3LHJA

Crystal structure of p38a mitogen-activated protein kinase in complex with a pyrazolopyridinone inhibitor.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
348
structure length
341
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery and evaluation of 7-alkyl-1,5-bis-aryl-pyrazolopyridinones as highly potent, selective, and orally efficacious inhibitors of p38alpha mitogen-activated protein kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 341
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lhjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lhjA01
2PU8A 3SG8A 4HVSA 4IB5A 5AV3A 3EFKA 3M42A 4AA4A 4KNBA 2BRNA 5DR6A 2QONA 2WQOA 2H9VA 4PPAA 4NYEA 4FV5A 5J8IA 1ZYSA 5GZ9A 4TWCA 3AD6A 4XG7A 3FYKX 1KWPA 2HELA 4HGTA 5EM5A 4IZAA 3VS1A 2J0IA 4S32A 5CT0A 2C3KA 2UW9A 2XNPA 4X3FA 4FGRA 4WG5A 1SVGA 1W84A 3DXPA 3DBCA 3EN4A 3FQHA 4FSQA 4K11A 4NFNA 3R00A 4QYHA 3RJCA 5FXRA 5IMEA 3QQKA 2XNOA 5ITAA 3LM5A 3D5WA 3KEXA 4ZEGA 4JIKA 3Q9XA 5M57A 3R9RA 5IQDA 3TDVA 1L8TA 3ORZA 5AR8A 4DH7A 1Q4LA 3BZ3A 3DZQA 4JR3A 3NMUF 4O86A 4NKSA 3ZMMA 2CGXA 3TNWA 4DFZE 4E26A 5CAOA 4D58A 4FV7A 3F3ZA 3GC7A 5IH5A 4D55A 2C3LA 3R28A 3R9NA 3OG7A 3WIGA 3PE1A 4XG9A 3C4EA 4KBCA 5K0KA 3L8PA 4I0TA 4IVBA 5HI2A 5CF8A 3TKIA 4KBAA 3F3TA 3ODZX 3MBLA 4RX9A 5KMKA 3CPBA 4K6ZA 2GSFA 4QYGA 2OGVA 4FTOA 2FYSA 3AC4A 4I5MA 2JFLA 5L3AA 1OIYA 4F08A 3Q2MA 5AUWA 3EYGA 5CU0A 3I1AA 4F7NA 2BZJA 2WMTA 3HA6A 2PVHA 1OBDA 4YZNA 4Q5EA 4GT3A 5KKRB 4EK3A 1BL6A 3OCGA 4LGHA 5E8XA 4A9SA 2ZVAA 3DK7A 4O7TA 2CMWA 2YABA 3QKLA 2VTIA 3OTUA 2VV9A 4IWDA 3UO4A 3C5IA 3EQPA 5JSMA 3N4UA 4CFMA 4O81A 2VWXA 4NW6A 1XBAA 1BUHA 3L8SA 2HW7A 4FKQA 3HV5A 2CHLA 4FVQA 4RIOA 3UOHA 3MV5A 2ACXA 4D4VA 4EJ7A 4D0WA 2VO3A 1JQHA 4CYJA 2Z60A 2VTHA 2VNYA 4CFVA 2GQGA 4NT4A 3RNYA 3LCDA 4AW1A 4DFLA 3A7IA 5HESA 3FYJX 5HO6A 3UBDA 3KREA 3CP9A 3DJ5A 2O2UA 3UP7A 4RX5A 4MEDA 3F2RA 3QXOA 1IA9A 1VEBA 4RFYA 2X2LA 3ZSGA 3R7EA 1XH6A 4D2RA 1PMUA 2VU3A 4IDTA 5E8UA 4AN9A 3OT8A 4I5PA 2J0JA 5ANIA 2NO3A 5AM7A 5H9BA 3VS2A 3OT3A 3PXYA 4QYYA 2UW0A 4L68A 4XG2A 2BIKB 3UC3A 3CQUA 4QNAA 2PZ5A 5HOAA 1RDQE 3G9LX 3R9DA 5A9UA 3MJ2A 2ITNA 4G34A 2G15A 3CBLA 4IM2A 1OL1A 3FL4A 3C13A 4PP9A 4X2GA 5HLWA 2ZV9A 2C3JA 4NJ3A 5J5TA 1L3RE 3G6HA 4H1JA 4RA4A 5E1EA 3BLHA 2QR7A 2C0TA 4FTUA 4DT9A 3C0GA 3AMYA 3BYOA 2NRUA 3TIZA 5AUTA 3TV4A 3W2OA 2JKQA 1Q8WA 5AP0A 4QMVA 4BGHA 4YTHA 5DVRA 4ENXA 4IADA 3FLQA 3R04A 3GGFA 4EWQA 1G8AA 1TVOA 5AV2A 5HO8A 4KKGA 2W0JA 5IH4A 2OIDA 4IH8A 4O38A 1SMHA 4GKIA 3ZC5A 4EOKA 5HG5A 2V62A 1M2QA 5AMNA 4BIBA 2CNUA 5HE3A 3OWJA 4O2ZA 5IU2A 5FM2A 5CANA 4FEWA 3P86A 3UZPA 3COKA 4YBKA 4EHGA 3QL8A 4BICA 5GJDA 3E8DA 3P79A 4IFGA 4D5HA 1FVRA 2P3GX 3DKFA 2UZBA 3H3CA 3I81A 3V5WA 3BE2A 2QR8A 4ASDA 2PMIA 4FKRA 1P5EA 3MJ1A 4I3ZA 3CEKA 2BCJA 2OW3A 3UDBA 1S9IA 3GU8A 4OR5A 3FV8A 4AF3A 3NUAA 3EKNA 4FZ7A 1KE6A 2W4KA 3GP0A 3AXWA 5E8SA 2BRMA 2UW6A 4EH4A 1OL5A 2VX1A 3MPTA 2G2FA 2X8DA 4F0IA 2E9VA 5KMOA 5A3XA 2H34A 4FSNA 3PE2A 4J8NA 4PMPA 2BUJA 4DGNA 4ZOGA 2FA2A 3RALA 3EZRA 3D0EA 4KAOA 4CTCA 1ZYLA 4RIXA 2I0EA 5CVGA 4D2SA 2F2UA 4OT6A 5DPVA 5H8BA 1B38A 3KVWA 5M51A 5EDQA 1URWA 2GNIA 4E4LA 3TACA 4CYIA 5HCXA 3RM6A 2WNTA 4E6CA 4AE9A 4J8MA 4ALVA 5HE0A 3ZM9A 5EQYA 2XCHA 3EQCA 4GYIA 4P4CA 2C5NA 5EHLA 3F82A 5IDNA 1NW1A 1R0PA 2C6KA 3CQWA 4UMPA 1V0BA 5EKNA 3PSBA 2HW6A 3UJGA 3GNIB 3ITZA 5BUEA 2ONLA 3V5QA 4J53A 4KKHA 5KX8A 1GY3A 1QPCA 4DTAA 5FBNC 4D1XA 5BYZA 5CEPA 5LVNA 4C34A 4ACCA 4WNMA 1SNUA 2A2AA 2OFVA 2YISA 3M1SA 4QQJA 3T8OA 2J0LA 3OP5A 1JSUA 3ENHA 2CKQA 2RGPA 4QPSA 4D4SA 3C7QA 4IAYA 4DAWA 4I6BA 3NWWA 4BCFA 4JG6A 3PVBA 2BFXA 4JBVA 4EH8A 3NYOA 4EKLA 1OBGA 2Y6MA 5DOSA 4FGBA 3HAMA 2RIOA 3ACKA 4QMXA 1K2PA 2XP2A 4PPCA 5A4QA 4ZMEA 4TYHB 4I41A 1MP8A 5BYLA 4WRGA 3VUTA 1PYEA 1JBPE 4YTIA 2C6TA 4C7TA 2WTVA 2OICA 5C8MA 4MF1A 1A48A 1KE5A 4IB1A 3LPBA 2O8YA 3NW7A 4TNBA 4EJNA 3E8NA 3F66A 5AV0A 5J7BA 5KMLA 3AC2A 4JR7A 3COIA 3KMUA 1AQ1A 4M3QA 2YITA 5L2SA 5LJJA 3SXFA 2PVYA 3LXNA 4H3BA 3NUNA 5M06A 3A7JA 3AT2A 5LMAA 1GZKA 1OZ1A 5TO8A 1UV5A 4HCTA 4XP2A 3L9PA 1H1RA 2XNEA 4FSRA 4EOIA 1IAJA 3GCPA 4D5KA 2BZHB 5FDXA 5AR5A 4UWCA 4G9RA 3S3IA 3SG9A 2ZMCA 1PXKA 1RJBA 4L3LA 3FXZA 3DJ6A 3QTUA 3FZRA 4YJNA 4FOCA 4R6VA 4A9RA 4K2RA 4QMPA 2VD5A 5EHYA 5BYYA 5C26A 5JEBA 3DBQA 4D0XA 4P5QA 3O17A 3KRXA 3ID6C 3E64A 1H1PA 4BDDA 4AQCA 4M67A 4GG5A 4NU1A 1QPDA 1Y91A 5E4HA 5CZIA 3U4WA 3OWLA 5CAPA 4QMMA 2Q83A 2QU6A 3QXPA 5HNIX 1GZOA 3IW8A 3OCBA 4RLLA 3UP2A 4CQEA 3E8CA 3MIAA 3MVJA 4XLIA 3MPAA 1M52A 4I4EA 3DB6A 3AT3A 2OSCA 2VO0A 2XS0A 4HZRA 2C6IA 2YWPA 4U8ZA 2WOTA 2WZJA 3TKHA 2OXDA 5FGKA 4LOQA 3RNIA 5FXSA 1Q3DA 2O0UA 4YJVA 5H3QA 4QD6A 1F5QA 4ZK5A 4YZMA 1XHAA 4DH1A 2F2CB 1OPLA 3KK8A 1ZAOA 4OBOA 4OTIA 4AT5A 4BYIA 4AFJA 2RFNA 2XEYA 5I9ZA 3KCKA 4UEUA 5HBJA 3CGOA 5AAGA 1AGWA 1XQZA 5LWMA 3WYXA 1MQBA 5JT2A 2BAJA 4FKIA 3ZLYA 5DIAA 3NRMA 2GNFA 4HGEA 4TPTA 2X0GA 5J7HA 4AOTA 1YI6A 1URCA 4TWPA 5GNKA 4J96A 3IO7A 3MPMA 3D4QA 3AMBA 2ETMA 5D11A 3IOKA 3W2SA 2IPXA 4AA5A 2G01A 4C4FA 4DG3E 3NAXA 3S2PA 3IS5A 4W8DA 4UMQA 3DNDA 4O7VA 5IQGA 2ZMDA 2J6MA 3QTQA 4FSMA 2PVRA 2XF0A 3ACJA 2YCFA 4QT1A 3AC5A 4ZP5A 3WZJA 1M14A 4AN3A 4QMOA 5LCKA 5HG9A 5CSWA 4W9WA 4BHZA 4J71A 4YJTA 4UN0C 2Y0AA 3NS9A 4RZVA 3RINA 4O82A 4BL1A 3U9NA 3WZDA 1G3NA 3ZRLA 2OU7A 1VR2A 4HVDA 2WPAA 5ETFA 3A7GA 3TNHA 3LW0A 4APPA 3ANQA 3LCSA 3L9NA 4FZ6A 3ELJA 4RIWB 2YM4A 4RQKA 1OI9A 1U54B 2JFMA 3HRFA 4Y8DA 3S95A 3FEGA 3ZBXA 3OS3A 2XJ2A 3BCEA 3HDNA 3PIZA 4QMSA 3CXWA 2BTRA 3FI2A 3VAPA 4U44A 3ZFMA 4TN6A 4RMZA 4BDJA 1OPJA 1UKIA 3KGAA 1V0OA 4FNWA 4LV5A 4P7EA 4QMZA 3SHEA 4EH2A 4F7LA 3O2MA 4G16A 1E1XA 4BBFA 4FTNA 2F7XE 4M8TA 4CFWA 4HJOA 3UO5A 3BGQA 5ETAA 3EL8A 4K18A 1SYKA 3VUHA 4D28A 4C57A 2YM7A 1BKXA 1SZMA 2J50A 2OO8X 3ENMA 4X0MA 4CRLA 3H10A 4EHZA 4DCAA 3KVXA 3SD0A 2ITUA 4PWNA 2ETRA 3ETAA 4MBLA 5DEYA 4QTEA 3PWYA 3JVSA 3ZSHA 4O7WA 3LXPA 2W99B 1BLXA 3TKUA 4BB4A 5F20A 2NRYA 4GIIA 5HKMA 2Y8OA 3GT8A 1MRVA 4IMYA 4JXFA 5CY3A 1LEZA 4PL5A 4QQ5A 2GS7A 4FT0A 3R1YA 4JDHA 4W4XA 4OTQA 3BE9A 4S33A 2R3OA 3RCDA 3Q5ZA 5JQ5A 1BL7A 1KE8A 3PG1A 2QO2A 2R3FA 3W8QA 3NEWA 3WOWA 2C6MA 1O6YA 2XK9A 3WF5A 4EOOA 5B2LA 4OTRA 3R7OA 2Z2WA 5B0XA 4A4LA 5KKRC 4O0XA 3OBGA 5DFPA 2PZPA 1OUKA 4EK4A 4RVLA 5BVOA 3ZBFA 3FC1X 5C1QB 4R78A 5JKGA 3BPRA 5HTBA 3EH9A 3T3UA 5AP7A 3TWJA 2O65A 3UIXA 4YUQA 4GRBA 2QOIA 3BRBA 1Q8ZA 4RX8A 3MVHA 4OT5A 3TUCA 1ZOGA 2R5TA 3IGOA 3PY3A 5HORA 1PYXA 2PL0A 3PTGA 4F9AA 3Q4CA 3COHA 3VF8A 3VRZA 4AZTA 2OJGA 4PRJA 5HEZA 4XOYA 4FTJA 1W7HA 4C58A 5DEWA 2HZIA 3NUYA 3QQJA 5I0BA 3WE8A 3SVVA 3A4PA 4FV4A 4IACA 4FIFA 2R7BA 4UZHA 3TZ8A 4DBNA 4E6QA 4BGQA 4YC3A 4C37A 2HXLA 5BVDA 2YHVA 3OY3A 2QD9A 4L7FA 1ZLTA 1UWJA 3FZTA 4MNFA 2WMQA 4G3EA 3FE3A 5CWZA 4OTPA 4O21A 5ANDA 4MBIA 3E3BX 4K8AA 3HDMA 3KU2A 3MH0A 4BDHA 2ITTA 3ULIA 1OITA 1OMWA 2PMOX 5FTGA 3TM0A 5J5SA 2ZB0A 5CI6A 3NPCA 4HPUE 4I0RA 1UU8A 2F49A 3PP0A 4EC9A 1O9UA 3GFWA 3MY1A 3BLQA 4J99A 3GQIA 1J1CA 4RJ5A 2X9FA 2GHLA 4JQ7A 4RC3A 4U97A 1J7IA 5F95A 3RWQA 3NCZA 3Q5IA 2IVUA 4FBXA 1YRPA 2P33A 4YC8A 3ULZA 4NL0A 4MF0A 4LV8A 3SV0A 1K9AA 2GTMA 1R39A 4MNEA 1R78A 3Q04A 4KWPA 2PVFA 5AUVA 3EQFA 4OBPA 3DK3A 1YOMA 2GCDA 3Q6WA 4WOVA 3EFLA 1PRYA 5I3OA 4O0YA 4PNIA 3FQEA 4C4JA 4EK6A 4JG8A 3W32A 4KABA 2DUVA 2QOCA 4MXAA 4QTBA 3NIZA 2FSMX 3W55A 2QOLA 2WQBA 3SRVA 4N4SA 4JLCA 2Z7RA 4U43A 4E6AA 3SGCA 3POZA 2GPHA 2WMSA 3D5UA 4M66A 4JDIA 4M13A 2EB3A 3LCOA 3U87A 4E73A 4Y85A 4H58A 2OWBA 3OXZA 2GDOA 2V55A 4CZYB 4G6NA 3E3PA 3VN9A 5B7VA 2EU9A 4HCVA 2JC6A 2XNBA 2WTJA 4FTMA 3HV7A 3DLSA 2PUNA 1YXSA 2FSLX 1ZRZA 3A99A 1OGUA 2VTMA 4X2FA 4FE2A 5IEYA 3FBVA 4KIKA 4I20A 4ANMA 4PTEA 4RJ7A 5K9IA 5J1WA 2WU7A 4JX3A 2YM6A 3PXZA 3HAVA 3F69A 2GQSA 1FBNA 5AR3A 1W0XC 4M14A 3HRCA 4MXXA 3H9FA 4L53A 5FBOA 4ZJJA 4LOOA 2C0IA 3KRJA 3OF0A 4ONAA 4AW5A 1Z9XA 3DY7A 3KQ7A 3UODA 4X3JA 4KRDA 4QMYA 4IX3A 4FNYA 2OJIA 4ZSLA 4FSZA 2CKEA 5H8EA 4FKJA 1YHWA 3V04A 1Y6AA 2CGWA 2YIXA 3QHWA 4FZDB 2UZUE 3KXGA 4OLIA 4QMQA 4K33A 3LZBA 2XIKA 2CKOA 3FI4A 5I5ZA 4CCBA 2P2IA 4AA0A 4NM7A 2J9MA 3QGWA 3VVHA 2CNVA 3G2FA 2BFYA 2RF9A 3W2RA 4BN1A 4EUUA 3LAUA 3LQ5A 2X7FA 3BYVA 3UE4A 4K9YA 5AV4A 4J1RA 3IG7A 3F7WA 3DPKA 4BCHA 4E8AA 4EOLA 2J5EA 2JBOA 3LMHA 4C4HA 3QU0A 3MN3A 3OTVA 4FKLA 4PMTA 3R8MA 3W33A 5BVEA 1XR1A 2YA9A 4YJPA 2QLUA 3HKOA 4DEIA 3L8VA 3KRRA 2BRHA 3AC3A 4FL1A 4R7HA 2WMUA 4KS7A 4BDFA 2Y7JA 5E8WA 3QRTA 4YLJA 4BRXA 2HY81 3OBJA 3PPJA 4NK9A 3VJNA 1STCE 3ZLXA 4EBWA 3A7FA 1H27A 3BLRA 2BDWA 3HA8A 2EUFB 3OWKA 3Q9YA 4LMNA 4YJQA 5C4LA 3R02A 4NTTA 4QQTA 5M4FA 4EORA 2W4OA 1ATPE 1REJA 3OEZA 5AX9A 4EUTA 4RA5A 3WF7A 3HP2A 3SAYA 3FMHA 1F0QA 3U6IA 4OTGA 2ZDUA 4OTHA 4UX9A 1I44A 5M09A 1OVEA 2XYUA 2QHMA 2Z7QA 2YZAA 3MTLA 3VHKA 3MY0A 2WGJA 4GT4A 3ZDIA 4BCPA 3TCPA 2C6LA 2C5YA 4P90A 4Y95A 1KV2A 3MH1A 4C36A 3BWJA 1U4DA 4O0RA 4W4WA 3A62A 4DINA 4KBKA 4L52A 4CXAA 4MXZA 2WMVA 5FXQA 4YGAA 3RPOA 3MSSA 3QCSA 2UUEA 4OUCA 4F4PA 4DFXE 1WBOA 5A6NA 2R0UA 1LP4A 2OXXA 3WBLA 4XG3A 5HX6A 2PY3A 2VTPA 3MTFA 3KFAA 4NFMA 5E8VA 5LARA 2B9IA 2ZOQA 1K3AA 4YR8A 1QCFA 3B8RA 2JDRA 3IECA 2HK5A 3V5JA 2W96B 2XKDA 1UVRA 1H07A 4L7SA 4LFIA 4AT3A 2W9FB 4QMWA 1XKKA 3JY0A 5TF9A 5AA9A 3QD4A 3VWAA 2BR1A 5TR6A 3PY0A 3FQSA 5IQBA 5CAUA 1E9HA 4FICA 3MW1A 1WAKA 4G31A 4OGRA 2X8IA 5EI6A 3PVUA 3P0MA 5CU3A 4H39A 3ORKA 3OVVA 3O50A 4O2PA 3C0HA 3QRUA 3R7VA 3G15A 4TWNA 4DG2E 1Q8UA 4RIWA 4TNDA 3FLYA 4EOPA 3I5ZA 1U54A 4FSUA 4N70A 4RRVA 4U42A 5CU4A 3BQCA 5EYKA 1H26A 4CT2A 4DLIA 4ZS4A 4NCTC 2E9UA 5A6OA 1ND4A 3HECA 5EH0A 3RPYA 4UMRA 2IWIA 3PFQA 5CF6A 3O23A 4GU6A 5IUHA 2FVDA 4QYFA 4B8LA 4AOJA 2W1DA 3IKAA 3K5VA 3MGYA 1YW2A 2J7TA 3RZBA 4AGUA 2B0QA 1H0WA 5HG7A 2PPQA 5L8JA 3QF9A 3UVRA 5HTIA 3OD6X 1DAWA 1XH8A 2EXMA 2WTDA 4QP8A 4R5SA 3GU4A 3DS6A 3GFEA 3VRYA 1P14A 1CM8A 2X8EA 2I7QA 2FB8A 2C5XA 1U59A 3MFTA 3QFVA 4UXLA 4GK2A 3G6GA 2C6DA 4C61A 2CNQA 4EEVA 3VUKA 4F65A 4MBJA 3CY3A 4PX6A 3T9TA 5HZNA 1KOAA 5I9YA 4HYUA 1H28A 3DCVA 4E5BA 5KMIA 3FMLA 3ZLWA 5CALA 2LAVA 3IOPA 5KBRA 4LGDA 4O6LA 4OW8A 1Q41A 4PP7A 1KOBA 3R7GA 2PVMA 4WUNA 4FKOA 2WFYA 3L1SA 4AP7A 3VS7A 1YXTA 4G3DA 3LFQA 3GC0A 3JR1A 4F1OA 4NIFB 3LMIA 3ZFYA 4FV0A 4GJ3A 5GZAA 1W82A 4BI1A 3CTJA 4USEA 4PDYA 4B9DA 2VTSA 3NSZA 4O7YA 2DWBA 5AADA 2YDKA 2PUPA 5E92A 5CEQA 1JSVA 4UXQA 3UG1A 3UIUA 3ZUTA 4FL3A 4WNOA 4O7ZA 2E2BA 3GCVA 2J0MB 3CR0A 5B2KA 5M4CA 4FNXA 3PSCA 3E93A 5H2UA 4PL4A 4EYMA 4DFBA 2PVKA 3TIYA 3DBEA 2IVSA 3CY2A 2YCSA 3MB6A 2HYYA 3EB0A 4IC8A 3AD4A 5EDRA 3KN5A 3NCGA 4RVMA 3WF8A 2HWPA 4O96A 5IEXA 2PULA 3PIYA 3EFWA 1Y8YA 3LCKA 5E8YA 4BTJA 3AG9A 1SNXA 2W5BA 4MVFA 1YWRA 4OTWA 4A9UA 3FLZA 4M0YA 3CIKA 3EQHA 1OKWA 3RKBA 2DS1A 2XH5A 3Q9ZA 4IQ6A 4MQ1A 3W18A 5IMXA 3REPA 5AP4A 3BYUA 4ACGA 1IR3A 5CU6A 4F7JA 1YHSA 3DJ7A 3TI1A 3EWHA 2X81A 2VWVA 1DAYA 4QP7A 3ZRKA 5A4TA 4RWLA 4Z7HA 2JAVA 4QQCA 1YVJA 3AMAA 1ZMVA 4ZLZA 3C50A 2YERA 4GV1A 3QKKA 1R3CA 4XJ0A 1FGKA 5IZFA 5KHXA 3LQ3A 1VYWA 4IW0A 4N6YA 5EM8A 2YACA 5AV1A 4TYJA 3Q6UA 4ZSGA 3PYYA 5JRQA 2B7AA 1X8BA 4D9UA 2B52A 4AGWA 4ZS0A 4I24A 3LQ8A 5HIBA 3MY5A 4LG4A 5I9XA 4IAKA 2VWBA 4EI4A 3BGZA 4N0SA 3U4UA 4FV2A 4W9XA 5TKDA 4NEUA 2VWIA 2BHEA 3VQUA 4ZZNA 2B4SB 2QQ7A 2O3PA 4QP4A 2OBJA 4ZSAA 4O7SA 2IZSA 3QTRA 2BHHA 2J0KA 5DG5A 4FV3A 5AIKA 3BIZA 2EWAA 3DKOA 4L8MA 4LI5A 2BDJA 3FZOA 4ZTRA 2ZJWA 3LJ2A 4Q2AA 3QGYA 4C4EA 3G0EA 3ZM4A 3LE6A 3D5VA 1ZZ2A 1APME 5IA0A 5ETCA 2W1FA 2ITYA 3MS9A 4FYNA 4MWHA 3V5LA 3GI3A 3VUDA 5E9EA 2B9HA 4UYAA 1R0EA 3HMOA 3HMNA 4GYGA 4EQUA 3UOJA 4UYNA 4ACDA 2XCKA 3UYTA 3DAJA 3P78A 2UW4A 4ZXTA 4AW2A 5KHWA 3MVLA 1IRKA 3PSDA 1Y8GA 2O63A 5LOHA 4I5CA 1WBNA 4CMTA 3TUDA 2X2MA 2WQMA 3BYMA 3DK6A 5BVKA 4R5YA 3GU6A 3VBTA 5EW3A 3KCFA 3QZFA 1DM2A 4I6QA 2XRUA 5IKWA 5CSXA 4G17A 4AN2A 2OH4A 2VTQA 3VBYA 1REKA 1IG1A 4ZY5A 4KA3A 5IG1A 2R3KA 2EXEA 4DBXA 4IWQA 1FQ1B 4GFGA 3SXSA 4R1VA 2UW5A 4L45A 3SOAA 3EYHA 4R1YA 2KTYA 2O5KA 5K4JA 3VC4A 3ZDUA 5HVJA 4C2WA 4GK4A 3OCTA 2CGUA 4FTLA 3EHAA 2XBAA 3CD3A 4CV9A 3KF7A 5IQCA 4YC6A 4B99A 3VW6A 1Q3WA 5G6VA 1UNLA 3RBWA 3L9LA 3II5A 3R6XA 5AUZA 4R7BA 2BIYA 4YTCA 3TJCA 3ZTXA 2W1ZA 2JKMA 5TOZA 4FMQA 5FP5A 3QRKA 2QOHA 3QLFA 3R9HA 4U3YA 4P2KA 1SVEA 5K0XA 3QHRA 5J79A 2R3JA 3LOKA 2JDVA 2YM5A 3FZ1A 5DBXA 4YURA 5JH6A 1VYZA 1J1BA 5D9HA 4BCJA 2QC6A 4AZWA 3D7TB 5AWMA 1UU9A 4C4IA 2QVSE 4EOMA 4OTDA 3PG3A 5LVPA 3U6HA 1WBWA 3TXOA 4FV9A 3UZTA 2H8HA 2OK1A 1YWVA 1XO2B 4AFEA 4I92A 3ZXZA 4CNHA 5CT7A 3O8UA 2C6OA 3RAKA 5HIEA 4CFFA 3AOXA 5GJGA 2ZV8A 3Q3BA 5ANGA 2UZVA 5CF5A 3BEAA 1OIUA 3NNUA 2PMLX 3KXXA 2WQNA 3HLLA 5DT3A 4YHFA 5AP6A 2WEIA 3CD8A 3EJ1A 4FG9A 4C59A 5IDPA 3OROA 4UY9A 4CQGA 3NYXA 4ANBA 3UGCA 1QPEA 1G8SA 1CMKE 5HE2A 3ZO2A 5DT0A 3BWFA 3A7HA 1PXOA 2C0OA 4G6LA 4J95A 4NM3A 4X21A 3QA0A 2YDJA 3PVWA 5FLFA 3U9CA 5L2TA 3TZMA 3EN5A 4Y72A 5CU2A 4H05A 5DNRA 3DTCA 2ESMA 3EQBA 4LM5A 2CSNA 4IJ9A 4ZTQA 2JIIA 4EH9A 2HOGA 3V8WA 3R2YA 4G3FA 4BIDA 4FT3A 1W83A 3BHYA 4BZNA 2C5VA 4RJ4A 3CPCA 4DITA 3NGAA 1PXNA 5CVFA 4NM5A 2HXQA 2QOOA 3I4BA 1IEPA 4HW7A 2X2KA 3B8QA 4FKWA 3PJ1A 4K0YA 4MD9E 4XCUA 2QNJA 3NDMA 4LRMA 5CVHA 5H8GA 4ZJVA 3FI8A 1A9UA 4E93A 4EONA 4F0GA 5L6PA 3F61A 3VW8A 4MKCA 1ZYCA 4JBOA 4E4MA 3IPHA 1UKHA 1YXXA 4BWKA 3PWDA 5AUUA 1KV1A 4EK8A 5D1JA 2FSOX 2A4LA 4XBRA 1CKPA 4IVAA 4U0IA 4G6OA 1JKKA 1OKVA 2UZNA 5BVFA 4I93A 2VGOA 3DBFA 4JDKA 4JI9A 3PA4A 5F94A 2XNNA 3BX5A 1YXVA 4U5JA 2VWUA 3MI9A 4IWPA 2AC5A 3OUKA 2Z7SA 3C4CA 3LXLA 4JJRA 4BFMA 4XV2A 5LQFA 3F2NA 4BTMA 3AC8A 4O0SA 3TG1A 3H4JA 3W2PA 2NP8A 3VUGA 2YCRA 4MWIA 2BKKA 2VWYA 3LFDA 3FXXA 4TRLA 4FIJA 2AYPA 2FO0A 3BHTA 2JDOA 5FP6A 3LHJA 4IZ5A 1UWHA 4ZSEA 3R01A 4CLJA 4FOBA 3TTJA 2X39A 2X1NA 1CKIA 2X6EA 3PJCA 4FTRA 5JFXA 5HO7A 2Q0NA 5HHWA 4BDAA 4QP2A 3QWJA 4L67A 1GZNA 2JIUA 4XG4A 3R8LA 4FKVA 2CGVA 4BCOA 5CAVA 3NUUA 2XYNA 5EYDA 4GUBA 2ONLC 2VAGA 2QOFA 3O8PA 3R0TA 4YO6A 4JQEA 1YDRE 3QD3A 1VJYA 3V5TA 4D2VA 4D1SA 5I4NA 3QUPA 1Q62A 2GQRA 4UMTA 2Z02A 2UVXA 2XMYA 4CLIA 4PDPA 3DAKA 4AACA 5FTQA 3JPVA 3ZU7A 1PXJA 2XJ0A 1NY3A 2Q0BA 4U6RA 2UW7A 3PPKA 4DH3A 2VWWA 4Y5QA 4OAVB 3BBTB 3NUPA 5ACKA 3UMXA 4E4NA 4XOZA 4EOQA 4PTCA 4E20A 1MUOA 4LRJA 3N4VA 4F1TA 1XH9A 2CLQA 2I1MA 3JY9A 5D7AA 1OPKA 3NW6A 4XX9A 3NYNA 4FYOA 3FKLA 1OB3A 3U8WA 2GNJA 4QMLA 4JIAA 4A06A 4GSBA 4JS8A 4I1ZA 2X7GA 3KRWA 5ACBC 4YTFA 3HUBA 2EXCX 2P4IA 4B4LA 3OMVA 4LOPA 4LRKA 4ASXA 5BNJA 5A4EA 5IQAA 4IC7A 3BHVA 3DQXA 5FM3A 4QMUA 2QO7A 3P7BA 1JAMA 2OF2A 2WKMA 4N57A 3R73A 4YJRA 3T9IA 1SVHA 4USDA 5A46A 5D7VA 4CMOA 3Q32A 4PDSA 3Q4UA 4TYEA 4LL0A 4WG4A 3UPXA 3GVUA 5BMSA 2PYWA 2GU8A 2VTLA 5JZJA 3FMNA 2QODA 3ERKA 3NLBA 4GUEA 4WD5A 4YO4A 2XJ1A 3H9OA 3PDTA 2BILB 4EZ7A 2IZTA 1T46A 3ZOSA 3OEFX 4Q9ZA 5IA4A 1WVWA 4WSYA 4W4VA 2OZAB 2W4JA 4K1BA 4RJ6A 4AS0A 1NVRA 4BF2A 4D4RA 4DEBA 3VS5A 2OZOA 1NT2A 2ERKA 3DFAA 5FUTA 4O0UA 1OL7A 2VUWA 3OW4A 4GG7A 3V5PA 4Y83A 5IQHA 4RT7A 2JITA 4RGJA 3KF4A 3K3JA 3KXZA 1PXIA 3N9XA 2V7OA 4CKRA 2UV2A 3EN7A 4I4FA 4IXPA 3B2TA 1XBCA 1M7QA 2X6DA 1YWNA 3ROCA 3ZLSA 3ET7A 5CNNA 3O7LB 3A2CA 4JRNA 3FXWA 2PZRA 4LMUA 5EI8A 4DGGA 1DS5A 4L3JA 2YJRA 2YLFA 4WA9A 4XBUA 2V0DA 2EVAA 3ORMA 1KE7A 4NTSA 5EI2A 5AR2A 5FG8A 4R3CA 5J9LA 3DLZA 1HCLA 4FK3A 4MQ2A 3TJDA 1PMNA 3F9NA 3IW7A 3MB7A 3RGFA 3ZCLA 4G5PA 4F1MA 3BQRA 4YSMA 2I0HA 1TQPA 2YWVA 4KD1A 2RSVA 2YLEA 4BR3A 2C6EA 3FHIA 3WZUA 3PJ3A 3NVKI 4E5AX 2LGCA 4BBMA 4C3PA 2R9SA 2XK4A 3VS6A 1OM1A 3Q52A 2V7AA 3W2QA 5CSPA 3RMFA 4J52A 3VHEA 5B2MA 3ZO3A 4FTQA 4I94A 3MH2A 5JGBA 2C5OA 2A19B 2JAMA 4O0VA 4F6UA 3P1AA 2PK9A 3DKCA 4ZIMA 2WTIA 5A4LA 4HCUA 3BU6A 2A1AB 1PXMA 4IEBA 2XKCA 4RWJA 2IW6A 2C1BA 2R4BA 1U46A 2QO9A 3I60A 4ORKA 2PUUA 4U40A 3QQHA 3KKVA 5AUXA 4KSQA 2JDSA 3CJFA 4S2ZA 3EL7A 2YN8A 4KIOA 3MDYA 4IJPA 4KKEA 2XIRA 4HNIA 3ALOA 3QCXA 4PL3A 1BX6A 2CKPA 3UVQA 4BCMA 3R1NA 2X4ZA 4RC2A 5GJFA 2WB8A 5DMZA 5DWRA 2I0YA 2UZTA 1Q5KA 3F88A 3ZRMA 1WVXA 4CTBA 4AXAA 3LFNA 2IJMA 3D2IA 5FRIA 5C01A 4ZTLA 2GS6A 2JGZA 1Y6BA 3DV3A 3PLSA 4KIPA 4V01A 3ZUVA 5LVMA 3R1SA 4WRSA 5KMNA 4ANLA 2C47A 2GFCA 3MWUA 4HYHA 5I3RA 1JKTA 2QURA 1XBBA 2YM3A 3DOGA 3V8TA 3KC3A 2QG7A 1OECA 3GENA 1YI4A 4M0ZA 3VJOA 3OW3A 4NH1A 4S34A 3FZSA 3UTOA 2ZV7A 1FOTA 2VX0A 3GU7A 3FLWA 4GMYA 1R1WA 2H96A 2XM9A 4TZRA 4CZTA 4RG0A 2BZIB 1CDKA 2RKUA 3LCTA 2WD1A 4XV3A 5CS6A 2UZDA 5HLNA 4CMUA 2B9FA 4LUEA 2BROA 3HL7A 3OFMA 4JNWA 4IBMA 4KIQA 2GS2A 3ORXA 4KRCA 3UOLA 4F9CA 1GAGA 3EOCA 4JX7A 3Q4ZA 4DTKA 3PLAE 1YI3A 3I7CA 2YIWA 3C4FA 2VTOA 2WMAA 2YAAA 4EZ5A 2HAKA 5DHJA 4YZBA 5K4IA 3C4ZA 1GIHA 1H00A 3BU5A 4BYJA 2Y6OA 2R3LA 2GFSA 2BZKB 3D7ZA 2ZAZA 4WSQA 1B6CB 4C8BA 2B9JA 4RIYB 3VBQA 2C4GA 4BTFA 3ODYX 4FKUA 4GJ2A 3D7TA 1GZ8A 4IZ7A 4YBJA 2HZNA 3SX9A 3KK9A 3BHHA 3NX8A 4GEOA 2CN8A 1UNGA 4HPTE 2ZM4A 3QX2A 4L43A 5DGZA 3TZ7A 1JOWB 2C30A 4RPVA 3HMIA 2I40A 4UMUA 1MRYA 1YQJA 2XM8A 1PF8A 3NR9A 4PPBA 5AUYA 5C9CA 3GBZA 4C0TA 2HZ4A 2OIQA 4GFOA 3CE3A 5EW9A 3VQHA 3IW6A 4E3CA 5CQWA 2F4JA 5HBEA 2G2HA 4M69B 3RZFA 4UALA 5A4CA 4HVHA 1YHVA 2ERZE 2W9ZB 4BGGA 4BWXA 1B39A 4TYHA 3RAIA 3ZFXA 3I6UA 3ZH8A 1XH5A 4RFMA 4YNEA 2RFEA 5CX9A 3EZVA 4CZUA 2VO7A 1PKGA 1YDSE 4JQ8A 2BAQA 5KBQA 2BAKA 2RFSA 2JEDA 3CQEA 4W8EA 2H6DA 3W1FA 3EQRA 3TNIA 4XYFA 2WOUA 3E5AA 4O27B 3ZHPC 1TKIA 5LMKC 3ANRA 4JBQA 2QOQA 5TT7A 3E7VA 2HIWA 4X2NA 5KMMA 3HMMA 3OC1A 4Q9SA 3HV4A 4GH2A 2UW8A 1QMZA 1UA2A 3HP5A 3EQIA 1KE9A 4DFUA 4BCNA 4IE9A 4NKAA 5EHOA 3UO6A 4FVPA 1JNKA 2X4FA 2CPKE 3EQDA 5HCZA 3CGFA 4M68A 4G5JA 1ZYDA 1I09A 2OJ9A 3DXQA 2R3NA 2PTKA 1NA7A 4PNKA 3IW5A 2WXVA 1T45A 2ITZA 3F5GA 3RI1A 4F0FA 3ZONA 1HCKA 3MIYA 4FG8A 3R22A 4A9TA 4F7SA 4BC6A 4HVGA 4DF3A 2IVVA 3LKMA 4QOXA 3S00A 4F70A 2VTAA 3KY2A 5AIRA 3FDNA 2BKZA 3QUEA 4YHJA 3GOPA 1H25A 3FPQA 1FINA 3O71A 3ZEWA 1ZWSA 3DDPA 3HUCA 2WELA 3KXMA 5EK7A 2WMBA 4NCTA 4XG6A 3PIXA 5FTOA 4QRCA 4BI2A 2WEVA 5GINE 2GMXA 3OXIA 5M55A 1OUYA 4X6RA 4AWIA 5AA8A 1ZYJA 1H1QA 4C02A 5LCJA 3K54A 4FKSA 4FT7A 4YZCA 3A61A 3RWPA 3SQQA 3DKGA 4S30A 4IHPA 4EH6A 4ANQA 3QKMA 1GIJA 3GB2A 1V0PA 3FPMA 3M11A 4WKQA 4ZTNA 4F9YA 1CTPE 2XKFA 4HYIA 2X7OA 4LL5A 2XVDA 5D10A 4QO9A 2X9EA 1EH4A 3R8ZA 3PJ8A 3F7ZA 5HU9A 4IIRA 3DZOA 2OIBA 4JOAA 3ROYA 5HX8A 1WBSA 3S4QA 1M2RA 5TE0A 2W1EA 4MD8E 3QQLA 2WIHA 3F5XA 2JKKA 3C51A 3E92A 3GOKA 3P9JA 2A27A 5IUIA 3VF9A 4B0GA 4IDVA 4AG8A 3LJ0A 2ITPA 3R8PA 5CNOA 3D5XA 4BIEA 4Z3VA 2XNGA 2F9GA 4ANNA 5CXHA 4AUAA 3RAHA 1M17A 5F9EA 3Q96A 4O6EA 3VS3A 4A4OA 2WTKC 4JVGA 3FWQA 2A0CX 4X2JA 4WBBB 5CSHA 3L9MA 1WBPA 3HEGA 3HX4A 3KMWA 3QBNA 3SLSA 3F5UA 4BDBA 2E9NA 4YJOA 2ITWA 3FSKA 4PQNA 3V01A 4IB0A 4IAFA 5IQFA 2C68A 2RG5A 2B1PA 4KB8A 5DA3A 3DBDA 3EN6A 2PVLA 3OWPA 4EH5A 1V1KA 5DE2A 3AD5A 4XNEA 1GOLA 2W7XA 3I7BA 1Q99A 2BMCA 1UU3A 2OZAA 3JXWA 1UU7A 5EOBA 3DGKA 3GCUA 3UOKA 5KNJA 3UYSA 1PMVA 5EQPA 4EZ3A 2BTSA 1WCCA 3CKWA 4I23A 2UZEA 2WIPA 2JBPA 3LFEA 1NXKA 2SRCA 3QTZA 4LGGA 5KE0A 4MH7A 4GIHA 4N6ZA 3E88A 4GS6A 4QPAA 4MCVA 4YU2A 3QX4A 4BBEA 4H3PA 5EG3A 5CEOA 5EDPA 1PW2A 3FL5A 4EOJA 3BU3A 2BALA 3LVPA 4K77A 3KA0A 4MYGA 1NVSA 1W98A 2QI8A 4MX9A 4U41A 1E1VA 4U81A 4QMNA 2W5HA 4WO5A 4Y5HA 4FKPA 4HZSA 2AUHA 3OZ6A 4GVAA 2P2HA 3IDCA 3HVCA 3QA8A 4FV8A 4IAIA 3NYVA 5DYJA 3AGLA 2REIA 3KMMA 4HYSA 4AAAA 1TQMA 3R71A 4BDKA 1RQQA 2YJSA 3IDBA 3Q4TA 2O64A 4EH7A 4YSJA 2VTTA 3BELA 5HVKA 4V0GB 4YJUA 2YIRA 3JS2A 4XH6A 4BTKA 3MH3A 1U5RA 4O1PA 5EM6A 3R7YA 3V8SA 3R9OA 3IQ7A 3TZ9A 4OTFA 4Z9LA 4QTDA 2W1HA 3LM0A 2ZM1A 3NNWA 4BDCA 5GIPE 3D94A 4FTIA 2ITVA 4X6QC 2WO6A 2VX3A 4CFXA 5M53A 2UZWE 2R64A 4TWOA 1WBVA 4C3RA 4CT1A 4RC4A 2G9XA 4IAAA 4R3PA 3QUDA 4F6SA 4L9IA 2FUMA 4FC0A 2R3PA 3DTWA 4FNZA 4ID7A 4U3ZA 5AAEA 2I0VA 4I21A 3GCSA 2JD5A 2FH9A 5IA2A 4I6FA 4NW5A 1OL2A 5IEVA 1CKJA 3SW4A 4FTAA 3TNPC 4EOSA 4ACMA 4GL9A 4CCUA 4QTCA 1PXPA 3HV6A 1H4LA 4A9YA 4FKGA 4BDGA 3F3WA 3RHXA 5EKOA 2QG5A 1TQIA 4IX5A 3K3IA 1S9JA 3KXNA 4FV1A 3TN8A 4WNKA 1PKDA 5GHVA 3UIBA 4R77A 4XRJA 4HOKA 5HE1A 1H8FA 4MAOA 1O6LA 2W1GA 2PE1A 4C3FA 3CS9A 2PE0A 3F5PA 4UB7A 5D12A 4AZFA 5AR7A 3ORTA 5CI7A 5ANJA 5EW8A 4CG9A 5FEQA 3LLTA 4WIHA 2HY0A 2OI4X 3SXRA 3PZHA 4ANSA 5BPYA 3S1HA 4X3FC 4ALUA 5JFSA 3R83A 3CTHA 4NSTA 3RVGA 4LQMA 3O8TA 5CEMA 2JKOA 3G0FA 4L00A 3FC2A 3NNVA 3C9WA 5DH3A 4DFYA 3Q2JA 3UQCA 4XV1A 2GHMA 3RPRA 2XK3A 5CXZA 4BCKA 3FMMA 1BMKA 4O91A 3D9VA 4YHTA 4ZZMA 4L42A 4FEUA 1AD5A 3KXHA 1W8CA 4FV6A 4BKJA 3FMEA 5FQDC 4DYMA 3DFCB 3CKXA 5AM6A 4I6HA 4RIYA 2XK6A 4WT6A 2C69A 3LFSA 5IH6A 3PZEA 3QYWA 5HICA 4CGAA 2CN5A 2JLDA 3PUPA 5T6KA 5KZIA 1PY5A 4X7QA 4IVDA 5HU3A 4F6WA 3RK5A 1XH4A 1ZMWA 5L2WA 2ITXA 3PP1A 2IN6A 3LFCA 5D41A 5BVNA 2QU5A 4JT3A 5AX3A 2ZM3A 4FZAB 1QPJA 4UWYA 3QC4A 2XBJA 5DR9A 5JRSA 3WI6A 4YPSA 4BHNA 1FVVA 3P08A 3PXKA 4XMOA 1P4FA 4APCA 1HOWA 5C03A 3GEQA 3MFUA 4M69A 4HVIA 2OKRA 4DE4A 2AC3A 4ZTMA 5A54A 3VS4A 2PZYA 4XRLA 5JK3A 3P7AA 3B2WA 4L46A 3NZ0A 4G3CA 4NM0A 5ETIA 3WE4A 3SW7A 4PF4A 3HYHA 3G90X 5E8TA 4U80A 5HVYA 5J87A 3W16A 3EIDA 3FKOA 3FSFA 3U51A 5ICPA 5JMSA 5GZ8A 3VNTA 4ITJA 5CASA 3RPVA 3LLAA 4IX6A 4KINA 2G1TA 1LEWA 1WMKA 5CF4A 3UNKA 3VIDA 5J9ZA 4G2FA 3RP9A 4AZSA 4UBAA 4IAZA 4FIEA 4PUZA 5AP1A 5M44A 4L6QA 3FKNA 4PY1A 3ATSA 3AGMA 2BDFA 3WZKA 5KO1A 3P5KA 3MA6A 4HNFA 1NVQA 3EMGA 1Q61A 3QC9A 4J7BA 4UZDA 4WHZA 5JN2A 4DT8A 4QP6A 3F2AA 3QTXA 2R0IA 5K3YA 5J9YA 4O84A 3Q9WA 5EFQA 3A8WA 4RVKA 5M08A 3UNZA 4DA5A 2P0CA 3ZC6A 1ZXEA 4FSTA 3N51A 4AW0A 4O7RA 5HTCA 3QRJA 4WG3A 1ERKA 3R63A 3PRIA 3LJ1A 2YM8A 1U5QA 3VS0A 3BGPA 4XEYA 4BI0A 5GIOE 3VBWA 2ZV2A 3MA3A 2P55A 3W8LA 2Y4IB 4V04A 4BZDA 2FSTX 3C1XA 1PMEA 4ZY4A 1LPUA 1KSWA 3C4WA 3QYZA 2VTNA 2ZB1A 2J5FA 4RWKA 5BUJA 4MNEB 3P7CA 4DEGA 1MQ4A 4FT9A 1Q8TA 1UNHA 4AU8A 3N4TA 4RLKA 3R8UA 2W05A 3KULB 4DEAA 4QYEA 5M56A 1GNGA 2ZDTA 2XZSA 3NVMB 3FMDA 5KMJA 4GT5A 3WARA 2PVNA 1P4OA 3PXRA 4RFZA 3NUSA 3SRVB 4WBOA 4XS2A 4IB3A 2XEZA 2R3MA 4JAJA 3MFRA 3L8XA 3QCQA 3RTPA 4E5WA 5LXMA 3IGGA 4DTBA 4O7LA 3QZHA 2W5AA 4RVTA 2UZOA 4O0WA 4EQMA 2VTRA 5KZ0A 4G9CA 2J51A 2QOKA 3G9NA 5CEIA 4G1WA 2PVJA 5M07A 3K5UA 4KIKB 3UPZA 3MFSA 4PV0A 3VULA 1F3MC 3DA6A 1M7NA 4GK3A 5F1ZA 3H30A 1PJKA 4DH5A 4I5HA 3POOA 3UC4A 4AZEA 2OG8A 3FY0A 4RQVA 4TYIA 5HG8A 5L2QA 4ZTSA 2WTKB 3OXTA 3IONA 1ZOEA 5I9WA 4EHVA 4ZLYA 3NUXA 4EK5A 4M84A 5IUGA 2RFDA 5L8LA 4AT4A 2ITQA 3EQGA 4C35A 3D83A 5KCVA 4FF8A 3THBA 1DI8A 3RCJA 4F09A 3PY1A 4AE6A 3FLNC 1WFCA 4FZFB 4TT7A 4BY9E 3IDPA 4YZ9A 3FMJA 4FTCA 2W17A 2HCKA 2HZ0A 3CLYA 3R7IA 4BKYA 3BKBA 1RW8A 4M15A 5L2IA 4AGDA 2XK7A 1J91A 3FZPA 3QZGA 2OFUA 5JFWA 4CFNA 4F9BA 3LFFA 1G5SA 3O0GA 4LYNA 5T68A 3GU5A 3QCYA 2PSQA 5ANOA 4DC2A 4CG8A 1H1WA 4AX8A 3ZO4A 2G2IA 3COMA 1ZZLA 2CCHA 4O1OA 5DT4A 4XP3A 3UQFA 3GC9A 4U9AA 1M2PA 2Y4PA 2BRBA 3D2KA 1H24A 4U45A 2XIXA 4IFCA 3F3UA 3T3VA 4JL9A 3ORPA 1H01A 3QTSA 5I9UA 5E7RA 3PA3A 4GVJA 3TNQB 4QPMA 2WMRA 5HD7A 3H0ZA 2CDZA 2I6LA 3BV3A 4WUAA 3ZYAA 5LVOA 3QZIA 2UVZA 1J7LA 3ZO1A 4TL0A 2OLCA 4O83A 3HNGA 4QTAA 3KRLA 3DB8A 4ASZA 4NJDA 1CSNA 2OJFE 3E7OA 4G3GA 3MVMA 4BKZA 4XP0A 3GC8A 1BI8A 4M12A 4P5ZA 3OOGA 4U79A 3ZSIA 5LVLA 1Y57A 2RG6A 2VNWA 4V0GA 3QAME 3UQGA 4IZYA 4F63A 4QP9A 4A07A 5C4KA 5I9VA 4FSWA 1FGIA 4NIFA 2WU6A 3ZUUA 1JWHA 2YEXA 4ENYA 3JYAA 4QNYA 3PJ2A 3TDWA 3G33A 2F7EE 4BWPA 4BDEA 4GKHA 1P2AA 5EYCA 3R7UA 4ERKA 2GTNA 4QMTA 4ZZOA 3ZZEA 5CSVA 5IISA 5E8ZA 4DG0E 3E63A 4OAUC 4AOIA 2FGIA 5E90A 5EYMA 4DEHA 3FY2A 2W06A 2VO6A 4RBLA 5DRBA 3U54A 4FIIA 3QTWA 2JDTA 2YFXA 4MXYA 1WVYA 3BYSA 4FEQA 3BEGA 3TL8A 2J2IB 4Z16A 1YKRA 1JVPP 3QTIA 3UNJA 3KL8A 5IPJA 5EQEA 2EB2A 3UG2A 4EQCA 3BHUA 4F64A 2XA4A 5HNBA 3V6SA 5ANKA 5EM7A 3W2CA 2C3IB 4E1ZA 2R2PA 3AC1A 2F57A 4EHEA 3HV3A 2VTJA 3IK3A 2HWOA 2HENA 4FL2A 4II5A 4S31A 1J7UA 4C62A 1QL6A 5JGAA 5E1SA 4YMJA 5M4IA 3I6WA 4FEVA 4DEDA 3SDJA 4X3FB 2NNWB 5C27A 4RSSA 4FI1A 4DH8A 2CCIA 4FUXA 1OKYA 4R3RA 4HGLA 1YOLA 2XRWA 5FDPA 1XWSA 1PHKA 3FHRA 3AQVA 3GXLA 2V5QA 3R21A 4O22A 3BI6A 4ALWA 4CRSA 2VRXA 4XHKB 4WNPA 3FUPA 4ACHA 1MRUA 2WTWA 3SKCA 4D2WA 4DEEA 1ZARA 3WF6A 3VBXA 4J98A 3RK9A 3ALNA 4NUSA 4EWHA 5IQIA 1DI9A 5JGDA 2PWLA 1BYGA 5JQ8A 2YAKA 4FR4A 2PMNX 1A06A 5C8KA 1FMKA 4DCEA 4RWIA 4C33A 5FEDA 4ERWA 4ANOA 5FD2A 2QLQA 2R3RA 1PXLA 4FEXA 4MHAA 1JKLA 1O6KA 2BRGA 5CTPA 4FT5A 3KB7A 1IAHA 3SOCA 2IO6A 4RZWA 3QQGA 4H36A 1ZOHA 5HLPA 2XB7A 4CEGA 4ARKA 3E62A 3E8EA 2IW8A 2UZLA 1KUTA 5K5NA 1ZY4A 5BVWA 4XUFA 5CEKA 4YPDA 2XNMA 1Q97A 3HGKA 2ETKA 5L4QA 2W1IA 4D2PA 2VN9A 4XV9A 4DGMA 4GU9A 4JRVA 4TYGA 1ZY5A 5AAFA 2ITOA 2OH0E 4MTAA 4FSYA 2GNGA 4F9WA 5LWNA 4TKSA 5LMKA 3I79A 4E7WA 3QD0A 1OIQA 3UMWA 3SC1A 3MESA 4BCGA 4HGSA 3FJQE 4BZOA 3IW4A 4I0SA 3A8XA 3H0YA 4FTKA 2BVAA 2QKRA 4KS8A 3QQFA 2Z8CA 3TTIA 3Q53A 4FX3A 2B55A 3GUBA 3U6JA 5HIDA 1YXUA 4FA2A 4GW8A 1H1SA 3U55A 4UWBA 2QHNA 4A4XA 1JLUE 4A7CA 3C0IA 3LFAA 3OOMA 4TY1A 1WZYA 3C5UA 3EN9A 5G1XA 4B8MA 2GNHA 2E9PA 3HZTA 5EOLA 4ASEA 3SA0A 3D14A 5T3QA 3RK7A 3VBVA 4CFUA 4QP3A 4D9TA 4ZY6A 3V3VA 3AT4A 4ITIA 5AP2A 5CZHA 3LFBA 3DDQA 4IM3A 5AR4A 4PDOA 5FEEA 4ZMFA 3PPZA 5L6WL 4C2VA 4AZVA 4KUJA 5CENA 3V6RA 4BCQA 2C1AA 2UVYA 5HCYA 4R7IA 4DFNA 2RL5A 4FIGA 2GNLA 2CJMA 2YCQA 3ORIA 2IZRA 2VWZA 2WMWA 2B53A 4RX7A 4EKKA 3LXKA 3BV2A 4KSPA 5IA5A 5M4UA 2YZLA 3PA5A 3OY1A 2Y9QA 5CAQA 5L8KA 5CYIA 2BPMA 3CC6A 5AJQA 3WYYA 3F3VA 1OIRA 3QWKA 2VGPA 4TXCA 5HGIA 1FPUA 3KULA 5DLSA 4MD7E 1Q24A 4GCJA 5E91A 5CLPA 4MXCA 1LUFA 3OCSA 3LIJA 3NAYA 4H3QA 2QOBA 4E6DA 4I22A 4M97A 3PXQA 1WBTA 3C4XA 3DXNA 1OL6A 4PMSA 3P4KA 4IVCA 5AFVA 1JPAA 4J97A 3DNEA 4ZTHA 2KULA 4FIHA 4IANA 3MYGA 4JDJA 4PTGA 1ZMUA 3ATTA 3QD2B 5DR2A 3TV7A 3RHKA 2YDIA 4ZJIA 3OUNB 3KN6A 1OKZA 4EC8A 4L44A 2XIYA 3FI3A 2WAJA 5A14A 3NNXA 2R7IA 3TUBA 4GFMA 4CVAA 3E87A 2R3IA 4D2TA 4EYJA 2PUIA 4H1MA 4Y73A 2R3GA 3RAWA 2PZIA 5LMBA 3TT0A 2J90A 3R1QA 1H08A 4OBQA 4IWOA 4YNOA 3O51A 2IW9A 3CCNA 3CTQA 3A4OX 5ANEA 4L01A 3R30A 2DYLA 3D15A 4BVUA 4CD0A 1BI7A 4B6LA 2IG7A 3HMPA 4JBPA 3WZEA 1FVTA 5L6OA 4PMMA 5CQUA 4D4YA 4XG8A 3BBWA 4BDIA 5BQ0A 3R8VA 1J3HA 3PRFA 2R3HA 1FMOE 3QLGA 4RIXB 4YLKA 3VUIA 4E4XA 1XH7A 4EH3A 4DLJA 1H0VA 5K5XA 3NIEA 3PVGA 4C38A 2IZUA 1Z57A 3VO3A 3JUHA 2WQEA 2CLXA 4RJ8A 5IQEA 4CV8A 4FG7A 1IA8A 5JZNA 4ZLOA 3Q60A 3EKKA 2Y4IC 3EFJA 3CJGA 4CKIA 1GJOA 1IASA 3M2WA 4NWMA 3G51A 4CKJA 4MK0A 4YJSA 4Y46A 3ZZWA 3P23A 1SM2A 3NW5A 4FODA 4FTTA 5JFVA 3PXFA 3QALE 3ORLA 4JG7A 4M7IA 4ZAUA 5KUPA 2JIVA 4QP1A 1YOJA 2Z7LA 3GCQA 4ZSJA 3O7LD 2PE2A 4UV0A 4D1ZA 3R2BA 5HQ0A 4YP8A 4DN5A 3S0OA 2PHKA 4L3PA 3TV6A 4B7TA 3RM7A 1LR4A 4USFA 3CSVA 4JAIA 4O0TA 5BUIA 4DGOA 2NPQA 4W4YA 4Z55A 2YIQA 2QCSA 3A60A 3O96A 3DQWA 2OXYA 3F6XA 4FK6A 1YDTE 3I5NA 4IX4A 5HD4A 5IA3A 3UZRA 3GQLA 4LUDA 4FUYA 4YZDA 3HRBA 4FKTA 4BCIA 5IF1A 5DI1A 2V22A 3I0QA 5DRDA 5J1VA 4R8QA 2IVTA 4Z7GA 1Q8YA 2F7ZE 5BX0A 4FVRA 4F99A 5HNGA 2J4ZA 1VZOA 2UW3A 2VZ6A 5DN3A 3FAAA 4NZWB 4YLLA 4ITHA 2DQ7X 4X2KA 2E9OA 3DAEA 4C4GA 3TEIA 2WHBA 3ZXTA 2W1CA 4O7NA 2WMXA 2XK8A 4DGLC 1XJDA 4RJ3A 3G5DA 3I0OA 3UIMA 5C8NA 2XIZA 5FWKK 4AGCA 4XLVA 3W10A 2ZYBA 2QKWB 3DT1A 5F4NA 1JSTA 3H9RA 2OF4A 4EBVA 4V05A 3QQUA 3LMGA 4TTHB 3UVPA 3JVRA 2WTCA 4EL9A 5HBHA 2YIYA 2XUUA 4IM0A 1GIIA 1JKSA 4U7ZA 3V51A 2GHGA 3WF9A 3FMKA 4DHFA 2B54A 3ZEPA 1Z5MA 5AP3A 5J95A 3WILA 5BMMA 1RE8A 3K2LA 3VUMA 3FLSA 5IA1A 5AP5A 3DU8A 3ZS5A 4TW9A 2XKEA 5AEPA 4Q5HA 2OJJA 3RPSA 3QRIA 4MXOA 2R3QA 4CSVA 3ORNA 3WIKA 3OHTA
chains in the Genus database with same CATH superfamily
2PU8A 3SG8A 4HVSA 4IB5A 5AV3A 3EFKA 3M42A 4AA4A 4KNBA 2BRNA 5DR6A 2QONA 2WQOA 2H9VA 4PPAA 4NYEA 4FV5A 5J8IA 1ZYSA 5GZ9A 4TWCA 3AD6A 4XG7A 3FYKX 1KWPA 2HELA 4HGTA 5EM5A 4IZAA 3VS1A 2J0IA 4S32A 5CT0A 2C3KA 2UW9A 2XNPA 4X3FA 4FGRA 4WG5A 1SVGA 1W84A 3DXPA 3DBCA 3EN4A 3FQHA 4FSQA 4K11A 4NFNA 3R00A 4QYHA 3RJCA 5FXRA 5IMEA 3QQKA 2XNOA 5ITAA 3LM5A 3D5WA 3KEXA 4ZEGA 4JIKA 3Q9XA 5M57A 3R9RA 5IQDA 3TDVA 1L8TA 3ORZA 5AR8A 4DH7A 1Q4LA 3BZ3A 3DZQA 4JR3A 2XARA 4O86A 3NMUF 4NKSA 3ZMMA 2CGXA 3TNWA 4DFZE 4E26A 5CAOA 4D58A 3BL9A 4FV7A 3F3ZA 3GC7A 5IH5A 4D55A 2C3LA 3R28A 3R9NA 3OG7A 3WIGA 3PE1A 4XG9A 3C4EA 4KBCA 5K0KA 3L8PA 4I0TA 4IVBA 5HI2A 5CF8A 3TKIA 4KBAA 3F3TA 3ODZX 3MBLA 4RX9A 5KMKA 3CPBA 4K6ZA 2GSFA 4QYGA 2OGVA 4FTOA 2FYSA 3AC4A 4I5MA 2JFLA 5L3AA 1OIYA 4F08A 3Q2MA 5AUWA 3EYGA 5CU0A 3I1AA 4F7NA 2BZJA 2WMTA 3HA6A 2PVHA 1OBDA 4YZNA 4Q5EA 4GT3A 5KKRB 4EK3A 1BL6A 3OCGA 4LGHA 5E8XA 4A9SA 2ZVAA 3DK7A 4O7TA 2CMWA 2YABA 3QKLA 2VTIA 3OTUA 2VV9A 4IWDA 3UO4A 3C5IA 3EQPA 5JSMA 3N4UA 4CFMA 4O81A 2VWXA 4NW6A 1XBAA 1BUHA 3L8SA 2HW7A 4FKQA 3HV5A 2CHLA 4FVQA 4RIOA 3UOHA 3MV5A 2ACXA 4D4VA 4EJ7A 4D0WA 2VO3A 1JQHA 4CYJA 2Z60A 2VTHA 2VNYA 4CFVA 2GQGA 4NT4A 3RNYA 3LCDA 4AW1A 4DFLA 3A7IA 5HESA 3FYJX 5HO6A 3UBDA 3KREA 3CP9A 3DJ5A 2O2UA 3UP7A 4RX5A 4MEDA 2XANA 3F2RA 3QXOA 1IA9A 1VEBA 4RFYA 2X2LA 3ZSGA 3R7EA 1XH6A 4D2RA 1PMUA 2VU3A 4IDTA 5E8UA 4AN9A 3OT8A 4I5PA 2J0JA 5ANIA 2NO3A 5AM7A 5H9BA 3VS2A 3OT3A 3PXYA 4QYYA 3W0RA 2UW0A 4L68A 4XG2A 2BIKB 3UC3A 3CQUA 4QNAA 2PZ5A 5HOAA 1RDQE 3G9LX 3R9DA 5A9UA 3MJ2A 2ITNA 4G34A 2G15A 3CBLA 4IM2A 1OL1A 3FL4A 3C13A 4PP9A 4X2GA 5HLWA 2ZV9A 2C3JA 4NJ3A 5J5TA 1L3RE 3G6HA 4H1JA 4RA4A 5E1EA 3BLHA 2QR7A 2C0TA 4FTUA 4DT9A 3C0GA 3AMYA 3AKLA 3BYOA 2NRUA 3TIZA 5AUTA 3TV4A 3W2OA 2JKQA 1Q8WA 5AP0A 4QMVA 4BGHA 4YTHA 5DVRA 4ENXA 4IADA 3FLQA 3R04A 3GGFA 4EWQA 1G8AA 1TVOA 5AV2A 5HO8A 4KKGA 2W0JA 5IH4A 2OIDA 4IH8A 4O38A 1SMHA 4GKIA 3ZC5A 4EOKA 5HG5A 2V62A 1M2QA 5AMNA 4BIBA 2CNUA 5HE3A 3OWJA 4O2ZA 5IU2A 5FM2A 5CANA 4FEWA 3P86A 3UZPA 3COKA 4YBKA 4EHGA 3QL8A 4FRFA 4BICA 5GJDA 3E8DA 3P79A 4IFGA 4D5HA 1FVRA 2P3GX 3DKFA 2UZBA 3H3CA 3I81A 3V5WA 3BE2A 2QR8A 4ASDA 2PMIA 4FKRA 1P5EA 3MJ1A 4O4EA 4I3ZA 3CEKA 2BCJA 2OW3A 3UDBA 1S9IA 3GU8A 4OR5A 3FV8A 4AF3A 3NUAA 4AXCA 3EKNA 4FZ7A 1KE6A 2W4KA 3GP0A 3AXWA 5E8SA 2BRMA 2UW6A 4EH4A 1OL5A 2VX1A 3MPTA 2G2FA 2X8DA 4F0IA 2E9VA 5KMOA 5A3XA 2H34A 4FSNA 3PE2A 4J8NA 4PMPA 2BUJA 4DGNA 4ZOGA 2FA2A 3RALA 3EZRA 3D0EA 4KAOA 4CTCA 1ZYLA 4RIXA 2I0EA 5CVGA 4D2SA 2F2UA 4OT6A 5DPVA 5H8BA 1B38A 3KVWA 5M51A 5EDQA 1URWA 2GNIA 4E4LA 3TACA 4CYIA 5HCXA 3RM6A 2WNTA 4E6CA 4AE9A 4J8MA 4DDIA 4ALVA 5HE0A 3ZM9A 5EQYA 2XCHA 3EQCA 4GYIA 4P4CA 2C5NA 5EHLA 3F82A 5IDNA 1NW1A 3NFFB 1R0PA 2C6KA 3CQWA 4UMPA 1V0BA 5EKNA 3PSBA 2HW6A 3UJGA 3GNIB 3ITZA 5BUEA 2ONLA 3V5QA 4J53A 4KKHA 5KX8A 1GY3A 1QPCA 4DTAA 5FBNC 4D1XA 5BYZA 5CEPA 5LVNA 4C34A 4ACCA 4WNMA 1SNUA 2A2AA 2OFVA 4O4FA 2YISA 3M1SA 4QQJA 3T8OA 2J0LA 3OP5A 1JSUA 3ENHA 2CKQA 2RGPA 4QPSA 4D4SA 3C7QA 4IAYA 4DAWA 1OGYA 4I6BA 3NWWA 4BCFA 3O5AA 4JG6A 3PVBA 2BFXA 4JBVA 4EH8A 3NYOA 4EKLA 1OBGA 2Y6MA 5DOSA 4FGBA 3HAMA 2RIOA 3ACKA 4QMXA 1K2PA 2XP2A 4PPCA 5A4QA 4ZMEA 4TYHB 4I41A 1MP8A 5BYLA 4WRGA 3VUTA 1PYEA 1JBPE 4YTIA 2C6TA 4C7TA 2WTVA 2OICA 5C8MA 4MF1A 1A48A 1KE5A 4IB1A 3LPBA 2O8YA 3NW7A 4TNBA 4EJNA 3E8NA 3F66A 5AV0A 5J7BA 5KMLA 3AC2A 4JR7A 3COIA 3KMUA 1AQ1A 4M3QA 1XMLA 2YITA 5L2SA 5LJJA 3SXFA 2PVYA 3LXNA 4H3BA 3NUNA 5M06A 3A7JA 3AT2A 5LMAA 1GZKA 1OZ1A 5TO8A 1UV5A 4HCTA 4XP2A 3L9PA 1H1RA 2XNEA 4FSRA 4EOIA 1IAJA 3GCPA 4D5KA 2BZHB 5FDXA 5AR5A 4UWCA 3AKJA 4G9RA 3S3IA 3SG9A 2ZMCA 1PXKA 1RJBA 4L3LA 3FXZA 3DJ6A 3QTUA 3FZRA 4YJNA 4FOCA 4R6VA 4A9RA 1G8KA 4K2RA 4QMPA 2VD5A 5EHYA 5BYYA 5C26A 5JEBA 3DBQA 4D0XA 4P5QA 3O17A 3KRXA 3ID6C 3E64A 1H1PA 4BDDA 4AQCA 3UDSA 4M67A 4GG5A 4NU1A 1QPDA 1Y91A 5E4HA 5CZIA 3U4WA 3OWLA 5CAPA 4QMMA 2Q83A 2QU6A 3QXPA 5HNIX 1GZOA 3IW8A 3OCBA 4RLLA 3UP2A 4CQEA 3E8CA 3MIAA 3MVJA 4XLIA 3MPAA 1M52A 4I4EA 3DB6A 3AT3A 2OSCA 2VO0A 2XS0A 4HZRA 2C6IA 2YWPA 4U8ZA 2WOTA 2WZJA 3TKHA 2OXDA 5FGKA 4LOQA 3RNIA 5FXSA 1Q3DA 2O0UA 4YJVA 5H3QA 4QD6A 1F5QA 4ZK5A 4YZMA 1XHAA 4DH1A 2F2CB 1OPLA 3KK8A 1ZAOA 4OBOA 4OTIA 4AT5A 4BYIA 4AFJA 2RFNA 2XEYA 5I9ZA 3KCKA 4UEUA 5HBJA 3CGOA 5AAGA 1AGWA 1XQZA 5LWMA 3WYXA 1MQBA 5JT2A 2BAJA 4FKIA 3ZLYA 5DIAA 3NRMA 2GNFA 4HGEA 2XAOA 4TPTA 2X0GA 5J7HA 4AOTA 1YI6A 1URCA 4TWPA 5GNKA 4J96A 3IO7A 3MPMA 3D4QA 3AMBA 2ETMA 5D11A 3IOKA 3W2SA 2IPXA 4AA5A 2G01A 4C4FA 4DG3E 3NAXA 3S2PA 3IS5A 4W8DA 4UMQA 3DNDA 4O7VA 5IQGA 2ZMDA 2J6MA 3QTQA 4FSMA 2PVRA 2XF0A 3ACJA 2YCFA 4QT1A 3AC5A 4ZP5A 3WZJA 1M14A 4AN3A 4QMOA 5LCKA 5HG9A 5CSWA 4W9WA 4BHZA 4J71A 4YJTA 4UN0C 2Y0AA 3NS9A 4RZVA 3RINA 4O82A 4BL1A 3U9NA 3WZDA 1G3NA 3ZRLA 3UDZA 2OU7A 1VR2A 4HVDA 2WPAA 5ETFA 3A7GA 3TNHA 3LW0A 4APPA 3ANQA 3LCSA 3L9NA 4FZ6A 3ELJA 4RIWB 2YM4A 4RQKA 1OI9A 1U54B 2JFMA 3HRFA 4Y8DA 3S95A 3FEGA 3ZBXA 3OS3A 2XJ2A 3BCEA 3HDNA 3PIZA 4QMSA 3CXWA 2BTRA 3FI2A 3VAPA 4U44A 3ZFMA 4TN6A 2XALA 4RMZA 4BDJA 1OPJA 1UKIA 3KGAA 1V0OA 4FNWA 4LV5A 4P7EA 4QMZA 3SHEA 4EH2A 4F7LA 3O2MA 4G16A 1E1XA 4BBFA 4FTNA 2F7XE 4M8TA 4CFWA 4HJOA 3UO5A 3BGQA 5ETAA 3EL8A 4K18A 1SYKA 3VUHA 4D28A 4C57A 2YM7A 1BKXA 1SZMA 2J50A 2OO8X 3ENMA 4X0MA 4CRLA 3H10A 4EHZA 4DCAA 3KVXA 3SD0A 2ITUA 4PWNA 2ETRA 3ETAA 4MBLA 5DEYA 4QTEA 3PWYA 3JVSA 3ZSHA 4O7WA 3LXPA 2W99B 1BLXA 4O4CA 3TKUA 4BB4A 5F20A 2NRYA 4GIIA 5HKMA 2Y8OA 3GT8A 1MRVA 4IMYA 4JXFA 3P5JC 5CY3A 1LEZA 3UDTA 4PL5A 4QQ5A 2GS7A 4FT0A 3R1YA 4JDHA 4W4XA 4OTQA 3BE9A 4AQKA 4S33A 2R3OA 3RCDA 3Q5ZA 5JQ5A 1BL7A 1KE8A 3PG1A 2QO2A 2R3FA 3W8QA 3NEWA 3WOWA 2C6MA 1O6YA 2XK9A 3WF5A 4EOOA 5B2LA 4OTRA 3R7OA 2Z2WA 5B0XA 4A4LA 5KKRC 4O0XA 3OBGA 5DFPA 2PZPA 1OUKA 4EK4A 4RVLA 5BVOA 3ZBFA 3FC1X 5C1QB 4R78A 5JKGA 3BPRA 5HTBA 3EH9A 3T3UA 5AP7A 3TWJA 2O65A 3UIXA 4YUQA 4GRBA 2QOIA 3BRBA 1Q8ZA 4RX8A 3MVHA 4OT5A 3TUCA 1ZOGA 2R5TA 3IGOA 3PY3A 5HORA 1PYXA 2PL0A 3PTGA 4F9AA 3Q4CA 3COHA 3VF8A 3VRZA 4AZTA 2OJGA 4PRJA 5HEZA 4XOYA 3BL7A 4FTJA 1W7HA 4C58A 5DEWA 2HZIA 3NUYA 3QQJA 5I0BA 3WE8A 3SVVA 3A4PA 4O4BB 4FV4A 4IACA 4FIFA 2R7BA 4UZHA 3TZ8A 4DBNA 4E6QA 4BGQA 4YC3A 4C37A 2HXLA 5BVDA 2YHVA 3OY3A 2QD9A 4L7FA 1ZLTA 1UWJA 2IEWA 3FZTA 2WMQA 4MNFA 4G3EA 3FE3A 5CWZA 4OTPA 4O21A 5ANDA 4MBIA 3E3BX 4AAYA 4K8AA 3HDMA 3KU2A 3MH0A 4BDHA 2ITTA 3ULIA 1OITA 1OMWA 2PMOX 5FTGA 3TM0A 5J5SA 2ZB0A 5CI6A 3NPCA 4HPUE 4I0RA 1UU8A 2F49A 3PP0A 4EC9A 1O9UA 3GFWA 3MY1A 3BLQA 4J99A 3GQIA 1J1CA 4RJ5A 2X9FA 2GHLA 4JQ7A 4RC3A 4U97A 1J7IA 5F95A 3RWQA 3NCZA 3Q5IA 2IVUA 4FBXA 1YRPA 2P33A 4YC8A 3ULZA 4NL0A 4MF0A 4LV8A 3SV0A 1K9AA 2GTMA 1R39A 4MNEA 1R78A 3Q04A 4KWPA 2PVFA 5AUVA 3EQFA 4OBPA 3DK3A 1YOMA 2GCDA 3Q6WA 4WOVA 3EFLA 1PRYA 5I3OA 4O0YA 4PNIA 3FQEA 4C4JA 4EK6A 4JG8A 3W32A 4KABA 2DUVA 2QOCA 4MXAA 4QTBA 3NIZA 2FSMX 3W55A 2QOLA 2WQBA 3SRVA 4N4SA 4JLCA 2Z7RA 4U43A 4E6AA 3SGCA 3POZA 2GPHA 2WMSA 3D5UA 4M66A 4JDIA 4M13A 2EB3A 3LCOA 3U87A 4E73A 4Y85A 4H58A 2OWBA 3OXZA 2GDOA 2V55A 4CZYB 4G6NA 3E3PA 3VN9A 5B7VA 2EU9A 4HCVA 2JC6A 2XNBA 2WTJA 4FTMA 3HV7A 3DLSA 2PUNA 1YXSA 2FSLX 1ZRZA 3A99A 1OGUA 2VTMA 4X2FA 4FE2A 5IEYA 3FBVA 4KIKA 4I20A 4ANMA 4PTEA 4RJ7A 5K9IA 5J1WA 2WU7A 4JX3A 2YM6A 3PXZA 3HAVA 3F69A 2GQSA 1FBNA 5AR3A 1W0XC 4M14A 3HRCA 4MXXA 3H9FA 4L53A 5FBOA 4ZJJA 4LOOA 2C0IA 3KRJA 3OF0A 4ONAA 4AW5A 1Z9XA 3DY7A 3KQ7A 3UODA 4X3JA 3PUFC 4KRDA 4QMYA 4IX3A 4FNYA 3W0QA 2OJIA 4ZSLA 4FSZA 2CKEA 5H8EA 4FKJA 1YHWA 3V04A 1Y6AA 2CGWA 2YIXA 3QHWA 4FZDB 2UZUE 3KXGA 4OLIA 4QMQA 4K33A 3LZBA 2XIKA 2CKOA 3FI4A 5I5ZA 4CCBA 2P2IA 4AA0A 4NM7A 2J9MA 3QGWA 3VVHA 2CNVA 3G2FA 2BFYA 2RF9A 3W2RA 4BN1A 4EUUA 3LAUA 3LQ5A 2X7FA 3BYVA 3UE4A 4K9YA 5AV4A 4J1RA 3IG7A 3F7WA 3DPKA 4BCHA 4E8AA 4EOLA 2J5EA 2JBOA 3LMHA 4C4HA 3QU0A 3MN3A 3OTVA 4FKLA 4PMTA 3R8MA 3W33A 5BVEA 1XR1A 2YA9A 4YJPA 2QLUA 3HKOA 4DEIA 3L8VA 3KRRA 2BRHA 3AC3A 4FL1A 4R7HA 2WMUA 4KS7A 4BDFA 2Y7JA 5E8WA 3QRTA 4YLJA 4BRXA 3W0MA 2HY81 3OBJA 3PPJA 4NK9A 3VJNA 1STCE 3ZLXA 4EBWA 3A7FA 1H27A 3BLRA 2BDWA 3HA8A 2EUFB 3OWKA 3Q9YA 4LMNA 4YJQA 5C4LA 3R02A 4NTTA 4QQTA 5M4FA 4EORA 2W4OA 1ATPE 1REJA 3OEZA 5AX9A 4EUTA 4RA5A 3WF7A 3HP2A 3SAYA 3FMHA 1F0QA 3U6IA 4OTGA 2ZDUA 4OTHA 4UX9A 1I44A 5M09A 1OVEA 2XYUA 2QHMA 2Z7QA 2YZAA 3MTLA 3VHKA 3MY0A 2WGJA 4GT4A 3ZDIA 4BCPA 3TCPA 2C6LA 2C5YA 4P90A 4Y95A 1KV2A 3MH1A 4C36A 3BWJA 1U4DA 4O0RA 4W4WA 3A62A 4DINA 4KBKA 4L52A 4CXAA 4MXZA 2WMVA 5FXQA 4YGAA 3RPOA 3MSSA 3QCSA 2UUEA 4OUCA 4F4PA 4DFXE 1WBOA 5A6NA 2R0UA 1LP4A 2OXXA 3WBLA 4XG3A 5HX6A 2PY3A 2VTPA 3MTFA 3KFAA 4NFMA 5E8VA 5LARA 2B9IA 2ZOQA 1K3AA 4YR8A 1TFFA 3AKKA 1QCFA 3B8RA 2JDRA 3IECA 2HK5A 3V5JA 2W96B 2XKDA 1UVRA 1H07A 4L7SA 4LFIA 4AT3A 2W9FB 4QMWA 1XKKA 3JY0A 5TF9A 5AA9A 3QD4A 3VWAA 2BR1A 5TR6A 3PY0A 3FQSA 5IQBA 5CAUA 1E9HA 4FICA 3MW1A 1WAKA 4G31A 4OGRA 2X8IA 5EI6A 3PVUA 3P0MA 5CU3A 4H39A 3ORKA 3OVVA 3O50A 4O2PA 3C0HA 3QRUA 3R7VA 3G15A 4TWNA 4DG2E 1Q8UA 4RIWA 4TNDA 3FLYA 4EOPA 3I5ZA 1U54A 4FSUA 4N70A 4RRVA 4U42A 5CU4A 3BQCA 5EYKA 1H26A 4CT2A 4DLIA 4ZS4A 4NCTC 2E9UA 5A6OA 1ND4A 3HECA 5EH0A 3RPYA 4UMRA 2IWIA 3PFQA 5CF6A 3O23A 4GU6A 5IUHA 2FVDA 4QYFA 4B8LA 4AOJA 2W1DA 3IKAA 3K5VA 3MGYA 1YW2A 2J7TA 3RZBA 4AGUA 2B0QA 1H0WA 5HG7A 2PPQA 5L8JA 3QF9A 3UVRA 5HTIA 3OD6X 1DAWA 1XH8A 2EXMA 2WTDA 4QP8A 4R5SA 3GU4A 3DS6A 3GFEA 3VRYA 1P14A 1CM8A 2X8EA 2I7QA 2FB8A 2C5XA 1U59A 3MFTA 3QFVA 4UXLA 4GK2A 3G6GA 2C6DA 4C61A 2CNQA 4EEVA 3VUKA 4F65A 4MBJA 3CY3A 4PX6A 3T9TA 5HZNA 1KOAA 5I9YA 4HYUA 1H28A 3DCVA 4E5BA 5KMIA 3FMLA 3ZLWA 5CALA 2LAVA 3IOPA 5KBRA 1W2DA 4LGDA 4O6LA 1Q41A 4OW8A 1KOBA 3R7GA 2PVMA 4WUNA 4PP7A 4FKOA 2WFYA 3L1SA 4AP7A 3VS7A 1YXTA 4G3DA 2X0QA 3GC0A 3LFQA 3JR1A 4F1OA 4NIFB 3LMIA 3ZFYA 4FV0A 4GJ3A 5GZAA 1W82A 4BI1A 3CTJA 4USEA 4PDYA 4B9DA 2VTSA 3NSZA 4O7YA 2DWBA 5AADA 2YDKA 2PUPA 5E92A 5CEQA 1JSVA 4UXQA 3UG1A 3UIUA 3ZUTA 4FL3A 4WNOA 4O7ZA 2E2BA 3GCVA 2J0MB 3CR0A 5B2KA 5M4CA 5BV3A 4FNXA 3PSCA 3E93A 5H2UA 4PL4A 4EYMA 4DFBA 2PVKA 3TIYA 3DBEA 2IVSA 3CY2A 2YCSA 3MB6A 2HYYA 3EB0A 4IC8A 3AD4A 5EDRA 3KN5A 3NCGA 4RVMA 3WF8A 2HWPA 4O96A 5IEXA 2PULA 3PIYA 3EFWA 1Y8YA 3LCKA 5E8YA 4BTJA 3AG9A 1SNXA 2W5BA 4MVFA 1YWRA 4OTWA 4A9UA 3FLZA 4M0YA 3CIKA 3EQHA 1OKWA 3RKBA 2DS1A 2XH5A 3Q9ZA 4IQ6A 4MQ1A 3W18A 5IMXA 3REPA 5AP4A 3BYUA 4ACGA 1IR3A 5CU6A 4F7JA 1YHSA 3DJ7A 3TI1A 3EWHA 2X81A 2VWVA 1DAYA 4QP7A 3ZRKA 5A4TA 4RWLA 4Z7HA 2JAVA 4QQCA 1YVJA 3AMAA 1ZMVA 4ZLZA 3C50A 2YERA 2IF8A 4GV1A 3QKKA 1R3CA 4XJ0A 1FGKA 5IZFA 5KHXA 3LQ3A 1VYWA 4IW0A 4N6YA 5EM8A 2YACA 5AV1A 4TYJA 3Q6UA 4ZSGA 3PYYA 5JRQA 2B7AA 1X8BA 4D9UA 2B52A 4AGWA 4ZS0A 4I24A 3LQ8A 5HIBA 3MY5A 4LG4A 5I9XA 4IAKA 2VWBA 4EI4A 3BGZA 4N0SA 3U4UA 4FV2A 4W9XA 5TKDA 4NEUA 2VWIA 2BHEA 3VQUA 4ZZNA 2B4SB 2QQ7A 2O3PA 4QP4A 2OBJA 4ZSAA 4O7SA 2IZSA 3QTRA 2BHHA 2J0KA 5DG5A 4FV3A 5AIKA 3BIZA 2EWAA 3DKOA 4L8MA 4LI5A 2BDJA 3FZOA 4ZTRA 2ZJWA 3LJ2A 4Q2AA 3QGYA 4C4EA 3G0EA 3ZM4A 3LE6A 3D5VA 1ZZ2A 1APME 5IA0A 5ETCA 2W1FA 2ITYA 3MS9A 4FYNA 4MWHA 3V5LA 3GI3A 3VUDA 5E9EA 2B9HA 4UYAA 1R0EA 3HMOA 3HMNA 4GYGA 4EQUA 3UOJA 4UYNA 4ACDA 2XCKA 3UYTA 3DAJA 3P78A 2UW4A 4ZXTA 4AW2A 5KHWA 3MVLA 1IRKA 3PSDA 1Y8GA 2O63A 5LOHA 4I5CA 1WBNA 4CMTA 3TUDA 2X2MA 2WQMA 3BYMA 3DK6A 5BVKA 4R5YA 3GU6A 3VBTA 5EW3A 3KCFA 3QZFA 1DM2A 4I6QA 2XRUA 5IKWA 5CSXA 4G17A 4AN2A 2OH4A 2VTQA 4O4DA 3VBYA 1REKA 1IG1A 4ZY5A 4KA3A 5IG1A 2R3KA 2EXEA 4DBXA 4IWQA 1FQ1B 4GFGA 3SXSA 4R1VA 2UW5A 4L45A 3SOAA 3EYHA 4R1YA 2KTYA 2O5KA 5K4JA 3VC4A 3ZDUA 5HVJA 4C2WA 4GK4A 3OCTA 2CGUA 4FTLA 3EHAA 2XBAA 3CD3A 4CV9A 3KF7A 5IQCA 4YC6A 4B99A 3VW6A 1Q3WA 5G6VA 1UNLA 3RBWA 3L9LA 3II5A 3R6XA 5AUZA 4R7BA 2BIYA 4YTCA 3TJCA 3ZTXA 2W1ZA 2JKMA 5TOZA 4FMQA 5FP5A 3QRKA 2QOHA 3QLFA 3R9HA 4U3YA 4P2KA 1SVEA 5K0XA 3QHRA 5J79A 2R3JA 3LOKA 2JDVA 2YM5A 3FZ1A 5DBXA 4YURA 5JH6A 2NYAA 1VYZA 1J1BA 5D9HA 4BCJA 2QC6A 4AZWA 3D7TB 5AWMA 1UU9A 4C4IA 2QVSE 4EOMA 4OTDA 3PG3A 5LVPA 3U6HA 1WBWA 3TXOA 4FV9A 3UZTA 2H8HA 2OK1A 3BLAA 1YWVA 1XO2B 4AFEA 4I92A 3ZXZA 4CNHA 5CT7A 3O8UA 2C6OA 3RAKA 5HIEA 4CFFA 3AOXA 5GJGA 2ZV8A 3Q3BA 5ANGA 2UZVA 5CF5A 3BEAA 1OIUA 3NNUA 2PMLX 2X0OA 2WQNA 3HLLA 3KXXA 4YHFA 5DT3A 5AP6A 2WEIA 3CD8A 3EJ1A 4FG9A 4C59A 5IDPA 3OROA 4UY9A 4CQGA 3NYXA 4ANBA 3UGCA 1QPEA 1G8SA 4FJVA 1CMKE 5HE2A 3ZO2A 3NFGB 5DT0A 3BWFA 3A7HA 1PXOA 2C0OA 4G6LA 4J95A 4NM3A 4X21A 3QA0A 2YDJA 3PVWA 5FLFA 3U9CA 5L2TA 3TZMA 3EN5A 4Y72A 5CU2A 4H05A 5DNRA 3DTCA 2ESMA 3EQBA 4LM5A 2CSNA 4IJ9A 4ZTQA 2JIIA 4EH9A 2HOGA 3V8WA 3R2YA 4G3FA 4BIDA 4FT3A 1W83A 3BHYA 4BZNA 2C5VA 4RJ4A 3CPCA 4DITA 3NGAA 1PXNA 5CVFA 4NM5A 2HXQA 2QOOA 3I4BA 1IEPA 4HW7A 2X2KA 3B8QA 4FKWA 3PJ1A 4K0YA 4MD9E 4XCUA 2QNJA 3NDMA 4LRMA 5CVHA 5H8GA 4ZJVA 3FI8A 1A9UA 4E93A 4EONA 4F0GA 5L6PA 3F61A 3VW8A 4LDTA 4MKCA 1ZYCA 4JBOA 4E4MA 3IPHA 1UKHA 1YXXA 4BWKA 3PWDA 5AUUA 1KV1A 4EK8A 5D1JA 2FSOX 2A4LA 4XBRA 1CKPA 4IVAA 4U0IA 4G6OA 1JKKA 1OKVA 2UZNA 5BVFA 4I93A 2VGOA 3DBFA 4JDKA 4JI9A 3PA4A 5F94A 3PFYA 2XNNA 3BX5A 1YXVA 4U5JA 2VWUA 3MI9A 4IWPA 2AC5A 3OUKA 2Z7SA 3C4CA 3LXLA 4JJRA 4BFMA 4XV2A 5LQFA 3F2NA 4BTMA 3AC8A 4O0SA 3TG1A 3H4JA 3W2PA 2NP8A 3VUGA 2YCRA 4MWIA 2BKKA 2VWYA 3LFDA 3FXXA 4TRLA 4FIJA 2AYPA 2FO0A 3BHTA 2JDOA 5FP6A 3LHJA 4IZ5A 1UWHA 4ZSEA 3R01A 4CLJA 4FOBA 3TTJA 2X39A 2X1NA 1CKIA 2X6EA 3PJCA 4FTRA 5JFXA 5HO7A 2Q0NA 5HHWA 4BDAA 4QP2A 3QWJA 4L67A 1GZNA 2JIUA 4XG4A 3R8LA 4FKVA 2CGVA 4BCOA 5CAVA 3NUUA 2XYNA 5EYDA 4GUBA 2ONLC 2VAGA 2QOFA 3O8PA 3R0TA 4YO6A 4JQEA 1YDRE 3QD3A 1VJYA 3V5TA 4D2VA 4D1SA 5I4NA 3QUPA 1Q62A 2GQRA 4UMTA 2Z02A 4AXFA 2UVXA 2XMYA 4CLIA 4PDPA 3DAKA 4AACA 5FTQA 3JPVA 3ZU7A 1PXJA 2XJ0A 1NY3A 2Q0BA 4U6RA 2UW7A 3PPKA 4DH3A 2VWWA 4Y5QA 4OAVB 3BBTB 3NUPA 5ACKA 3UMXA 4E4NA 4XOZA 4EOQA 4AXDA