3LHKA

Crystal structure of putative dna binding protein from methanocaldococcus jannaschii.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
b'NAKIIGYARVSFNAQKDDLERQIQLIKSYAEENGWDIQILKDIGSGLNEKRKNYKKLLKMVMNRKVEKVIIAYPDRLTRFGFETLKEFFKSYGTEIVIINKKHKTPQEELVEDLITIVSHFAGKLYGMHSHKYKKLTKTVKEIVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative DNA binding protein MJ0014
publication title Crystal structure of putative DNA binding protein from Methanocaldococcus jannaschii.
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein
total genus 53
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhkA01
1ZR2A 1GHTA 3PKZA 4BQQA 5C32A 3G13A 3BVPA 2R0QC 5C35A 5C34B 3LHKA 1GDTA 1ZR4A 3LHFA 1HX7A 3GUVA 2GM5A 2MHCA 5C31A 3UJ3X 2RSLA 3ILXA 2GM4A
chains in the Genus database with same CATH superfamily
2DHRA 1KYXA 4LSMA 3X2EA 1B8OA 1BFUA 5JAIA 4KIFA 3M1LA 1ZOOA 2BTQB 5CXQA 3I5AA 5IT9A 3R5KA 1LI4A 4PAGA 2IP2A 2JI4A 3CX4A 2H18A 2C4VA 2JJ1A 1RRFA 1U5AA 2BBOA 3HCWA 4PFJA 1GO2A 4UCXA 4RKWA 3IA2A 3UFBA 5A05A 5D3MB 1N5KA 2IVFA 4OIMA 1OF1A 2JLSA 3LF2A 1GSAA 4FSDA 3H99A 2WHPB 4Q1EA 5LUAA 1WXWA 1E0SA 4CFZA 3RYCB 3A6JA 2BZ1A 3RT7A 1NXTA 5AW3A 5YASA 4UCWA 3AEKB 2W2NA 4BY9E 4K9NA 4UVDA 1JHRA 4INOA 4L6CA 3IULA 1PZXA 5KNLA 3HA3A 3VR5H 4Y2HA 1HETA 1EFRA 1N9KA 4ZQHA 5L9AA 2DX7A 1V25A 1L5VA 3RU9A 4LV5B 1R74A 2C1ZA 1HC7A 1Q83A 1RKXA 2HLPA 5AXAA 1YCGA 5JSKA 3SGLA 2IIQA 2GD1O 5ECWA 4IO0A 2BEUA 4DWJA 1KETA 3JARA 4JJZA 1QX3A 4CT4B 1V8DA 1OZGA 5BNZA 3ZV6A 2VT2A 3V4OA 1XG5A 1EFCA 1UT8A 4CM4B 3O2NA 4PSDA 1X1TA 3QIVA 3C3PA 2WJ6A 2GBGA 3GA7A 3RE1A 2JJ2D 1DCKA 4GMDA 4JEUA 4BJHB 1OIVA 3L79A 4CKXA 4L57A 1R50A 3E22A 4FI3F 4Q1CA 2X4IA 1PNOA 3RYHA 4W5QA 1QTRA 3FVTA 3KVYA 5AFSA 1PR5A 4DIKA 5JXIA 1Y7PA 4GBJA 1JDSA 3BZBA 3FLAA 1TJ3A 4F4DA 2JLQA 3N5CA 5F1PA 1IQPA 2ZPAA 5B1EA 4AY6A 1RAFA 2RKWA 3VVLA 3FR8A 3LL4A 1S9HA 4YLYA 1SBZA 3R76A 2L42A 2OC9A 2GEBA 2J0UB 2E4XA 4S1VA 3ERCA 1AN0A 3LUBA 5BVHB 1F2TA 2I6GA 1HSOA 2PUAA 4BTLA 1G0OA 1ZMBA 3NATA 4JI0B 1QRAA 2PRZA 5FPTA 4W9MC 1MT0A 3FJOA 3PFHA 3HLYA 1LQ2A 2AEEA 4GDFA 2K7FA 5DHSA 4A1OA 2UUPA 3IAHA 3T99A 4I5GA 3PL5A 3WY9A 4JODA 2JGDA 1NJGA 4FCTA 4BU0A 1JQBA 1QHHA 1Z4LA 4GL2A 1Q0ZA 4I3GA 3MOIA 4PC2A 3WG9A 3U56A 1AM4D 2NZ8A 1GDHA 4U4AA 2NT4A 2HGSA 4I6EA 4C21A 5FNVB 1YHYA 4WA7A 5FWXB 3I53A 2JHCA 3DW1X 2HQRA 4R9VA 2QRZA 3E9RA 1F0KA 4PR0A 4MRMA 4DIEA 1AZTA 1X13A 1X7YA 5D3KA 3UANA 2BGWA 1E1DA 4UDOA 2WG1A 4YAIA 1PJZA 4D0LB 2PZGA 1E2DA 3AVTA 3THYB 3LZDA 4N49A 4IQGA 3QVMA 3I30X 4PPGA 5ITZB 4RNDB 5BSTA 3C3BA 3VX4A 1AG9A 4X62B 4MNTA 5DYIA 2ZG6A 3C3EA 4N8SA 2OO3A 3KCQA 4OQ4A 3AUXA 1DRWA 4Q4AA 1XU9A 3NGXA 3OJEA 2QX4A 5JSQA 4INAA 2Q46A 4P1ZA 1ZXXA 5ED0A 4ANFA 1S1MA 4FNMA 1XB2A 1RI2A 2OXFA 2D13A 2FZWA 4MW4A 2ZITA 4IMIB 3OQOA 4DY4A 1U31A 1E9SA 5L95A 4RQAA 3P2EA 3QIAA 4KQGA 4ZV7A 3FIJA 3H97A 3TQCA 4G5GA 1W48A 4LHEA 4DCVA 3FPAA 5ENZA 1T9HA 2ZJ7A 4A2CA 3JQAB 3R23A 2PSFA 4QFMA 4CLEA 1KI7A 1QPZA 4B6GA 4S3MA 1OFTA 5F2NA 2CDBA 5B3JA 1TOAA 3LWZA 4GGOA 5ARDA 1DV2A 1JH8A 5JQGA 1K6EA 2E9SA 4ZJPA 4N82A 2Q3FA 4C5BA 2OB2A 3FCOA 2ZYUX 3ITNA 3BTSA 1JXMA 1B8VA 3JATA 4L5IA 4FMPA 1KZHA 1OJLA 4IJKA 1KJZA 3NHJA 5LDHA 5KVQA 3U3RA 3KTAB 4ISBA 2I6TA 5AK4A 4DV1B 2XZPA 4CEHB 3UMJA 4EFLA 3V7YA 3FKSA 5EVCA 3UBMA 4IMPA 3L9XA 4PX3A 3DDNA 4RTRA 2C8KA 3L02A 3A0UA 1FTGA 3RSZA 3AKEA 1LLCA 4LDPA 1HLGA 3Q40A 4RX1A 5JSHA 4FHDA 5EXEA 1GPMA 3B36A 4FGUA 1KY3A 1XV5A 5BNWA 2FZ4A 2AA3A 3OQVA 2IPLA 5FYDA 4KXVA 1O4VA 5JSYA 3W4JA 1PT9A 3ZDZB 5A02A 3EGCA 1UBRS 3M81A 3ZI4A 5HZMA 1G5QA 3LLSA 2XJ9A 3STWA 2ASVA 5AK5A 1ZKDA 3DOEA 3S7ZA 3T3NA 1G5TA 4LJ9A 3RWMB 2QZJA 4J29A 1Q92A 2JZNA 3IEPA 3T0IA 2ZBGA 1IQ0A 2QTRA 4QUAA 3ZQJA 5JADA 1LH0A 3DKIA 3QX8A 3CSSA 1VKRA 4FXPA 1NMZA 2GPBA 4WKGA 2X1MA 4PYOA 1P7CA 1BE6A 2FUG1 2QA5A 2YWBA 3DW3X 4G9GA 4AIRA 5MN5A 4XIYA 2FFHA 1LBHA 4CR7A 3LYLA 4DSNA 3C41J 3DTTA 3FMVA 5EJFA 4EB8A 4QU5A 5K0LA 3UENA 2OK8A 2YJ6A 1EH5A 1TZJA 4IYRA 1DCFA 1UM9B 1V6SA 1G1MA 2VK1A 3HU2A 4ZXPA 3VU0A 1DX6A 3D3WB 1RP1A 3RR2A 4DS3A 2HJRA 2C2BA 3DAGA 5TS2A 1IULA 4O08A 5JARA 3EZ2A 4JA2A 3JZMA 4LSWA 3RNOA 2A5FA 4WNYA 1XZQA 2QQEA 4ND5A 2JEZA 2MU1A 3KEOA 3JX9A 4OQYA 4TMKA 3VR5A 3M1IA 4RFSA 2XCRB 4S12A 2R11A 3AKYA 3PFIA 4TQGA 2FETA 4CG0A 4Q4JB 3L7MA 3TBHA 1RHQA 2GAIA 2WSMA 3U4AA 3DO6A 3FHLA 3EFOA 5F3RA 1W0KD 1G8FA 1YI8A 3A0RB 1IZ0A 4F5YA 1QPGA 4DF3A 4WGGA 5EHXA 2DVMA 4F1JA 4BE7B 4F21A 5CVUA 5T4BA 5C7IO 1XMQB 1S3GA 2ZWAA 3IUMA 3N1UA 5EN4A 1FB5A 5JS1A 3NI2A 4ZI5A 3FGNA 3DOFA 5F5LA 1MRZA 3G1TA 3HJFA 2OKCA 5FORA 5GZ1A 5FUYA 3II6X 5TX7A 4LZNA 4A36A 3K70D 5FTMA 3TCXB 1F2VA 4UASA 3H42B 4D8XA 5FWNA 221PA 1KJ9A 5DDIP 2XNDD 5I9TA 3TRKA 3HXMA 4UARA 5BPFA 2HF9A 2V59A 4LYAA 1ETHA 1ZCAA 2WABA 3GMTA 2YIVX 1JHAA 2HHAA 3RUAA 1YRYE 2IYWA 1NZFA 3BGSA 3HBFA 3LKZA 4IM7A 2RHWA 4GWLA 4O3FA 3DVQX 4OHKA 3IUYA 4YJ3F 4ZOLA 5DM1A 3TTXA 4HWTA 5GADl 5LL6P 3KRTA 3G5MA 2ZUVA 1IAVA 2W0MA 3RVRA 4ZICA 6REQA 3ECAA 1XA3A 3RCBA 3W90A 1Y6GA 4R9UC 1TA9A 1OFGA 4KNYA 3OE1A 1M34B 3IJEB 2DPLA 2YBEA 1SPXA 3M5CA 4PQYA 5KYXA 4X91A 1G8YA 2R6CA 2GEDA 3G85A 3E81A 4OHCA 3X1DA 1QSGA 1CNMA 3B3QA 1AKTA 5E1BA 3VTFA 1YQ9A 5CNIA 3K9CA 2I03A 3E2MA 4Q19A 3ORFA 1L7RA 4WZZA 2P5UA 4JLMA 3RS3A 4PG8A 1L4KA 4PRYA 3NIWA 4DL9A 3K73O 4WN9B 1A9QA 1VSQA 3R6WA 1U0LA 2B0JA 1UFQA 4IG4A 4C43A 4TKVA 1NJ8A 4LPSA 1LXCA 4FWTA 2E55A 2GN9A 2AW3A 2W11A 2YV1A 2VZ8A 1P1RA 4G5XA 3PFKA 4XI9A 4PLWA 1FUUA 1KYWA 3BKWA 1M6NA 4YJFB 3WGHA 1O89A 1K92A 2GLTA 5EIAA 2VBIA 3OZWA 2WAXA 4XW2A 1RXSA 1DJNA 2DKNA 2BTEA 3FZEA 1R64A 5DISB 2FDXA 3MJSA 3JVUA 2ZJ8A 2W6IA 4D9KA 1VE1A 4YBZA 1Z34A 4JYPA 1RS0A 3O4VA 4P7FA 1XDSA 4FMCF 4KWHA 1CUYA 4X1YB 5I7AA 3ZCXA 5K8TA 1YFZA 4EB6B 4KXXA 1JLSA 4K46A 4MA0A 3NKFA 3Q8KA 1UKVY 4TRJA 1BOOA 3S0JA 4N0EA 2C78A 2YXLA 4PM4A 4QO8A 3TXXA 1MOQA 2BFAA 2Z4SA 3F8WA 3AQIA 1BVUA 2ZYDA 4UBNA 4OHPA 3H2HA 4K6FA 2NYUA 2IU3A 1NBWB 2YZMA 1HFKA 3ZDFA 1I1OA 2DFLA 2DPYA 1VBKA 1VL2A 3OESA 2IV2X 1NF9A 2E6UX 2P75A 1ZCZA 4OI1A 5AVRA 1CJUC 1V43A 5AM1A 2OCPA 3LPDA 1V48A 2CKDA 5I01A 2OG2A 3IVXA 3GLIA 1J2JA 3KTFA 3GGPA 3T06B 3BS4A 3UG6A 2H7VA 3WWZA 2HYDA 4QJ5A 3M34A 2J5RA 2P11A 1PG0A 3KVNA 3PXCX 3TAUA 4B6QA 1JHDA 3IBCA 3CW8X 3PNBA 3TG8A 4MH0R 5F7OA 1ATIA 3F8TA 3OZTA 4QRIA 5TPWB 4ENSA 2JF0A 1CR0A 3BXXA 1V5IA 5JD4A 5DHQA 1K0UA 3PJGA 5GONF 1PK8A 3D2BA 2V6BA 2VHYA 4ZEMA 2QW0X 4ZZ1A 5IVPA 4PONA 1LRKA 2HPZA 4KOEC 2HBQA 4D5EA 5BSEA 2PU7A 3CLTC 1OGJA 3E4DA 1PEYA 1RXVA 3L7NA 3SR3A 3COSA 4CDMA 2VR1A 4HH4A 3KR0A 2JIBA 4KVZA 2C9ZA 4LX0A 4PSKA 4U3JB 3VNRA 1OOEA 3MSCA 2QMOA 4D0RA 2ZRPA 1BS1A 3FTDA 1JW9B 5LKRA 1U2DC 2W6JA 2BF4A 4ZVPA 1HLPA 3U3OA 2PZMA 2QAGC 1Y1SA 3O84A 2AFVA 2XB6A 3FRHA 1M1ZA 2VAPA 5IT0A 4ZTBA 5IUJC 2XSZD 5ALDA 4HZGA 3V42A 4EPYA 4D7AA 2I4MA 4PR3A 2MR6A 1EIZA 1PFQA 3FNEA 1GCAA 1DOHA 3I76A 2I7CA 3I6IA 4L78A 3B1XA 1YU9A 3ZC3A 5SY4A 3UK7A 1KMIY 2VEOA 2R96A 3STVA 3TIIA 4U7GA 1RQGA 4B3BA 3PGXA 1Q20A 1VKJA 2EW8A 5BSVA 1ST2A 1GQOA 2HJSA 3OZGA 4II2A 3BF7A 1VOTA 2XUIA 3LDAA 4S0XA 4BHTA 4S05A 2IYLD 3BMQA 1C1HA 1E4YA 1TTPB 3MFYA 4AY3A 4KBGA 1CQIB 1D2CA 1XDGA 3DV0A 4XLTA 3C3WA 4JLNA 4JGBA 2VBCA 4YHBA 1QFZA 1T2NA 1GZ4A 3IP8A 1GPH1 4ZQIA 5L4LA 1ZMRA 4E4RA 3QU7A 3CF6R 1FSZA 3UXMA 4U2EA 1JXAA 3GRAA 2R79A 5CP8A 5EAIA 3F46A 2FZEA 2O2YA 2AXNA 2NZYA 1L4NA 2QM7A 3F2IA 4RULA 1O95D 3CEHA 1C1XA 1DUVG 1P1BA 2PX2A 1T8PA 3PDCA 2VRWA 4MQFA 4MVJD 1BMQA 1ZAYA 4P7GA 2G08A 2OENG 1K06A 1WP9A 1TW2A 3OZRA 3SDZA 3TH5A 3UPDA 4AF8A 3X1WA 4BCBA 3K53A 4FVTA 2CHVA 1ZNWA 5HE8A 3LUCA 3MUEA 2WWYA 2WUWE 1F1JA 2HLHA 2ZRLA 4BNGA 1DAPA 4FKBA 3Q2KA 3KFLA 1WZUA 1OXMA 2PWYA 2HLNA 3WK6A 4A3SA 2Z08A 4LY9A 1JMKC 4P80A 1P18A 5BUQA 2DEUA 1I4DD 3E3AA 5JCPA 1CUDA 3OFKA 5JASA 4LNUA 1IB6A 2FMXA 3GUYA 4D9CA 3AUSA 5KHOC 4XZ3A 1WDTA 2O7NA 1IMOA 3PQ6A 4M7PA 4G1BA 2XUJA 4MVJP 3L9WA 3JAKB 1XL1A 2JLYA 3E15A 3TB6A 1N1GA 1UPCA 1FYWA 5K3SA 1EB8A 2OCYC 2PH5A 4IIVA 1H0SA 4URHA 1DI0A 5IU6A 5IAKA 1IYZA 4FBMA 4RZIA 1NPTO 4U8GA 4LHWA 4E6PA 3A9SA 5FBLB 1IONA 1U6JA 3CNHA 1PR0A 4JLUA 1Q0RA 3JVVA 1GXSB 3G0DA 3MRTA 1PLKA 4CIVA 2BGNA 4QUHA 1I1NA 2F00A 3RI3A 1C8KA 1U04A 2J07A 4GI5A 2Q2NA 5LYJA 1JECA 2O3RA 3GAZA 1JG1A 3B60A 1M9NA 2OEPA 4JC4A 2YFKA 1PV4A 1ESCA 2AVDA 3A6LA 1T0HB 2CWDA 2JARA 3ENKA 3H1AA 4FEAA 4UNPA 3WJAA 1QBKC 1A2QA 3OM0A 3BB1A 3GRVA 1YTLA 2AR7A 1CZKA 4BVBA 4PCUA 1DEKA 1E6MA 4BE4A 4E14A 2D7CA 1EVZA 1GPDG 1X1QA 1Y8RB 4C2UA 1GYPA 2N46A 1R0RE 4ND6A 1JX6A 1YZLA 2Q62A 1E5XA 1H66A 1G7RA 1I32A 4LGMA 1Y5IA 5DKFA 3C7DB 1YZVA 1L2TA 4Z2YA 5JNWA 1B43A 1QQTA 1U7ZA 1VGRA 3AERA 3EE6A 3OU6A 2QAGA 3INGA 2AOWA 4DQDA 1LLQA 2V65A 3NWJA 2EJUA 3R0VA 3BDVA 2ZS9A 3MMZA 1XVIA 3BWYA 4INZA 2P3OA 5I45A 3TL3A 3V7NA 4PPQA 4EQ6B 5B55A 1Z2DA 2PWBA 3O2QB 3VHQA 2PIAA 3I1IA 2HEGA 3PSAA 3Q7IA 5F3DA 1E98A 2G71A 2MYNA 4H1UA 3RYTC 3O94A 3SC3A 4YONB 3AC0A 2W2LD 3PQ7A 4RHYA 3Q6NA 5JANA 1LC0A 2VHUA 1ZDMA 3N28A 1ISIA 2Q1WA 4AXXA 1MO4A 1T5HX 2AOXA 4JD5A 4MQEB 4GRIA 4NFLA 4ZJZA 4V0RA 1AKVA 1IIBA 3FMFA 1N2ZA 3GQBA 1EKXA 4P58A 3WQHA 1U4SA 2CXHA 5BY2A 4YCLA 3L7YA 1V47A 3VISA 1YNOA 3C85A 1C41A 4DR5B 3AM1A 4ZQFA 2VDOB 1RWOA 1ZY2A 5F73A 2PO7A 3HYSA 3K05A 2D5LA 1K6XA 2O2ZA 1XKLA 4REQB 2ZS8A 1X7ZA 1I5OA 1D2GA 5E6SB 3RJ9A 3TPZA 1Z63A 3LHDA 1SBYA 3HZOA 3O6VA 4ZCQA 1VECA 1AB5A 1NQXA 4KE7A 5BQ5A 1F3OA 1NY6A 1OY1A 3AY3A 2ZIXB 3U6KA 3SX2A 4CN8A 3IXQA 3DMTC 2X5JO 5B1SA 1G7CA 1XCPA 4DREA 1KVQA 2MTBA 4Q7JB 1UIRA 2REBA 3JAWB 3IQDB 3HB0A 3JWHA 3STXA 4W5RA 3HCAA 1DC8A 4GMKA 4U2GA 1GRQA 2R4TA 5CT4A 4G1MB 2WE7A 3UGQA 4NAUA 5G4KA 4RMGA 1CUIA 5JY1A 3K6SB 5MGBA 3GELA 3TGWA 3KPUA 1DEOA 4YJGA 2OR3A 3K09C 5K0BA 4WBNF 2C7PA 1K97A 1SURA 2JL1A 3BD6A 3F3MA 1X39A 1SELA 3T41A 4RGQA 1PJSA 1WKBA 5H9VA 4WVLA 3DE0X 1HFEL 4XGKA 1BNCA 2IYXA 5CVVA 1YC5A 3PLAE 2XYGA 3JSAA 4W6QA 4A6XA 3NTLA 1C3VA 3BGVA 2GRUA 3UN1A 5IHXA 5B2EA 3I9V6 4ZREA 3B38A 1D2NA 4B4VA 1F8YA 4KGVA 1PV1A 3PNMA 4TV8A 1G5FA 2WJGA 3DONA 1GZ5A 5KYUB 4RM3A 3CN7A 3GEEA 3OZFA 5CR9A 5J2TF 4DMCA 4NMLA 5JDCC 4TZTA 2G77B 4KLRA 4RA9A 2ZK7A 3PPIA 3CVUA 2Q9CA 4RVFA 1A2KC 1XMPA 3NM5A 1ZIPA 2YMPA 1BCSA 1U2EA 2HMVA 2Q9BA 2D5AA 3KT8A 1A50B 3CUVA 1KOGA 1Y5MA 2IHKA 5E3IA 3E8XA 3L8HA 1UR5A 2I6FA 2JFOA 3PXEA 5K8CA 3UK1A 1QKJA 2JC3A 1MA3A 1G19A 2Z8YM 5FQOA 2QL6A 4RVCA 1TK9A 1OFVA 2HMSA 3A9RA 3OD5A 1R5BA 3O73A 3P9NA 3ZX4A 3ISTA 3K1AA 1JGTA 2JB9A 2WMOB 4HAOA 4CL3A 3IHLA 3OZUA 3K0AA 3R1IA 2O8DA 5FJIA 721PA 1J8MF 4B31A 4EG8A 2GD2A 1D6JA 2XNCA 5K51A 4R51A 3OF3A 4FEEA 5EJIA 2A7XA 2JHFA 5JDIA 1JPJA 1UBNA 2XADA 4AZVA 4DQVA 3FOFC 1V6AA 5JBIA 1RQ2A 5HPYB 5F78A 5J9FA 2VQFB 4QODA 1IHXA 1M2FA 1XEFA 4IJQA 3HCFA 1Q7EA 1ZGGA 2FPKA 1TUEA 4EW2A 1NUAA 4JKOA 1RQXA 1TVKB 3QBTA 1IWPB 3PXDA 2ZR9A 1OA1A 1FS4A 2A4MA 3ELUA 4RZ3A 1F8UA 1EXMA 2GO1A 4GX2A 3T5TA 3W2HA 2UYHA 4HQRA 5EJ8A 4HBZA 4YUZA 5IJXA 2ZSBA 3QITA 3FYSA 2D3TA 2CDAA 2PANA 1J21A 4ZAZA 5HUQA 1J22A 1RQPA 5K3OA 3ZJUA 1UZLA 3BE6A 4GPD1 4PCVA 1XZPA 2AIRA 3VHXA 2DBQA 3PS9A 5D87A 2P2CA 2VYNA 4R0NA 3UW3A 4CGZA 5EJ9A 2F1KA 1JJFA 4MUMA 3ASVA 4FILA 1VKNA 4UE6A 1E0JA 1YR6A 3EQZA 1FLVA 4DUGA 4X65B 4XFDA 1GNLA 2V9ZA 4Z1MD 5HF5A 5BN1A 4HG2A 1DPGA 3MK31 1XCMA 1K4YA 1ZUHA 3OWOA 2ZIWB 4C0WA 2J0SA 1XCJA 3BD8A 3RT1A 2EW1A 5I7UA 3ADBA 2IA5A 5KSZA 3JALA 3JASB 2A7QA 3P32A 4XWTA 5EXDA 2RAFA 4MS3B 3FTNA 1TYAE 3DMTA 4BNHA 1HE3A 1FJHA 2Z56A 4LZAA 3WYGA 5K8JB 2QNRA 2BJHA 3DOHA 1PO7A 2VJKA 4MV6A 1YA4A 4MB6A 4RVSA 3WGUA 4HPJB 1U8UA 5B6IA 1UADA 2A1TR 5DN9A 1MORA 3DE2X 3CIFA 5HEKA 1FFYA 4W5NA 3E23A 4NI5A 1Z08A 1Z5NA 2ZT6A 2Q49A 3RSQA 2LDXA 2Z9DA 3GLHB 4WCDA 4HFMA 1GUBA 1BXGB 4PVCA 3B1FA 4ZANA 4HGYA 2ALJA 3QSGA 5K6TA 1A5BB 4FDTA 1I13A 1O9HA 3PGJA 4A2WA 3PHHA 4GMXA 4XEHA 5C34B 4DNFA 4DCMA 4D6YA 1GARA 2QPAA 2PXAA 1OD6A 5F2OA 1PS8A 3BYZA 3WGIA 3QEMA 3KU4A 4UBIA 5AOVA 2ZB3A 3B52X 2GR9A 3S5UA 4E09A 1XQ1A 4EY4A 2V0GA 2JIPA 5LNK1 1GGFA 3EXAA 2QBYA 4RELA 3QEBZ 4MCJA 4W1QA 3LY7A 5AHRA 3A05A 1JUDA 2G5GX 3OMXA 2H5IA 1CEEA 3RC7A 3NPMA 1SCQA 5DBHX 1QQBA 2EP8A 4BQSA 2B78A 2WP0A 2RONA 1A9SA 3A4LA 2C99A 4PO8A 3L4JA 3IBTA 1UBSB 3AFNA 5THKA 2WYHA 3HCPA 4IQ8A 3MHTA 3TTWA 3Q9LA 5SZKB 3UTCA 3EA4A 5ESXA 3QW4B 3SF8B 1NSYA 1B42A 1Z2NX 4Y0AA 4ZDWA 5C8ZA 5HRAA 1VP9A 3EXEB 4YC7A 2ODEA 3QFFA 4C0QC 3U4MA 3DBLA 1YXMA 4Y9RA 2X4GA 3ADOA 2NZUG 3Q8WA 1H65A 1YBVA 4E5PA 3L1HA 1EAYA 5EKXA 4QNRA 2UUAB 1SKUA 4Q4CA 3RRZA 3DNMA 3B5IA 2JNWA 3QLEA 4MWCA 2XOEA 4MI3A 4Y9DA 4J0QA 4CT5A 4HRVA 4JV5B 3MN1A 4ZRNA 3W5HA 3VNSA 3ENWA 2OCDA 4C4PA 1YMUA 6LDHA 2H9AA 1RPNA 3RDPA 4WESB 1IB0A 3G8YA 2CHEA 3PXAA 1PWXA 3OPYB 4BO9A 5IVKA 4MWEA 4F5WA 1FNDA 2ZSDA 2JI8A 1IJEA 3DB2A 2FQ1A 3G2JA 1MTOA 3R7DA 4DOMA 2L82A 5BN5B 8AT1A 3OJOA 4NAVA 1NBHA 1ID8A 3AJRA 3NTXA 1NJ5A 2OE2A 2XZTA 4UVHA 3OEHA 5IEBA 1YI1A 5DGIA 3SWWA 3GD7A 1II8A 2HJ9A 2ZRMA 4Z6KA 5FHQA 1MXHA 1EBFA 1FP1D 2JFBA 3KQYA 2I7DA 2GCPA 1J1IA 1G5HA 3QY0A 1PFKA 2HIHA 4O2AB 5C31A 1Y7HA 1UOPA 5CHYA 5DM2A 4XWOA 4KREA 2KB0A 1HYQA 2UZ0A 5JIBA 5FBKA 4U9HS 4D98A 4I55B 3T94A 3OIGA 4TVOA 1Z26A 2BSAA 2RG7A 1PJAA 2CUTA 3FSRA 2W70A 3S1AA 3IP1A 3T5CA 4ZVUA 3TX2A 4C7OB 1YDMA 2WYWA 4AZSA 5A2QA 3T3MB 3UK0A 2P6RA 3KYCB 5KMGB 2UVPB 1AO3A 3R0XA 3I2HA 4PFSA 1KMHA 3ER9A 3PA8A 4HEHA 1QYDA 3MHPA 2P4UA 1MB3A 1UBKS 4KE6A 1DBQA 1TGYA 3RUHA 3EIHA 1Z12A 3ILSA 3RJ5A 1J2RA 4C6HA 5KC8A 2JLWA 1P9OA 2GN6A 3REQA 5C1DA 1FDRA 1JLLB 5FT9A 4E2WA 4UTOA 2EP7A 3GWZA 5CTJA 3A6FA 4KX3A 1U2RA 4TQ9A 1E1CA 2Q7OE 5LQSA 4RMNA 3PJRA 3H5OA 3WLSA 2Q7XA 3NV9A 1NLZA 3DZHA 1XRLA 2CE7A 3OQNA 2ZTSA 3FHCB 3HADA 3L6RA 3VZBA 4BMNA 2VJMA 3VR1A 4F60A 4EB3A 1Y3BE 4CV1A 1GWNA 2ES4A 3AG5A 4GD3Q 3GCDA 2DQZA 2OFPA 2Y0BA 4XCXA 1OKKD 1RXIA 1HDYA 1DFIA 3W3AA 1X70A 2OUKA 3IMKA 1JIIA 3MWEA 4I4TF 1P9WA 1TUBB 3GUUA 3UMFA 1MD9A 5KKNB 3OTOB 1ADBA 1UXKA 2JBHA 4DLPA 2QGNA 1H94A 4F7DA 4JBYA 4IAOA 1L8QA 1H6CA 5KTTA 4RH0A 4DADA 3HHEA 1NV8A 4J94A 1IEWA 1X80B 1P17A 1WZIA 2YCLA 4B76A 4YMTA 2OC4A 3O8QA 3ILXA 2JRLA 1RM5A 1YOBA 3OFNA 2WFLB 5LA6F 2DUMA 1VCNA 2NZXA 1FC0A 1SC9A 2WNIA 1P1CA 2CD7A 4IHAA 4C29A 3KO8A 1EUQA 3FSGA 1GGNA 3NPAA 4XUDA 1T6XA 5BSKA 3L1JA 4HB3A 3P45A 4HX2A 4Q03A 1BX0A 5IJAA 5CDGA 1CR1A 1TCCA 2ZIUB 5AXBA 2INGX 3O3MB 3GJ8A 3PDUA 4UTXA 4EVIA 3TGPA 2O57A 1BCRB 5L45A 1E0DA 1YQXA 2N1BA 4PTLA 1FBTA 3K9WA 3MTDA 5IW8A 1JFRA 3KAPA 1V9LA 1FP4B 1OVGA 2J6IA 3IE2A 3PFWO 3SCZA 1EFPA 1VJGA 2G67A 4JI4B 5FR2A 3D0RA 4OXKA 5BNIA 4J9VA 3OURA 5KINB 1ENYA 3JPYA 1PSWA 3UEOA 1GL7A 3I2KA 2AC2A 1DO2A 3IAM6 4BO6A 3JQDA 5JFTA 1K08A 4IVPA 5KYTA 2Q45A 5JS2A 4HDQB 4CFYA 4M21A 4UW9A 1LV7A 4EX7A 3TJMA 3MJRA 4K03A 1L7XA 1HE1C 1SBQA 2D5BA 1E2JA 2WMYA 3NAMA 5D6NA 1BTOA 2LW7A 4KRGA 5FA8A 1SCNE 2B94A 2JBWA 2B69A 5EHGA 3M4NA 1GTVA 2VRNA 3U5TA 2IRWA 3EH1A 1PVOA 1WMAA 3A6EA 3WA7A 4UDYX 1JR3D 3HA5A 1LF5A 1EM8B 2P0AA 3V4LA 3AVPA 2G5TA 3CZCA 4TRMA 4V03A 1W46A 4ZO9A 3GVIA 3B51X 4IDEA 1VMDA 1ZD2P 1N0VC 5DBIA 3HWRA 1YNSA 1HRDA 3OCUA 4O2BA 5COQA 5IDVA 4EHFA 1ENOA 4DTIA 1NN3A 1XZ8A 3O90A 1YDHA 4Q37A 4FONA 1EB9A 1U8ZA 5ARBA 1E2BA 1URPA 2VSNA 2GTIA 4OHWA 2ZWVA 4TS3A 2YOHA 1XNRB 3DLTA 9MHTA 3Q0TA 2QKYA 1EVJA 5P21A 2IK8A 1DBVO 2WU0A 1TCVA 2XODA 4JT2A 4Q7KA 2EOAA 3VUFA 4E5KA 4BE9A 3TGLA 3C4JA 1BO6A 3AIMA 1SD1A 5ALUA 4X00A 2NSLA 3AKDA 4JT4A 5F76A 4JLBA 3W06A 2VHXA 4DLVA 1PFUA 3T1NA 4IYJA 4JXKA 4O4IA 5CA1B 2D0DA 2EJWA 3O83A 1CZOA 2B36A 3WP0A 3A36A 1WU8A 2ZUTA 3QJ5A 3GEBA 4FC7A 2LBPA 5HNKA 4Q00A 1X94A 4WJKB 5GZ6A 4P3OA 4D8WA 1HE5A 2COUA 1UJ4A 1RW4A 1NBMD 3SQOA 5A4KA 5IKPA 4QPCA 4IUDS 1Z0ZA 3L5KA 4FSXA 5DLEA 5KNBD 3LNTA 1Q14A 2J4DA 5GJVC 3TKLA 4S1TA 3K5HA 4AO6A 4PQGA 4XJXA 3JD2A 3UAXA 4IV0A 4DLTA 4ZYLA 3E3OA 4AZ0B 3C39A 1U81A 3HI4A 2QJWA 4R3NA 3CO0S 5K0TA 1KQPA 3AFMA 1JAXA 1RYDA 1TM2A 2APJA 4HAIA 4MEJA 4DLSA 4U5XA 5J2TB 4BMCA 4NWIA 4GYJA 4DV3B 1XAHA 3GUHA 4LJ4A 2FR1A 1XQVA 3BJIC 3L6EA 3IPYA 4D9BA 2VF7A 1N0HA 3N0VA 2BEUB 4B2PA 3JARB 3JXEA 3OZCA 4BFSA 3RSFA 2G82A 4RACA 4C7JA 4KR0A 4GPAA 2YYSA 4ZZ0A 4G0UA 3LUGA 3EQ9A 3KKPA 2OHVA 3NGLA 4D97A 3S8EA 4DCUA 3A7DA 1WNTA 3JQ7A 1XTUA 2AI2A 2C9CA 3FUUA 3LBFA 3D6TB 4L9SA 4QUKA 4MPTA 4U7WA 5I9MA 3BXOA 3E22B 3FHTA 1E6LA 3RYHB 4KMMA 2NP6A 1YS2X 5I8WA 5IJ9A 1D2AA 2AFHE 2ZRBA 4BWYA 1ONBA 2ID7A 8ATCA 3F7MA 2VS1A 4YAUA 2VTVA 1I0ZA 3KOXA 4P4SA 3ZIAA 1IY9A 1QQ5A 2J6BA 4RH1A 4BAZA 1FRFS 1IE3A 1SKMA 1DE0A 1U8FO 3IT0A 2RE8A 1CEQA 3SJCA 1F2TB 3T3EA 4JZKA 5DW3A 4NCAA 4Y2SA 1ZFNA 2EDAA 3HBMA 3PX2A 3SNHA 1X6VA 1NP6A 1QUEA 2EG9A 3T3GA 2CNWD 2WWVD 2R7NA 3KTOA 3ZE1B 2BD0A 1PCXA 1Z15A 1VPVA 4P6VF 4JHLA 4MEBA 2JGDB 2MWMA 1W6RA 1QHHB 1ZSYA 2QL9A 2XD4A 4B8ZA 1K5HA 2NQ8A 3I09A 4XGQA 3HY4A 3NYRA 1KJQA 5E9QA 2C95A 1QTNA 3K20A 2Y2VA 2ZDGA 1WUIS 1JA9A 4L0MA 5FO0A 1KF0A 3OLZA 2EGHA 4IBOA 3B5JA 1FRZA 1HOTA 4PBSA 1J06A 4AP5A 1LJUA 2NWQA 3I0MA 4OQDA 3HDJA 1X7YB 2AJDA 3GVHA 3S8YA 1I24A 1NFRA 4HBGA 2P0YA 4KFTA 2FPWA 3V1TC 3F5QA 2CXPA 2ERXA 3C5VA 2IC5A 4EJ2A 2WNSA 1XQ6A 4PE5B 2COEA 2OAP1 4ND3A 3BIOA 3H05A 5JS6A 4KW7A 5FBHA 2QN8A 1PVVA 4BN4A 1WXDA 2BR3A 3VR3A 3A31A 3GP5A 3U3KA 3GJSA 1TC2A 1CUHA 1XHEA 4KDEA 5CB4A 3WYDA 2QVGA 2BDTA 5DEOA 4ZARA 1UZNA 1ZHFA 1D6MA 3I5UA 1U11A 2J3IA 4MCAA 4WOBA 3U5ZB 1O94A 1NPDA 4JOSA 4YCMA 1DS6A 2ZYRA 4UU8A 3K0FB 3HVJA 2PNFA 1DSSG 4MTCA 4UEWA 2BFFA 1CRLA 1ECCA 3NDIA 4PICA 5ITSA 2AK3A 5LP6A 2YS7A 3BRQA 2P9JA 4UTPA 3KYBA 4CLRB 3OEED 1CJKC 2FEWB 5LVAA 4NZ9A 3H11B 3WWPA 5TT0A 5GVRA 4NL4H 4LFCB 4KQWA 2VRCD 1PI3A 2EWWA 2WU4A 3R6TA 1C3EA 4TRRA 2HWKA 1O8CA 4MYCA 3VR6D 1H8HA 2N9UA 3CX3A 3L7LA 1W581 3MTEA 5AW1A 5CK5A 3ZWMA 4RPIA 3FVRA 4IJWA 4J7CA 4MRVA 5KOHA 3VKHA 5BSUA 4J3NA 1DFGA 1J99A 5E7JA 3IBGA 2QUKA 3GWGA 3JATB 3QY9A 1R3DA 2D59A 1TCAA 1V5WA 2VDMB 4G09A 1K6IA 3AQ4A 1GAQA 2RGXA 2NUPA 2PLWA 3I9OA 4MVJE 3V6LA 2VJNA 3Q9NA 5C8YF 1I6KA 2RH5A 2JBAA 3Q1KA 3GN2A 1JDZA 2DM6A 4MWDA 3VSBA 4CF4A 3WAGA 1CQZA 1FQWA 1L1RA 3HQ4O 3HDYA 3G0IA 5EE0A 3TNYA 1VCOA 3ZDCA 4RZQA 2A94A 3H04A 2J9GA 1NY5A 1SU6A 1BHQ1 2I1QA 2DKFA 2W71A 1JLRA 1G2OA 1K8ZB 3UXHA 4AN1A 4F4CA 3E2PA 2ZRIA 2D1FA 2NVUA 2H4YA 1CPYA 1TLFA 1AQNA 4XLLA 2EW2A 4IKPA 4LRUA 3ZJ5A 2C3UA 4LVOA 2I3BA 2P9ZA 2R1VA 2Y6UA 3I92A 4TLMB 4A27A 5BSGA 3ESQA 2DGDA 3AJAA 1L4YA 4JB3A 1T0JB 1GZ7A 1XMIA 3NJRA 3IO5A 2ZETA 4ALKA 4CUJA 4CL2A 3BH7A 3GRKA 4D4KA 1PUIA 4K28A 3BTOA 5TGTA 3QPDA 2DUNA 1P2BA 2PO5A 4G1VA 2VP2A 1PG2A 3HKCB 3U37A 3C74A 3PB3A 4OJQA 1Z39A 2J6HA 1Z33A 5IAAA 5FBQB 1Z3IX 3IGFA 2R5FA 4NU5A 5JVDF 1JWBB 5F1KA 3T15A 2BC9A 1G6OA 3QKRA 1PIWA 2Z5FA 1Q3TA 1SOWA 1ZSNA 2IVZA 3KKMA 2XGOA 2PX4A 1C9JA 3JQ9A 4HC4A 1JIUA 3R41A 3SICE 2R00A 5TPZA 3GA5A 3V7FA 2RKOA 2ZUUA 4LHZA 3WKDA 3RK1A 5JO0A 2K2WA 3CH4B 1EEXB 1YZYA 3T9CA 4WI1A 1P1IA 2Z95A 1MX1A 2G1JA 4HL6A 4M2LA 2VRBA 3S68A 1HXHA 2EFEB 3TM4A 4FQ5A 3OTHA 3S2IA 1P5JA 1G59A 2IXFA 2A9FA 3EFOB 1HUQA 3A37A 2ZIAA 3ZK8A 1S89A 3WDKA 1Z5GA 1XAJA 3HUEA 5DHPA 1AQYA 1IOZA 4TTSA 1PE0A 3NHRA 2VWPA 4ITRC 4NABA 4XR9A 1WTCA 2VAXA 5ESDA 5ANRB 2J31A 3A3NA 3V8MA 4ZCPA 5IMSA 1D6SA 3H5AA 3KV1A 3KJXA 4MKRA 5HZKA 1ADCA 1H9CA 3HC7A 5CVCA 2IELA 3A04A 5TSDA 1HT3A 3VU9B 5IBRA 1H2XA 1R8QA 2OM2A 3N2KB 3T6KA 2CUKA 3ONDA 4UM5A 4X44A 1A72A 1EFDN 1EJ2A 3SHFA 4BASA 5HIMA 2CLLB 3C3KA 2BGJA 3VZPA 4TLCA 4F0JA 3ADKA 1J42A 1U9IC 3H19A 2QX7A 1MO2A 1L5FA 3MCUA 4GDMA 4ZOLB 3V8EA 4EECA 3IR6A 2OCXA 5F7JA 1UKBA 2P9QA 2W2VA 4UZFA 3GR6A 2EFYA 2O7SA 4OYHA 6REQB 1B00A 2E37A 2ZULA 1GPAA 1QCYA 3A3KA 2OORA 1K1EA 1U65A 1UFRA 1PL7A 4V0OA 4WCFA 5KAPA 4QATA 3OCJA 1MEEA 4LGYA 1SCUA 1LCIA 1FS6A 3NT4A 1P81A 1XMJA 4ISCA 5CURA 5IK2D 4FIZA 3GLFA 2AQ8A 3SZGA 4AWAA 3P2MA 2FE1A 4XSVA 3ZS8A 5LA6B 1Z0DA 3UWOA 1KVUA 5PNTA 2YASA 3FYUA 3W5CA 1RWQA 3L7KA 5ELXA 3AVUA 3ZNNA 4XM2A 4YT8A 5J43A 4DMRA 3FD8A 4NU8X 4COKA 1U8CB 3LPLA 2YHAA 1B6RA 3T7IA 1E9CA 4YRNA 4F9TA 4RD2A 4LTMA 2DOKA 4YUVA 4EG6A 2X15A 2B1JA 4L9RA 1UFVA 2A59A 2FUCA 1RKBA 5TY0A 5EHIA 4DLZA 4HSEA 1I9CA 3U2QA 3WKBA 4I19A 4A5SA 3TW0A 1T3ZA 2Q28A 5L3RA 3GRUA 1E4EB 3MWJA 5B6PA 4OJKA 4IEIA 5M04A 1YJQA 3T5BA 1V6CA 2F55A 1DC6A 1JEDA 1W5TA 1G3UA 4MUKA 4UHBA 4FCWA 1HDRA 4XR4A 1BA2A 2NW6A 3EK2A 2RAVA 1W93A 3MJDA 4ZV9A 2NZWA 1NMXA 3M2TA 2B4KA 4JJIA 2AF4C 4H3VA 2DWQA 1E18A 1VGQA 2H16A 1Z47A 5GAJA 4DFDA 1OX4A 1ULTA 1WSWA 4RZHA 4DGQA 4RD0A 3T34A 3FPGA 1B0UA 2O6HA 2BL4A 4K6KA 4L5JA 5AM5A 1JSCA 2G70A 4LJ8A 3UAGA 2O3JA 2EKZA 4M53A 1TU3A 5B2FA 3MA0A 2GVNA 1ECJA 1A8QA 1SO8A 2D2IA 2RHDA 5G41A 1AKYA 1R16A 4PQRA 5AD1A 1E6EA 3GZNA 4OJYA 3LX8A 1C4XA 1I0LA 2PXXA 3A2MA 2FEMA 4LRWA 1JPUA 4RAOA 2PGOA 1J0AA 4WDRA 1VLMA 1RR6A 3ZK9A 2FUNB 1R00A 3GHYA 4OFZA 5A6VA 2FDRA 1E9AA 2VTKA 1H0KA 3DEFA 1SG6A 3OIYA 5I6DA 5FBVB 2WV9A 1RHKA 1QNLA 5A4JA 1FYXA 1GTJ1 3GLIB 2ECQA 3GFRA 1KAMA 1IG3A 1GTG1 1XU7A 5EPOA 2K4MA 3E7PA 4YDSA 3WOHA 5K6AA 2CEKA 3VNVA 3PD7A 4CNBA 4PO1A 1C8BA 4DLWA 4DVGA 3K0HA 2ABWA 2J41A 1LTHR 1VMIA 1A4RA 3HA7A 1NFQA 5KQLA 4MUFA 1VDZA 4FOTA 5J2UA 3T4EA 2G4VA 3CMCO 1I3LA 3NNSA 4WXHA 4B9EA 2C7GA 4NE9A 3GGOA 4BBAA 4CCYA 4EX6A 3LIIA 5FUMA 5FUVA 5K0EA 2FRVA 1MVNA 1UK6A 2AG6A 3GROA 2OG1A 3B6KA 3F6RA 4JL8A 2CN1A 5KTRA 1DBPA 1NSTA 4ACBA 1SC1A 2V7XA 1I2BA 1NJ6A 1VL8A 3FOBA 1GTMA 3OT4A 3G02A 4HAYA 4MVJF 1CK4A 4G1FA 3FHJA 3QBEA 4UPEA 1EBUA 3VVMA 1JKXA 4HLCA 4TYWA 1NI5A 2Z5GA 2CKMA 2LE0A 1PZNA 3EMDA 3TOVA 1HNZB 2ARKA 2ZSUA 3BGWA 1CE8A 3H17A 4FD2A 2QE7A 2YJ4A 1ZEMA 2W9XA 3EVNA 3K0KA 4LXXA 5ALLA 4MUYA 3PUVA 1IY2A 3LGSA 3KT3A 1TQ4A 4H17A 4RTJA 4Q3OA 4L3OA 4OV6B 2VI5A 2JFGA 4GOOD 4NSNA 3E58A 4PYMA 3W4IA 4BGEA 4DJDC 5CEEA 5JECA 1D2RA 4IVRA 4HX5A 1NXWA 4LCEA 4O4LF 2B5VA 3UMVA 1P0FA 5JXJA 2IZOA 1SCBA 1U02A 4LWPA 4JEIA 3PXUA 2GT1A 4EA9A 3WRWA 4BNLA 5BQFA 4JFAA 1GR0A 3ICOA 4JEMA 1HQKA 1L5LA 3WNDA 4E46A 3INTA 3GLIE 2X7JA 2HA6A 4AY4A 1XDZA 1WKVA 4K6MA 1C29B 4CM7A 4RIHA 3E3NA 4E21A 2BFMA 4NLLA 4CHGA 3NWPA 1MU0A 3DV0B 1T9ZA 3BSSA 3EPKA 4RHCA 4WCVA 5LB2A 3ZWXA 1U80A 3W8FA 3JV7A 3HJHA 4J0JA 4DBLC 4ZCTA 4WLFA 2J3EA 3GRFA 4K88A 1RXCA 4S2UA 4EHAA 1RQRA 4POOA 5JXWA 1E5TA 2F43A 3V1LA 1D2EA 1OLSA 2QR3A 4MTLA 5IYZF 4ECAA 1ZGBA 3BSWA 4LYYA 4QDOA 5DK4A 4ZCMA 1Z4OA 3I2YX 5AW8A 4JY7A 4P3XA 5G40A 2R7AA 1UM8A 4KE9A 3CE6A 1C1XB 2B6HA 3QOFA 4IFIA 2H06A 4KMRA 3WSVA 2J32A 4MQFB 3VAAA 2QYHA 3IE0A 2C8JA 3TNDA 1HDEA 3FOEC 1A9PA 1UDXA 2A5DA 5T57A 1LDMA 1E2EA 2D74A 1XTVA 3AF2A 3TD9A 2K2QB 3GLRA 1MF7A 2QVXX 1BHO1 2QTFA 1WUTA 3GG9A 4ZD6A 2PL3A 3WWOA 1W4ZA 1GCUA 3KXIA 3W78A 4C0LA 4E11A 2QP3A 1HYEA 4WNCA 2O8EB 4LZJA 4XUGB 2SKCA 2GN0A 1KH2A 1SOUA 3B6EA 4OYLA 1EA5A 2QYTA 3KD3A 2LVBA 4ZAGA 1LSSA 1AURA 2BDUA 2F9MA 2W83A 3D4PA 3MT7A 3R3WA 2CMKA 3NVKI 2V3WA 4WBXC 4CMCA 4W7HA 2BEJA 4TM7A 3IMEA 2YYYA 2RGNC 5IN5A 1NP7A 2FJPA 3WLKX 1QK4A 4OXRA 3AL2A 2H0QA 1TADA 3WKAA 2KHZA 4YMIA 5EMMA 1KO5A 3A9UA 3OAAD 4J4HA 4MYUA 3VH1A 4PGMA 1HE2A 5B4UA 1OLXA 3D5QA 3PXGA 3AEZA 3MBOA 1RJGA 3OJFA 2XD9A 2QD1A 3NBFA 2FMTA 4I4NA 2ZT5A 1V95A 3H3XA 5B36A 4AJKA 1XP8A 3KSZO 1T1EA 1Y63A 4I1PA 1JFTA 1LRJA 1P5RA 3KOZA 3T5MA 5LYJB 1P45A 2D8AA 2HU7A 4MP6A 3K5WA 4LJKA 4UNNA 5HVNA 2QRMA 1YQGA 4KCGA 4XOUA 3AUYA 3PJDA 2MIIA 3BERA 2P7IA 3R6DA 2I2CA 1B41A 1HK7A 3D1JA 4LDRA 5AKKA 2TMDA 1QZTA 4UHCA 2ZQZA 5EP3A 4EI7A 4QECA 4F56A 1JT9A 5HQ3A 1N6KA 4KN5A 1SVUA 3AGQA 1EWQA 3DAOA 1TW3A 2V7GA 4KJXA 3R0ZA 2V0CA 1CJMA 1C0PA 2P77A 3LPAA 3K92A 2F48A 5ALPA 3LO8A 3GARA 3GBVA 4B83A 5A4IS 1XC7A 1Z17A 3AERB 2QAGB 5ER6A 3BBPA 4MI9A 3A4IA 2B98A 4GXTA 1YCHA 2ZSFA 3Q5DA 3DL2A 5A3SA 2VA8A 3HLKA 1E62A 1BRMA 3ZHBA 4ZVQA 5E38A 1U9CA 4TSFA 3AHHA 3PEVA 1N2JA 1XTKA 1FNBA 2QTGA 3EEYA 4NG5A 3K9GA 2GPTA 1EXNA 2IPAB 4X5OA 4YT5A 5DULA 2ILTA 4P5EA 5AOAA 5BV8A 1JVSA 2YMMA 4LHYA 4RKRA 1E3WA 3G2IA 4JSTA 4YRCA 1ZOIA 5MHTA 4V1CI 1ZWLA 4PXAA 1XRQA 2V6IA 3CRQA 2Y05A 1WHTB 3OETA 5C8DA 4F11A 3UMSA 1D4OA 3PX3A 5BWNA 1RYZA 1PFVA 2C82A 2XUGA 3P2JA 2R0QC 4YRFA 3KR2A 2GBFA 5D00A 5BSWA 2P6PA 3FNGA 5I8PA 4G0WA 2QV0A 3OM9A 5IP5A 3OOSA 1UEJA 2IIPA 3BQNB 4K8RB 1K7XB 4R9NA 2DWUA 4XDYA 5KX5A 5F9FA 2JGFA 1Y1QA 5EZYF 2RK4A 2OPHA 1A2OA 1X7ZB 1A8IA 3TQOA 2IFTA 1IOVA 3HYLA 2F4VB 4M9ZA 2PUBA 4IQ0A 4BQPA 2KPOA 2ZWOA 4EUFA 4CV3A 1KQ3A 1AV7A 1ZM2A 2PD4A 3PRHA 2AFIB 3F4BA 3JYOA 4BEJA 4JI1B 4Q47A 3ZYCA 4BKQA 2C2XA 3DMGA 3NCHA 3V4ZA 2E1PA 2QLLA 1K8YB 4GLFA 3HDHA 2QMZA 1E9EA 4R7ZA 3TJZA 3KJFA 3EWAA 1VZ2A 4IJ5A 5JVDB 4YP6A 2FPIA 2NXEA 4FYWA 4OH1A 1MAWA 3O5AA 1J20A 1DT5A 4R6WA 3Q85A 3O4FA 3ZHXA 3ECSA 2XXAA 4MQ5A 1L1EA 2CYAA 5G4KB 2J0QA 1YR3A 2ZUSA 3OLCX 2JIZD 1E1NA 4W8GA 2AD5A 4F85A 3N2ZB 3QEOA 4ID9A 4WW0A 4IXWA 1IATA 4CTMA 3RS4A 5MGNA 4QGBA 1AMUA 3VZRA 5EIBC 4TN1A 3QSYA 4MQLA 5CBPA 4J0GA 1PJRA 4HDSA 4WMLA 5IM4F 5C9ZA 1QIJA 3B9BA 1SUIA 3AFIA 3ND9A 3T9DA 7ADHA 1JWLA 3THWA 3QG5A 4QQ8A 2PR7A 2FFAA 3CV3A 3OZEA 4ASUD 4CODB 4TV8B 3IL2A 2KI5A 4IIJA 1FQKA 5JG7A 1T25A 2DY1A 4WLOA 3V4RA 1KRXA 4B7UA 5FDFA 4RA9B 5EP2A 4D2IA 4QOEA 3HCBA 1IVNA 3WYFA 3L0IB 1C7EA 4C1NA 2O7VA 2FSIA 2XUPA 4ROSA 1BCSB 2FVXA 4IDFA 5EGSA 4M8LA 1ISHA 3VXKA 3C6KA 3MT8A 1Z35A 4I9UA 3C5HA 3OD1A 4FT2A 3E48A 1ND6A 4KG7A 4NPAA 4XLZA 3VH2A 1VRVA 3S7TA 4C3OB 3DOJA 1J24A 4YGXB 2EKBA 1BXRA 4MB0A 4RLHA 2G06A 4EMSA 2DBRA 3FPHA 2P3SA 4KR7A 4ZQEA 1KEVA 1DC7A 2Q1XA 5CLJA 4DM3A 1ONOA 1TO6A 4N5LA 3GEPA 2NPFA 3UJ7A 1QOZA 3GCWA 2HX1A 2RK3A 2P6UA 5C32A 3NH9A 3BK1A 1C9YA 3K1AB 3O9VA 4KXYA 1P6UA 4KRXA 4PZAA 4HAUA 3V80A 4C3VA 4GZMA 2PZ8A 3TD2A 3WX0A 4E1AA 2I1WA 4QIHA 3U3DA 4FB5A 3O8BA 1VYHA 5DWVA 1KOJA 3TAXA 5KWVA 4YX9A 1HYHA 4R1OA 1OAOC 3KUXA 4JROA 1YBFA 4I1UA 2XVMA 5FTNA 3EX7C 2VYQA 4IZIA 4ZVNA 3ZHOA 1V37A 2AFHB 1DRUA 2XTAA 4LDQA 2SCUB 2P5SA 1DZ3A 4YAOA 2NU8A 3BRWD 2RSLA 3LT2A 3TE6A 2BCGY 3PDIA 3A9TA 3WK4A 4HEQA 4NEQA 1E1KA 1GPNA 1P5HA 4OGFA 3TIXB 2DSTA 1KJYA 1WB4A 1QV7A 4M1MA 5DEIA 1SXIA 2MSLA 1I2ZA 1Z4MA 1GVNB 3CNNA 4P7BA 5FD8A 2DCUA 1DKLA 1SK9A 2HXYA 2VF5X 1DOAA 2IPXA 1C0KA 4UQOA 5JEDA 3EG9A 2EZTA 1KKMA 4TKLA 1T4MA 1PSDA 4PPFA 3B5EA 2WK1A 3LRPA 3D4LA 4X8HA 3A2NA 1X0XA 1HURA 4FYVA 4L0DA 4DAEA 5HQTA 1NBME 1UDBA 2H1OA 3SIWA 1X7WA 1PYGA 2QPOA 5EEHA 1IN8A 1M1NA 1VE6A 5IFKA 2G09A 4TTJA 2NSHA 1YE3A 1Z06A 4MPJA 2YWCA 3ER6A 4JJ7A 4RF2A 3SR4A 2IX3A 5E3HA 3JALB 4MUEA 3ZE8A 2E7ZA 5NLLA 1B3BA 3LZ6A 2QRHA 3VMMA 4YCCA 1SNYA 1U1FA 2I2DA 1DUSA 3FH0A 2C2OA 4F3CA 1RD4A 3SSMA 1R8SA 3EYAA 3C97A 4NMWA 5DZSA 2ZBUA 3J7TA 3SOZA 1XZMA 5J5CA 4ZC1A 3HKBA 1N6LA 2ZYGA 3DF9A 1C7JA 3JYLA 1G4UR 4UUQA 4XUCA 3Q98A 2G6BA 5BYBA 2YY7A 4BFZA 4C22A 3NNDA 1HA3A 3D3EA 1ZK0A 4CDRA 1D8TA 3T1TA 3IEXA 1XK7A 3WVNA 2CZQA 2JJ2A 3R4CA 1UUFA 4JNCA 3RS7A 2D2XA 4FBLA 4QG7A 3SEFA 5EKTA 1N6RA 4IQ4A 2B3TA 1H2RS 1TAGA 3A4TA 2P5TB 2AJBA 2QN2A 3QEMB 3KJQA 4WKPA 4X24A 2FFBA 3A6GA 4LDAA 4M6WA 2O1SA 3E18A 4R83A 2HIAA 4ESVA 3GLTA 3UG7A 3R9WA 2ZUBA 2PRSA 4PYJA 1UBHS 2OMEA 2R8BA 2QBYB 2JK0A 3EUEA 4HLQB 1I3OA 3AXSA 1R9MA 2FWRA 3AHCA 4HEJA 3WOVA 2HWYA 1CY8A 1M1XB 1U2GC 2QK4A 1FSSA 4WECA 7YASA 2G1PA 4NECA 1DKMA 1P62B 4K6GA 3EDOA 4K86A 5A4AA 2OP1A 4HN2A 4HS9A 1Y6FA 4MDFA 1E2HA 5EWLA 2VP5A 4OQNA 1GZDA 3TAHA 2A3RA 2Z3ZA 4PC3A 4E5UA 4D46A 3RTAA 5AVYA 3GMDA 4MA4A 4MI1A 4EPTA 2O1XA 2C59A 4RWEA 4F9EA 1F2DA 1RC0A 4YT4A 3DBLB 4PYRA 4GBED 4OUDA 2QZPA 2GCNA 3QVVA 4EJ0A 1KJJA 4TT8A 1DG3A 2VDNB 4ARVA 3CR3C 1Q0PA 4D3YA 4AJEA 1PJCA 3NT2A 4M87A 4U00A 2BKEA 2C2GA 3GP3A 1JG4A 4ZEOA 1NF3A 4DMGA 3OVMA 2R6GA 4HMPA 5IJWA 2UZ4A 2C5FA 2JG3A 3PI7A 4CIBA 2OAQ1 3A8TA 5AR1A 3LUJA 3T7CA 5M29A 1E0AA 2H3EA 5AHKA 1TKCA 3OIWA 3FNRA 1W36D 2BKAA 3FVWA 4FDUA 1EK1A 3LOUA 5A1JA 1GU7A 4OI2A 4UVGA 1CDZA 3ZVKA 3OPYI 2KLHA 1OAOA 4G0XA 3QXSA 1RFLA 4RM2A 1T8SA 3IUEA 3HJBA 4TTQA 1PBNA 4E5SA 3MTJA 1ZK1A 4DR4B 1NVMB 1UJ5A 3A06A 5AJTA 3ROEA 2VZLA 1TM7E 1L5GB 1II8B 2OXCA 4R2MA 3FOAA 1TTHA 1XRJA 4UNIA 4N18A 3SBDA 3IVMA 2OL4A 4ZT4A 3K0CA 4HSGA 1A71A 4OQQA 2ATVA 4JP1A 5IYZB 1L8LA 4NXNB 1DPFA 1CJVC 2PAAA 1JB9A 5BUSA 2VP3A 1FTWA 1CP3A 4L8YA 4MVJM 4NZZA 3ICCA 1U4NA 2NX2A 1E7SA 1UKCA 2XIQA 1RBMA 3K35A 2POCA 2PD3A 3QJYA 3OZIA 3S1AB 4DV7B 4WOCA 4PYNA 5H4HA 2HHJA 5KWSA 4U0KA 3TQQA 3R3XA 3ENQA 5D85A 2JDID 3FRIA 1IN4A 3UWMA 5IF3A 4P4LA 3TUJC 4LTDA 2Z9BA 4I99A 4MLPA 1J0EA 3QXJA 2GO7A 4CQJA 4DQUA 4KQFA 5DM4A 1Y3IA 3DWGA 2J7KA 1L5OA 3H0KA 1T8YA 1E1CB 3KWMA 3VYSB 4RC9A 3F1KA 2J33A 3PE3A 1ZN2A 2P9BA 2OOSA 3AR8A 3PNLA 3IIJA 4RMJA 3ZGYA 4ESHA 2ZAGA 1VHQA 3QV2A 2HQOA 3QTLA 3DXYA 4FOSA 1NJFA 3TF5A 1XNQB 2XCQA 3CVJA 1XMSA 4IEFB 2VJMB 4Q9DA 4BP8A 4U7TB 2F1RA 5F23A 1D03A 1R0CA 2PRIA 2WU3A 1JBEA 2Z1NA 5J4LA 1HYGA 1OXVA 2B1GA 5FPYA 3P9XA 4D41A 4EPWA 2ZXUA 2GNOA 2LTAA 3VM6A 1J9ZA 3MWEB 2WINI 3H5NA 2GBCA 5DB4A 1XZBA 2Y1WA 3AI2A 3QHQA 1V1JA 4NYJR 2CHGA 3N8DA 4CG2A 3FETA 1REQA 1V9SA 4GPIB 1MVLA 2CEAA 3OECA 3ANSA 1B14A 4RS4A 5A9RA 5HIKA 4GBMA 3S99A 4NHEA 1KDZA 2RB5A 4RTKA 5L6LB 3ZLVA 1OZFA 2G0AA 1DV1A 3F7TA 3KBOA 3O8QB 4A0QA 4BYMA 2CFSA 4RSHA 1X38A 1KSFX 3K8ZA 3OLQA 2H08A 3HA2A 1CRWG 5A3JA 1IC6A 3SHWA 1MEOA 1RHRA 4G89A 1N7IA 3V1NA 4AKHA 3FSEA 1U2GA 1VIAA 2J3HA 1SIOA 5EJMA 4G37A 2IZ5A 1CS4C 2P35A 1XTZA 3PE6A 1USWA 4F3TA 3ODGA 4BX2A 4C06A 4MPRA 3E8SA 2GM3A 2AQKA 3DXFA 3NAZA 4BCDA 3RHFA 3UBTA 4M8KA 3H9CA 4QAQA 1R4MA 1E8NA 4D6XA 5C8YA 2RGWA 1W30A 3WLEA 4ZODA 4GAEA 5I8ZA 2Y9MB 4F84A 1NX6A 2B9VA 2EBWA 2PVCA 2B8WA 3FLMA 4N3AA 1QG4A 3HM2A 3N2NA 4PLGA 4E08A 1JJIA 5AVKA 4U6SA 4RD6A 3KJIA 4IHKA 1EFPB 3JYPA 1B6SA 1TM3E 4B4KA 1ZMOA 4CUZA 1H6DA 3KOWA 1QIHA 5FLKA 2FAXA 4R3UC 3KK0A 4GLLA 2WNHA 5EG5A 1R1DA 4B3JA 1I2CA 4O4JA 3GCXA 3NC0C 4HKTA 1W0KA 1A7UA 5EIOA 2YJ3A 1SIBE 2HMWA 3R09A 1TPZA 2YVAA 3JZAA 4JJKA 3L49A 4O5OA 1UQUA 2BWJA 2C9YA 4A6PA 2Y1EA 5SZHB 5CG2A 5IAOA 4ZO4A 3U31A 1FF9A 3AF0A 2Q3LA 1DU4A 2WTXA 4D96A 4GL4A 1IOLA 5TQJA 1GM5A 3W9UA 2QN1A 3MGBA 4KPGA 1VJTA 2W37A 1B7GO 5ICGA 5M5BA 1LRLA 4QUBA 5LZ2A 3IO3A 4XJVA 4NBRA 1NONA 2XNDA 1EWYA 1O1YA 4IWNA 4MHOA 2C2HA 2IZZA 3ZWVA 4O2BB 3KX2A 2EL7A 5D5HA 1VHWA 3N75A 3AKZA 4QRHA 3B9QA 4BEVA 2QI9F 1PDVA 3SDSA 2OUIA 2ZYWX 1NXSA 3HUUA 4PFKA 5CDFE 4XDGA 1KTIA 1QQAA 5FOXA 3R9KA 1G1AA 1NC1A 4XIGS 3UWDA 4OAOA 5HKKD 1JE0A 5BRAA 1PTJC 2W98A 1USIA 2W8ZA 5JE8A 4A4DA 3QOWA 4YRGA 4AI6A 2PWPA 4KP7A 2X8JA 2D3WA 3OSZA 2B7LA 4PBTA 3WZLA 5KKCA 1SZPA 4BFYA 1ILEA 3H4IA 1E94E 1YOVA 2EZ9A 4RMIA 5G3ZA 3IP7A 3UYKA 3VGPA 5EIXA 1OUMA 4H7EA 2I4RA 2GZ1A 2GF9A 2M98A 3EIUA 3HCOA 4O4IB 4YP5A 1UDAA 3HBAA 2KBEA 3WLLA 4ARZB 4DABA 3O8CA 1OAAA 1EWKA 3W5SA 1AGXA 3MLBA 2VHWA 1SR8A 2YJTD 4WL0A 2IOFK 1DADA 4YCAA 2HPAA 3VDQA 3GFPA 5KTNA 3PI6A 3I62A 2J45A 1NF8A 3P9KA 4QU8A 3OQ6A 2YYAA 3DB1A 4ZVOA 1RWNA 2P91A 2HV9A 1XYGA 1MJ5A 2WY2D 3IURA 1K7YA 2XF8A 2ISCA 4GXRA 5CLHA 5EKUA 3EXHA 1YE5A 4Y3UA 3TQRA 4DB4A 3IQHX 1IXSB 4Q3KA 4QEZA 4YAGA 1BDHA 2V1UA 5I7RA 3EC2A 1KSJA 3GGDA 4HVAA 5E2AA 4OJMX 5H70A 3WBKA 1KQOA 1G98A 1D5CA 3MLEA 2VPXA 3KYDB 5E3JA 3BTVA 2AMVA 4D6PA 1H5UA 4PXYA 3NFRA 3PEFA 5T3UA 3FFXA 3R4VA 4G2NA 3OZBA 4FEGA 4PYIA 3IT2A 3ZHQA 4LOJA 3GRRA 4IILA 2J9FB 3ZJVA 2GZSA 4M88A 3B9RA 3FM9A 4C20A 2YDXA 3AGPA 1H05A 1Y82A 1HE8B 5IS2A 4Z3OA 3X1JA 2H7YA 4C4ZA 1WULS 1NJSA 2EAUA 4P38A 1OYWA 3TD6A 5DM0A 3GI1A 5IJ9B 1BQ4A 1JI0A 1G3MA 2NSJA 4MS1B 4XX0B 5EWJA 3ZW7A 4HFRA 1CR4A 3C8ZA 1MB2A 1JSZA 5ALZA 4JYZA 4H0FA 1SQSA 3QMVA 4OG2A 1ZEJA 3GU3A 1N9GA 3BA6A 4YAFA 3UMGA 3V1KA 1P3Y1 4CLHA 4P4SB 1XZKA 2NO1A 4LUCA 1Y3FE 5FR1A 1A4IA 2EARA 1KFJB 2VWGA 3COWA 4J0IA 5JZ9A 1V5FA 5MFZA 4AO7A 1NDHA 1P44A 4V2UA 1ESDA 5EQDA 4FX5A 3UK2A 1OASA 3NB0A 2H4HA 4EGSA 3DQZA 2YV5A 3BFVA 3NOOA 3MJVA 4NATA 4R0MA 4HDRA 4WZBA 5ICCA 1MC1A 3EVDA 4LYDA 3ZGZA 3QFCA 3DEYX 3ZCRA 1IM5A 2RG1A 1K8XB 3I01M 5LIPA 3PEWA 1G63A 2B4TO 2X0DA 2XRZA 5BV1A 1T10A 4H6PA 4ALIA 5A9SA 1YIOA 3ETGA 5IRCD 1T8TA 3HYNA 2O2SA 3BB4A 3WDMA 2NTYC 1UMCB 2EERA 5IULC 1J25A 3UJNA 3LQ1A 1FDWA 2XGSA 3AKCA 3GPCA 3GJQA 4BJ3A 1MV5A 2HSGA 3BFKA 4GZ6A 1SG0A 3GEIA 4JP2A 2BBWA 4DJJA 1QO9A 2CMHA 4WZAE 4POAA 4H2DA 3A26A 2O19A 1G21E 1Z37A 3URKA 3PL1A 1D9XA 3TSAA 1FL9A 1L5ZA 2HM7A 4MW6A 4B6RA 1LX7A 2H29A 1QQ6A 2NN3C 1EYZA 3RRFA 3ZWKA 4G01B 4D92A 1DKPA 1SZJG 3V1MA 1R0XA 2FSUA 4P4TA 5DLDA 2FG6C 2Z4RA 4B2YA 3L0OA 1N3YA 1E1YA 1Y3DE 2JCSA 2PKWA 3GXBA 4TTIA 5GGXA 5CB4B 4Y2UA 2XSZA 1XDBA 3K0SA 2DQYA 1BQEA 4RVGA 2ZSEA 4WFQA 3M0EA 4HI0E 4WQMA 1WX1A 2F3QA 3W5UA 1P4HA 3LRTA 3FUTA 3BCRA 4MQUA 3KE8A 1YRBA 2IBTA 1UQRA 5LP6B 2BFFB 4Y9SA 2CJPA 2JLRA 4Q3BA 3WB2A 4GNRA 1IN1A 4D4HA 3ZU6A 4QTXA 4QTTB 1TLLA 4BB9A 2WYIA 3CC8A 4GVXA 2NPOA 1OWMA 3AUFA 3F6CA 5LDDC 2RGAA 3F6EX 4UOEA 1I0IA 2NUTA 3T9BA 4CF5A 2ZANA 4DDTA 5JAPA 8MHTA 1DO8A 2ZUCA 3LT5A 4IIUA 3OPQA 4YN3A 2BSXA 3U48A 2IY7A 1J49A 4LOHA 3ASYA 5H8WA 1CSEE 4EHJA 3KTDA 3A10A 3WGQA 3GLSA 3TFQA 1PK9A 3WLOA 2V5UA 1FFCA 5DRTA 4A82A 3G8CA 3WL3A 3L3BA 4W5HA 4KTTE 1H4QA 2NUPB 4KGZA 4BBZA 3E5NA 2JBAB 2FW1A 2FPPA 3W6OA 4QKQA 3E03A 4B0OA 4H1WA 5FTKA 3UT5A 4DM4A 4E31A 2FPMA 2WZDA 3ND5A 1A3CA 1E7YA 1IEXA 1PX0A 2YXPX 5TJ9A 4OX9B 2BZSA 2HPHA 4O4HA 2O20A 2P4SA 1C3JA 3ORRA 1FXSA 2ZSJA 3RSOA 1K98A 1LFAA 4AMZA 4DCTA 4KBYA 1U63A 1TYBE 3CTPA 3UJBA 4NVRA 1FRVA 2PZAA 2V6GA 1JQJC 3B2QA 2G9NA 4KI7A 1XXLA 2W43A 1T0IA 3N5KA 2AMJA 2Z5VA 5CHEA 1MJNA 1QLJA 4GO1A 1DCTA 3ZE9A 4UD6A 1ZPDA 2XYRA 4Q66C 4A16A 3MTBA 4WK0B 1DIOB 2DU8A 3GOQA 5KYWA 4JL5A 2D1YA 3DCIA 3M9WA 3RHSA 2DFTA 4A91A 4J1SA 4BNTA 5K8UA 2UUCB 3SZ3A 1J8FA 2XRFA 3NKLA 3TKAA 4GOKA 5B1IA 4RNCA 3VKWA 4N40A 4DSTA 5A5EA 2VT3A 3GNSA 2GVDC 1C9EA 2RBEA 1BU8A 1P2GA 2AJTA 2O2HA 1O8BA 3MD9A 4NS4A 4MV3A 2P2SA 4AIIA 5GOTA 1NRWA 1YS6A 3VH3A 2XJ4A 1DL5A 3VSAA 2WZQA 5H02A 1NNSA 2ZFUA 4IUBS 4Q5IA 4GZ5A 4YGYA 3SQLA 1IWBB 3TLBA 1E6WA 4IH9A 2QL5A 4C76A 2QL7A 3KOUA 1SHKA 2PMWB 1YS1X 1J6UA 2R7LA 2AG1A 2Y71A 3K96A 4HYYA 4LSGA 2AZXA 5G1PA 3CNOA 1B2RA 4RJLA 4ZPJA 1T26A 3V33A 1JPNA 3ZZNA 1NYQA 1IPEA 3IRUA 4UD2A 1BGVA 1Y8QA 2H0RA 4IVNA 4L1KA 1T4DA 3FPSA 4YMWA 2CNBA 4FDLA 4FJ1A 1JF8A 4GGMX 1MC5A 1EE2A 2FSSA 2GARA 1MB4A 2JZCA 1QZ3A 3PNKA 3WZ2A 3EOBI 2AE2A 3ZCVA 2WF6A 5LXTA 3NIGB 2H5LA 3KKLA 4NEGA 1Y5RA 3GUVA 3OIDA 3U40A 1DAGA 4O0MA 5KS2A 1N2CA 4C08A 5C1BA 1Z6PA 1T2UA 2VDVE 1FNCA 2ONCA 3M33A 4FWBA 4DAOA 4LXQA 2KLBA 1K75A 1I10A 2XEXA 3KQQA 4ZVTA 1PF7E 3VO1A 4LGCA 3RC2A 4A0GA 1AZWA 2ZWMA 5JAHA 3BL8A 3HMQA 5HFAA 3Q3HA 4KPFC 2O8CB 3CJTA 4HGPA 3DULA 3ILHA 2BMVA 4B6JA 2PPLA 1XKTA 4V0NA 1ZGHA 4YTEA 3WNZA 4ZI7F 2M6SA 1G2QA 3A1SA 1XHFA 4DXHA 4ER6A 5HOEA 1QGAA 3EZXA 4G4GA 1THZA 2PGAA 1C1YA 1R6BX 3MYYA 5JTUA 5LWQA 2ET6A 3RVJA 1B8UA 1I30A 1N6IA 1HDGO 1NOJA 2C83A 3R0IA 4EGQA 4BTVA 3TR0A 2WHYA 2EQ5A 3ACCA 1ORWA 2Q1UA 3LBHA 1VBMA 2X8LA 2KW5A 1WSBA 5AVZA 5KBYA 1YL5A 1ZUD1 1QGED 3FY4A 2WVHA 2IDJA 1PHPA 3F90A 3OHSX 4E3ZA 3DE5X 5B5SA 1UZUA 1FUIA 4QWWA 1D2HA 2HWUA 2H0AA 1E2PA 3D6FA 1C7QA 3DTNA 4EJMA 4YYZA 3C43A 4WCFB 4BL5A 1WOYA 1P9NA 2B8NA 2VPZA 1KKUA 2QM3A 5SY9A 1YA6A 4Q1AA 3Q4GA 1CLUA 1D7OA 4L5CA 3RROA 1LKZA 1V5EA 3JQQA 1NMYA 3LQYA 1JQAA 4XWGA 4NOMA 4QNNA 3EGIA 3FBTA 4WIAA 2ZE5A 5CIQA 3GLFB 4DDMA 3CW9A 1TUIA 1TEHA 2X9NA 4LDJA 3CZ9A 1I9GA 3IERA 1E2LA 2QRQA 3F5DA 3ZH2A 1AF7A 1CB7A 2PGDA 3RVLA 5I7HA 3LI2A 1GPYA 4F92B 2PEYA 2ACVA 3TNLA 1ABFA 4NNJA 3K0EA 1IRXA 4DIUA 2QD2A 2YV3A 3HKDB 2WWWA 3L8EA 3FMPB 4EHDA 3BL5A 3JQAD 4E70A 2OHFA 5CMLA 1SVNA 4LDZA 5SV2A 1V45E 3TRDA 4KRYA 4MOWA 1R4NA 2QR2A 5I7WA 5IBQA 1I7SB 2JIQA 3K32A 3C70A 3AJ8A 2JLVA 1AKQA 3TVTA 3UAZA 1C30A 5I9NA 4W7SA 3C8DA 3HFJA 3KC2A 2GK7A 1GPUA 5C53B 3VKFA 1TQDA 1ENZA 3DEZA 3EZLA 5HRCA 1EJBA 1XD9A 3KDAA 5FA6A 1ZISA 3AHIA 4LKRA 1G6HA 2H9IA 2BM1A 5LDGA 1OX4B 1L8OA 4D0NA 4RHTA 3KNZA 1A9OA 3S28A 4E4TA 4GR5A 4Y1FA 1UDWA 4M38A 1PJBA 1ESZA 1WCXA 2C5SA 2BP7A 4JOBA 3UJ3X 3TRIA 4KO8A 4BIIA 3GCGA 2P1DA 4JUFA 4GX0A 4JCOA 4DMLA 1T5IA 1DOZA 1EFKA 2GSWA 3GZNB 4M36A 1ZOSA 2HRQA 3RC1A 2FWPA 4QX6A 3ZEAA 4H6VA 4AROA 4I5DA 2R1TA 8ABPA 3ZIUA 1MW9X 2IIBA 3LQRA 4N5NA 2F4NA 1P6XA 3LH5A 3ORHA 4KQ9A 1H93A 1KFKB 4S35A 3ZHUA 1Y9DA 1N92A 2LKCA 4LY0A 2HV8A 4N12A 3FX2A 1TTQB 1O3YA 5JD6A 4N7JA 2PV7A 4OXXA 2XDQB 4OMDA 4B3SB 1U7OA 4UUNA 4BLWA 4TUYB 1ZJ6A 2A2ZA 1E3TA 5CW2A 2JVJA 4AKSA 3AVVA 4EY3A 3IX7A 1UBFA 2H1RA 1EFTA 3BICA 4V39A 1JBQA 2BM0A 3KU1A 3JCZA 2GXQA 1X8JA 1L3IA 1ZD1A 1F48A 2J87A 2Z2ZA 4NNOA 1MGOA 4QQRA 1ZS9A 4QTZA 1N2SA 2OXRA 3MMSA 5H82A 5CFRA 1OBFO 4WEOA 3ASZA 3WHLA 4BO7A 3NTVA 4XCQA 1IIRA 1IZYA 1USGA 3U3JA 2AEFA 4NICA 4Q3LA 2FH5B 2WILA 1C4WA 1LSOA 1SKQA 2X6TA 1Z2OX 1EXDA 3ZGLA 4UUBA 1QAMA 4WD3A 1VSTA 1T2EA 4B71A 4E1VA 1J0DA 2F6RA 1KEEB 2C1XA 2ZW9A 5D01A 2OXTA 2H2GA 3WQSB 1UFOA 1QZZA 3ET5A 1R5OA 3AP1A 2EQAA 1KP3A 3HO1A 3LXMA 4ND8A 4RVHA 4WV3A 2SECE 4BV9A 1NXOA 2Q0HA 1CE8B 3FZYA 3GJ7A 3I01A 5K3EA 3VC2A 4UMFA 1Y48E 3H1FA 2EBUA 1FIUA 5CVJA 3F9CA 5DPMA 3QPUA 3KJHA 2J48A 4ZAYA 3H8VA 5FRDA 3L7IA 3NXSA 4G4SP 2ZRHA 5TQ2A 2OLEA 2Q07A 1W2WB 1YDGA 4CL0A 2PLNA 3DWFA 2FF7A 3LP5A 4AMYA 2J3KA 5HTOA 4MR8A 3MT0A 3H2GA 3Q2OA 5EUMA 3PQ2A 1UC4B 4IQFA 1G42A 3RFFA 1N3BA 1FDTA 1SBIA 1XRRA 4NNPA 4S1WA 5K5EA 1M6EX 1ZJZA 3QPVA 5DTMA 4Z1MA 4C7BA 3NFYA 4C2TA 2FW0A 4EA8A 1U8EA 1SCIA 2GN2A 3ESBA 1G8AA 5H9WA 1H2YA 4M98A 2RJOA 4ZOQI 3UYLA 4XX1A 2B1IA 3B1WA 4K7JA 3P9IA 2GEKA 3PJFA 1WG8A 4NJOA 4Z7JA 3SFVA 1V8BA 3TVDA 1PEDA 3DV9A 4MP8A 2DMRA 4OL9A 4RF5A 4MK4A 3DGFC 5JXHA 2RARA 3LBYA 2BZ0A 3HB4X 4TQUS 4WACA 3W05A 3CT4A 1B73A 2RBKA 2Z6QA 1WXQA 4PG6A 1OLSB 3G59A 3LS2A 3RT9A 3IODA 1R66A 3TPCA 1MJFA 4HY3A 4KLNA 1L7AA 3L6BA 5DBGA 4ZQCB 2HA7A 1M7BA 3F67A 3WSWA 3UJAA 1YFKA 3PTLA 3ZU3A 1JEYA 3TO5A 3GL9A 3CLRD 1SVWA 1XQ9A 4LZZA 1OI7A 4HB2A 2GPYA 3IEVA 4FLFA 4NBSA 3D54D 1YHZA 3H1EA 5ESWA 1ZU4A 2QS9A 5AVQA 3P2KA 1N8NA 4NH4A 5H3HA 4ZZIA 4JR1A 3ETLA 3QG1A 4FS8A 3NQ41 4J8PA 3M6UA 3CLSC 4QE3A 3SE0A 2YJZA 3WV5A 1SXJC 4EAAA 5AJYA 1W5FA 1ZKMA 1NE7A 4CCAA 4X7MA 1OI3A 4WE3A 3PHBE 2FSGA 3DS8A 3I4FA 5GMOA 3N7UA 3CZRA 1EG7A 1VE9A 4GSYA 3RNLA 4CXMA 4JIGA 3N8KA 3P2OA 2XE4A 4A26A 3P96A 4BVHA 2BBSA 5B64A 2UXDB 3IUNA 4EHNA 3CKLA 3R9XA 5AKZA 4UM8B 3IPXA 3PVSA 3KKQA 3SIRA 4DR3B 2VWHA 1JG6A 1L4GA 5JH7F 2CXUA 2EG5A 1NLYA 1FDUA 3P19A 1RI1A 5C7OO 1P7PA 2HPVA 3GZTB 4JLJA 1ZG3A 3RKRA 1XPOA 1DLJA 4N8DA 3ZE7A 5TQVA 2E5WA 3TBFA 4DRXA 1RRKA 1Q1GA 1GHTA 4CLOA 3PGA1 1E20A 2JFQA 1E60A 3ABQB 3FW1A 3LY9A 5ALRA 4DJTA 2B82A 2JLCA 4GM4A 4W4TA 1NE2A 1ODLA 1TM4E 3DA8A 3G88A 4B87A 5HDQA 2P2LA 3H4VA 2VCEA 4FHEA 4QDKA 1DBWA 1HMYA 4FGZA 3FYHA 3EBPA 1GQYA 3DTVA 4LOIA 4J75A 2CFTA 3LQ2A 3ZHYA 1CDOA 2IHTA 2OCAA 2B4RO 2ZSKA 1FFXA 2PWAA 3MGCA 4D9NA 2AF3C 4OBXA 1DAKA 1YI0A 2VJBA 5HQ3B 4QPZA 1YUBA 2L18A 4RHFA 2PKCA 2R8PA 5AKIA 1TECE 3SC2A 3CX8A 4XGNA 1X0VA 1DXHA 3GLKA 5BNFA 2YBDA 3ONFA 5I9BA 3IV7A 5JHHB 4P2GA 2FN4A 4Z5XA 1KYIA 4D26A 3DOCA 4DVJA 3OFJA 2IIVA 2R1UA 2HTFA 4DCCA 2D5IA 1ZW1A 4UU7A 3RAGA 2EZUA 3O8OA 5CYGA 1E89A 1G9TA 1SVOA 3SY8A 4UMVA 5KNDD 1CRQA 1U6IA 3AHJA 5LOVF 3LWDA 3PDJA 1F1BA 2PM8A 2WEKA 5K0CA 3P4YA 3V55A 3ZR4B 3D8TA 4J91A 1SWVA 3R44A 5FNZA 3ZLBA 3WK8A 2X19A 2LWIA 4DLUA 4L8GA 5IDWA 1G16A 1ULAA 4TT3D 3VH4A 4QFBA 5BSFA 2WTBA 3N0RA 1B0PA 4X20B 1N1EA 1Y5NA 2X1VA 3COJA 4B2LA 1B3RA 1LW6E 2QROA 2XKAA 1ZNYA 2XMSA 4ETIA 1WRBA 4BMZA 4M9XA 1MH9A 4FMDB 1ZJ4A 3CLUD 4MEAA 1M6YA 5KX5B 1C7IA 2Y1DA 1I80A 3VPXA 4GM1A 1I3KA 1WBJB 2B83A 2NV6A 3NHWA 3LJKA 3FWHA 5FTJA 2PKEA 5EEGA 3LFUA 1R0SA 4XD7A 4JC8A 1PQPA 3VNBA 3AUJB 3GGJA 4D74A 3PC2A 2PXHA 3DBRB 2F3RA 3H2YA 3HDGA 3C2QA 3HPRA 1OKKA 1TFUA 1Z45A 4J4TA 3UVEA 4NDZA 3ZGVA 3V4FA 2M1ZA 2P9CA 3H1GA 5DHFA 4K6CA 2QVZX 1PL8A 4RXUA 5EIFA 5A71A 5THQA 1Q0LA 2W2PA 3P94A 4TSKA 4F96A 2X1LA 1Z6ZA 2WZCA 1SHTX 3K1YA 3TM5A 4PLZA 1HDIA 2QXUA 4QJIA 5BT8A 3NVAA 2FPIB 2OZPA 3DDZX 3DEHA 2CLDX 1KAOA 4G24A 2DC1A 2P4QA 2J3JA 3AF1A 3DLAA 4QU0A 4JWTA 4B7XA 2JPDA 2XXAB 2WTNA 4G6ZA 1LPSA 1YE8A 5MFPA 4P8RA 4A6DA 1Z16A 1SXJA 3WIOA 5A5GA 1KI6A 1PGJA 1RVV1 1HT2E 2BFCB 3TUIC 4PAWA 3UKDA 2B5WA 4JSYA 3WAJA 4QPNA 5KSPA 8LDHA 1DJLA 3CF4G 4J3FA 3PUIA 2GHIA 4H77A 4HDSB 3RC3A 3ROQA 3U13A 5K3DA 2HDNB 3I5MA 4N0DA 5M2QA 1A04A 1A88A 4C7KA 4BBPA 4LBVA 1U8YA 1RMTA 1Q5PA 2HA4A 2MYTA 3WB9A 5L3QA 1T6YA 1FNMA 1XQWA 3A11A 1DKNA 3LX5A 2X13A 2QTMA 4YCJA 2D4AA 4IIJB 4GXNA 4M46A 4R01A 5TEWA 3VZCA 1TTTA 2XLBA 4G0YA 1DIGA 1L5HA 4TZ0A 2HMTA 4LX8A 3UB3A 3R3HA 2QTWB 1SUAA 3CB2A 3DMDA 4HDMB 1P60A 3HACA 4KO4S 4W5OA 2HADA 5C5DA 2CFOA 4DBVO 4ETNA 3UV3A 2WW8A 1YB6A 4J0DA 4FUTA 1RPTA 4KXWA 4HNRA 5GY7A 4LAFA 3D3QA 1JL3A 1UT6A 1NNI1 1LU9A 2IUYA 2P3LA 3EZGA 4OBBA 1WUKS 3F6YA 2M6LA 5JD5A 3I04A 5T6MA 1FZQA 4CFSA 1S3IA 4HN9A 4BO4A 3LWNA 2REQB 4MYRA 4BX9A 4J0FA 4BYGA 2OCLA 2I71A 4TXNA 2WM2A 3G2NA 3JQCA 4JBWA 3DFMA 3NORA 3T9AA 1JR3A 2WWRA 3UT6A 4EMBA 2BONA 4TLEA 1GA1A 4MUBA 1T8RA 3CXUA 1G60A 3OIUA 4IPTA 3T0FA 3U4GA 4QEDA 1RXUA 1L9KA 1TO2E 3F97A 5U4XA 4WWHA 4JC0A 2FEPA 4KC0A 4RJKA 3HJTA 4EUHA 1FUEA 4GP9A 2CLHB 3GAMA 4Q1DA 4NYMR 1OI4A 5A3QA 2NU8B 1JTEA 5KTPA 3BIFA 1RYMA 3PDIB 4BQIA 1UOEA 4WK4B 4DA9A 1CT9A 3O1HB 5CT8A 5U4QA 3VU3A 4DYVA 4IIYA 5T67A 4AO8A 4E3WA 4EM6A 5BWBA 3ZXSA 2AKYA 1PJ2A 3OQBA 1IFXA 1PQUA 3CW2A 4MW9A 4WINA 4KV7A 1NXXA 5HF9A 2KSQA 3IUBA 1RI5A 1Q84A 4MLDA 5AJVB 4YI5A 5AP9A 3YASA 1PR4A 3EG9B 5CJJA 2F90A 4AS3A 2B61A 4GI1A 2WUDA 3U7QA 3RAPR 4ARBA 2XZOA 4I2NA 2CNKA 5BMOA 2DAPA 4OAQA 3FHOA 4HDNA 2REXB 3VDRA 3TI9A 4AECA 3U7FB 2CLCX 4BO1A 1CBUA 5CG1A 3KLBA 4G86A 1X7WB 3G2MA 4JXJA 2ONKA 4BPBA 1LPBB 1F51E 1M1NB 1U4OA 4WKNA 1TK3A 4DM7A 2QTTA 4F2GA 1DJMA 1QC5B 2RH8A 2O52A 3MCZA