3LHHA

The crystal structure of cbs domain protein from shewanella oneidensis mr-1.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
TISSLMVPRSDIVFLDLNLPLDANLRTVMQSPHSRFPVCRNNVDDMVGIISAKQLLSESIAGERLELVDLVKNCNFVPNSLSGMELLEHFRTTGSQMVFVVDEYGDLKGLVTLQDMMDALTGEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of CBS domain protein from Shewanella oneidensis MR-1.
rcsb
molecule keywords CBS domain protein
molecule tags Membrane protein
source organism Shewanella oneidensis
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3lhhA01
2UV6A 5IIPA 3OCOA 4L28A 3K6EA 5K24C 3L2BA 2PFIA 3KPBA 2EMQA 4DQWA 2QLVC 4ESYA 3PC2A 3LFZA 3GBYA 3K2VA 1XKFA 2D4ZA 5KS7A 3I8NA 4GQVA 2ZY9A 3LV9A 2NYCA 2UV4A 4PCUA 3PC4A 4IY0A 3FHMA 2QR1E 4ESYB 5LXQA 4HG0A 2QREE 3PC3A 2UV7A 3FWRA 2P9MA 2QRCE 2YZIA 5MMZA 5K22B 3FWSA 4FRYA 2RIFA 4P1OA 3DDJA 3T4NC 4GQYA 1O50A 4UUUA 3FV6A 2O16A 4L27A 2OOYE 2YVZA 3OI8A 2EF7A 3KPDA 3KXRA 4L3VA 3OCMA 4FXSA 4GQWA 2YVYA 3HF7A 2NYEA 4O9KA 5K23C 2OUXA 3FNAA 4NOCA 4IYSA 4L0DA 4IY3A 5K25C 3KH5A 2QRDE 2RIHA 1PBJA 2QH1A 4IY2A 4COOA 4P1GA 3TE5C 3L31A 1PVMA 3LQNA 3SL7A 3ORGA 2RC3A 2UV5A 1Y5HA 3KPCA 2YZQA 2YVXA 3TDHC 2OOXE 4IY4A 1YAVA 3LHHA
chains in the Genus database with same CATH superfamily
2JA3A 2UV6A 5IIPA 3OCOA 4L28A 3K6EA 5K24C 3L2BA 2PFIA 3KPBA 2EMQA 4DQWA 2QLVC 2J9LA 4ESYA 3PC2A 3LFZA 3GBYA 3K2VA 1XKFA 2D4ZA 5KS7A 3I8NA 4GQVA 2ZY9A 3LV9A 2NYCA 2UV4A 4PCUA 3PC4A 4IY0A 3FHMA 2QR1E 4ESYB 5LXQA 4HG0A 2QREE 3PC3A 2UV7A 3FWRA 2P9MA 2QRCE 2YZIA 5MMZA 5K22B 3FWSA 4FRYA 2RIFA 4P1OA 3DDJA 3T4NC 4GQYA 1O50A 4UUUA 3FV6A 2O16A 4L27A 2OOYE 2YVZA 3OI8A 2EF7A 3KPDA 3KXRA 4L3VA 3OCMA 4FXSA 4GQWA 2YVYA 3HF7A 2NYEA 4O9KA 5K23C 2OUXA 3FNAA 4NOCA 4IYSA 4L0DA 4IY3A 5K25C 3KH5A 2QRDE 2RIHA 1PBJA 2QH1A 4IY2A 4COOA 4P1GA 3TE5C 3L31A 1PVMA 3LQNA 3SL7A 3ORGA 2RC3A 2UV5A 1Y5HA 3KPCA 2YZQA 2YVXA 3TDHC 2OOXE 4IY4A 1YAVA 3LHHA
chains in the Genus database with same CATH topology
2JA3A 2UV6A 5IIPA 3OCOA 4L28A 3K6EA 5K24C 3L2BA 2PFIA 3KPBA 2EMQA 4DQWA 2QLVC 2J9LA 4ESYA 3PC2A 3LFZA 3GBYA 3K2VA 1XKFA 2D4ZA 5KS7A 3I8NA 4GQVA 2ZY9A 3LV9A 2NYCA 2UV4A 4PCUA 3PC4A 4IY0A 3FHMA 2QR1E 4ESYB 5LXQA 4HG0A 2QREE 3PC3A 2UV7A 3FWRA 2P9MA 2QRCE 2YZIA 5MMZA 5K22B 3FWSA 4FRYA 2RIFA 4P1OA 3DDJA 3T4NC 4GQYA 1O50A 4UUUA 3FV6A 2O16A 4L27A 2OOYE 2YVZA 3OI8A 2EF7A 3KPDA 3KXRA 4L3VA 3OCMA 4FXSA 4GQWA 2YVYA 3HF7A 2NYEA 4O9KA 5K23C 2OUXA 3FNAA 4NOCA 4IYSA 4L0DA 4IY3A 5K25C 3KH5A 2QRDE 2RIHA 1PBJA 2QH1A 4IY2A 4COOA 4P1GA 3TE5C 3L31A 1PVMA 3LQNA 3SL7A 3ORGA 2RC3A 2UV5A 1Y5HA 3KPCA 2YZQA 2YVXA 3TDHC 2OOXE 4IY4A 1YAVA 3LHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UV6 A;  5IIP A;  3OCO A;  4L28 A;  3K6E A;  5K24 C;  3L2B A;  2PFI A;  3KPB A;  2EMQ A;  4DQW A;  2QLV C;  4ESY A;  3PC2 A;  3LFZ A;  3GBY A;  3K2V A;  1XKF A;  2D4Z A;  5KS7 A;  3I8N A;  4GQV A;  2ZY9 A;  3LV9 A;  2NYC A;  2UV4 A;  4PCU A;  3PC4 A;  4IY0 A;  3FHM A;  2QR1 E;  4ESY B;  5LXQ A;  4HG0 A;  2QRE E;  3PC3 A;  2UV7 A;  3FWR A;  2P9M A;  2QRC E;  2YZI A;  5MMZ A;  5K22 B;  3FWS A;  4FRY A;  2RIF A;  4P1O A;  3DDJ A;  3T4N C;  4GQY A;  1O50 A;  4UUU A;  3FV6 A;  2O16 A;  4L27 A;  2OOY E;  2YVZ A;  3OI8 A;  2EF7 A;  3KPD A;  3KXR A;  4L3V A;  3OCM A;  4FXS A;  4GQW A;  2YVY A;  3HF7 A;  2NYE A;  4O9K A;  5K23 C;  2OUX A;  3FNA A;  4NOC A;  4IYS A;  4L0D A;  4IY3 A;  5K25 C;  3KH5 A;  2QRD E;  2RIH A;  1PBJ A;  2QH1 A;  4IY2 A;  4COO A;  4P1G A;  3TE5 C;  3L31 A;  1PVM A;  3LQN A;  3SL7 A;  3ORG A;  2RC3 A;  2UV5 A;  1Y5H A;  3KPC A;  2YZQ A;  2YVX A;  3TDH C;  2OOX E;  4IY4 A;  1YAV A;  3LHH A; 
#chains in the Genus database with same CATH topology
 2JA3 A;  2UV6 A;  5IIP A;  3OCO A;  4L28 A;  3K6E A;  5K24 C;  3L2B A;  2PFI A;  3KPB A;  2EMQ A;  4DQW A;  2QLV C;  2J9L A;  4ESY A;  3PC2 A;  3LFZ A;  3GBY A;  3K2V A;  1XKF A;  2D4Z A;  5KS7 A;  3I8N A;  4GQV A;  2ZY9 A;  3LV9 A;  2NYC A;  2UV4 A;  4PCU A;  3PC4 A;  4IY0 A;  3FHM A;  2QR1 E;  4ESY B;  5LXQ A;  4HG0 A;  2QRE E;  3PC3 A;  2UV7 A;  3FWR A;  2P9M A;  2QRC E;  2YZI A;  5MMZ A;  5K22 B;  3FWS A;  4FRY A;  2RIF A;  4P1O A;  3DDJ A;  3T4N C;  4GQY A;  1O50 A;  4UUU A;  3FV6 A;  2O16 A;  4L27 A;  2OOY E;  2YVZ A;  3OI8 A;  2EF7 A;  3KPD A;  3KXR A;  4L3V A;  3OCM A;  4FXS A;  4GQW A;  2YVY A;  3HF7 A;  2NYE A;  4O9K A;  5K23 C;  2OUX A;  3FNA A;  4NOC A;  4IYS A;  4L0D A;  4IY3 A;  5K25 C;  3KH5 A;  2QRD E;  2RIH A;  1PBJ A;  2QH1 A;  4IY2 A;  4COO A;  4P1G A;  3TE5 C;  3L31 A;  1PVM A;  3LQN A;  3SL7 A;  3ORG A;  2RC3 A;  2UV5 A;  1Y5H A;  3KPC A;  2YZQ A;  2YVX A;  3TDH C;  2OOX E;  4IY4 A;  1YAV A;  3LHH A; 
#chains in the Genus database with same CATH homology
 2JA3 A;  2UV6 A;  5IIP A;  3OCO A;  4L28 A;  3K6E A;  5K24 C;  3L2B A;  2PFI A;  3KPB A;  2EMQ A;  4DQW A;  2QLV C;  2J9L A;  4ESY A;  3PC2 A;  3LFZ A;  3GBY A;  3K2V A;  1XKF A;  2D4Z A;  5KS7 A;  3I8N A;  4GQV A;  2ZY9 A;  3LV9 A;  2NYC A;  2UV4 A;  4PCU A;  3PC4 A;  4IY0 A;  3FHM A;  2QR1 E;  4ESY B;  5LXQ A;  4HG0 A;  2QRE E;  3PC3 A;  2UV7 A;  3FWR A;  2P9M A;  2QRC E;  2YZI A;  5MMZ A;  5K22 B;  3FWS A;  4FRY A;  2RIF A;  4P1O A;  3DDJ A;  3T4N C;  4GQY A;  1O50 A;  4UUU A;  3FV6 A;  2O16 A;  4L27 A;  2OOY E;  2YVZ A;  3OI8 A;  2EF7 A;  3KPD A;  3KXR A;  4L3V A;  3OCM A;  4FXS A;  4GQW A;  2YVY A;  3HF7 A;  2NYE A;  4O9K A;  5K23 C;  2OUX A;  3FNA A;  4NOC A;  4IYS A;  4L0D A;  4IY3 A;  5K25 C;  3KH5 A;  2QRD E;  2RIH A;  1PBJ A;  2QH1 A;  4IY2 A;  4COO A;  4P1G A;  3TE5 C;  3L31 A;  1PVM A;  3LQN A;  3SL7 A;  3ORG A;  2RC3 A;  2UV5 A;  1Y5H A;  3KPC A;  2YZQ A;  2YVX A;  3TDH C;  2OOX E;  4IY4 A;  1YAV A;  3LHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...