3LHNA

Crystal structure of putative lipoprotein (np_718719.1) from shewanella oneidensis at 1.42 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
b'LGDTSQNALDWPGVYEGVLPCASCEGIQTTLTLQADNSFELKSIYLGKDESIFKVAGKFDWDSNGSKITLSDGSKYLVGENQLLMLDTEGNRITGGLAEHYILKKKGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title Crystal structure of putative lipoprotein (NP_718719.1) from Shewanella oneidensis at 1.42 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Lipid binding protein
total genus 23
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04170 NlpE NlpE N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.640 Mainly Beta Beta Barrel Lipocalin Lipocalin 3lhnA00
3LHNA 4U3QA
chains in the Genus database with same CATH superfamily
2IFBA 4RUUA 4FQBB 5CSEA 5BVQA 5L8IA 2YG2A 1EW3A 4YDBA 3STKA 1QFTA 3SZHA 1DF8A 2W2AA 5EEEA 3H3IA 1HMSA 1NP4A 2L67A 1IKJA 2HYSA 3Q6LA 3FR5A 4KT5A 3CQNA 1MX8A 4BX6A 4YBPA 1KT7A 4NLIA 4ZJ0A 4HPAA 1STRB 3HWEA 1BSYA 1VWJB 3V8UA 2OVEA 3TF6A 4LZUA 3PH6A 1K3BA 3D9WA 2RA6A 2I5ZO 1RXJA 1VWKB 4JO6A 5IRUA 4YH0A 1SLGB 2RN4A 5F58A 2NNQA 4O4XA 4Z28A 1LDQA 2FS7A 2X45A 1Y55X 5IXGA 1SWQA 1X8UA 5LJEA 4ZCBA 1SRHA 4LZVA 2JW1A 2F01A 4L1NA 1EI5A 1TW4A 2CM9A 3AKMA 3P6HA 2X4MA 1BRPA 2X34A 1U17A 2FLJA 2X55A 2IZEB 4A8ZA 3HWDA 2QO5A 2RTAA 4ZFXA 1KT5A 1B0OA 1SWFA 4NNTA 5JR8A 2FR3A 1LNMA 2KTSA 4MISA 2KD2A 3CBCA 3FW4A 3T1DA 2RTNB 5KHPA 2AT8X 4L3RA 3EYCA 2IZCB 4QZUA 1IJ8A 3EMMA 3S60A 2RTPB 1AB0A 4OKAA 3SLTA 2ALLX 2RTMA 3WZNA 5K67A 2OVAA 1X8NA 2RCQA 3P6EA 2IZHB 1E5PA 4GNYA 4ODDA 5EZ2A 3VE1A 1HMRA 2QCBA 2G5LA 1Y53X 3RE5A 5H9KA 1GX9A 1LFOA 1NBXA 1JMZA 1OPBA 3ZWEA 2OY1O 1HQQA 2W2FA 5EDCA 3UEWA 1YP6A 1LIFA 3FEKA 4YFQA 1B56A 4Y0QA 2FT9A 2HNXA 4GGZA 1LKEA 4XMFA 5K68A 3T2WA 2QOMA 1NDJA 2MF6A 2BHVA 2P8GA 1ZNGA 2AT0X 2OZQA 2GTFX 4C5PA 1N7YA 2OY7A 2A3FX 4CPHB 4CSBA 1OBQA 1R0UA 1W4TA 1VWQB 1HBPA 1SLFB 1Y9LA 2BS5A 4K19A 2OY5O 3PQUA 1MM9A 3FR2A 2C1QA 4Z27A 3U03A 1SXYA 3GE2A 1ICNA 1X8QA 2BC3A 1SXWA 2OY8A 3LHNA 4N7DA 3RDOA 3FIDA 4HPCA 4ZHDA 1O1VA 3EM0A 4NV8A 3BDRA 4QGWA 3WJEA 1EPAA 2DJGA 4GGRA 2AL0X 2RTRB 4NYRA 4O49A 5D45A 5FQ6E 4ORRA 1KXOA 1O1UA 2O62A 3PDFA 1HBQA 1ERBA 3AEHA 1QQSA 5AJBA 4CDFA 3OBLA 5IO6A 4ORYA 1SWEA 1BWYA 2IZLB 1A3YA 4UU2A 1SLEB 4WFUA 3NQ3A 1ZNLA 3NQ9A 1LIEA 4OS3A 2X8FA 2E4JA 3WJDA 4IB6A 3ZW0A 4D6AA 4EDEA 2DM5A 4EEJA 1EIOA 3ELXA 4BBOA 3NX2A 4GNWA 5FQ7E 4YFRA 3OD9A 2RTJA 5D8JA 4ZHGA 1VWOB 3VPJE 1B4MA 3U0DA 3ZQ3A 3O2YA 3B2HA 5LJGA 3F8AA 1SWTA 1KOIA 5LJBA 4ALOA 1KZWA 2FRSA 2G8CO 1FDQA 2DJFA 2RTFB 1HQPA 1MK5A 1N43A 2OFBA 1Y9TA 1T0VA 2WQ9A 3FEPA 3P02A 1CRBA 1YUPA 3FMZA 3O19A 4CPIA 1YIVA 2C1SA 1QY2A 4ZR2A 3C77X 3MBTA 4YDAA 5B3MO 2WEXA 1LICA 1SA8A 1RBPA 5CHKA 1UYOX 1D3SA 5B5FA 1H91A 4HWMA 1ERXA 3FENA 5HZ5A 2CBRA 1X8OA 1HY2A 2ACPX 4MVIA 4BQUA 3IFBA 4O3YA 1SY2A 2Z4IA 3MX7A 5B27A 1KQXA 1NC9A 2QO4A 3WZOA 4FBRA 1BBPA 1OPAA 5BVSA 4LKPA 4CPHA 1OBUA 1TXLA 1B8EA 2WSJA 3GAQA 2A8GA 4XMEA 3OJYC 3QQ2A 2K23A 4ZHHA 4IAXA 4GZVA 2LA7A 3LTWA 5B2AO 3BSZE 4GKCA 1JYJA 1GM6A 1MOYA 5BYPA 1YWAA 2OVSA 1HN2A 5HZ8A 5F1EA 2Y32A 1N9MA 5HA1A 3FA9A 3ZZVA 4GU8A 3WJGA 2VDFA 2GJ5A 2Y3FA 4QNIA 3STMX 4EXZA 3C76X 4GDZA 3LV4A 1TOWA 1U0XA 1SWUA 1I4UA 1TVQA 1X71A 4FBVA 1NP1A 1T68X 3PPTA 1FELA 1QY1A 4ORSA 3ZW2A 4IAWA 2HLVA 4I9RA 4UU3A 1W6FA 3JS1A 4A1HA 1DV9A 3WYQA 1LIDA 1AQBA 1EUOA 4ZH9A 1LCWA 1PM1X 1SREA 1Y52X 1IW2A 3P24A 2CZUA 3FW5A 5LJDA 3UEXA 1S7DA 2F09A 4IBAA 1N9YA 2OL8O 1JMXA 1LDOA 2OFMX 3CMPA 3WOVA 3KFFA 2MWHA 3APUA 1VWLB 2IZGB 4GDAA 5D4AA 4FGIB 5HBSA 3SLJA 1G85A 1MX7A 2Q2MA 3PECA 4IMOA 5HZ6A 2Q2PA 4Z2VA 3X00A 3FA6A 2GH7A 5KIDA 2IZIA 3FLLA 3UEVA 1NQNA 2Y3EA 2AF5A 1OSPO 1Y0GA 2X56A 3S5VA 3SOTA 3RWXA 1ACDA 1BJ7A 2L5PA 3HPEA 4U3QA 3VG6A 4TQ2A 3CQRA 4O9SA 1JJUA 5F6BA 3FR4A 1AVDA 1ADLA 1SWDA 1WBIA 1EXSA 1XCAA 2RTBB 3CWKA 1Z24A 3NADA 4N7CA 2CBSA 1SLDB 4JNJA 4Z2OA 5B29A 4QGXA 2X46A 1RXKA 2RTQB 2BS6A 1G5WA 4OMWA 3ELZA 2EU7X 2K62A 2JU8A 2GTLO 4BCSA 3N91A 1STSB 3Q34A 1K24A 4Z6JA 2IZFB 2MM3A 1SY1A 3ZUOA 1MEPA 3WJCA 1W5RA 1VWHB 2ANSA 1KFFA 3ZI8A 1OEKA 1KL3A 1XKIA 4O3XB 4PJ2A 4YBUA 1GT1A 2OFRX 2NNEA 4U8UO 5D48A 4DQ3A 1AVGI 2XSTA 1YWCA 3SZIA 1QFVA 5D47A 4Y59A 1SRIA 2Q9SA 2QO6A 4CV7A 3KFHA 5B11O 2VFBA 4GRJA 4YFPA 1TOUA 4NYQA 3RE6A 2HZRA 1VYOA 4AW8A 3BX7A 5H9AA 2BT9A 1HMTA 4KC7A 1BEBA 1E2TA 4WBKA 4EKVA 4QRLA 4QYNA 2JU3A 1SWOA 2RTDB 1JZUA 4MVLA 2G79A 2X8TA 3APXA 1CBSA 3B2LA 1VWAB 1VYFA 3NX1A 1SMPI 2QM9A 4O3ZA 4QQ1A 3MM0A 2GTLN 5HAEA 2RD7C 5EEDA 2RTLA 1JYDA 4XMDA 4O4OA 1ZNHA 2IZBA 1CBQA 1SWBA 2A5BA 4EQAC 3O22A 4LQZA 1X89A 4NLJA 4U8UN 4NP1A 5HWZA 1GGLA 1ALBA 4U9CA 1VWMB 3BX8A 3HWGA 2Z4HA 5L3YA 3I17A 1YWBA 2A5CA 2YMSA 1I05A 3WJFA 2JU7A 5AJCA 2KW1A 2RCTA 1RXHA 1VWCB 3BY0A 1LCZA 1N4JA 1SWSA 4WFVA 3C78X 1QG5A 5HTDA 1BRQA 4ZGUA 1DZPA 4YCEA 2UYWA 4AYHA 4GE1A 4ZHCA 1VWPB 4U46A 4YGZA 3K3LA 2FS6A 2ZAGA 3B2JA 5L8NA 2G7BA 2AT6X 4QAEA 1BLRA 4ZGFA 1FEMA 4R0BA 3HTYA 3B2IA 3AKNA 3CBSA 1DC9A 2OF9A 4BJ8A 3RBYA 2FKGA 3KFGA 4BX5B 1JJJA 2OL6O 4JHQA 1VWGB 4Y0SA 3FYFA 4ES7A 1OEEA 3CKFA 5HCDC 1IFCA 2L68A 1A2DA 1D2UA 1LIBA 2R73A 4KCAA 3D4RA 3WVMA 5HTEA 1RSTB 2HZQA 3MG5A 2R56A 3RY2A 5LJHA 3D96A 5HCCC 1NGLA 2A13A 1E06A 1FJ1E 4OS8A 2KTDA 3VG7A 3RDQA 2CM4A 3EBWA 2OYBO 1AVEA 1GT5A 3EBKA 4GUZA 1RAVA 1NQMA 2AH7X 2POAA 4AZQA 4QYPA 1OBPA 3RDUA 3SZJA 2JMBA 1LPJA 2FHNX 3I0AA 2JGSA 5CYBA 2BLGA 4CDCA 1UZ2X 3FA8A 3ZW1B 4CDDA 2RTOB 5HCEC 2GC9A 2FR2A 2OFAA 5F6ZA 1SWHA 3KVNA 5LJKA 3WJBA 3HOEA 4TKBA 3PQSA 1UYNX 5JD2A 3F6ZB 2CZTA 3TZSA 3HK1A 4YGGA 3SLOA 1A57A 4I95A 3BS2A 4GH7A 4QGVA 4QZTA 2FKJA 5K06A 5H9LA 4TKHA 2IZDB 2AMMX 2AT5X 4RUNA 1SWAA 4EFGA 3HOLA 4O3WA 4Y0RA 4I3CA 1SXUA 4YVBA 1L6MA 4IB8A 2WWPA 1SWPA 1T8VA 4OMXA 4CK4A 3PP6A 5CE4A 5F7GA 3D95A 4YCHA 4O4UA 4GK9A 4LKTA 5FENA 5L8OA 2A2UA 4WHIA 3G7XA 3STNA 2FHLA 3VG5A 4YMYA 1IKEA 1MDCA 1I78A 1SWRA 1GKAB 1VWDB 2LBAA 2ZSCA 2W2BA 5DG4A 1SY0A 1DZMA 1S2PA 2RTHB 4IMNA 2FGSA 4OS0A 4JGLA 3VHIA 5FAZA 1DZKA 3L4RA 1OEJA 4AZRA 4BX5A 4HFOA 4XMCA 5AEOA 1STPA 4ARHA 3ZUIA 4ZH6A 1KGLA 4IABA 1AELA 1O8VA 3VG2A 1SRFA 1U18A 3MVFA 2WEWA 1ZNKA 1SWLA 1JV4A 1KL5A 4PSQA 1FENA 2ASNX 4XMGA 1GT3A 3OE3A 3S5XA 3CKGA 1DZJA 1IFBA 5EPQA 1EQDA 5B5GA 3WXQA 1BSQA 3EW2A 1UREA 4TNNA 3IA8A 2Q39A 1KT3A 3WZPA 4CPEA 3CR6A 3JQOA 4I60A 4TKJA 4DNEA 4BX7B 5HZ9A 4IB9A 3RKGA 1I9HA 3BLGA 2A0AA 4ORWA 2XKLA 1DFVA 4YKMA 5LKEA 3ZW1A 1FTPA 2X32A 2AT3X 2Q4NA 1G7NA 4HPDA 1VWEB 1BSOA 1KZXA 4AZNA 3TGBA 1I06A 4IRWA 1RLBE 3VG4A 1ICMA 2HKDA 4INNA 3AUMO 5HA0A 2N93A 1SRGA 3RZYA 2ZAIA 3NP1A 1EPBA 1PBOA 1SWKA 1ZNDA 4ML7B 2QOSC 4BGFA 5IO7A 4AZMA 3T6FA 3JSQA 1LF7A 4FBOA 1E00A 1CBRA 1G74A 3D97A 3PEDA 3QKGA 4GD9A 3T2XA 2R74A 2I5VO 2WR6A 1EIIA 4Y0PA 5B10O 1VPRA 1LUQA 2LFOA 1VWFB 4MVEA 4CDEA 5IO5A 5KICA 1GKAA 3RSWA 3DTQA 4IB7A 2CAMA 3VE2A 4I6SA 3FIQA 2RTEB 5H9NA 3P6CA 2MHDA 2OF8A 1VWRB 2NNDA 1JIWI 3NQKA 4TJZA 1A18A 1GXAA 1KT4A 4OEMA 1DF3A 1VYGA 4M6SA 4B55A 3RDSA 3BU9A 2RTGB 1KT6A 4HPBA 3NR3A 1PTSA 4AZOA 1IIUA 3BU1A 2WQAE 3FDCA 3SAOA 4GJSA 3P6FA 4BOEA 3F9DA 2G78A 3RDMA 1P6PA 1HXLA 3KFIA 3FA7A 4M7MA 1ZNEA 2AVIA 4ORXA 1KL4A 4COTA 1VWNB 3S26A 5C0NA 1S44A 4ZHFA 5IRAA 2RTCB 3P6GA 1PBYA 4NNSA 5LJCA 4DCBA 4I3BA 1SWNA 4MVKA 1KQWA 5FFHA 4BX7A 3TGAA 1GX8A 2ACOA 2NP1A 5DPQA 1WUBA 3ZW0B 4NV7A 3B2KA 5H8TA 1ZRYA 3T6LA 1BM5A 1SRJA 2RTIB 2X8SA 4YGHA 4ID2A 4ALBA 1LCVA 2MO5A 4YKOA 3KZAA 1SWCA 1E02A 2BSZA 3FELA 2RTKA 3VHMA 2LKKA 1SY3A 3BRNA 2RQ0A 2F73A 3DSZA 2OVDA 4BVMA 4BX6B 3VU1A 1MUPA 1GT4A 2AKQA 2FTBA 2VFCA 3APWA 5EDBA 5AQ6A 2QMIA 1PEEA 3VG3A 1JQPA 5BVTA 2LB6A 4A60A 3PK2A 1SXXA 1ML7A 3APVA 1HXZA 2IZJA 1JBHA 1MVGA 4KH8A 4GGTA 1N0SA 1QY0A 4I9SA 5HZQA 1QABE 2OL7A 5IRWA 3RDXA 5FQ8E 1FE3A 2L9CA 2M4LA 4NW4A 4OELA 3EW1A 3TGCA 1SWGA 1X8PA 3RY1A 1CJ5A 1EALA 4MIRA 3EC5A 4O4SA 1I04A 4AZPA 2KT4B 3VHHA 3UAQA 3HWFA 2IZAA 4A1YA 1SWJA 2MJIA 2UZ2A 3NPOA 4D6BA 4DQ4A 1CBIA 1VWBB 4Y5DA 5LKFA 3WYPA 3E3CA 2WPUA 3KQ0A 4ORUA 3WBGA 2HMBA 4MEEA 3UEUA 1YP7A 1GX3A 2LBVA 2PI3O 4GJVA 2GTLM 2A2GA 4XMHA 3U9PC 3VGWA 4I3DA 1JJXA 2JN3A 2FWVA 1RSUB 1QWDA 1VWIB 4Z2PA 3PH5A 1PMPA 2IZKA 2JOZA 2C4IA 4ON1A 2WUTA 4KC8A 3NBXX 4KIIA 1LELA 1YWDA 2PY1A 5F2BA 3WZQA 4CPFA 4GETA 3P6DA 4TLJA 4U8UM
chains in the Genus database with same CATH topology
2IFBA 4RUUA 4FQBB 5BVQA 5L8IA 2YG2A 1EW3A 4YDBA 3STKA 1QFTA 2W2AA 5EEEA 3H3IA 1HMSA 1NP4A 2L67A 1IKJA 2HYSA 3Q6LA 3FR5A 4KT5A 3CQNA 1MX8A 4YBPA 1KT7A 4NLIA 4ZJ0A 4HPAA 3HWEA 1BSYA 3V8UA 2OVEA 3TF6A 4LZUA 3PH6A 2RA6A 4ZGFA 4YH0A 2RN4A 5F58A 2NNQA 4O4XA 2FS7A 2X45A 1X8UA 5LJEA 4ZCBA 4LZVA 2JW1A 4L1NA 2CM9A 1EI5A 1TW4A 3AKMA 3P6HA 1BRPA 1U17A 2FLJA 4A8ZA 3HWDA 2QO5A 5JR8A 4ZFXA 1KT5A 1B0OA 4NNTA 2FR3A 1LNMA 2KTSA 4MISA 2KD2A 3CBCA 3FW4A 3T1DA 5KHPA 2AT8X 4L3RA 3EYCA 4QZUA 3S60A 3EMMA 1AB0A 2ALLX 2OVAA 1X8NA 2RCQA 3P6EA 4GNYA 1E5PA 4ODDA 5EZ2A 3VE1A 1HMRA 5H9KA 1GX9A 1LFOA 1OPBA 3ZWEA 2W2FA 5EDCA 3UEWA 1YP6A 1LIFA 3FEKA 4YFQA 1B56A 4Y0QA 2FT9A 2HNXA 1LKEA 4XMFA 2BHVA 2P8GA 1ZNGA 2AT0X 2OZQA 2GTFX 2A3FX 4CSBA 1OBQA 1R0UA 1HBPA 1Y9LA 4K19A 2BS5A 3PQUA 3FR2A 3U03A 1SXYA 3GE2A 1ICNA 1X8QA 1SXWA 4ZHDA 3LHNA 4N7DA 4HPCA 1O1VA 3EM0A 4QGWA 3BDRA 3WJEA 1EPAA 2AL0X 4NYRA 5D45A 4O49A 5FQ6E 4ORRA 1KXOA 2O62A 1O1UA 1HBQA 1ERBA 1QQSA 5AJBA 3OBLA 5IO6A 4ORYA 1BWYA 1A3YA 4UU2A 4WFUA 3NQ3A 1ZNLA 3NQ9A 1LIEA 4OS3A 2X8FA 2E4JA 3WJDA 4IB6A 3ZW0A 4D6AA 4EDEA 2DM5A 4EEJA 1EIOA 3ELXA 3NX2A 4GNWA 5FQ7E 4YFRA 3OD9A 5D8JA 4ZHGA 3VPJE 3U0DA 3O2YA 3B2HA 5LJGA 3F8AA 5LJBA 1KOIA 4ALOA 1KZWA 2FRSA 1FDQA 1HQPA 4ON1A 3FEPA 2WQ9A 1Y9TA 1T0VA 3P02A 1CRBA 1YUPA 3FMZA 3O19A 1YIVA 4ZR2A 1QY2A 3C77X 3MBTA 4YDAA 2WEXA 1LICA 1SA8A 1RBPA 1D3SA 1H91A 4HWMA 1ERXA 3FENA 5HZ5A 2CBRA 1X8OA 2ACPX 4MVIA 4BQUA 3IFBA 4O3YA 1SY2A 2Z4IA 3MX7A 5B27A 1KQXA 2QO4A 4FBRA 1BBPA 1OPAA 5BVSA 4LKPA 1OBUA 1TXLA 1B8EA 2WSJA 3GAQA 4XMEA 3OJYC 2K23A 4ZHHA 4IAXA 4GZVA 2LA7A 3BSZE 4GKCA 1JYJA 1GM6A 5BYPA 1YWAA 2OVSA 1HN2A 5HZ8A 5F1EA 5HA1A 3ZZVA 3FA9A 4GU8A 3WJGA 2GJ5A 4QNIA 4EXZA 3STMX 3C76X 4GDZA 3LV4A 1TOWA 1U0XA 1TVQA 1I4UA 1X71A 4FBVA 1NP1A 1T68X 3PPTA 1FELA 1QY1A 4ORSA 3ZW2A 4IAWA 2HLVA 4I9RA 4UU3A 3JS1A 4A1HA 1DV9A 1LIDA 1AQBA 1EUOA 4ZH9A 1PM1X 1IW2A 3P24A 2CZUA 3FW5A 5LJDA 3UEXA 1S7DA 2F09A 4IBAA 2OFMX 3CMPA 3WOVA 3KFFA 2MWHA 3APUA 5D4AA 3WJFA 5HBSA 4FGIB 4ZHFA 5HZ6A 1G85A 1MX7A 2Q2MA 3PECA 4IMOA 2Q2PA 3FA6A 5KIDA 3FLLA 3UEVA 3TZSA 3SOTA 3S5VA 3VG6A 3RWXA 1ACDA 1BJ7A 2L5PA 4U3QA 4TQ2A 3CQRA 4O9SA 5F6BA 3FR4A 1XCAA 1ADLA 4A60A 3NADA 1EXSA 3CWKA 4N7CA 1Z24A 2CBSA 5B29A 4QGXA 2X46A 2BS6A 1G5WA 4OMWA 3ELZA 2EU7X 2K62A 2JU8A 2GTLO 3N91A 2MM3A 1SY1A 3ZUOA 3WJCA 2ANSA 3ZI8A 1OEKA 1XKIA 4O3XB 4PJ2A 4YBUA 4DQ3A 1GT1A 2OFRX 2NNEA 4U8UO 5D48A 1AVGI 2XSTA 1YWCA 1QFVA 5D47A 4CV7A 2Q9SA 2QO6A 3KFHA 4YFPA 4GRJA 4AW8A 1TOUA 4NYQA 2HZRA 3BX7A 5H9AA 2BT9A 1HMTA 4KC7A 1BEBA 4WBKA 4QRLA 4QYNA 2JU3A 1JZUA 4MVLA 2G79A 2X8TA 3APXA 1CBSA 3B2LA 3NX1A 1VYFA 1SMPI 2QM9A 4O3ZA 4QQ1A 5HAEA 2GTLN 2RD7C 5EEDA 1JYDA 4XMDA 4O4OA 1ZNHA 4EQAC 1CBQA 3O22A 4LQZA 1X89A 4NLJA 4U8UN 4NP1A 5HWZA 1GGLA 1ALBA 4U9CA 3HWGA 3BX8A 2Z4HA 3I17A 1YWBA 2YMSA 1I05A 2JU7A 5AJCA 2KW1A 2RCTA 3BY0A 4WFVA 3C78X 1QG5A 5HTDA 1BRQA 4ZGUA 1DZPA 4YCEA 4AYHA 4GE1A 4ZHCA 4YGZA 3K3LA 2FS6A 2ZAGA 3B2JA 5L8NA 2G7BA 2AT6X 4QAEA 1BLRA 1FEMA 4R0BA 3HTYA 3B2IA 3AKNA 3CBSA 1DC9A 3RBYA 3KFGA 1JJJA 4Y0SA 3FYFA 4ES7A 1OEEA 5HCDC 1IFCA 2L68A 1A2DA 1D2UA 1LIBA 2R73A 4KCAA 3D4RA 3WVMA 5HTEA 2HZQA 2R56A 5LJHA 3D96A 5HCCC 1NGLA 2A13A 1E06A 4OS8A 2KTDA 3VG7A 2CM4A 3EBWA 1GT5A 3EBKA 4AZQA 2AH7X 2POAA 4QYPA 1OBPA 2JMBA 1LPJA 3I0AA 5CYBA 2BLGA 1UZ2X 3FA8A 3ZW1B 5HCEC 2GC9A 2FR2A 5F6ZA 5LJKA 3WJBA 3HOEA 4TKBA 3PQSA 3F6ZB 2CZTA 3HK1A 4YGGA 1A57A 4I95A 3BS2A 4GH7A 4QGVA 4QZTA 5K06A 5H9LA 4TKHA 2AMMX 2AT5X 4RUNA 4EFGA 3HOLA 4O3WA 4Y0RA 4I3CA 1SXUA 1L6MA 4IB8A 2WWPA 1T8VA 4OMXA 4CK4A 3PP6A 5CE4A 5F7GA 3D95A 4YCHA 4O4UA 4GK9A 4LKTA 5FENA 5L8OA 2A2UA 4WHIA 3G7XA 3STNA 3VG5A 4YMYA 1IKEA 1MDCA 5DG4A 1JJXA 1GKAB 2LBAA 2W2BA 1SY0A 1DZMA 1S2PA 4IMNA 4OS0A 4JGLA 5FAZA 1DZKA 3L4RA 1OEJA 4AZRA 4HFOA 4XMCA 5AEOA 4ARHA 3ZUIA 4ZH6A 1KGLA 4IABA 1AELA 1O8VA 3VG2A 1U18A 3MVFA 2WEWA 1ZNKA 1JV4A 4PSQA 1FENA 2ASNX 4XMGA 1GT3A 3OE3A 3S5XA 5EPQA 1DZJA 1IFBA 1EQDA 3WXQA 1BSQA 1UREA 4TNNA 3IA8A 2Q39A 1KT3A 3CR6A 3JQOA 4TKJA 5HZ9A 4IB9A 3RKGA 3BLGA 2A0AA 4ORWA 2XKLA 1DFVA 4YKMA 5LKEA 3ZW1A 1FTPA 2AT3X 2Q4NA 1G7NA 4HPDA 1BSOA 1KZXA 4AZNA 3TGBA 1I06A 1RLBE 3VG4A 1ICMA 5HA0A 4INNA 2N93A 3RZYA 2ZAIA 3NP1A 1EPBA 1PBOA 1ZNDA 4ML7B 2QOSC 5IO7A 4AZMA 3JSQA 1LF7A 4FBOA 1E00A 1CBRA 1G74A 3D97A 3PEDA 3QKGA 2R74A 2WR6A 1EIIA 4Y0PA 1VPRA 2LFOA 4MVEA 5IO5A 5KICA 1GKAA 3RSWA 3DTQA 4IB7A 3VE2A 4I6SA 3FIQA 5H9NA 3P6CA 2MHDA 2NNDA 3NQKA 1JIWI 4TJZA 1A18A 1GXAA 1KT4A 1DF3A 1VYGA 4M6SA 3BU9A 4HPBA 1KT6A 3NR3A 4AZOA 1IIUA 3BU1A 2WQAE 3SAOA 3P6FA 4BOEA 3F9DA 2G78A 1B4MA 1P6PA 3KFIA 3FA7A 4M7MA 1ZNEA 4ORXA 4COTA 3S26A 5C0NA 1S44A 3P6GA 4NNSA 5LJCA 4I3BA 4MVKA 1KQWA 5FFHA 3TGAA 1GX8A 2ACOA 2NP1A 5DPQA 3ZW0B 3B2KA 5H8TA 1ZRYA 1BM5A 2X8SA 4YGHA 4ID2A 4ALBA 2MO5A 4YKOA 3KZAA 1E02A 3FELA 2LKKA 1SY3A 3BRNA 2RQ0A 2F73A 3DSZA 2OVDA 4BVMA 3VU1A 1MUPA 1GT4A 2AKQA 2FTBA 3APWA 5EDBA 5AQ6A 1PEEA 2QMIA 3VG3A 3ZQ3A 5BVTA 2LB6A 1SXXA 1ML7A 3APVA 1JBHA 1MVGA 4KH8A 1N0SA 1QY0A 4I9SA 5HZQA 1QABE 5FQ8E 1FE3A 2L9CA 2M4LA 4NW4A 3TGCA 1X8PA 1CJ5A 1EALA 4MIRA 4O4SA 4AZPA 1I04A 2KT4B 3UAQA 3HWFA 4A1YA 2MJIA 3NPOA 4D6BA 4DQ4A 1CBIA 5LKFA 3E3CA 3KQ0A 4ORUA 3WBGA 2HMBA 3UEUA 1YP7A 2LBVA 2GTLM 2A2GA 4XMHA 3U9PC 4I3DA 2JN3A 2FWVA 1QWDA 3PH5A 1PMPA 2JOZA 2WUTA 4KC8A 3NBXX 4KIIA 2PY1A 1YWDA 4GETA 3P6DA 4TLJA 4U8UM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LHN A;  4U3Q A; 
#chains in the Genus database with same CATH topology
 2IFB A;  4RUU A;  4FQB B;  5CSE A;  5BVQ A;  5L8I A;  2YG2 A;  1EW3 A;  4YDB A;  3STK A;  1QFT A;  3SZH A;  1DF8 A;  2W2A A;  5EEE A;  3H3I A;  1HMS A;  1NP4 A;  2L67 A;  1IKJ A;  2HYS A;  3Q6L A;  3FR5 A;  4KT5 A;  3CQN A;  1MX8 A;  4BX6 A;  4YBP A;  1KT7 A;  4NLI A;  4ZJ0 A;  4HPA A;  1STR B;  3HWE A;  1BSY A;  1VWJ B;  3V8U A;  2OVE A;  3TF6 A;  4LZU A;  3PH6 A;  1K3B A;  3D9W A;  2RA6 A;  2I5Z O;  1RXJ A;  1VWK B;  4JO6 A;  5IRU A;  4YH0 A;  1SLG B;  2RN4 A;  5F58 A;  2NNQ A;  4O4X A;  4Z28 A;  1LDQ A;  2FS7 A;  2X45 A;  1Y55 X;  5IXG A;  1SWQ A;  1X8U A;  5LJE A;  4ZCB A;  1SRH A;  4LZV A;  2JW1 A;  2F01 A;  4L1N A;  1EI5 A;  1TW4 A;  2CM9 A;  3AKM A;  3P6H A;  2X4M A;  1BRP A;  2X34 A;  1U17 A;  2FLJ A;  2X55 A;  2IZE B;  4A8Z A;  3HWD A;  2QO5 A;  2RTA A;  4ZFX A;  1KT5 A;  1B0O A;  1SWF A;  4NNT A;  5JR8 A;  2FR3 A;  1LNM A;  2KTS A;  4MIS A;  2KD2 A;  3CBC A;  3FW4 A;  3T1D A;  2RTN B;  5KHP A;  2AT8 X;  4L3R A;  3EYC A;  2IZC B;  4QZU A;  1IJ8 A;  3EMM A;  3S60 A;  2RTP B;  1AB0 A;  4OKA A;  3SLT A;  2ALL X;  2RTM A;  3WZN A;  5K67 A;  2OVA A;  1X8N A;  2RCQ A;  3P6E A;  2IZH B;  1E5P A;  4GNY A;  4ODD A;  5EZ2 A;  3VE1 A;  1HMR A;  2QCB A;  2G5L A;  1Y53 X;  3RE5 A;  5H9K A;  1GX9 A;  1LFO A;  1NBX A;  1JMZ A;  1OPB A;  3ZWE A;  2OY1 O;  1HQQ A;  2W2F A;  5EDC A;  3UEW A;  1YP6 A;  1LIF A;  3FEK A;  4YFQ A;  1B56 A;  4Y0Q A;  2FT9 A;  2HNX A;  4GGZ A;  1LKE A;  4XMF A;  5K68 A;  3T2W A;  2QOM A;  1NDJ A;  2MF6 A;  2BHV A;  2P8G A;  1ZNG A;  2AT0 X;  2OZQ A;  2GTF X;  4C5P A;  1N7Y A;  2OY7 A;  2A3F X;  4CPH B;  4CSB A;  1OBQ A;  1R0U A;  1W4T A;  1VWQ B;  1HBP A;  1SLF B;  1Y9L A;  2BS5 A;  4K19 A;  2OY5 O;  3PQU A;  1MM9 A;  3FR2 A;  2C1Q A;  4Z27 A;  3U03 A;  1SXY A;  3GE2 A;  1ICN A;  1X8Q A;  2BC3 A;  1SXW A;  2OY8 A;  3LHN A;  4N7D A;  3RDO A;  3FID A;  4HPC A;  4ZHD A;  1O1V A;  3EM0 A;  4NV8 A;  3BDR A;  4QGW A;  3WJE A;  1EPA A;  2DJG A;  4GGR A;  2AL0 X;  2RTR B;  4NYR A;  4O49 A;  5D45 A;  5FQ6 E;  4ORR A;  1KXO A;  1O1U A;  2O62 A;  3PDF A;  1HBQ A;  1ERB A;  3AEH A;  1QQS A;  5AJB A;  4CDF A;  3OBL A;  5IO6 A;  4ORY A;  1SWE A;  1BWY A;  2IZL B;  1A3Y A;  4UU2 A;  1SLE B;  4WFU A;  3NQ3 A;  1ZNL A;  3NQ9 A;  1LIE A;  4OS3 A;  2X8F A;  2E4J A;  3WJD A;  4IB6 A;  3ZW0 A;  4D6A A;  4EDE A;  2DM5 A;  4EEJ A;  1EIO A;  3ELX A;  4BBO A;  3NX2 A;  4GNW A;  5FQ7 E;  4YFR A;  3OD9 A;  2RTJ A;  5D8J A;  4ZHG A;  1VWO B;  3VPJ E;  1B4M A;  3U0D A;  3ZQ3 A;  3O2Y A;  3B2H A;  5LJG A;  3F8A A;  1SWT A;  1KOI A;  5LJB A;  4ALO A;  1KZW A;  2FRS A;  2G8C O;  1FDQ A;  2DJF A;  2RTF B;  1HQP A;  1MK5 A;  1N43 A;  2OFB A;  1Y9T A;  1T0V A;  2WQ9 A;  3FEP A;  3P02 A;  1CRB A;  1YUP A;  3FMZ A;  3O19 A;  4CPI A;  1YIV A;  2C1S A;  1QY2 A;  4ZR2 A;  3C77 X;  3MBT A;  4YDA A;  5B3M O;  2WEX A;  1LIC A;  1SA8 A;  1RBP A;  5CHK A;  1UYO X;  1D3S A;  5B5F A;  1H91 A;  4HWM A;  1ERX A;  3FEN A;  5HZ5 A;  2CBR A;  1X8O A;  1HY2 A;  2ACP X;  4MVI A;  4BQU A;  3IFB A;  4O3Y A;  1SY2 A;  2Z4I A;  3MX7 A;  5B27 A;  1KQX A;  1NC9 A;  2QO4 A;  3WZO A;  4FBR A;  1BBP A;  1OPA A;  5BVS A;  4LKP A;  4CPH A;  1OBU A;  1TXL A;  1B8E A;  2WSJ A;  3GAQ A;  2A8G A;  4XME A;  3OJY C;  3QQ2 A;  2K23 A;  4ZHH A;  4IAX A;  4GZV A;  2LA7 A;  3LTW A;  5B2A O;  3BSZ E;  4GKC A;  1JYJ A;  1GM6 A;  1MOY A;  5BYP A;  1YWA A;  2OVS A;  1HN2 A;  5HZ8 A;  5F1E A;  2Y32 A;  1N9M A;  5HA1 A;  3FA9 A;  3ZZV A;  4GU8 A;  3WJG A;  2VDF A;  2GJ5 A;  2Y3F A;  4QNI A;  3STM X;  4EXZ A;  3C76 X;  4GDZ A;  3LV4 A;  1TOW A;  1U0X A;  1SWU A;  1I4U A;  1TVQ A;  1X71 A;  4FBV A;  1NP1 A;  1T68 X;  3PPT A;  1FEL A;  1QY1 A;  4ORS A;  3ZW2 A;  4IAW A;  2HLV A;  4I9R A;  4UU3 A;  1W6F A;  3JS1 A;  4A1H A;  1DV9 A;  3WYQ A;  1LID A;  1AQB A;  1EUO A;  4ZH9 A;  1LCW A;  1PM1 X;  1SRE A;  1Y52 X;  1IW2 A;  3P24 A;  2CZU A;  3FW5 A;  5LJD A;  3UEX A;  1S7D A;  2F09 A;  4IBA A;  1N9Y A;  2OL8 O;  1JMX A;  1LDO A;  2OFM X;  3CMP A;  3WOV A;  3KFF A;  2MWH A;  3APU A;  1VWL B;  2IZG B;  4GDA A;  5D4A A;  4FGI B;  5HBS A;  3SLJ A;  1G85 A;  1MX7 A;  2Q2M A;  3PEC A;  4IMO A;  5HZ6 A;  2Q2P A;  4Z2V A;  3X00 A;  3FA6 A;  2GH7 A;  5KID A;  2IZI A;  3FLL A;  3UEV A;  1NQN A;  2Y3E A;  2AF5 A;  1OSP O;  1Y0G A;  2X56 A;  3S5V A;  3SOT A;  3RWX A;  1ACD A;  1BJ7 A;  2L5P A;  3HPE A;  4U3Q A;  3VG6 A;  4TQ2 A;  3CQR A;  4O9S A;  1JJU A;  5F6B A;  3FR4 A;  1AVD A;  1ADL A;  1SWD A;  1WBI A;  1EXS A;  1XCA A;  2RTB B;  3CWK A;  1Z24 A;  3NAD A;  4N7C A;  2CBS A;  1SLD B;  4JNJ A;  4Z2O A;  5B29 A;  4QGX A;  2X46 A;  1RXK A;  2RTQ B;  2BS6 A;  1G5W A;  4OMW A;  3ELZ A;  2EU7 X;  2K62 A;  2JU8 A;  2GTL O;  4BCS A;  3N91 A;  1STS B;  3Q34 A;  1K24 A;  4Z6J A;  2IZF B;  2MM3 A;  1SY1 A;  3ZUO A;  1MEP A;  3WJC A;  1W5R A;  1VWH B;  2ANS A;  1KFF A;  3ZI8 A;  1OEK A;  1KL3 A;  1XKI A;  4O3X B;  4PJ2 A;  4YBU A;  1GT1 A;  2OFR X;  2NNE A;  4U8U O;  5D48 A;  4DQ3 A;  1AVG I;  2XST A;  1YWC A;  3SZI A;  1QFV A;  5D47 A;  4Y59 A;  1SRI A;  2Q9S A;  2QO6 A;  4CV7 A;  3KFH A;  5B11 O;  2VFB A;  4GRJ A;  4YFP A;  1TOU A;  4NYQ A;  3RE6 A;  2HZR A;  1VYO A;  4AW8 A;  3BX7 A;  5H9A A;  2BT9 A;  1HMT A;  4KC7 A;  1BEB A;  1E2T A;  4WBK A;  4EKV A;  4QRL A;  4QYN A;  2JU3 A;  1SWO A;  2RTD B;  1JZU A;  4MVL A;  2G79 A;  2X8T A;  3APX A;  1CBS A;  3B2L A;  1VWA B;  1VYF A;  3NX1 A;  1SMP I;  2QM9 A;  4O3Z A;  4QQ1 A;  3MM0 A;  2GTL N;  5HAE A;  2RD7 C;  5EED A;  2RTL A;  1JYD A;  4XMD A;  4O4O A;  1ZNH A;  2IZB A;  1CBQ A;  1SWB A;  2A5B A;  4EQA C;  3O22 A;  4LQZ A;  1X89 A;  4NLJ A;  4U8U N;  4NP1 A;  5HWZ A;  1GGL A;  1ALB A;  4U9C A;  1VWM B;  3BX8 A;  3HWG A;  2Z4H A;  5L3Y A;  3I17 A;  1YWB A;  2A5C A;  2YMS A;  1I05 A;  3WJF A;  2JU7 A;  5AJC A;  2KW1 A;  2RCT A;  1RXH A;  1VWC B;  3BY0 A;  1LCZ A;  1N4J A;  1SWS A;  4WFV A;  3C78 X;  1QG5 A;  5HTD A;  1BRQ A;  4ZGU A;  1DZP A;  4YCE A;  2UYW A;  4AYH A;  4GE1 A;  4ZHC A;  1VWP B;  4U46 A;  4YGZ A;  3K3L A;  2FS6 A;  2ZAG A;  3B2J A;  5L8N A;  2G7B A;  2AT6 X;  4QAE A;  1BLR A;  4ZGF A;  1FEM A;  4R0B A;  3HTY A;  3B2I A;  3AKN A;  3CBS A;  1DC9 A;  2OF9 A;  4BJ8 A;  3RBY A;  2FKG A;  3KFG A;  4BX5 B;  1JJJ A;  2OL6 O;  4JHQ A;  1VWG B;  4Y0S A;  3FYF A;  4ES7 A;  1OEE A;  3CKF A;  5HCD C;  1IFC A;  2L68 A;  1A2D A;  1D2U A;  1LIB A;  2R73 A;  4KCA A;  3D4R A;  3WVM A;  5HTE A;  1RST B;  2HZQ A;  3MG5 A;  2R56 A;  3RY2 A;  5LJH A;  3D96 A;  5HCC C;  1NGL A;  2A13 A;  1E06 A;  1FJ1 E;  4OS8 A;  2KTD A;  3VG7 A;  3RDQ A;  2CM4 A;  3EBW A;  2OYB O;  1AVE A;  1GT5 A;  3EBK A;  4GUZ A;  1RAV A;  1NQM A;  2AH7 X;  2POA A;  4AZQ A;  4QYP A;  1OBP A;  3RDU A;  3SZJ A;  2JMB A;  1LPJ A;  2FHN X;  3I0A A;  2JGS A;  5CYB A;  2BLG A;  4CDC A;  1UZ2 X;  3FA8 A;  3ZW1 B;  4CDD A;  2RTO B;  5HCE C;  2GC9 A;  2FR2 A;  2OFA A;  5F6Z A;  1SWH A;  3KVN A;  5LJK A;  3WJB A;  3HOE A;  4TKB A;  3PQS A;  1UYN X;  5JD2 A;  3F6Z B;  2CZT A;  3TZS A;  3HK1 A;  4YGG A;  3SLO A;  1A57 A;  4I95 A;  3BS2 A;  4GH7 A;  4QGV A;  4QZT A;  2FKJ A;  5K06 A;  5H9L A;  4TKH A;  2IZD B;  2AMM X;  2AT5 X;  4RUN A;  1SWA A;  4EFG A;  3HOL A;  4O3W A;  4Y0R A;  4I3C A;  1SXU A;  4YVB A;  1L6M A;  4IB8 A;  2WWP A;  1SWP A;  1T8V A;  4OMX A;  4CK4 A;  3PP6 A;  5CE4 A;  5F7G A;  3D95 A;  4YCH A;  4O4U A;  4GK9 A;  4LKT A;  5FEN A;  5L8O A;  2A2U A;  4WHI A;  3G7X A;  3STN A;  2FHL A;  3VG5 A;  4YMY A;  1IKE A;  1MDC A;  1I78 A;  1SWR A;  1GKA B;  1VWD B;  2LBA A;  2ZSC A;  2W2B A;  5DG4 A;  1SY0 A;  1DZM A;  1S2P A;  2RTH B;  4IMN A;  2FGS A;  4OS0 A;  4JGL A;  3VHI A;  5FAZ A;  1DZK A;  3L4R A;  1OEJ A;  4AZR A;  4BX5 A;  4HFO A;  4XMC A;  5AEO A;  1STP A;  4ARH A;  3ZUI A;  4ZH6 A;  1KGL A;  4IAB A;  1AEL A;  1O8V A;  3VG2 A;  1SRF A;  1U18 A;  3MVF A;  2WEW A;  1ZNK A;  1SWL A;  1JV4 A;  1KL5 A;  4PSQ A;  1FEN A;  2ASN X;  4XMG A;  1GT3 A;  3OE3 A;  3S5X A;  3CKG A;  1DZJ A;  1IFB A;  5EPQ A;  1EQD A;  5B5G A;  3WXQ A;  1BSQ A;  3EW2 A;  1URE A;  4TNN A;  3IA8 A;  2Q39 A;  1KT3 A;  3WZP A;  4CPE A;  3CR6 A;  3JQO A;  4I60 A;  4TKJ A;  4DNE A;  4BX7 B;  5HZ9 A;  4IB9 A;  3RKG A;  1I9H A;  3BLG A;  2A0A A;  4ORW A;  2XKL A;  1DFV A;  4YKM A;  5LKE A;  3ZW1 A;  1FTP A;  2X32 A;  2AT3 X;  2Q4N A;  1G7N A;  4HPD A;  1VWE B;  1BSO A;  1KZX A;  4AZN A;  3TGB A;  1I06 A;  4IRW A;  1RLB E;  3VG4 A;  1ICM A;  2HKD A;  4INN A;  3AUM O;  5HA0 A;  2N93 A;  1SRG A;  3RZY A;  2ZAI A;  3NP1 A;  1EPB A;  1PBO A;  1SWK A;  1ZND A;  4ML7 B;  2QOS C;  4BGF A;  5IO7 A;  4AZM A;  3T6F A;  3JSQ A;  1LF7 A;  4FBO A;  1E00 A;  1CBR A;  1G74 A;  3D97 A;  3PED A;  3QKG A;  4GD9 A;  3T2X A;  2R74 A;  2I5V O;  2WR6 A;  1EII A;  4Y0P A;  5B10 O;  1VPR A;  1LUQ A;  2LFO A;  1VWF B;  4MVE A;  4CDE A;  5IO5 A;  5KIC A;  1GKA A;  3RSW A;  3DTQ A;  4IB7 A;  2CAM A;  3VE2 A;  4I6S A;  3FIQ A;  2RTE B;  5H9N A;  3P6C A;  2MHD A;  2OF8 A;  1VWR B;  2NND A;  1JIW I;  3NQK A;  4TJZ A;  1A18 A;  1GXA A;  1KT4 A;  4OEM A;  1DF3 A;  1VYG A;  4M6S A;  4B55 A;  3RDS A;  3BU9 A;  2RTG B;  1KT6 A;  4HPB A;  3NR3 A;  1PTS A;  4AZO A;  1IIU A;  3BU1 A;  2WQA E;  3FDC A;  3SAO A;  4GJS A;  3P6F A;  4BOE A;  3F9D A;  2G78 A;  3RDM A;  1P6P A;  1HXL A;  3KFI A;  3FA7 A;  4M7M A;  1ZNE A;  2AVI A;  4ORX A;  1KL4 A;  4COT A;  1VWN B;  3S26 A;  5C0N A;  1S44 A;  4ZHF A;  5IRA A;  2RTC B;  3P6G A;  1PBY A;  4NNS A;  5LJC A;  4DCB A;  4I3B A;  1SWN A;  4MVK A;  1KQW A;  5FFH A;  4BX7 A;  3TGA A;  1GX8 A;  2ACO A;  2NP1 A;  5DPQ A;  1WUB A;  3ZW0 B;  4NV7 A;  3B2K A;  5H8T A;  1ZRY A;  3T6L A;  1BM5 A;  1SRJ A;  2RTI B;  2X8S A;  4YGH A;  4ID2 A;  4ALB A;  1LCV A;  2MO5 A;  4YKO A;  3KZA A;  1SWC A;  1E02 A;  2BSZ A;  3FEL A;  2RTK A;  3VHM A;  2LKK A;  1SY3 A;  3BRN A;  2RQ0 A;  2F73 A;  3DSZ A;  2OVD A;  4BVM A;  4BX6 B;  3VU1 A;  1MUP A;  1GT4 A;  2AKQ A;  2FTB A;  2VFC A;  3APW A;  5EDB A;  5AQ6 A;  2QMI A;  1PEE A;  3VG3 A;  1JQP A;  5BVT A;  2LB6 A;  4A60 A;  3PK2 A;  1SXX A;  1ML7 A;  3APV A;  1HXZ A;  2IZJ A;  1JBH A;  1MVG A;  4KH8 A;  4GGT A;  1N0S A;  1QY0 A;  4I9S A;  5HZQ A;  1QAB E;  2OL7 A;  5IRW A;  3RDX A;  5FQ8 E;  1FE3 A;  2L9C A;  2M4L A;  4NW4 A;  4OEL A;  3EW1 A;  3TGC A;  1SWG A;  1X8P A;  3RY1 A;  1CJ5 A;  1EAL A;  4MIR A;  3EC5 A;  4O4S A;  1I04 A;  4AZP A;  2KT4 B;  3VHH A;  3UAQ A;  3HWF A;  2IZA A;  4A1Y A;  1SWJ A;  2MJI A;  2UZ2 A;  3NPO A;  4D6B A;  4DQ4 A;  1CBI A;  1VWB B;  4Y5D A;  5LKF A;  3WYP A;  3E3C A;  2WPU A;  3KQ0 A;  4ORU A;  3WBG A;  2HMB A;  4MEE A;  3UEU A;  1YP7 A;  1GX3 A;  2LBV A;  2PI3 O;  4GJV A;  2GTL M;  2A2G A;  4XMH A;  3U9P C;  3VGW A;  4I3D A;  1JJX A;  2JN3 A;  2FWV A;  1RSU B;  1QWD A;  1VWI B;  4Z2P A;  3PH5 A;  1PMP A;  2IZK A;  2JOZ A;  2C4I A;  4ON1 A;  2WUT A;  4KC8 A;  3NBX X;  4KII A;  1LEL A;  1YWD A;  2PY1 A;  5F2B A;  3WZQ A;  4CPF A;  4GET A;  3P6D A;  4TLJ A;  4U8U M; 
#chains in the Genus database with same CATH homology
 2IFB A;  4RUU A;  4FQB B;  5BVQ A;  5L8I A;  2YG2 A;  1EW3 A;  4YDB A;  3STK A;  1QFT A;  2W2A A;  5EEE A;  3H3I A;  1HMS A;  1NP4 A;  2L67 A;  1IKJ A;  2HYS A;  3Q6L A;  3FR5 A;  4KT5 A;  3CQN A;  1MX8 A;  4YBP A;  1KT7 A;  4NLI A;  4ZJ0 A;  4HPA A;  3HWE A;  1BSY A;  3V8U A;  2OVE A;  3TF6 A;  4LZU A;  3PH6 A;  2RA6 A;  4ZGF A;  4YH0 A;  2RN4 A;  5F58 A;  2NNQ A;  4O4X A;  2FS7 A;  2X45 A;  1X8U A;  5LJE A;  4ZCB A;  4LZV A;  2JW1 A;  4L1N A;  2CM9 A;  1EI5 A;  1TW4 A;  3AKM A;  3P6H A;  1BRP A;  1U17 A;  2FLJ A;  4A8Z A;  3HWD A;  2QO5 A;  5JR8 A;  4ZFX A;  1KT5 A;  1B0O A;  4NNT A;  2FR3 A;  1LNM A;  2KTS A;  4MIS A;  2KD2 A;  3CBC A;  3FW4 A;  3T1D A;  5KHP A;  2AT8 X;  4L3R A;  3EYC A;  4QZU A;  3S60 A;  3EMM A;  1AB0 A;  2ALL X;  2OVA A;  1X8N A;  2RCQ A;  3P6E A;  4GNY A;  1E5P A;  4ODD A;  5EZ2 A;  3VE1 A;  1HMR A;  5H9K A;  1GX9 A;  1LFO A;  1OPB A;  3ZWE A;  2W2F A;  5EDC A;  3UEW A;  1YP6 A;  1LIF A;  3FEK A;  4YFQ A;  1B56 A;  4Y0Q A;  2FT9 A;  2HNX A;  1LKE A;  4XMF A;  2BHV A;  2P8G A;  1ZNG A;  2AT0 X;  2OZQ A;  2GTF X;  2A3F X;  4CSB A;  1OBQ A;  1R0U A;  1HBP A;  1Y9L A;  4K19 A;  2BS5 A;  3PQU A;  3FR2 A;  3U03 A;  1SXY A;  3GE2 A;  1ICN A;  1X8Q A;  1SXW A;  4ZHD A;  3LHN A;  4N7D A;  4HPC A;  1O1V A;  3EM0 A;  4QGW A;  3BDR A;  3WJE A;  1EPA A;  2AL0 X;  4NYR A;  5D45 A;  4O49 A;  5FQ6 E;  4ORR A;  1KXO A;  2O62 A;  1O1U A;  1HBQ A;  1ERB A;  1QQS A;  5AJB A;  3OBL A;  5IO6 A;  4ORY A;  1BWY A;  1A3Y A;  4UU2 A;  4WFU A;  3NQ3 A;  1ZNL A;  3NQ9 A;  1LIE A;  4OS3 A;  2X8F A;  2E4J A;  3WJD A;  4IB6 A;  3ZW0 A;  4D6A A;  4EDE A;  2DM5 A;  4EEJ A;  1EIO A;  3ELX A;  3NX2 A;  4GNW A;  5FQ7 E;  4YFR A;  3OD9 A;  5D8J A;  4ZHG A;  3VPJ E;  3U0D A;  3O2Y A;  3B2H A;  5LJG A;  3F8A A;  5LJB A;  1KOI A;  4ALO A;  1KZW A;  2FRS A;  1FDQ A;  1HQP A;  4ON1 A;  3FEP A;  2WQ9 A;  1Y9T A;  1T0V A;  3P02 A;  1CRB A;  1YUP A;  3FMZ A;  3O19 A;  1YIV A;  4ZR2 A;  1QY2 A;  3C77 X;  3MBT A;  4YDA A;  2WEX A;  1LIC A;  1SA8 A;  1RBP A;  1D3S A;  1H91 A;  4HWM A;  1ERX A;  3FEN A;  5HZ5 A;  2CBR A;  1X8O A;  2ACP X;  4MVI A;  4BQU A;  3IFB A;  4O3Y A;  1SY2 A;  2Z4I A;  3MX7 A;  5B27 A;  1KQX A;  2QO4 A;  4FBR A;  1BBP A;  1OPA A;  5BVS A;  4LKP A;  1OBU A;  1TXL A;  1B8E A;  2WSJ A;  3GAQ A;  4XME A;  3OJY C;  2K23 A;  4ZHH A;  4IAX A;  4GZV A;  2LA7 A;  3BSZ E;  4GKC A;  1JYJ A;  1GM6 A;  5BYP A;  1YWA A;  2OVS A;  1HN2 A;  5HZ8 A;  5F1E A;  5HA1 A;  3ZZV A;  3FA9 A;  4GU8 A;  3WJG A;  2GJ5 A;  4QNI A;  4EXZ A;  3STM X;  3C76 X;  4GDZ A;  3LV4 A;  1TOW A;  1U0X A;  1TVQ A;  1I4U A;  1X71 A;  4FBV A;  1NP1 A;  1T68 X;  3PPT A;  1FEL A;  1QY1 A;  4ORS A;  3ZW2 A;  4IAW A;  2HLV A;  4I9R A;  4UU3 A;  3JS1 A;  4A1H A;  1DV9 A;  1LID A;  1AQB A;  1EUO A;  4ZH9 A;  1PM1 X;  1IW2 A;  3P24 A;  2CZU A;  3FW5 A;  5LJD A;  3UEX A;  1S7D A;  2F09 A;  4IBA A;  2OFM X;  3CMP A;  3WOV A;  3KFF A;  2MWH A;  3APU A;  5D4A A;  3WJF A;  5HBS A;  4FGI B;  4ZHF A;  5HZ6 A;  1G85 A;  1MX7 A;  2Q2M A;  3PEC A;  4IMO A;  2Q2P A;  3FA6 A;  5KID A;  3FLL A;  3UEV A;  3TZS A;  3SOT A;  3S5V A;  3VG6 A;  3RWX A;  1ACD A;  1BJ7 A;  2L5P A;  4U3Q A;  4TQ2 A;  3CQR A;  4O9S A;  5F6B A;  3FR4 A;  1XCA A;  1ADL A;  4A60 A;  3NAD A;  1EXS A;  3CWK A;  4N7C A;  1Z24 A;  2CBS A;  5B29 A;  4QGX A;  2X46 A;  2BS6 A;  1G5W A;  4OMW A;  3ELZ A;  2EU7 X;  2K62 A;  2JU8 A;  2GTL O;  3N91 A;  2MM3 A;  1SY1 A;  3ZUO A;  3WJC A;  2ANS A;  3ZI8 A;  1OEK A;  1XKI A;  4O3X B;  4PJ2 A;  4YBU A;  4DQ3 A;  1GT1 A;  2OFR X;  2NNE A;  4U8U O;  5D48 A;  1AVG I;  2XST A;  1YWC A;  1QFV A;  5D47 A;  4CV7 A;  2Q9S A;  2QO6 A;  3KFH A;  4YFP A;  4GRJ A;  4AW8 A;  1TOU A;  4NYQ A;  2HZR A;  3BX7 A;  5H9A A;  2BT9 A;  1HMT A;  4KC7 A;  1BEB A;  4WBK A;  4QRL A;  4QYN A;  2JU3 A;  1JZU A;  4MVL A;  2G79 A;  2X8T A;  3APX A;  1CBS A;  3B2L A;  3NX1 A;  1VYF A;  1SMP I;  2QM9 A;  4O3Z A;  4QQ1 A;  5HAE A;  2GTL N;  2RD7 C;  5EED A;  1JYD A;  4XMD A;  4O4O A;  1ZNH A;  4EQA C;  1CBQ A;  3O22 A;  4LQZ A;  1X89 A;  4NLJ A;  4U8U N;  4NP1 A;  5HWZ A;  1GGL A;  1ALB A;  4U9C A;  3HWG A;  3BX8 A;  2Z4H A;  3I17 A;  1YWB A;  2YMS A;  1I05 A;  2JU7 A;  5AJC A;  2KW1 A;  2RCT A;  3BY0 A;  4WFV A;  3C78 X;  1QG5 A;  5HTD A;  1BRQ A;  4ZGU A;  1DZP A;  4YCE A;  4AYH A;  4GE1 A;  4ZHC A;  4YGZ A;  3K3L A;  2FS6 A;  2ZAG A;  3B2J A;  5L8N A;  2G7B A;  2AT6 X;  4QAE A;  1BLR A;  1FEM A;  4R0B A;  3HTY A;  3B2I A;  3AKN A;  3CBS A;  1DC9 A;  3RBY A;  3KFG A;  1JJJ A;  4Y0S A;  3FYF A;  4ES7 A;  1OEE A;  5HCD C;  1IFC A;  2L68 A;  1A2D A;  1D2U A;  1LIB A;  2R73 A;  4KCA A;  3D4R A;  3WVM A;  5HTE A;  2HZQ A;  2R56 A;  5LJH A;  3D96 A;  5HCC C;  1NGL A;  2A13 A;  1E06 A;  4OS8 A;  2KTD A;  3VG7 A;  2CM4 A;  3EBW A;  1GT5 A;  3EBK A;  4AZQ A;  2AH7 X;  2POA A;  4QYP A;  1OBP A;  2JMB A;  1LPJ A;  3I0A A;  5CYB A;  2BLG A;  1UZ2 X;  3FA8 A;  3ZW1 B;  5HCE C;  2GC9 A;  2FR2 A;  5F6Z A;  5LJK A;  3WJB A;  3HOE A;  4TKB A;  3PQS A;  3F6Z B;  2CZT A;  3HK1 A;  4YGG A;  1A57 A;  4I95 A;  3BS2 A;  4GH7 A;  4QGV A;  4QZT A;  5K06 A;  5H9L A;  4TKH A;  2AMM X;  2AT5 X;  4RUN A;  4EFG A;  3HOL A;  4O3W A;  4Y0R A;  4I3C A;  1SXU A;  1L6M A;  4IB8 A;  2WWP A;  1T8V A;  4OMX A;  4CK4 A;  3PP6 A;  5CE4 A;  5F7G A;  3D95 A;  4YCH A;  4O4U A;  4GK9 A;  4LKT A;  5FEN A;  5L8O A;  2A2U A;  4WHI A;  3G7X A;  3STN A;  3VG5 A;  4YMY A;  1IKE A;  1MDC A;  5DG4 A;  1JJX A;  1GKA B;  2LBA A;  2W2B A;  1SY0 A;  1DZM A;  1S2P A;  4IMN A;  4OS0 A;  4JGL A;  5FAZ A;  1DZK A;  3L4R A;  1OEJ A;  4AZR A;  4HFO A;  4XMC A;  5AEO A;  4ARH A;  3ZUI A;  4ZH6 A;  1KGL A;  4IAB A;  1AEL A;  1O8V A;  3VG2 A;  1U18 A;  3MVF A;  2WEW A;  1ZNK A;  1JV4 A;  4PSQ A;  1FEN A;  2ASN X;  4XMG A;  1GT3 A;  3OE3 A;  3S5X A;  5EPQ A;  1DZJ A;  1IFB A;  1EQD A;  3WXQ A;  1BSQ A;  1URE A;  4TNN A;  3IA8 A;  2Q39 A;  1KT3 A;  3CR6 A;  3JQO A;  4TKJ A;  5HZ9 A;  4IB9 A;  3RKG A;  3BLG A;  2A0A A;  4ORW A;  2XKL A;  1DFV A;  4YKM A;  5LKE A;  3ZW1 A;  1FTP A;  2AT3 X;  2Q4N A;  1G7N A;  4HPD A;  1BSO A;  1KZX A;  4AZN A;  3TGB A;  1I06 A;  1RLB E;  3VG4 A;  1ICM A;  5HA0 A;  4INN A;  2N93 A;  3RZY A;  2ZAI A;  3NP1 A;  1EPB A;  1PBO A;  1ZND A;  4ML7 B;  2QOS C;  5IO7 A;  4AZM A;  3JSQ A;  1LF7 A;  4FBO A;  1E00 A;  1CBR A;  1G74 A;  3D97 A;  3PED A;  3QKG A;  2R74 A;  2WR6 A;  1EII A;  4Y0P A;  1VPR A;  2LFO A;  4MVE A;  5IO5 A;  5KIC A;  1GKA A;  3RSW A;  3DTQ A;  4IB7 A;  3VE2 A;  4I6S A;  3FIQ A;  5H9N A;  3P6C A;  2MHD A;  2NND A;  3NQK A;  1JIW I;  4TJZ A;  1A18 A;  1GXA A;  1KT4 A;  1DF3 A;  1VYG A;  4M6S A;  3BU9 A;  4HPB A;  1KT6 A;  3NR3 A;  4AZO A;  1IIU A;  3BU1 A;  2WQA E;  3SAO A;  3P6F A;  4BOE A;  3F9D A;  2G78 A;  1B4M A;  1P6P A;  3KFI A;  3FA7 A;  4M7M A;  1ZNE A;  4ORX A;  4COT A;  3S26 A;  5C0N A;  1S44 A;  3P6G A;  4NNS A;  5LJC A;  4I3B A;  4MVK A;  1KQW A;  5FFH A;  3TGA A;  1GX8 A;  2ACO A;  2NP1 A;  5DPQ A;  3ZW0 B;  3B2K A;  5H8T A;  1ZRY A;  1BM5 A;  2X8S A;  4YGH A;  4ID2 A;  4ALB A;  2MO5 A;  4YKO A;  3KZA A;  1E02 A;  3FEL A;  2LKK A;  1SY3 A;  3BRN A;  2RQ0 A;  2F73 A;  3DSZ A;  2OVD A;  4BVM A;  3VU1 A;  1MUP A;  1GT4 A;  2AKQ A;  2FTB A;  3APW A;  5EDB A;  5AQ6 A;  1PEE A;  2QMI A;  3VG3 A;  3ZQ3 A;  5BVT A;  2LB6 A;  1SXX A;  1ML7 A;  3APV A;  1JBH A;  1MVG A;  4KH8 A;  1N0S A;  1QY0 A;  4I9S A;  5HZQ A;  1QAB E;  5FQ8 E;  1FE3 A;  2L9C A;  2M4L A;  4NW4 A;  3TGC A;  1X8P A;  1CJ5 A;  1EAL A;  4MIR A;  4O4S A;  4AZP A;  1I04 A;  2KT4 B;  3UAQ A;  3HWF A;  4A1Y A;  2MJI A;  3NPO A;  4D6B A;  4DQ4 A;  1CBI A;  5LKF A;  3E3C A;  3KQ0 A;  4ORU A;  3WBG A;  2HMB A;  3UEU A;  1YP7 A;  2LBV A;  2GTL M;  2A2G A;  4XMH A;  3U9P C;  4I3D A;  2JN3 A;  2FWV A;  1QWD A;  3PH5 A;  1PMP A;  2JOZ A;  2WUT A;  4KC8 A;  3NBX X;  4KII A;  2PY1 A;  1YWD A;  4GET A;  3P6D A;  4TLJ A;  4U8U M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...