5JTUA 3IQFA 4XB2A 3H9JA 5LPNA 4WXHA 3L8HA 1W4RA 5FFMA 4E51A 1GN9A 4KPGA 2DWPA 4DV7B 3E4DA 4RPHA 1Q1ZA 3VJRA 4IIDA 3I9NA 1O08A 3I2FA 3U4IA 2HJSA 5BWLA 5IWAB 1EFAA 1P1CA 2V6GA 3GLGB 3C6ZA 4ROTA 3LC7O 4BL5A 1VM6A 1KU0A 4BNWA 3COWA 5K4GA 3NBYC 4AMUA 4DUZB 1GNSA 1QO0A 4QGBA 4ZAYA 1JJBA 2WYUA 2D2EA 3R7BA 3WB9A 5T3YA 3A2NA 3LUHA 1ZXBA 4O63O 3QELB 4B4OA 3CNNA 2PX5A 3N2KA 3QBVA 2CVFA 3MCAA 2HOQA 4O3FA 3SI7A 4G85A 5J3JA 5IBCA 4FOLA 2YZGA 4AUEA 4LYGA 4BEBA 2OO5C 2BEVB 2J6HA 2PZKA 2QU8A 4LVUA 3SKXA 3N0VA 3WDLA 4BNZA 5EHXA 1DIAA 1ORDA 1XCOA 3KJFA 2ZG6A 5AJZA 5B5SA 1C9KA 5AVVA 3BGOS 1AQIA 4DIMA 3BDVA 4BQSA 2F9FA 2DQKA 1TK3A 3T5DA 2H59A 4A5SA 3MB5A 1GA1A 1PGPA 3EGCA 2V7QA 3ICWA 3Q1KA 2Y1CA 2BLLA 3W5AA 1FJ2A 1PGJA 1YE3A 5SY6A 1X1SA 3IR7A 3G0IA 3OQIB 3GVXA 4MV7A 2G9QA 1R4ZA 5ALVA 3NX4A 3SCZA 5AI9A 1WUYA 1TMYA 2HSEA 1ZC4A 4TWBA 4V38A 2R65A 1Z6ZA 2K2QB 4GGMX 4R7TA 4XX0A 2I4OA 1YHYA 2HF9A 3WIVA 4B6SA 1JZSA 5AESA 3VPSA 3VKUA 1TJ3A 4CF5A 4A3SA 1ISSA 2IE8A 2VPXA 4UVIA 4CEIB 2ZYGA 1FIUA 2Y3IA 1Z7YA 2MU1A 4ZO9A 4D6XA 1VG8A 3LCCA 2YYAA 3BREA 2ODPA 3CXRA 2R4QA 3E9RA 1R74A 1WZIA 2ABWA 5DGCA 2W6CX 4MUNA 5FOXA 3TZKA 2RGNC 4JNCA 1XRRA 4OQLA 4R31A 1KDTA 2QTBA 3UG6A 3VR0A 5DSXA 3W5SA 1M0EA 1Z5UA 5CT6A 2CHGA 4LHXA 1GCUA 4DV3B 2CNWA 3AG6A 3EIXA 2UZ3A 1AUQA 2OPHA 1LSUA 3FKSA 3WLRA 1JQ5A 3TCXB 4F9TA 2EX4A 4ICIA 3CJQA 1EX6A 3FVRA 2XECA 4OP2A 4TKLA 3L7AA 2Q2QA 1KEVA 3ZWPA 3GJTA 5LBTA 2WAMA 4FNAA 2A9VA 1A2QA 3NT5A 1F2UA 5FPHA 5TR9A 3E2IA 3KFXA 2YNMD 4X54A 1VHQA 2F9LA 3HG7A 1A97A 3ZEIA 3HABA 1P60A 2G28A 4DNQA 2IWHA 2AJDA 5H3HA 1SXPA 4EZEA 3GHHA 1PS8A 5JNSA 2VJKA 2AIRA 3DBHB 3LXUX 4KXFB 4PPQA 1IMJA 4INPA 5KX5A 1TZBA 4V3BA 4TTSA 2XZDA 2ZDGA 1P45A 2Q8QA 4HXFB 5CEJA 3Q87B 4XGIA 2OG2A 1OXKB 3MLEA 4GXNA 4UC4A 1FRFS 1XLWA 3EQZA 4IJ6A 5LLTA 5D6XA 8LDHA 1HLPA 5GV7A 3HB5X 4MHSA 2YHBA 5JLJA 2X58A 2PDAA 3AUAA 4I6GA 2AG1A 2OHGA 5CNIA 1A3CA 2Q07A 3FDXA 3S2YA 4WW0A 2CYCA 2ZYVX 2PT6A 5C3UA 3SX4A 2H4ZA 3WWDA 4UCXA 5JU6A 2VWGA 1U80A 1I9GA 2QAIA 5C7IO 3FR8A 5LXTF 1S3FA 1JR6A 1DDIA 4PO8A 3HV0A 3M3HA 3RSQA 5JSYA 5LMCA 1U7HA 3WOVA 1M8PA 1RIIA 3ETCA 2ZIXA 3PL5A 3PICA 4G36A 4JEUA 1KS2A 3C3BA 4GIBA 2D2VA 4RFSA 3CKLA 4IYJA 2O2XA 4WLOA 2ZXFA 2C7BA 3PDJA 3LUGA 2YQ4A 2XE7A 4HEA6 4NU5A 4WA7A 3ECAA 3IPCA 3PQDA 3L8CA 4H3KB 2FUCA 3UB4A 1X3LA 2ECPA 4XI9A 2QMEA 2WAAA 1GL9B 1VSBA 2JIOA 2R68A 3O7WA 4G1MB 5HBRA 4DMHA 5BSEA 2BFMA 3VTAA 1JT2A 1QCCA 1E63A 1Z5GA 1SBCA 3A9TA 2BEKA 2AOUB 3KXLA 4KW7A 2FVYA 4O4HF 4ZXFA 2GN1A 1VA4A 2NO7A 4PXSA 4HLUA 3EPJA 1XU9A 421PA 1NUPA 3QMVA 1IHPA 4RK5A 1R3UA 3MAJA 5I5EA 4F04A 3ENKA 3G13A 7AT1A 5HKLA 1NSFA 4OXYA 5FORA 1F4PA 5LMNB 5ERYA 2BUAA 4YRAA 1P9NA 4Q3BA 3KZNA 3BGSA 4RY9A 1F8UA 3TL2A 1NNEA 3BQBA 1DQNA 1XF1A 5EIOA 1A77A 1WXIA 5EZSA 4BVKA 3F0TA 5KNBH 2PCJA 1S96A 1YGYA 1T10A 1I3CA 4UD2A 1RU3A 2X6QA 3A6KA 2FCRA 4IXNA 4P0QB 1CEEA 4HWOA 4V0LA 1CDOA 3WXMA 4DPKA 1WL8A 3GY0A 4QELA 1ZA2A 1EE2A 2EGHA 2VHQA 3DR3A 3FZYA 2GDJA 4BWGA 3DCNA 1X70A 3WK4A 1I1QB 1W73A 3TTVA 2JFZA 3AZQA 3IMFA 4KX3A 3EZGA 4TLDA 5EJ7A 1WD7A 3KOOA 4YRLA 3ROQA 1UDRA 2J1LA 2YJTD 3A1NA 5GM2A 5ITWA 4JQSA 1ZQ1A 1SVLA 2V7UA 5L40A 2XKJE 3JRXA 3O3CA 4QVKA 4WBNA 1JECA 3LT4A 1ABFA 4B17A 4BZQA 1LF0A 5LDDC 4F46A 2I1VB 4QOEA 1ECPA 1MOZA 1CC1S 1WKBA 2BLNA 2K5UA 5IG2A 3U56A 4P0PB 4GEGA 3GQBA 3EDQA 5JG7A 3UAYA 1QK5A 4GI3A 4S0ZA 1UK8A 2CBZA 3JD1A 1NVDA 2X22A 1DZ3A 3U62A 3PDUA 3PZBA 3RV3A 2UUCB 3TB4A 2RGCA 2W2VA 2J5QA 1KI6B 2GA8A 3JD2A 4HP8A 3JZAA 4GR5A 4KQKA 5EMHA 1XPUA 1KU6A 2J85A 1RXWA 4MOWA 1ZNXA 2WPDD 1FXWF 4TXNA 3BF8A 3WNDA 4DCNA 4KNYA 4E70A 1QJ4A 4GT1A 2DRIA 3SKVA 2EFGA 1EFVB 3TLYA 4G4SP 4X24A 1E6WA 2YR0A 4FLMA 5AJYA 2YZ2A 4MKZA 1PT5A 1A04A 1E9VA 4OQXA 1QO7A 2X3UA 1E2IA 5JCXA 5J4LA 4H1WA 1N2CE 2YRWA 1MTOA 3HM2A 1T9GR 4MS3B 4DLTA 4O3MA 1T3GA 3LBIA 3OJ0A 4RVHA 4Y2RA 4BFCA 3WAGA 2GMWA 2VWHA 5I8PA 4AXBA 1UXOA 1Y33E 4H7JA 1RLUA 4N0QA 2B8WA 3B78A 4ZGGA 3QE0A 2YXBA 4HX5A 2UZ1B 4WFQA 5IZCA 3H18A 3B82A 3C5CA 5E8JA 4AJJA 5AIBA 1U2TA 3W3AH 3G88A 1FFSA 2EFDB 2GO1A 2HBRA 1T36B 2NT3A 3PFHA 4Q3DA 1MNQA 3KTFA 3SYTA 4XGQA 4B6GA 1AU9A 4FYVA 4FWBA 5K4HA 1FMFA 4LOKA 3PQCA 4OA8A 2WF7A 1OE0A 3DPUA 1CZNA 3QVVA 4X94A 4IIGA 3WX0A 4QREA 2EXXA 5BYKA 4BNHA 5IT0A 4AS1A 1XMSA 1Y6GA 2JBHA 3TIVA 2R7MA 1L7VC 2Q5FA 5JEEA 3HM9A 1V3VA 2JVKA 4L2IA 2HXSA 3AL3A 5ALPA 1E2PA 1QRDA 1YZHA 3CRVA 1N6PA 4LS3A 1IHOA 5ILOA 5HRUA 4NPCA 1LZKA 4U3JA 5KREA 1UBGA 4D74A 2VA9A 5F21A 4BDSA 1TZJA 2X0IA 2WKWA 4PGAA 1XALA 2GF2A 1I4TD 1V1JA 4KODA 2D0DA 1ZAKA 4BCCA 1MJHA 4OXRA 5FYQA 2HA0A 4R1UA 4ZCQA 3CNEA 2WYIA 3JCZA 3WJ1A 5BSTA 1WDLA 1TKBA 4KVZA 2I6XA 4MIYA 4L08A 3S99A 1N4AA 1SRRA 1IY8A 4ZVKA 2JNWA 5KNBA 1DC5A 1G3QA 3EZYA 1PI3A 3BQ9A 1H4SA 4YRSA 3GBVA 2W4QA 4NMXB 3GUUA 4C14A 5G1PA 4RDXA 1PEYA 3IPAA 1DQSA 1QCDA 2HWXA 5CM2Z 4I2NA 4I9FA 2CWWA 5D6WA 1IN4A 1XEWX 3PNBA 3VPXA 3S1AB 1ZJYA 2AD5A 3NHLA 1QJCA 3JASA 1FX1A 1NL3A 1UBUS 1FRZA 1TJYA 2PGDA 1ZH0A 1L5OA 4DCSA 1CUWA 1QRTA 1T9BA 3PNMA 2FMTA 3WFIA 1FYFA 2GTHA 4KIWA 1GLVA 2QMYA 1F4VA 4M9UA 1EYZA 2KSQA 3DOOA 3PHBE 2XGJA 1I5OA 4MITA 3IIJA 5JWRA 3FDFA 5I9IA 1GV1A 1EWYA 2VHXA 3ACDA 3QPVA 4IJMA 4ITRC 2I7VA 3H3XA 3WL8A 4TZKA 5EGSA 4IHJA 3A3YA 1Y6RA 1YA4A 3OX1A 4KBFA 1CS0B 3P4XA 4G8BA 5TC4A 3KQLA 2UXCB 4NZNA 2GSDA 2HREA 1QDEA 3KWFA 3NV7A 4XJTA 5I4IA 4AO7A 1SUSA 1DJMA 3MELA 8OHMA 5CA1F 4PYIA 1M73E 5ELXA 3NEPX 2VJMB 1Z9BA 1I51A 3O9VA 1XZGA 1T8YA 1BJTA 3DR5A 1D5WA 3KQVA 3UA4A 4HDNB 3A9SA 4TZ6A 2ZKLA 1CNEA 2F17A 4GZMA 1FSGA 4HDRB 4ND8B 4F5WA 1YZGA 1DVRA 5FOVA 3HYRA 2HU2A 3E27A 4FT2A 2PZLA 1TC1A 1VLJA 5TS3A 1DMRA 1P77A 1FFAA 1QK4A 1H2WA 1NXPA 3MERA 3DV0A 5E7IA 3RK0A 3D2CA 3ZD8A 4GSKA 5D3MA 4GMHA 3AY3A 5A4AA 1YDFA 2J32A 5MN4A 1T3HA 2OO3A 2Z83A 4BLOA 1E9RA 3AYZB 1WD5A 3W3AA 5LP6C 3RHZA 2N9UA 2CCKA 2HH9A 4ZRDA 3WRXC 2P30A 1OAOA 3NGXA 1JH8A 4IDCA 3AW8A 3E35A 4H27A 3T0FA 1QHGA 4LY3A 4CKEB 1YNSA 4YS6A 1O95D 5DBHX 1I3LA 1QGYA 2QN2A 5JXIA 3M4YA 2GD2A 4G5XA 1L4FA 4B85A 4GXRA 1B93A 4EIWA 3UTCA 1NY5A 2I6SA 2XMRA 5JFTA 1FB5A 2YXNA 5AR1A 3G1TA 1KC3A 4WK4B 4FHZA 1F0KA 2A5JA 4DHEA 4PAQA 5K45A 4U2FA 1E8NA 3SGLA 4GQBA 1NVXQ 1ONPA 5EPUA 4DCGA 5EJ5A 2OHIA 1VCNA 1ZJZA 1G5IA 4IJQA 3CH6A 1GFZA 5DYGA 4TL6A 3UWMA 3NWEA 4HBZA 4YX9A 4JVSB 3ZY4A 3PUVA 3GJXC 1NC3A 2C96A 2WNSA 1B42A 2FQYA 1U98A 1RXUA 2SKDA 1CERA 1NBEA 1R8XA 3MWKA 4IHAA 2R00C 3I1JA 4UATA 1E32A 1ZL2A 4C2UA 5L51A 3LBNA 4PQFA 1IM2A 3FLAA 4JFAA 1WP4A 4LBVA 4UHKA 4Y1GA 4H17A 1ZX1A 4FYMA 2KLHA 3DVQX 1GL6A 2CLDX 2WF5A 2BH2A 1Z2PX 4E2ZA 1L5MA 5BQFA 5EHZA 1V47A 4JSRA 2DQYA 1TD1A 2VLIA 4BJ6A 2PAFA 3F96A 5E9WA 5DM2A 3TLKA 1CY6A 4PZAA 2CUKA 1U1CA 1YBVA 1OFGA 2XCUA 1UPXA 1U3UA 2PR7A 5TVGA 4D4IA 3K0SA 2VT3A 4JL8A 2XITA 4RY8A 1FUUA 4RZHA 3R9IA 1O97D 2L2QA 5T4HA 3U6KA 4E3WA 1EVKA 2JJ2D 3D31A 1OYVA 2O1SA 1XKXA 3D3WA 1JSCA 1XVTA 3CNQS 1ENPA 1LJUA 1Q0ZA 2V3VA 3L18A 3PIDA 4QQFA 5EYPA 2NZXA 3BDAA 5U4QA 1LC0A 1C9DB 2Q1XA 1PYDA 1K08A 1P61B 1HQDA 3D7SA 3D0QA 3KB2A 4MQEB 3SJ7A 1O89A 1XJ5A 2KJQA 2SKCA 4IR7A 5AKKA 3E1KA 2X5NA 5K0LA 4EA8A 4CKBA 3LHIA 1M6WA 3B3AA 2EF0A 3KJXA 1X7DA 2R6R1 3Q11A 4TGLA 4RWZA 2LUOA 1D03A 2CLCX 3U4DA 2PE5A 2DWQA 3RYHA 5I7EA 2O8CB 4H35A 5AW8A 1RC0A 1KVTA 4D4KA 1TA9A 2NP7A 1OF1A 4N8DA 4W9NA 2JIQA 1N0IA 4RD2A 4FI3C 1E20A 4B3BA 1J9GA 1KYWA 4YAKA 1CD5A 5J47A 4EA7A 1DC4A 1ULTA 2PUTA 1Q0UA 1EQ2A 4CJXA 5KSZA 2Y4OA 1XMOB 4G5FA 4J4BA 2VSNA 3EMBA 2OXRA 3OEED 4JWTA 1PL7A 4XB1A 3PXAA 2NXWA 4V1CI 1XLUA 1X39A 1A8HA 2DULA 2J9ZB 2EHJA 2OFXA 5LQUA 4QT4A 1Q6YA 3JS5A 2Z5VA 5KWVA 2Q3BA 5HHTA 4JAVC 3ZXYA 4NBKA 5SV2A 2CVHA 2XCIA 2Q3JA 3KPYA 3USES 4G6ZA 4DF3A 1SWVA 2GYVA 3L1VA 2VYNA 5HGJA 2R8OA 2FWMX 2RK3A 3GRFA 3LHFA 4PBRA 2TECE 2B21A 5JLAA 2W2KA 3QQ8A 1JPNA 3OAAD 3OZTA 1XKLA 1TVEA 2EQAA 2OFOA 3IDQA 2XMCA 1IM5A 4O2LA 3MMZA 2IEGA 3H3FA 4UXHA 2HHJA 5ICFA 5CT5A 2Q8PA 5DH9A 4P3KA 3GCXA 2IUYA 1IULA 3PDIB 2JJ1D 1NJSA 3CUWA 2VEOA 1W0JA 4LHZA 2JJYA 2Q45A 2EP5A 2ZUCA 2DU8A 1Z8FA 3O8OB 2JFWA 2YIJA 2MM0A 3ZHUA 5A9RA 3B52X 5KKNB 1CWUA 3OJFA 3PRKE 3HU3A 3DW1X 4XWWA 4X93A 1Q1AA 1OOEA 4ZI2A 1ZH2A 3CUSA 3RKSA 3D6FA 3DV9A 4UC0A 2QZ4A 2ZI4A 1XJQA 4LZZA 2WZDA 1WW2A 1ZK4A 4EI8A 5SYAA 1T26A 1HKUA 1K97A 2PJRA 3EGIA 2AK2A 2AEFA 1P80A 4MI1A 1XD8A 4F2HA 4NCKA 1G20B 2BCGY 2BH9A 3OOWA 1LSOA 2QENA 4RTLA 3QQ5A 5D2CA 1LDBA 2ZUUA 5B2EA 4PCLA 2A7XA 2C61A 3WK9A 3PEYA 5ECGC 3AUFA 3J7TA 5H68A 1V8PA 4PNZA 2OZEA 2F43A 3K0FA 3O4VA 4BNUA 4EG4A 3B38A 2NU8A 2FN7A 5FAKA 3X1MA 1QC5B 1QGED 5BY2A 1F12A 2D62A 4JQOA 1S02A 2NSJA 3K0CC 5DOVA 1ZG3A 5JWHA 5TVKA 1KJNA 1ZRSA 4CG3A 3AZPA 3CNHA 4CIWA 1D4AA 4JXZA 3TH5A 5CP8A 5LZ7A 1BCSA 3JWHA 4W5WA 2XUZA 1T2UA 3MK31 1OH7A 4G09A 5HF9A 1F60A 3F71A 1KE1A 3VYSB 4YR9A 1TUBA 4HSEA 1Y7HA 3V8QA 1D6JA 2X5XA 4PZCA 1P72A 1WLSA 4J2OA 5GQSA 2GBPA 1ADBA 1VKOA 2ZRAA 3G2KA 2GM9A 1HWYA 3LKVA 1E6UA 1GOTA 1UBHS 2VJQA 4HWTA 2G9NA 3FOEC 1TADA 5LYJA 2EGGA 3B9RA 2NUPA 4WJKB 2POCA 2XOKD 3FOWA 2QAGA 3PG5A 4BNDA 1TQ6A 4DMGA 4QHSA 4DJTA 5AVXA 1P2GA 1U5BA 2R47A 5BSRA 3RT9A 4J7XA 3V1LA 3IELA 1P73A 4O1HA 2GFHA 1I14A 4F6CA 2PRZA 3R7DA 3NETA 3P4UA 1UBOS 3DTVD 4O2RA 4ENQA 1HPLA 4XWAA 4DUGA 2SKEA 1FYWA 2AR0A 1MMFB 4D4MA 3DGEC 5K3AA 4EWLA 1KMNA 4N0PA 5HIKA 3G8CA 3RQIA 4UQPA 1VI2A 4F1KA 1P0MA 2QRVA 1NRIA 2P2NA 1LGYA 2WUGA 4RZIA 3VGJA 2BKVA 3T54A 3ACCA 3PHJA 4KQHA 3N70A 3EX7C 2VKQA 2I6UA 1MGPA 4XCXA 5GWXA 3BRWD 3WGGA 1A9YA 1C7FA 2XHEA 1U7XA 1P91A 2YIVX 1G8FA 3LHSA 3MNFA 4AJLA 5DHPA 1V5GA 1FL9A 2R8XA 4L0QA 2CKMA 3UJDA 1AVTA 1AJEA 5JVDB 3QEAZ 3CF0A 2KE5A 3H9BA 2X7XA 1B00A 4IUDS 4MUHA 4G0ZA 4LXIA 4TUYA 5DP2A 4URVR 4O0LA 3CLUD 4RXUA 5DCLA 5B58C 3H0KA 3WLIA 2X0RA 4RLFA 1RWOA 4ZHQB 3L6CA 3OZEA 3QLEA 3T1TA 1EFTA 3NATA 2OHVA 1DINA 4EBFA 1R16A 2DBRA 1W4CA 2J31A 4KN8A 3TQIA 2A7QA 1U28A 2R3SA 2PV7A 1JQEA 3MTBA 3ZWVA 1KYTA 2UYYA 4L5IA 2J3JA 5CNKA 2ZUEA 1T1JA 3DFUA 1G1MA 4OREX 4UMVA 5LQSA 2OUKA 3LCRA 1YMVA 2EFCB 1Q22A 4JI6B 1TO6A 2G71A 4JN6B 1O0BA 3DL2A 5C4MA 5IRCD 2OLJA 4HDKA 1C9YA 1ZZGA 1HQKA 2Y27A 1GUBA 4CLXA 1ZWLA 3GUCA 2HJRA 4CT4B 2PXHA 4Q1AA 3HXOA 3WICA 2MR5A 3A6GA 4O4IF 3P2JA 1QFYA 1Z6AA 1CR1A 1NF2A 1Y89A 2V9PA 2QDXA 2YICA 1Y9DA 3ACBA 3DLCA 3O4HA 4ONEA 3N3BC 4R4JA 5K0FA 3R5XA 2BCEA 1WP9A 5H82A 3STVA 3PUIA 3T38A 4YV2A 1X80B 5E95A 4CIDA 4C7MA 1T0UA 1A9RA 5I7AA 3K9QO 3BHIA 4IJ5A 1UMBB 3TQFA 2LWIA 1XK6A 1K92A 1UJNA 3R24A 4U9HS 3Q3IA 3PDHA 3BCUA 1R0ZA 2W42A 1BEUB 4FEAA 2XVZA 3U7QA 5BVGA 2OCDA 2KW5A 4RH0A 4NVRA 1II0A 1YJ5A 2DUUA 3IUEA 3IXQA 4BGVA 4N9QA 5KTPA 2E4AA 2WC1A 4Z4HA 4FDMA 5BRJA 2V5UA 4LOIA 5CM8B 5J1SB 1OVMA 2PL9A 1AHIA 4IDPA 4JP1A 1CDDA 3RVJA 3HGTA 1TFRA 4MWDA 3H5AA 2AE2A 1FFBA 3H6KA 3L8MA 1KVUA 3MCZA 3SIPA 1EB9A 2PL5A 4O4LB 2ZBGA 5BNIA 5JJLA 1CBUA 1GPJA 2HJGA 3HMQA 3OZ7A 1YUNA 2E0IA 1FMLA 1H66A 2WT9A 4AJEA 4PZUA 1SC4A 3LWNA 1PJAA 2OO5A 1Z4NA 4I4LA 5FFFA 2YVQA 2XKBA 3I30X 3TAUA 1PS0A 4QJ5A 5HZKA 4BY9E 3SX0A 1UQUA 4PLFA 1NOIA 4BN4A 5TGDA 2I03A 2GEJA 2WSIA 1LPAB 5DHAA 1EJ6A 1K3UB 3L49A 1U9IA 1W48A 1BN7A 1R6BX 1Z5PA 5ALEA 1K86A 5LQDA 1LLCA 1NI4A 4J7CA 2IPLA 4LBWA 4NFLA 4TTTS 2HQBA 3IALA 1WZ2A 4XGNA 1PNVA 4QBGB 3CRQA 1QZUA 3FSGD 1CULC 1SBQA 2I9KA 4BVJA 3DOHA 4BE4A 5FF9A 2H8GA 1Q6ZA 1WNFA 3EFOA 3NHFA 4PV7A 4D0SA 1E2BA 1BFUA 4E5SA 1PQPA 2EBFX 1TMOA 1LS6A 3TI7A 4JBWA 1JLLB 5K01A 2JGEA 2IHUA 3FLMA 3OT4A 5BR4A 4KWIA 2UUPA 3EA0A 4B3IA 4JLKA 2WQ7A 3UUFA 4HS9A 1SBZA 4YMHA 5D6YA 2RKBA 4BWVA 5KDOA 2J3IA 4TRRA 1PFWA 1N2BA 1N2EA 1GRQA 3C6BA 2WM8A 3DL0A 4A26A 3TPCA 1M34E 1P4JA 4F71A 1XZMA 3PRYA 3VO8A 1NUSA 1OWMA 3UPUA 1YH3A 4KPEC 5E9JA 5E6SA 2FPGA 2IU0A 2RGNA 4RTQA 1V48A 3BPSA 1MQ9A 3FNFA 4C5BA 3R7FA 4X1YB 4MKHA 4GI5A 4DL9A 4B6EA 4C20A 4JITA 3DXZA 2XB2A 2GCPA 4KI0A 4KMRA 2AG6A 2BUBA 4DJJA 1DT5A 1KDYA 5KC9A 1JR4A 2YWFA 1YMQA 4K6GA 4OFZA 2K6GA 2V97A 2B4YA 4K7JA 1U2RA 2WAXA 1MFZA 3SX2A 5CG2A 3OCJA 1WQ3A 3KNZA 1SVSA 4YJ2A 3A27A 4ND1A 2VSFA 3K2EA 3D4NA 4M0FA 4PPGA 3H8WA 5CA0A 3T0GA 1CUZA 2QRQA 1YS4A 2X15A 2ZDQA 3F2VA 3LCJA 4ZARA 5TF4A 1RJGA 1PW7A 1CLUA 1TJNA 4UOZA 1IHUA 1UP7A 1R6VA 4F4HA 3K6RA 3LUAA 2FVXA 3MWEA 4Q7EA 2P2YA 2H17A 3RPEA 4D9JA 3T5AA 3IMCA 4J1SA 1GADO 4JC4A 3KKNA 4OQZA 3M9LA 4ZREA 3O73A 4C2BA 3IQEA 1B43A 4MB0A 2W2OA 2WEKA 2WY2D 5BOVA 1FTSA 2WIBA 4RV0A 1XP8A 5K0EA 3JALB 5C37A 1WNTA 2DAPA 3E7XA 4Z1OA 1A4IA 3GLQA 3VSAA 3O8QA 4NENB 3QPUA 2IGTA 1E7SA 1GT91 2J9XB 1W75A 1E3SA 2P67A 3K9GA 3VNRA 2VAPA 2BHRA 1VL2A 4OHYA 4W9MC 2CFOA 4LDPA 3P2MA 2Q3FA 1OI3A 4JJFA 1XCLA 2D7DA 1URPA 3PHLA 2GZHA 3OOEA 4WBNF 2ZJ5A 2AKYA 3IQIX 1QGAA 1SVKA 5DTRA 1KRWA 1YZFA 3LGXA 4PQYA 3SVLA 3OX2A 3VISA 4BFXA 1LSJA 3AESB 2WWGA 4J9VA 4OGWA 2GFAA 1RLOA 5GY7A 4AULA 3KQSA 2JLYA 2BF4A 5BYJA 1U8CB 2VH1A 1WBBA 1KSGA 1OT3A 3CF4G 2Q1UA 3UV7A 3W78A 4KDIA 1C7IA 2Z6VA 1JG2A 2Q7XA 3GT3A 3B1ZA 1QRRA 2Y2UA 3OQJA 1N2XA 2DECA 3W79A 1XTZA 1IHDA 5TQ2A 3OD5A 4LX8A 5BN4A 5LNK6 1V1RB 3QNUA 1DTWA 1P9LA 1E62A 3L7YA 3QKRA 4FFLA 5IC6A 1YZUA 1X86B 2REOA 3N2GA 2F00A 5I7UA 4MGIR 3U48A 1AO3A 2F48A 1LTQA 3GC6A 1EVIA 5BWMA 4AZ0A 2OMEA 4JT2A 2ZRFA 4XPIA 3ICEA 1A8PA 2EHDA 3GH1A 3HPRA 4AO6A 4EGSA 1T2FA 4KN5A 2NUTA 1SKBA 1TO1E 1XQXA 3W8RA 3CN9A 5LKAA 4LF9B 2FSSA 2X9QA 4M38A 3N8GA 5SZJA 5IEJA 1OXTA 4X6YA 4BMYA 1C0PA 2WU4A 3ABZA 4WEOA 2YVKA 3OQOA 1NU6A 2C82A 5BNTA 1DO0A 1R4NA 1O9HA 1Y3FE 4HFNA 4FYYA 4AIRA 1G3UA 3M1AA 4WY5A 5EUBA 1L3BA 1PJ3A 4W1SA 3NBZC 4B34A 4QPZA 1PZGA 4CBVA 3E70C 1FS4A 3PRHA 3HUUA 5C5EA 3GLGE 1E2LA 3IRVA 1FY2A 3LRXA 2NO0A 3LTEA 2RAUA 3KR2A 4OHUA 3KCQA 2XVMA 5T57A 2GM5A 3VX4A 2CXUA 4R0NA 5IULC 2O2ZA 3MT9A 1SUFA 4E6PA 4Z53A 1ISGA 1GGJA 3T41A 3AUYA 1VLHA 2J0EA 2H85A 1D7AA 2ZYWX 3IHKA 4GWLA 3GJQA 1CB7A 3OHMA 3Q9UA 3I0NA 4KE7A 3UJ9A 4QGHA 1EDBA 3LG2A 5KCZA 1TL7C 1YZKA 4WOBA 5KSPA 1XEAA 1OY1A 3RGGA 3QXXA 5TT0A 4AJ1A 4ND5A 3WNBA 4DMRA 5C1OA 3AOEA 1WSWA 1XL1A 3ZBUA 4I19A 1L8AA 2P9JA 4DV0B 5BN3A 1JF8A 2EX1A 3PX3A 2PK3A 3HBFA 1D8AA 2Q0SA 3GLRA 3I76A 2DBVO 1LLUA 2O5RA 2D74A 3LO5A 2VPIA 3TOCA 2YINC 3G2IA 3AVPA 2AFHB 1UOEA 5DTQA 2OGUA 2OQ2A 1MO5A 3A1SA 1S4MA 2V7BA 5BRNA 3FHLA 4ZANA 2IS2A 3HKCA 3VDNB 3VTFA 2JKVA 2YZMA 2ZUWA 4Y8VA 3RE1A 1D1PA 1DC8A 1EGQA 3GOHA 3L79A 3OOHA 4X8LA 5LXTB 1B16A 1SVUA 2QTLA 4AKSA 5E0OA 4DLXA 5JS8A 3L9WA 3DMPA 1HE1C 3QVTA 4ZVQA 1KQPA 3DE5X 1L7DA 3KO8A 1HQYE 1RVDA 5CD1A 1JHUA 1RYMA 1UADA 2YBEA 3KKLA 1M6VB 2P0YA 2PT7A 1JAYA 4KFSA 1V7CA 5NLLA 4AX4A 5ADHA 3U4QA 1BXGB 2VYFA 4NONA 5JNTA 2PUGA 2B3DA 4MKFA 4PLTA 4MUMA 1YB4A 3NNNA 5EJ2A 2XQIA 3IJ5A 3WQRA 4E11A 1QO0D 3CPEA 1L5HA 5AW2A 4RKEA 4P58A 1MOSA 5K8CA 1OAAA 4RD0A 1PE0A 1A9TA 2JAHA 3DOCA 3JQAA 4F21A 2WM9B 1XRLA 1I3KA 3LPMA 4O4HB 3HXQA 1FNMA 5B4VA 2IOFA 3CX3A 4PWZA 1RRCA 1FP4A 5C32A 1AX9A 1SUIA 3K6JA 4KSYA 2RCYA 1H2YA 2GN2A 2PWZA 3CVUA 1RS0A 4JLMA 4FGKA 3UGKA 4P38A 5EP2A 1AN0A 1OZHA 2X42A 1PTJC 3PC6A 2GAFA 2HSZA 2XNHA 3CTPA 3DBOB 1SOAA 2VF8A 1RE0A 4ECAA 5K3OA 4LFAB 3CZ9A 1O03A 2JIPA 2WTXA 3PA6A 4Q02A 5JCJA 2JGNA 4OK3A 3B2NA 3UYLA 3JQFA 5F2NA 1UP4A 2BMDA 4ZI7A 1RI1A 3OX4A 3ZOZA 3QTLA 1UKYA 4F92B 1WG8A 2DH6A 2HMAA 4H15A 4KO2S 3JRWA 2Z6QA 4MRVA 1H5UA 1T0BA 1WAMA 1KSHA 3GT0A 1G2IA 3QOFA 5LUBA 3U31A 1HDXA 1OLSB 2QJOA 1ORRA 3UJCA 5A05A 1UWVA 1UC4B 2QTWB 1UMKA 3P20A 4Y7DA 1E3WA 2ZSEA 3LXMA 3NHSA 2DF8A 4GVPA 3RUDA 4E12A 4QNNA 1QQ5A 3OJXA 4UU8A 4Q1DA 1J00A 5AUOB 4DLKA 5C2JB 3FMFA 5L3SA 1S4QA 4UUAA 1BVHA 1GYQA 3QHQA 1Y37A 4FYXA 5K20A 4JEIA 4YHHB 1MABA 1QYCA 3KSRA 1VDZA 5JD4A 4J0JA 2CNWD 3TZLA 3VDMA 4C4SA 1V8ZA 3LOUA 3FKSD 5IKPA 1FFCA 1W85A 4UD6A 4KQ6A 3EW7A 5FYDA 4RZXA 3OTHA 1IM8A 1E4OA 4GOKA 4QU8A 2HN9A 1T9KA 3H6GA 2J45A 3DOUA 3N8HA 4B5LA 4YPFA 2Q9UA 1E1KA 4KUGA 5EZYA 5HIJA 5FPQA 4B7ZA 3I61A 1UWLA 1G5FA 2L17A 3QH4A 4C87A 2RI0A 4RDCA 5TEVA 4TKZA 3TQHA 3PEWA 1F5NA 1D07A 4G0OA 4BFLA 2KLBA 3QXSA 4FFWA 5LP6A 3ZHCA 3WRXA 3C2QA 4GKAA 3O47A 2H48A 5K8JB 2LTAA 1DRUA 4HGRA 1A98A 4KR0A 1L7EA 4QU9A 1Z5WA 4E03A 3A26A 2X2PA 1KBOA 3L4EA 3CEPB 3MS2A 2A78A 3A3KA 4KQ1A 3JD4A 4R1OA 4YP7A 3VHLB 4EG1A 4YCLA 3ADCA 5E6UB 2F90A 1OZAA 1MZVA 2BEJA 4WZAE 4GPBA 3Q0TA 4NCJA 1E6LA 2VXCA 5IK2A 1P2SA 2PNJA 2Y2VA 5JYCA 3K1JA 4K3VA 1B76A 2VF7A 3ESZA 3EMKA 6GPBA 1HYBA 3OWXA 4C0LA 4YR7A 2G25A 1VE6A 4BQFA 1JEEA 2A1UA 1N36B 5IDXA 3TR0A 1Z39A 2WV7A 3GV0A 2KBFA 5KTMA 1LNQA 1E2EA 1L4BA 4RTJA 4RE5A 4P7FA 1UWCA 3O4IA 2HTEA 2VPQA 3CCBA 1B15A 2JZOA 4YPOA 2XTAA 4YASA 4R2LA 3GP5A 5KVVA 2Q4TA 2D0PB 2H7YA 5GM1A 3CRZA 2H2WA 2XTZA 1KBZA 1NHWA 1SVOA 2F9MA 2I4TA 2JFQA 2R96A 4NHEA 2JFNA 2WG2A 4PGGA 1F2TB 2QGNA 4OQQA 1KQFA 2C9MA 1DFIA 1MC8A 5KYUA 4BATA 1GA4A 1L5NA 4BRWA 3ZGOA 4LHSA 4F6RA 2ECKA 3IEMA 1MORA 3PA8A 1TRKA 2FPWA 1XD2A 4UASA 2HI0A 3LT1A 1T1GA 4LDZA 3EWIA 3OUUA 5AQEA 1BCRB 1K98A 4N5HX 4QQ8A 4C3OB 2SICE 4F1JA 1COZA 1UAYA 1PJZA 2IE0A 4F86A 1ORWA 3FNBA 3OE7A 3V8RA 3TD2A 4RV9A 4WI1A 2VZ9A 3NYRA 3WK5A 1EUYA 3EDMA 1P17A 3OZDA 2JFVA 1IAVA 1PSWA 4B46A 4NYMQ 1Y1QA 1O8CA 2WAYA 2HMTA 1H42A 3TIIA 3LL4A 2HRCA 1TA0A 4A6PA 4CL8A 5REQA 1DLJA 3LCVB 4J1TA 4R2MA 4UKDA 2YJGA 1FUKA 2IP1A 1C30A 4BKRA 1MQSA 2JRLA 3ELBA 4QZVA 4BLPA 3DAHA 4EUEA 3IAS6 2P27A 4B3JA 5CA1B 3G8AA 1QH1B 1DCTA 3BH7A 4BIMA 2BHSA 4IV5A 1AKMA 1V4VA 1UDBA 4CV0A 3O03A 1MO2A 2B35A 2BFBA 2XQKA 1ZI6A 1NYLA 4G86A 4H3HB 4KGVA 4XX1A 2NSHA 3SM9A 1PO7A 4JI5B 1W5BA 4WWHA 2Z9DA 1L5FA 1ISRA 2GYYA 4BO0A 1PL6A 2GEKA 1EQUA 1P2TA 2AFIA 2O48X 3EXHB 4KHZA 4KWCA 4LQCA 1IYZA 3CIFA 4GX1A 4Z1MA 3CR8A 3ELWA 2PLWA 3E48A 2FFJA 2F1RA 5AK6A 4CMIA 5IS2A 1ZUWA 3FYUB 2PKEA 3O8BA 1IUKA 1T4MA 3ADDA 2FFBA 3QUTA 3K72B 3BCRA 3C8DA 4AK9A 2H1VA 2A3RA 1E2FA 5CVJA 4MDHA 3QENA 3EA5A 2A9FA 3GVIA 4OJQA 3IQGX 4YI3A 4ZDKA 4UQLA 5JANA 3U7FB 4QX6A 2FPPA 3QIVA 2QHXA 4HWSA 5F2OA 3T3HA 4BQIA 4TMTA 2Q6VA 3GPBA 1S2MA 2WU1A 4R8MA 3GRCA 4LVOA 1NSTA 5DWDA 3AFHA 3V7UA 5IABA 2P9CA 4KCGA 1C9JA 3IB6A 2VDQB 5HIAA 2WWHA 2RK6A 3CSUA 5A2GA 2G4VA 1PUIA 4QFDA 3HXLA 5KQMA 1XRSB 4LZPA 1KDZA 2ANBA 4CEHA 3NMUF 2OXTA 3ZHRA 1K8QA 3QV2A 4OB8A 4DT1A 3H5WA 4RD1A 1LRKA 4LC9A 4K3UA 4MWEA 5JARA 4BNNA 3UPTA 2WTBA 4UPEA 1WPRA 3KDSE 5DBIA 1JKFA 1TVKB 2J8ZA 3C3WA 4F93B 2B78A 4X62B 1N6KA 3WSTA 4BLUA 1N0WA 3UC9A 2QW0X 3D1JA 2HBZA 2GYWA 2C4WA 1N3BA 4M0KA 4ATNA 1DKMA 1R00A 2FNAA 2R6AA 3BSWA 1TEHA 4CV1A 4F9FA 2YWRA 5NULA 4GBGA 5FBVB 1UANA 3ZNOA 4FHDA 1DX4A 4RNCA 3UV3A 4N41A 4AKHA 2QR5A 1YOBA 2JI6A 3DT6A 3VYTB 1EA7A 1CVRA 3IOCA 1IQUA 2NGRA 3REFA 1J2TA 2Y71A 3K0CA 5JSHA 3KEOA 3JTMA 2FLKA 3Q9NA 4IKPA 3O92A 4IIBA 4A03A 4DJEC 1C3OB 2OORC 1KSJA 2XJ4A 2O50A 1ZVJA 2P9BA 3GDWA 1QMGA 4GE3A 1HFEL 1IVNA 3F3SA 4IQGA 4Z51A 4O8CA 1YI8A 2C5FA 4LIPD 4UAUA 4YHBA 4X97A 1LU9A 1RYYA 3GU3A 3MQFA 3GGOA 5G0VA 5KNBD 2H1OA 2QTMA 4JHXA 1YZVA 1C7JA 3TZCA 3ZI7A 1RQ7A 1IXKA 4DCOA 1N2OA 4I1VA 3WJ7A 1QGUA 1PZFA 2YS6A 4QTUB 2VPYA 2YMQA 4DCMA 5A5DA 2VHWA 3NHZA 2EZ8A 3MGAA 1GAQA 1T4GA 3MJVA 5DYYA 1NX9A 1AHHA 1S01A 3HB9A 4IG4A 3ULKA 3VZSA 4ZVTA 3CVVA 1Y3BE 3UXEA 2G70A 3FTDA 3TEJA 2BGUA 4JC5A 1ZJ5A 3RRFA 3JWGA 2GM3A 3WYAA 4QO7A 3G17A 1NR7A 3SLGA 3KQNA 4RTMA 3E7WA 2O23A 1Q7TA 4C7BA 1CUGA 4XJSA 2WQZA 1MUUA 3I4LA 4URZR 4WKNA 2P5UA 4X71A 3WAJA 1AGPA 1V0JA 3NIBA 3H6HA 1OJ7A 3VU9B 1KP2A 2QG6A 1LDEA 3Q3CA 3LUKA 2G08A 3L6OO 3W0LB 1VYTA 1GPDG 1RE1A 1T3ZA 3ANLA 4PBTA 3N3AC 4MUJA 3R9XB 3FPGA 4B87A 3EZ2A 5F5XA 1IJKA 3DWEX 1M8GA 4N12A 3VO1A 2Y1WA 4J1QA 2FFAA 4XIGS 2DERA 1JFLA 3TNDA 2DBZA 3G0GA 3O93A 5JISA 3UCEA 2B30A 2YTZA 3G5UA 4QUKA 1VBFA 2HQOA 3TW0A 4I4NA 1RACA 2DFLA 2J3LA 2FPXA 2P11A 1ENYA 1H6AA 1N0HA 1TTHA 3LDUA 5DEIA 4YGXB 5FUXA 1Q0HA 1U2PA 4B32A 4B3SB 3DLTA 2F8SA 3E5MA 3RS8A 1L5KA 3U1BA 1ZGAA 1U0EA 3PNQA 5IC4A 5KYXA 3UMFA 5FWXA 5ITZB 4KO3S 5ADUS 2ZZMA 2NXNA 5I8ZA 3PL1A 4CMAA 1PFQA 1KOLA 1V3QE 1V71A 1KEWA 5FPSA 1GAEO 1SAYA 1DBSA 1ID1A 3JXEA 4QJBA 5HQJA 1Q3KA 1JQDA 3W3AD 3A3NA 1FBTA 5BMVA 1U3GA 4D6PA 4PHCA 2J87A 2OYCA 3GL9A 1CJCA 3KKQA 5KWIA 5DB4A 1G8PA 3WNCA 3ZBPA 1MLDA 3NU1A 1O54A 1H0HA 5IAAA 3R3ZA 4DCUA 1I4WA 5G1OA 4BB9A 4FE7A 3BMOA 1K8YB 3EGEA 1F9AA 1LRLA 4GMKA 2W58A 4JB2A 3RS3A 1FQJA 1U9JA 4MLDA 4XE5A 1SHTX 1DBPA 1IIRA 3ZE7A 3R5FA 4AP9A 4UHCA 4L95C 3N0TA 2HCTA 1C1XB 4WA8A 1RPNA 3LMKA 3OICA 1RXIA 3STWA 1WMEA 5F78A 4JI1B 4KLCA 2PKRA 5AT1A 3ABRB 3ZQUA 1UEIA 3KUXA 2FW1A 4BX3A 1TTPB 4GUAA 3VKFA 5D5PA 4MYTA 4UFOA 5KS2A 5TB5A 2OV4A 1SQ0A 2VPTA 2A0XA 3RVPA 4CCYA 3GCZA 4H7HA 3EWNA 2J0VA 2UUAB 3T1OA 2QTZA 1FVFA 2ZS9A 2H1RA 2GK6A 3MJTA 1XNHA 3UFXA 4NARA 1PAUA 1CUAA 3IP7A 2AI3A 2EZUA 4FCWA 4JT9A 3M4ZA 4Y67A 4LFCB 1KEEA 4E5UA 3RRJA 3M3DA 2OZVA 4DSNA 1KP3A 2E21A 2FEOA 2PH7A 3R76A 3CB4A 1FP6A 4LJAA 1X74A 3KEQA 1CRQA 4IEIA 4IV0A 3ZXUB 3RW9A 4QYMA 2J9YB 3MJRA 3PLRA 2PS3A 4LHYA 5EAIA 3H2SA 3PFKA 2OXIA 2X0DA 1L7AA 1S2NA 3N5KA 4OLHA 4DGQA 3VDQA 4G81A 7MDHA 1YR6A 3EXFB 3UAXA 4HQFA 3AF3A 3CISA 4NMHA 3HCOA 1I6KA 3F8WA 5TSDA 3MOGA 1UFOA 4G5HA 4D9GA 3Q7TA 1Y5LA 4CM4A 3HRIA 2FTKE 1GGHA 5DCUA 3UJBA 1RI4A 2PJZA 3C7KA 2CLKB 2VDKB 3I39X 2ZIFA 4LJ9A 4IIUA 1SNYA 1UCFA 2NVUA 3AXTA 4FGLA 3SFZA 4G0MA 2X6TA 1P4AA 1G3IA 5E1OA 4PX5A 3TJMA 3RGWS 3FGNA 5GTDA 1T15A 4RHEA 4MUIA 3MUOA 3AKYA 5E2AA 4HUTA 1H3EA 3MBKA 2E4UA 2FSIA 3BL8A 3KPWA 5F3RA 2X8AA 1L6IA 3ZIUA 1A4RA 4MEBA 3K9HA 2B1GA 3DVAB 1IAQA 3M89A 1Z4JA 2EJWA 3O8NA 4R5MA 1KDRA 3T9FA 1IQRA 2HPVA 4QHTA 1VL5A 10MHA 1NZJA 2VTKA 4Z8XA 5CCXA 1R27A 1RWWA 4ZT3A 4E5YA 2Z6AA 1GO2A 2VUIB 2Q5OA 4EO7A 4G0UA 3I28A 4P3YA 2IDZA 1N5KA 2Z04A 5ALRA 3MTJA 4MRPA 1IFXA 1YQTA 4AJ4A 3AHHA 1QTIA 2NVOA 1T8UA 2XDWA 2XUDA 2Q19X 1IN6A 1ZIXA 3DGFC 3DWIA 3OKCA 4LRWA 4F3YA 1BVUA 2P2ZA 3RSFA 1JXMA 3OQPA 1ZGGA 2O1EA 5LP1A 4EGAA 3UW3A 1KNQA 1KH3A 1XPJA 5MHTA 3PJGA 2VYND 6YASA 3DUFB 2ZWVA 2PH1A 5AXDA 2ZAYA 1ACLA 2G06A 3M82A 2B99A 3H1AA 5AM1A 4B4DA 5HYVA 5I4CA 1R4AA 3T7DA 1PNRA 4O2BF 2O7RA 4OHZA 5FHRA 4XD7A 2VUTA 5ICEA 2ZJ4A 1WXHA 1MV5A 4O4IB 1YJAA 1EXWA 2HXYA 2RHLA 1UPBA 4MH0R 2NV2B 4RCVA 4Y2GA 4CKZA 3IHLA 3N1UA 5D6OA 3WA6A 2ZXUA 2P75A 4YRMA 3SQLA 3NALA 3IB3A 1DIGA 5LL6P 1U6IA 1XLTA 1FSPA 3GFBA 3KSMA 4RD6A 3H2IA 4X84A 3RRMA 3EZLA 4OHXA 2I1WA 1KY5A 3CRRA 2C54A 1CEYA 1IBMB 4ZVRA 2JFUA 3ZDXB 1QUEA 4BNYA 4EJSB 4J0KA 4JI8B 3CT6A 5JALA 3QKUA 2PH5A 3CV3A 4NU6A 3WRWA 2ZEJA 1USWA 1WXFA 4DYHA 4BFUA 5K6TA 3JTEA 1NLFA 4MK4A 3D6TB 2G9RA 4Z2YA 3UATA 1VPLA 3QF4B 1BJRE 1OI4A 2ZTVA 3N0XA 1W8DA 4PC1A 4WZBA 1RTTA 4UHFA 2XEXA 3AV3A 2GPAA 1SZJG 1YR7A 3VH3A 4MZDA 2D2XA 4AP5A 2C5BA 2WIAA 1A2OA 3Q98A 3UJNA 1MC4A 4EW1A 4JLSA 4U6SA 5DISB 3WMXA 5AVRA 1O8BA 2O20A 2M32A 4XPZA 3ZZ0A 2G5TA 4NDAA 2LZ0A 3HV2A 1LQTA 1Z0UA 2PSEA 4OEHA 4BUJA 3I5YA 2XXAB 1CX9B 2WFAA 3DZCA 1JTFA 1K2WA 5FOWA 5IBRA 1HOXA 1NVVR 3H9UA 3OD1A 4KXNA 1EUCA 2O6LA 1JI0A 2Z9CA 1CY2A 1KJWA 4LGCA 1D6SA 2IF0A 4G2NA 1UOOA 5BW6B 4AJ2A 2PX2A 3COPA 3NFYA 4UULA 1E5XA 1NXVA 3RUFA 3T3MB 2DFPA 1MAAA 3KSZO 3V8NA 4S2UA 4ZCRA 5CB0A 2Y0PA 4YK7A 4ERXA 4C0HA 3DNMA 2NOAA 4J16A 1YVEI 3D8RA 3ZU4A 3JVVA 2E37A 1LDGA 4KQJA 4V0OA 5AKLA 1JQLB 2P91A 2QLNA 3DV2A 4F8YA 3R40A 1M2HA 2XI4A 3OCCA 2AXEA 1IQ0A 4J0GA 2QYOA 3WWEA 1USVA 3EIQA 4US1R 1VRWA 2R8EA 4YQZA 4P4UA 3OSZA 1BNCA 1M2FA 5ENVA 3BMQB 3DYVA 3Q3GE 4YH1A 3TVTA 4DUGD 1AT1A 2NU9A 2GQ0A 1SXJB 1YL5A 1OXXK 3BL6A 3KPVA 2A67A 4OGLA 3WDMA 4DVGA 2VQEB 3IJRA 3SXUB 4HEQA 3N74A 4GYKA 4OM8A 5AM0A 1NT4A 1CNFA 3CR7A 1NQ5A 5J2TF 5U9CA 4RA6A 2CFCA 3SBEA 4AX8A 4WH0A 5BOSB 5J23A 3A4LA 5BWCA 5I3CA 3ASVA 4KNVA 4RHXA 4AKEA 1GTRA 3OPVA 4BX0A 1DEOA 1GG2A 2C5HA 4WKBA 5HQ3A 3EQ9A 2YMLA 3DEKA 3UENA 2W5UA 4J0DA 1Z7EA 3BE8A 2Q1WA 2P9FA 3UWOA 4BBJA 4UEJA 2ZIGA 4MVJF 3MUNA 4B0PA 1Y4SA 1M1NA 4BXOB 3VAAA 4ZOLA 3FTEA 2QUIA 5B12A 1LBEA 3B1FA 3BILA 5AW3A 3WFZA 1CR0A 1U0NA 3PE3A 3WGJA 4M0MA 4EJ6A 2JGKA 2EP8A 5F1YA 5JBQA 4C05A 5J59A 3MSCA 2RGYA 1FX0A 1JNYA 1G5HA 1UBNA 2FW7A 3KLPX 3MCTA 5H70A 4QOJA 1XZNA 3GAZA