3LHUA

Crystal structure of the mutant i199f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAFIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhuA00
4Z0JA 1P5BA 3UXDA 3NQAA 1TMHA 2VFHA 3NPUA 5CG7A 3QSTA 4LOCA 4XTDA 2ZRYA 2QAPA 2E6DA 4XZ9A 4FXRA 3AJXA 4JTUA 4O28A 4WJEA 1CI1A 2ISVA 1HL2A 1FDZA 1YADA 3IIOA 4O53A 3RF9A 4ZZ9A 1BTMA 4M6VA 4W9TA 3SECA 3MWAA 2ZRXA 4A2SA 2CFFA 3CPRA 1L9WA 2A5HA 2ABAA 1NF0A 3LRMA 1D9EA 4GUFA 4UXDA 1QPQA 3W7OA 3M44A 1JCJA 1HUVA 3HGSA 5GVJA 2OMAA 3H55A 3QEZA 3C2FA 2Y63A 4JEQA 2FDSA 3PUDA 4HNTA 2C3ZA 4FNUA 1GOXA 3QFEA 2XN0A 1K8YA 5K4ZA 3IGXA 1OYAA 2PURA 3G1SA 4HNVA 3PBWA 3ATZA 3JRKA 1VCFA 1TTQA 4KKXA 3W85A 1F2JA 1SZFA 3WJSA 3W2NA 3NM1A 1NEYA 3HOJA 2E6AA 4DPQA 1SPQA 1IIGA 3KRZA 4OBTA 4JICA 1MSSA 1VPXA 4WOZA 3GLCA 4FHAA 2RFGA 4Q33A 1W54A 2Z0IA 4XWUA 1KM1A 4PC8A 1FBAA 3B0UX 4GUIA 3PAJA 1S5WA 5F1UA 4FF7A 1OFDA 3GDKA 3MW7A 4O50A 3MHGA 3W88A 2YW4A 4O13A 5AC6A 3GDTA 1ML1A 1M6JA 1M7PA 3THQA 1OFEA 3U8GA 4BI6A 4DF0A 1NFBA 2V82A 3STGA 5EL1A 5HR7A 3SGUA 2XFWA 3H54A 2WO5A 3NL6A 4WXZA 4HIBA 1Q6OA 3OIXA 5FI8A 1HTIA 3W22A 2ZQ0A 2NUXA 1K8XA 1W5NA 6TIMA 3P5ZA 3CT7A 3FJ6A 4DF1A 2RH9A 1DHPA 3TJXA 2B0MA 3UPWA 2GJNA 3CWOX 4OU1A 2ALDA 3A5VA 5KSWA 1W3IA 5L6UA 1TV7A 2C15A 5AN7A 1K7FA 4IMDA 3KOFA 2W6RA 3L2IA 2I14A 1EWEA 2Y70A 3CQ0A 2A21A 1YPFA 1LCOA 4ZQRA 3M5ZA 4JNMA 5LZLA 1GVRA 3OVQA 4O1AA 2RDUA 1P4CA 4EF8A 1LBFA 4M6PA 4MY1A 2TPSA 5F1VA 1DORA 1TPEA 3P74A 3W1UA 2HMCA 4FXSA 5FF0A 5BMWA 3QQ1A 4LNYA 4P61A 4TR9A 1SZGA 3GX9A 1VJIA 3RK8A 3M41A 3C6CA 3PWAA 3S6DA 3VE9A 2DZPA 1OG0A 3BLFA 5L9FA 1WV2A 3BGJA 3G0XA 3IIPA 2DZTA 1DQWA 1TO3A 3NQVA 4Y9AA 1W5QA 1B57A 4PODA 4ALDA 1OFRA 3BO9A 1T0OA 4RXFA 4XKYA 4MZ1A 4FNQA 2NUYA 3LCGA 1L2UA 1ZALA 2OZ0A 2VELA 1JCNA 5HINA 3FIGA 2QUTA 2PCQA 2X1UA 2PE4A 3DFPA 4DPPA 1OX4B 1IXOA 2FFCA 2ZRZA 3NYZA 5BW6A 4N4PA 3QPYA 3BG5A 3I7QA 3P62A 4BWLA 1LRQA 2Z6IA 1IXPA 1H63A 2G5WA 2V5BA 1SW0A 4LU0A 3EXTA 3P60A 2A7RA 1PS9A 5F2MA 3C56A 3W1LA 2BSLA 3NPWA 4O12A 2IQTA 3IVUA 1FWNA 2B7PA 1FX6A 1TPB1 2Y62A 3W2MA 4JX6A 1ZCOA 4LC8A 4YLWA 3GDRA 4IQLA 1TRDA 3M5VA 4Y90A 3MP3A 1M5WA 5K9CA 4CQ8A 3KX6A 5DY2A 5AYXA 1LRTA 3G24A 1U5JA 1VLIA 3STFA 3TSMA 4RX0A 1UJPA 1VQTA 2CWNA 2TSYA 3W73A 3E49A 3W7LA 3A5FA 3P81A 2CLKA 2P10A 3GXPA 1X6UA 4H6KA 3PSWA 1MEIA 3NPVA 2C19A 3SR7A 5LSMA 1VCGA 1FWRA 4L4LA 4I7WA 2WV8A 2WSYA 1U83A 2ZRVA 3DU0A 4UNLA 5U7SA 1W31A 4JIPA 3C8FA 4WY0F 1DJNA 3NL5A 3STCA 1HO1A 2ATMA 3NOEA 2QDGA 4DBEA 3IIVA 4QNEA 4O1CA 1Y0EA 1OFBA 3TQ0A 4TU1A 3EWBX 4M7SA 2TYSA 1R2RA 4TMCA 5CGQA 5AHEA 5CPMA 2W0UA 1UUOA 1ICSA 4AF0A 3NG3A 3W3OA 5HUPA 2QCEA 4UTJA 5CPNA 1K3UA 4NJKA 3WJXA 3LCLA 2ZZ5A 1QPRA 3GYEA 5HWJA 3U6WA 3EX6A 3UWVA 3TFCA 2NX9A 4OHQA 1A5CA 3ZFHA 3NQ8A 2CZDA 1H61A 1SFJA 3NQMA 1GWJA 1CW2A 4PL2A 1XUZA 1Q45A 1O5XA 3BW2A 4YL2A 5TBOA 3W7HA 1N55A 3F03K 3WFAA 5D33A 4O1BA 3IVTA 3FKRA 3MI3A 1K03A 5F4SA 2Z2UA 2H8ZA 5LHFA 4IMCA 1QFEA 1JCYA 3MO7A 1SZNA 4QISA 3MI2A 3S5NA 3L65A 3LBCA 1QWGA 2CW6A 5HJLA 4C1KA 1S5VA 1H7WA 3LXBA 4ONVA 3LXCA 4IPIA 5U4NA 3TDFA 1SO6A 2G95A 3CWNA 5LNUA 1H62A 2J6XA 4MY9A 4CLMA 4UFMA 2DP3A 1RZMA 2QCFA 3LHWA 3QRHA 5G2HA 1X1ZA 2X30A 2GQAA 2QAFA 4IMEA 1Z42A 2A6LA 2RKXA 3ATYA 3GAKA 4JTTA 3USBA 4YMZA 3W1MA 3D0CA 4ORIA 4JYEA 5C55A 1GTEA 1XUUA 1R2TA 3BW3A 1O94A 4AEOA 1PL9A 1KTNA 2VEPA 4O18A 1FY6A 3A22A 3TC7A 3E96A 1LOQA 4NXSA 4WXYA 2OX1A 3BV4A 4ZQMA 3KFTA 1ZNNA 5A8GA 3O1NA 4A21A 3FOKA 1TB3A 3CB8A 5D30A 3HB9A 3O15A 3L9CA 3LLFA 3P8JA 3HF3A 3NZ1A 3V1PA 3GR8A 1ZHAA 4NJGA 2A2IA 1G4EA 3NQEA 2C18A 3VE7A 2R94A 3TMLA 4GUGA 4MZ8A 3LB0A 3TW7A 3G3MA 1W37A 1WOAA 4HT3A 2W79A 4IWWA 1OF6A 1N8FA 4GXMA 1TQXA 1FXQA 1O4UA 1SSGA 4UUIA 4LW7A 2E09A 4Z1CA 4NNAA 7TIMA 1GVFA 2A4AA 4UFIA 4MVAA 4XUGA 2CLIA 3A21A 5DCEA 3SW6A 1H60A 4DELA 4IPJA 1PE1A 2GUUA 5DXXA 4RZ6A 2VOMA 4EWND 3MHUA 4K8HA 2ISSA 4WZHA 1K7XA 5I3HA 1XDLA 3RLVA 1GTHA 1C9DA 3EX3A 1FCQA 3ZR4A 3TAOA 3I7SA 3LERA 3W7QA 3HPSA 3KHJA 3S5YA 3TQKA 1K8ZA 1JQVA 2YR1A 3DZ1A 2P0OA 1HFBA 3E0IA 3EWUA 4K8EA 2DZSA 5LKYA 5K7JA 3DFSA 3WJWA 4NNCA 4UTTA 4O52A 4E2BA 3NL2A 1LYXA 5FF3A 2KZHA 3NVTA 3G0UA 1OX4A 3PVFA 5EPDA 1QNVA 3ZWSA 2NUWA 1WAUA 3E02A 3TR2A 2JBMA 2JKAA 4K38A 4ZMGA 3UWWA 2UV8G 5F4WA 5CSRA 4PL1A 4E0CA 5AHLA 3NQCA 4ZQPA 3M0ZA 3U2OA 5FESA 1JCXA 1UUMA 5LGXA 1TPH1 3PR2A 5FEPA 1OFQA 3C2EA 2D73A 3FYOA 3OEXA 3EX4A 5HMSA 4HSOA 3GNDA 3O16A 4QITA 5ABTA 4YWIA 3W7EA 5DY3A 4JTSA 3UY8A 1JRBA 5CZSA 3SZ8A 1S3HA 2CLFA 4DBDA 2QCMA 3DH7A 3LBMA 3LRKA 3FYPA 4GJ1A 2I1OA 1ZAJA 3N73A 3W1NA 1SQ7A 4N2YA 3TIMA 4LVGA 2ZTJA 1GEQA 2Y61A 3O07A 2FIQA 3BG9A 2NWRA 4FEZA 1B4KA 1YDOA 1UCWA 4L4MA 3QPZA 1EA0A 5FF2A 4AHPA 2FQIA 3EWXA 4UFKA 2HSAA 1YTDA 2QDHA 5AYZA 1TREA 1G7UA 5CZJA 3PUEA 3QH2A 1I2RA 1L6WA 1SSDA 3LHUA 1GJPA 3P80A 1AW1A 3TV8A 5G4EA 3W84A 3P84A 3GXNA 5F2IA 4LV4A 4NNBA 1K02A 3LM7A 4FX7A 1TQJA 4NJIA 3T55A 5G2WA 4OV9A 3QSRA 1W3NA 1D3GA 4CNOA 1XC4A 3CTLA 3S1XA 4UFLA 3HIJA 1QPNA 1JCMP 4M19A 3CIWA 5CPOA 1L6SA 2GPTA 4MOZA 4UR7A 4UTWA 3W23A 2ZZ4A 4PEKA 3S1WA 5C2XA 4UTTC 1ZAHA 4AVFA 3NQ2A 4O1DA 2YZRA 1YYAA 4JR5A 4FIQA 4R33A 3S5OA 4JTEA 1F74A 5I3GA 5CSSA 3KRUA 2RDTA 4OE7A 4A2RA 5KZEA 3W1RA 3IVSA 5K3VA 3MBFA 1SO3A 2LLEA 3MJYA 4QIUA 2NV1A 3O63A 2Y7GA 1XFBA 4QAIA 3W2KA 3K30A 4PH6A 4K6AA 1DBTA 1EUAA 3MYPA 2EKCA 4NJJA 3GAYA 2J27A 4LRTA 3TU9A 3HJZA 3BGGA 3L0NA 3M16A 2ZRWA 1RQHA 1X7FA 1KFBA 2E5CA 3GNNA 2QUVA 3N2XA 2ZZ3A 3CLMA 1GT8A 3HPZA 4O19A 4LVBA 4LVDA 2Q3OA 4KFNA 3MUXA 5H2ZA 2VEIA 4FB7A 5LGZA 1KV5A 1O60A 4LY8A 1XCFA 4GUHA 3UXAA 4JTKA 1VHNA 2WJZA 3BVJA 2A85A 3S9YA 1NVMA 3LHTA 2A0NA 3BK0A 3IGSA 2HS6A 4IXXA 4BI5A 3W86A 1RVGA 4MIMA 5J5RA 5CZTA 1P1XA 4Z1BA 3O06A 4FNSA 5EY5A 2ABBA 1S5TA 3LXAA 1J4EA 3SSJA 3W87A 1ME8A 4DF2A 8TIMA 2WSRA 3P5YA 5F4XA 4O14A 5T26A 2FTPA 4CQ9A 4DQWA 3ABOA 1JR1A 3THAA 1VYPX 1KLYA 1FXPA 2J88A 3TUUA 3TSBA 4KWVA 4H3DA 3C0JA 1G4PA 2V2DA 2J24A 4NU7A 4JTLA 2FLIA 2P1FA 3LCXA 4BK9A 1MEWA 3N34A 1G6CA 5D32A 4E2DA 2GOUA 4N6EA 1ZFJA 2BTMA 4YCPA 5IBXA 3NA8A 2BX7A 1G7VA 3OHIA 2F84A 5D09A 1GVSA 3BLEA 4LUIA 3TQVA 2Q8ZA 2RDWA 4CCEA 2E6FA 3G1YA 4RJEA 4NXKA 3PB2A 1KFLA 2QJGA 3PS7A 4M7TA 1LBLA 5HR6A 4K7VA 4Z1DA 1AW5A 4PCFA 3YPIA 4XKYB 2VENA 4KFPA 1XBXA 2JKEA 1XBZA 3QMTA 1OABA 3WJYA 3W83A 3G3DA 2DU2A 2ZCGA 5EA9A 1ZJIA 1KFKA 4WUIA 2X1TA 2WNNA 3S5ZA 4IUOA 1B3OA 4JIQA 2XN2A 1F73A 3M5YA 1WOBA 5D38A 4AWTA 3RU6A 4GC4A 1H1YA 3HGRA 4S2BA 5HNRA 4Y8FA 2FPYA 1RV8A 3W6YA 2YDAA 2ZTKA 4LTSA 1SUXA 3LI1A 1TYGA 4U4MA 3QW4B 3T7VA 3C4UA 2FJKA 4MY8A 1K7EA 3VKJA 3TJLA 1KA9F 5D2XA 3NPXA 3TROA 1Q6QA 3PULA 3VI2A 1CX9A 1LORA 2AAMA 4X2RA 5F2LA 3EXSA 5I3IA 3N9RA 3OVPA 2QCDA 3IGUA 1OF8A 1KM5A 2YGYA 3QC3A 4NT0A 4TX9A 3A24A 4O17A 3TAKA 2CLEA 3L0GA 2BZNA 1AW2A 3W70A 2H8XA 3DFQA 3L5AA 3LI0A 4PTNA 3PBYA 1TPUA 1TJPA 1VYRA 3B8DA 3NDOA 3G1DA 5AFDA 5D2VA 3KRSA 1EX5A 4Y6GA 4IMFA 3W72A 3GIYA 3N2MA 1GG1A 2DJXA 2HS8A 3LTYA 4Y96A 1O95A 1OYBA 2GQ9A 4UMBA 1F76A 4FX6M 3UZ5A 2QCHA 1A5AA 4LV9A 1SO4A 1AG1O 1EEPA 5C5YA 3FKKA 3LOTA 5C6MA 1NF7A 4GNJA 4HNUA 3M7WA 1ZAIA 4CCCA 3B03A 4RZ4A 4R7JA 2F7FA 2QCDB 1LDCA 1A5BA 3LTPA 1OFPA 1P0KA 1LROA 5AHFA 1JJKA 4ADTA 3UWUA 4XQ6A 3W2JA 5IM51 3QMRA 4XTIA 4A22A 1LP6A 1XL9A 1KFJA 3PUOA 1PHQA 3HG4A 4JDYA 2J9XA 2WQPA 4NVTA 1FCUA 3FS2A 2OT0A 3QZEA 4UTUA 2QCLA 2YX0A 1F6KA 2JGQA 4TMBA 3PG9A 2CZEA 2C13A 3BARA 3BLIA 3SIZA 5G2IA 5FEZA 1W0MA 3SFKA 2YXGA 4H4IA 3WK3A 1BEUA 1GG0A 5D2WA 4ADSA 1MO0A 2NV2A 2EGZA 3NXFA 4AB4A 2RHGA 1IGSA 1RR2A 4AMAA 1Q6LA 4BR1A 1QO2A 3LCHA 3BW4A 5CKSA 3STEA 3F4WA 4S2CA 4ORMA 5EBUA 4KFOA 3G1VA 3W7CA 3T78A 1ALDA 3ELFA 2B7QA 2E77A 1PIIA 4JXCA 3LGEA 3OA3A 1XI3A 1F5ZA 4IXHA 2QCCA 3P7YA 3L68A 3C52A 3MBDA 1V7YA 3GDMA 4MFDA 5D2TA 4AXKA 3W1AA 4MJZA 1W8SA 4ZL1A 2VFDA 4G1KA 3DI0A 1W56A 1OK6A 3PBUA 1VHCA 3IRDA 2NX3A 5MHBA 2A1YA 3W1PA 3G22A 3LCWA 3R12A 1YPIA 3NQDA 1QCWA 4XBSA 3VCRA 1THFD 3WJZA 1H5YA 1TPFA 4JD4A 4UMCA 2YFOA 2H90A 1YXYA 5DELA 5AC8A 5E93A 4OGZA 1NSJA 3P61A 1TSIA 3EKZA 4AF0B 2FPTA 3G1AA 3L0KA 5DXYA 3W7RA 3TSDA 4RR4A 1DQXA 1MXSA 2B7OA 4GE8A 4HN4A 5EYWA 1W5MA 3DKLA 4MFEA 3PB0A 3W2UA 4C1LA 1IIHA 5AOUA 3V75A 2O7SA 3C3NA 3G8RA 4POCA 3UWZA 5TIMA 1PCWA 1O5KA 5G1YA 1SZEA 1G4TA 1ADOA 4A3UA 4JY8A 2NXIA 2WPBA 5LNVA 2EF9A 1W3TA 4UTLA 4FX8A 3DKJA 1LOLA 3NO5A 3QMSA 2PC4A 2AQWA 1WXJA 3OG3A 1B9BA 2E6YA 1DV7A 4DEFA 1AK5A 1WBHA 1Q6RA 3W76A 1E51A 1OK4A 3O6DA 5I3FA 2X1SA 1LBMA 4MZYA 4FIRA 1R30A 3NZRA 4B5NA 2EPHA 3KVMA 3HGJA 4NX5A 3FJLA 4TO8A 3TW6A 4N4QA 3A23A 4HSNA 5A5WA 3Q2DA 4AH7A 2OT1A 4E38A 2Q3RA 2QEZA 4QJ1A 2VFFA 4MKNA 2ZZ2A 2Y85A 3QJAA 4Q32A 3LV5A 3F4NA 4WQ6A 1KM0A 2Q8LA 3HQ1A 4OWGA 2CLHA 3CU2A 5AHIA 4K7YA 4UR8A 3ANYA 4O4WA 3VFLA 4JX4A 1XBVA 2VFGA 1QMLA 1XXXA 3L5LA 3S8HA 1MEHA 4UTMA 3NM3A 3PG8A 4WD0A 4AHQA 2EAWA 1FQ0A 3M1ZA 4QNWA 3TKFA 3Q58A 3BG3A 4IX0A 3NGJA 4S1FA 3G1XA 3LV6A 1H7OA 4HPJA 4RV8A 4FO4A 3W1XA 1TTIA 2VKZG 5BRBA 3KXQA 3B4UA 4LUJA 1ONRA 2AGKA 2A7PA 2TMDA 4BWLC 3TH6A 1TV5A 1DOSA 2ZA1A 4GFSA 4JY9A 4FNTA 5FEWA 3LLDA 5DBUA 4XBKA 3W7GA 3I65A 6ALDA 1YDVA 3DFTA 3MI6A 4R34A 1GVOA 1IXNA 2ZBTA 1T8XA 2C14A 1H1ZA 4N9BA 1KLZA 3N19B 1KM3A 5D03A 1FUYA 1VZWA 3S1VA 4QQ3A 4CNNA 1R2SA 2C1HA 3ABRA 4CQAA 1ICPA 2PRLA 3NNTA 3NL3A 1Z44A 1KBJA 1VCVA 4UTIA 3MMTA 3N3MA 3M6YA 3FEMA 3LCIA 1OHLA 4O10A 4HKPA 3EX1A 1DVJA 1EP3A 1BKSA 1QR7A 3LTSA 4EOUA 3KVLA 2J9YA 1RPXA 3UYCA 2QR6A 4LS1A 2DZVA 4MLRA 3RMJA 3IIXA 1WX0A 1FDYA 1RQEA 3VNDA 4D2JA 2ZZ7A 4CCDA 4LWWA 4RKAA 4ICNA 1LLZA 4MUZA 4EVZA 4N6FA 1TRIA 4JDBA 3G0SA 3GB6A 3R8RA 1G4SA 1RQBA 1MZHA 2FPVA 1KFCA 3L66A 4LRSA 1QOQA 4Z1AA 4HHPA 4JS3A 5K9XA 3DGRA 1UBSA 2CU0A 2JK2A 2GJLA 2BLEA 3TXVA 3B06A 3F1QA 5DCBA 3GZ3A 2G97A 1GPWA 1A50A 2B7NA 3TXZA 3LCFA 1QPOA 5E0KA 5BOOA 4JTJA 3EX2A 2X2GA 3IV3A 3W7PA 1H7NA 4YCOA 2V81A 1YDNA 3W7KA 1T96A 1I45A 4CNPA 1GQNA 2DZXA 5DCDA 1W5OA 1I8JA 1W1ZA 1N7KA 4BI7A 1TV8A 1KTBA 3LHYA 3W07A 5C54A 2JKPA 5LNSA 3NQFA 3QYQA 4RCXA 3C2VA 4LC6A 1H7XA 2V9DA 5FF7A 1G69A 2A6NA 3RLUA 2FB3A 1XBYA 4EF9A 4RK8A 3B05A 3IIZA 3QQ0A 1XM3A 4OQVA 5KITA 3W1TA 1OFAA 4KWWA 1GZGA 3DAQA 2E1DA 4O0KA 2ZFAA 1D3HA 1R46A 3O6CA 3S1UA 3TNOA 1EP2A 1PVNA 3EWYA 3DENA 3GDLA 5DN1A 4UTHA 3I7RA 2WNZA 2OCZA 1GYLA 3B0VC 1YLVA 4N02A 2EHHA 4O16A 1AL8A 3G1HA 2V5LA 1VS1A 3LRLA 2VFIA 3QM3A 2CZFA 3TC6A 2BXVA 2NLIA 1F7BA 3RFAA 4P2VA 3FLUA 5FF4A 3UD6A 1BWKA 2OJPA 1RD5A 3QW3A 1FCBA 4IMGA 5AYYA 3MP5A 4K36A 3BPWA 1EPXA 2Y7EA 1YTKA 2V30A 1J5TA 4LVAA 3G18A 1JULA 1LOSA 3TX9A 3HPXA 2PRMA 4DO5A 1QAPA 4JYFA 4A29A 3GXTA 3MP4A 3OBKA 4FNPA 3NEVA 3PF3A 2JGYA 5BNKA 2CLMA 4WX2A 1OVDA 1IF2A 4PFMA 1TJRA 2YFNA 1OX5A 2NXHA 1LZOA 2CLOA 3N9SA 2O7QA 1EWDA 4UIOA 2WNQA 1Q3NA 3HO8A 4R53A 4IOTA 3W1QA 3TFXA 1G67A 3UPBA 2Y6ZA 3WK0A 1SR9A 3B0PA 3C2OA 1DKWA 1AL7A 1KW1A 5D04C 5DLCA 3GK0A 4DO4A 2ZRUA 3Q94A 3TK7A 4Z0SA 4NUWA 1OYCA 1KTCA 2A7NA 1VH7A 2DZUA 5I3JA 3KVKA 3O05A 4JTHA 2QJHA 1ZENA 1I2NA 2QCNA 1PV8A 1VC4A 4GUJA 2VEKA 2R8WA 4MYAA 2YSWA 5LNRA 3P8IA 2NX1A 1ME9A 4UFHA 2WSQA 5K4XA 4X22A 1DJQA 1QOPA 4O11A 4JTGA 2ZA2A 3UQNA 1ZY9A 5F2GA 3I6RA 3B04A 4UNKA 5G5IA 4JX5A 1OFOA 1A5SA 3TE9A 3G1FA 3NQ6A 4I7VA 2CZ5A 1KV8A 2YW3A 1C8VA 3O8AA 4I9AA 2HTMA 4HPXA 1C29A 1GYNA 2G96A 4GRSA 3KAOA 4ZQCA 5G1TA 2YYTA 2V0TA 2E5DA 1TPWA 2Z6JA 3W74A 3LHVA 2X1RA 4JTIA 5D02A 4NJHA 3UWYA 4LVFA 2V8ZA 1TIMA 4MLJA 2GVJA 3LX9A 1EIXA 4DO6A 3TCEA 4IX2A 2QKFA 1UB3A 5CZ0A 1JCLA 3R13A 3LDVA 3T4CA 3SY5A 1ME7A 4UTWC 1A53A 1H51A 3OVRA 5AC7A 3M47A 3H53A 3EKLA 3G8EA 2H3DA 3LHZA 5DBTA 3CHVA 4AWUA 4K39A 3CEPA 1WQ5A 2E5BA 4OV4A 4UTKA 1QDSA 1I2OA 2PRHA 4O4VA 3PSVA 4QSHA 3HGOA 4WOQA 4UMAA 3NR0A 4IJBA 2QF7A 4JYDA 1PHWA 2NXGA 5AB3A 5J5DA 3GKFA 2R14A 2ATSA 3P67A 4ZVJA 1KM4A 1KBIA 1TPC1 4JGDA 1HO4A 3RNDA 4AAJA 2NZLA 4K37A 2VXNA 4MPQA 3UZJA 4IGHA 3EXRA 5KZMA 3N14A 3DI1A 5D2YA 3T44A 1JUEA 1I2QA 1F05A 1H7RA 1JRCA 1YTEA 1I4NA 2ZZ6A 3M43A 3DFOA 4WY0B 3NAVA 4UC5A 1M7OA 1JQXA 3E12A 4Z08A 1SW3A 2ISWA 2QUUA 1JUBA 1I2PA 3INPA 2NWSA 3PM6A 4OT7A 2VFEA 4ADUA 2Y7FA 4Q4KA 3L67A 3R89A 1SU5A 2XN1A 4BF9A 3HG3A 1ICQA 1X8FA 5I3KA 1KM2A 5HWNA 4GBUA 5LNWA 1WA3A 2YYUA 1FCVA 2Y7DA 1SW7A 1TTPA 3CM4A 4O54A 1LLWA 4O0ZA 2QJIA 1VLWA 2V2HA 3T40A 4LT9A 3EEGA 5HQEA 5K2ZA 4AWSA 1FWWA 5D37A 1XDMA 2C0AA 2YCEA 3KVJA 1EP1A 3SI9A 1JVNA 2C16A 4O8RA 4TIMA 5E1QA 3TA6A 3C2RA 5AHMA 3GR7A 3W7JA 3EB2A 5H91A 1OJXA 4N9EA 1X1OA 2C6QA 3CC1A 5CPLA 5G4WA 1VGAA 1QO5A 3FA5A 4JN6A 2BWGA 3PC0A 2FB2A 4MJMA 3SJ3A 5K9DA 5HULA 1PCKA 1R47A 1Z48A 3Q37A 1T99A 3A9IA 3W75A 3P82A 2H3BA 3UY7A 1W5PA 3R5EA 1TPVA 2B4GA 3GVGA 4NZFA 2E68A 2ZYFA 2GVGA 1DL3A 1WYIA 2R91A 3GKAA 1FDJA 4PA8A 3MYOA 1JUKA 2WOQA 1SO5A 3UWQA 4I7UA 1SFLA 5EKYA 1VRDA 2I9EA 3E9AA 1WBJA 3W2LA 3ZWTA 4LS0A 2ZDRA 3PBVA 4ZQNA 5TQLA 1KM6A 1GVQA 1FWTA 4NX0A 3ZS4A 4FNRA 4M5PA 2CLLA 1Z41A 5AHNA 2H6RA 3HG5A 2Z1BA 4RLIA 4X9SA 4ZQOA 1LTDA 5LHEA 4EIVA 3DFNA 4LS2A 1IXQA 2VEMA 4ML9A 5IBXC 3EWZA 3HG2A 3O6YX 3W71A 4O57A 3EWWA 4N9DA 3S0CA 1TTJA 1LM1A 3W7NA 3W7IA 3M5XA 4QM1A 4X3ZA 1XKYA 2DZWA 1P0NA 3TMQA 3ABSA 4UFJA 3CEUA 3I68A 4O15A 1BWLA 4JTFA 4BFAA 3DBPA 3W7MA 3HMJG 3WK1A 1NAL1 3DHDA 5HUOA 1H50A 5HWMA 4NZJA 3S42A 1VYSX 3UNDA 4MYXA 3M9YA 1OX6A 4J9JA 3DXIA 3DHFA 5BMXA 2J9ZA 4NQ1A 3SGZA 2GVLA 2QCGA 4UCGA 2WKJA 3C61A 5EMUA 3NQ7A 1EUNA 1YXDA 4M6QA 3QF0A 1B4EA 1WDWA 4DXVA 1EB3A 1HG3A 1V5XA 2DJLA 4N9CA 2ZZ1A 1L6YA 3W7DA 3WK2A 3JS3A 3ABQA 1KFEA 4RXGA 1AMKA 3NQGA 1J2WA 4WY0A 1UASA 2ZA3A 1H7PA 2YPIA 5KTLA 1F6PA 3R2GA 1VR6A 2GQ8A 2Y88A 3FFSA 1TPDA 4YXGA 5KINA 5D05A 3L5MA 3IEBA 3JR2A 2DORA 3HBLA 1YXCA 5FEXA 3L21A 3W9ZA 4AHOA 1FWSA 3CIXA 3MHFA 1LRNA 4HNNA 2X16A 5SWUA 3AO0A 2Y89A 5KZDA 2V2CA 2TRSA 4GWEA 2VC6A 5KMYA 4U28A 1TCDA 4RZ5A 3PY2A
chains in the Genus database with same CATH superfamily
4L6HA 1SR0A 1P5BA 3OQEA 3UXDA 2AGTA 3WEOA 3QSTA 3P0XA 1P0DA 4JNZA 2ZRYA 2E6DA 2PDNA 2X7VA 4FXRA 3AJXA 3R4IA 4WJEA 3ICJA 1HL2A 1FDZA 1YADA 3IIOA 4B5TA 3ITOA 2ZDSA 3PJTA 3DERA 1BTMA 4GQ0A 4IL0A 3MWAA 4LAKA 4QROA 3SCWA 3PZMA 4YNGA 1MFVA 3T05A 3GWQA 5I2UA 1L9WA 1JXJA 3UGRA 2XSAA 1NF0A 4B5WA 1VFUA 4YPJA 1D9EA 4DBUA 3BICA 4AZGA 3KOXA 4IFKB 1VJZA 4F9DA 1JCJA 4G6CA 4FZIA 3ZJ6A 3BAKA 5GVJA 2CKRA 3H55A 2PGWA 3NOYA 4KCVA 3UR8A 3QFEA 5K4ZA 3LGGA 5EMKA 1OYAA 3UJEA 3EOUA 3PBWA 4Q8TA 1VCFA 1F2JA 1SZFA 1XLEA 3NM1A 3V1HA 1NEYA 1A4MA 1SPQA 3V0SA 4OBTA 1EC8A 3AS0A 1VPXA 2J66A 3AHZA 2RFGA 4Q33A 3I3BA 4K2SA 3PAJA 1XRTA 4O50A 3W88A 1EIBA 5AC6A 3GDTA 3U8GA 4AW7A 3SUTA 2OPJA 2XFWA 3NL6A 3OGRA 2BB0A 3OIXA 5FI8A 1HTIA 4H6QA 3SY1A 3W22A 1IWBA 2D2JA 3P5ZA 3CT7A 1LG1A 4DF1A 1OD8A 2VRQA 3TJXA 2GJNA 3OIHA 3ALGA 3H8AA 4OU1A 2ALDA 1W3IA 4JNYA 3KTSA 3CQ0A 2Y70A 3CYVA 2VVSA 1XCXA 4KRZA 1GVRA 5HPOA 2RDUA 4JHMA 1UD3A 2PDMA 1LBFA 4TVUA 4M6PA 1DORA 1LUCA 1OIFA 1TE6A 2W3ZA 5BU9A 1TUXA 3ZR5A 3CUJA 1VP5A 1IZCA 3BSGA 3GX9A 3RK8A 7REQB 3UG8A 2AOSA 1A3HA 2RAGA 1TX0A 2GVYA 3TYDA 4GIRA 3BLFA 3HM7A 5HNUA 4UNIA 4B5XA 3IIPA 4F0KA 4Y9AA 1CYGA 4YTUA 1B57A 4ALDA 3CLWA 4W87A 2ZE3A 1XD0A 3T2PA 2VELA 3ENLA 1TA3A 2QUTA 2OB3A 3OYZA 4DPPA 2VWSA 3KDOA 3TP4A 2V3EA 1UH3A 2ZUWA 3J7HA 4J5NA 1GOQA 3LPOA 2V5BA 1HP5A 1EXPA 1DWJM 4HYRA 3P60A 2A7RA 3QLDA 4QTGA 1PS9A 5F2MA 3WLSA 2WB5A 4XV0A 4G9PA 4O12A 2IQTA 3IVUA 2FZDA 2B7PA 1QOXA 4YLWA 1S1PA 3GDRA 1NOUA 4L7ZA 4M81A 1TRDA 4CVWA 2CBIA 1VEMA 3MP3A 4DJED 3LM3A 4CQ8A 1DIKA 5AYXA 1LRTA 1VLIA 4RX0A 1UJPA 3W73A 3XISA 9XIAA 3WQVA 3P81A 1KWKA 1CPUA 4U5IA 1A0EA 2FJUB 1X6UA 2DSZA 3SR7A 4W89A 1U83A 1ZP3A 3C8FA 3WCZA 3NL5A 4IIHA 3ES8A 5GPRA 1D2KA 2Y1HA 3HJEA 3UG3A 4YTSA 1HO1A 2JIEA 2YA1A 4O1CA 3TQ0A 1UYQA 2TYSA 3F7JA 1UUOA 3KHDA 3UW6A 4AF0A 1WDQA 4UTJA 4H19A 4NJKA 4GKTA 1W17A 3SCPA 3GYEA 3UWVA 4IQJA 4OHQA 3WH7A 3VDCA 5EMLA 2WVUA 3NQ8A 3V7PA 3V0UA 1GVIA 2GJRA 3WLNA 1ELSA 2CZDA 3W53A 3TZNA 3R94A 1XUZA 1XGZA 2X0YA 3ZSTA 3BW2A 4NHVA 4YL2A 2UY5A 5TBOA 3W7HA 3ARZA 1E40A 3IVTA 4P7OA 1LLOA 3TONA 2C7FA 1PO9A 3KZPA 3HQPA 5A8PA 1LL6A 5F4SA 3ONCA 3ABZA 1CENA 2PTDA 1OZQA 4DI8A 3UG5A 2VX5A 4I9MA 1JCYA 3G6MA 4RE4A 1SZNA 3S5NA 3MI2A 3LBCA 4B5UA 2CW6A 4C1KA 4BEUA 3Q45A 3GC2A 3TDFA 4MDPA 2G95A 1AH4A 1UWUA 1H62A 2OELA 5I5RA 1Z9AA 1E6PA 2DP3A 2QCFA 4UOJA 1ZTVA 3P3BA 3Q65A 1YNPA 1K6AA 5G2HA 2X30A 2GQAA 1XKJA 2RKXA 1E9LA 4GJIA 4HU3A 3T4WA 3USBA 5GNXA 3WLKX 4NIRA 3H21A 4U33A 3A4AA 4AEOA 4GISA 1KTNA 2FZMA 3VIGA 1TX2A 3A22A 1LOQA 4NXSA 2CERA 2GJXA 1MFUA 1TB3A 1PSCA 2ANUA 3CB8A 4PSPA 3CS2A 4AD0A 3PPGA 2CHNA 3L9CA 4A8IA 3TLLA 3HF3A 4KIEA 2E7FA 4QCFA 3CHEA 1QNOA 3ZT7A 2C18A 1SMAA 3W00A 3WLJA 1J0IA 3RLGA 3SCSA 1OF6A 1N8FA 1FXQA 3B8VA 3O6AA 3L4YA 3E2VA 7TIMA 1PZ2A 2Y5SA 1V51A 1D7KA 1WZMA 3HMCA 1GQLA 4MVAA 5CCZA 3M64A 1QW9A 2VX4A 4HK7A 1UD6A 2D2OA 3QV7A 2NVCA 1V7AA 3DFHA 1HKIA 3IUHA 4WZHA 1K7XA 1E6XM 4HK6A 1XDLA 4GYKA 6A3HA 1FCQA 2XH7A 3LERA 3KHJA 3S5YA 5A94A 3DZ1A 4YVVA 4CGTA 3EWUA 4K8EA 5LKYA 4GIEA 3TVAA 3TCSA 3IV8A 3CNYA 1F8MA 2FYMA 2DGAA 3WEZA 5A3HA 3ZWSA 1V3HA 5I0DA 2VM8A 3TR2A 3KRBA 5CSRA 1TWZA 3S9IA 1JCXA 5LGXA 1TPH1 3PR2A 4Q7BA 1GZ1A 2D73A 1KRBC 2GDVA 4XZMX 4YWIA 3FSTA 3VDAA 1JZ2A 4JTSA 3UY8A 1M03A 3DH7A 1F6YA 3FYPA 4GJ1A 1ZAJA 3HURA 2Z1KA 3W1NA 4N2YA 3TIMA 2XVLA 3WG6A 4JKKA 3FV9A 1IEIA 2FIQA 1UQYA 3BG9A 1CT5A 1YDOA 1PWLA 4A6GA 3GZAA 4AHPA 4WKFA 3PANA 1C3FA 2QDHA 4J3WA 1TWIA 4AIEA 1TREA 2PP3A 2QPUA 5AZ1A 4GCAA 5DMYA 1FRBA 4RL3A 1GJPA 1B9ZA 2XH2A 3TV8A 5G4EA 1UUQA 2R82A 3P84A 3GXNA 4M6UA 3PPFA 1PUDA 1JPKA 4LX4A 5I78A 3LM7A 1TQJA 4NJIA 4OV9A 1UKTA 4HA4A 2WKLA 2OZ8A 1U5HA 3KM8A 3A6OA 4UQDA 2WJFA 4W88A 4C5YA 4MOZA 4UR7A 2KAUC 3W23A 2X2YA 4PEKA 4UTTC 2PWGA 2FZ9A 2WVVA 4NAFB 1DXEA 3NQ2A 4L4PA 5I23A 3K4AA 5A6BA 1YYAA 1B0IA 1GOWA 4JR5A 2YIHA 1Q7ZA 3A3HA 3NDYA 3KRUA 4RPPA 5KZEA 4CNSA 4S3EA 1LWIA 3NCOA 3IVSA 1KO0A 2LLEA 3MJYA 2NV1A 4AQLA 1NELA 3WL0A 4MGGA 4K6AA 4GMEA 3OP2A 1A47A 5LA2A 3TU9A 4ZB5A 4GINA 3BGGA 2E5CA 5DQPA 3CL7A 1MNSA 2QUVA 3MUAA 3CLMA 4LVBA 4DYEA 4LVDA 2Q3OA 2Z00A 3G2GA 1REQA 3AU6A 2VEIA 4YYFA 2QGHA 5GNYA 4QE5A 2ZUTA 4C6EA 3MO4A 5DF0A 1R3YA 1JF6A 3BK0A 1UP2A 1AODA 4IXXA 4BI5A 1EPVA 3W86A 1Q8JA 1BVWA 4Z1BA 1HF6A 4C6NA 4HMCA 4L1XA 2YBUA 2ABBA 1RAKA 1S5TA 3W87A 3T09A 1ME8A 8TIMA 2WSRA 3LZ3A 3EMZA 4QE4A 1GQJA 4DQWA 2Q09A 1GKQA 4QHRA 5AZ0A 1DWAM 4GXPA 3C0JA 1A3XA 1JZ8A 4ZR8A 2FLIA 1G6CA 4E2DA 1CNVA 1ZFJA 2BTMA 5IRPA 4YCPA 1QT1A 2X1IA 5IBXA 1FH9A 1P48A 1X97A 4LUIA 3DDMA 2RDWA 1VD6A 1E5NA 3AXMA 4B90A 4URIA 1LQ0A 2PC8A 1KFLA 3PS7A 4M7TA 4IGSA 3JZUA 5A2BA 4GO8A 4GQGA 4PCFA 1E0TA 3NDZA 4L4OA 2VENA 1QJWA 3W83A 3GG8A 2ZCGA 4FOUA 1KFKA 3WNLA 2X1TA 2WNNA 1KXVA 4IUOA 2NQ9A 1WUEA 2POZA 3WUFA 2Y0FA 1B3OA 3PJWA 1KRCC 5B7ZA 1WOBA 3B0XA 4AWTA 3KS6A 2E28A 2D2HA 4Y8FA 3ZSSA 3V35A 2FPYA 1TZ9A 2XZ7A 2YDAA 4NZ3A 3LI1A 4V15A 3W26A 2L5HA 1K9DA 3KL5A 3E2QA 3KBWA 2FJKA 3ZOAA 4JQ1A 4LCQA 4IFOA 1EC7A 1K7EA 1Y5XA 1JFHA 5D9OA 5IXEA 3V18A 1M04A 5I3DA 3KBVA 3CIVA 1U1UA 3H26A 3CH0A 4YHGA 2XDFA 2PF8A 1Q6QA 3PULA 1XH1A 3M0JA 1CX9A 1JNEA 3GH5A 4X2RA 1CXHA 5I3IA 2QCDA 3PBGA 3BLDA 1KM5A 1TZZA 3KBNA 1K8CA 4O17A 4KEVA 4PBFA 3F5JA 1MXGA 4JHOA 1CDGA 1IGWA 4WJXA 3N6HA 1TJPA 4Z2IA 3B8DA 1KKOA 3N3TA 5AFDA 2XFFA 3GIYA 5CC6A 3VUPA 2HS8A 1PTGA 2A3HA 1N82A 5CLTA 2WCAA 1AG1O 1EEPA 2TAAA 2IPFA 2WMIB 5G1MA 1BRLA 4HNUA 4FXFA 1JD7A 1P7TA 2VHLA 1ZS2A 3LTPA 1OFPA 3EEZA 1LROA 2OX4A 3HPAA 4OECA 4XTIA 1LUCB 1XL9A 5DMNA 1PHQA 2FTYA 3HG4A 4JDYA 2J9XA 3ZM8A 4J3SA 3QOMA 2OT0A 3QZEA 2YX0A 3CPUA 1W6TA 1CGWA 2J6VA 2DDXA 4DJFD 2CZEA 5CJMA 3BARA 3SIZA 4BKNA 5FEZA 1E6RA 4IQEA 1MMFA 2W4XA 3SFKA 3RLHA 3WK3A 3SN1A 3KEHA 1YQ2A 3VGFA 4IICA 2EGZA 2VI0A 3ECQA 4QDPA 4AB4A 1UR0A 1IGSA 1RR2A 4AMAA 4M0XA 8CGTA 4YU1A 1QO2A 2XPKA 2PD9A 2G50A 5CKSA 3L23A 1IEXA 3IJ7A 3F4WA 4S2CA 3T78A 3B0YA 4JXCA 3AIQA 3OA3A 3MCNA 4LAUA 5FD0A 5D2TA 1GNXA 4MJZA 1XS2A 4G1KA 3BOFA 2DVXA 3DI0A 5A6SA 1BGAA 3IRDA 4XZLX 4GKLA 3CUZA 1YPIA 4A8LA 3NQDA 1H5YA 4TX6A 5MF5A 3AU2A 3KWSA 4U5KA 1EZ2A 3CV7A 3PZIA 1HKKA 2PLMA 3FAXA 2FPTA 3VCCA 5I00A 1I0DA 3AXIA 4AZCB 2DT2A 5FJUA 4L80A 2NV9A 1IIHA 2MANA 4KH2A 1BG4A 4EANA 3N29A 4PRTA 3U4AA 3V75A 3C3NA 4POCA 5TIMA 3RXZA 4KRTA 1SZEA 3RAOA 2V5CA 2EF9A 4MNJA 3TTEA 3FHAA 1KFWA 5E70A 2VOTA 2XH4A 1DPMA 2VT0A 3RR4A 3SCUA 3WF4A 2PB1A 1OT2A 4PUWA 1B9BA 2E6YA 1OINA 4GNVA 3W76A 3WUEA 2X1SA 4FIRA 1R30A 3NZRA 2PWHA 1XLLA 1UD4A 3H7RA 3HGJA 4NX5A 4WIWA 2PWDA 3A23A 2D69A 5A5WA 3CQKA 3Q2DA 4MJ2A 4L9YA 1BF6A 2ZUSA 2JE8A 2OT1A 1AQHA 4MDOA 4E38A 4RE3A 2VMFA 2BHUA 2Z25A 5JXQA 1A5NC 2F2KA 4I90A 3DIPA 4Q32A 1E1EA 2FGZA 1FFRA 2Q8LA 3UBPC 4YTRA 3MCOA 2P53A 4K7YA 4UR8A 3RM8A 3WQ4A 3PJUA 1OD0A 4JX4A 2ZICA 1XICA 1L0PA 1QMLA 3S8HA 1MEHA 4HCHA 4LYPA 4UTMA 3W38A 2ZOXA 2EAWA 3M1ZA 3CZLA 2XIJA 1BF2A 4IX0A 3GH7A 3L4VA 2B81A 4JZ5A 4FO4A 4ZXOA 2VKZG 1XJBA 2AGKA 5GJNA 3TH6A 1TV5A 1DOSA 4ZOEA 5FEWA 1NOWA 4GGBA 4XBKA 3WF2A 4DXXA 5I09A 3LYEA 3MI6A 2VGIA 1UWAA 3N19B 4H8NA 5D03A 3FVDA 3MMDA 4QQ3A 3ABRA 4X0NA 3NL3A 4FMVA 3B97A 4KWUA 4UTIA 4IJRA 3MMUA 3M6YA 3FEMA 3PZGA 4E3VA 1QR7A 3LTSA 1W3KA 2QR6A 3FYYA 2DZVA 2FHFA 3EOEA 1RQEA 2FZBA 3VNDA 2YCLB 2XTKA 4Q4MA 4YIWA 1EJSC 1HJVA 4CCDA 3OBEA 3ARVA 1CLKA 4MUZA 1TRIA 1YPXA 5AC5A 3G0SA 3WLIA 3R8RA 1G4SA 1G1YA 1ZGDA 1MYRA 2FPVA 1TFVA 3M0HA 4HOWA 2Y24A 2P50A 1K77A 2GJLA 1J8VA 3MANA 3KWXA 3F1QA 4F3HA 2G97A 1GPWA 1A50A 1QPOA 1UKSA 3VCNA 3EX2A 3IV3A 3GHRA 3W7PA 1H7NA 4YCOA 3H22A 2ZX7A 1GW1A 2PDJA 4LAMA 3E0LA 4CNPA 5BU6A 1H3GA 2PMQA 2OLSA 1GQNA 1W5OA 5EB8A 1W1ZA 1N7KA 4BI7A 1KTBA 3JZEA 4UOQA 3F2DA 1S5NA 2F2HA 5C54A 1XLFA 1VIZA 3LMZA 3PP7A 1F9CA 2DUZA 2OLAA 3O9NA 4Q4QA 3B8WA 4OQVA 3B05A 3QQ0A 1CGUA 3DECA 3PNUA 1UHVA 4A8RA 2ZFAA 1D3HA 5CC7A 2A79A 3S6OA 3S1UA 4IL2A 1EP2A 3BZJA 2A3CA 4KPLA 1Y8BA 3EWYA 1E9ZB 2EO7A 3GDLA 1AJ0A 4UTHA 4U2YA 5TF0A 3PJXA 1XGDA 3FGCB 1YLVA 3VKCA 8A3HA 4B2DA 3G1HA 4KGLA 3CZGA 3DC0A 4K1WA 3V36A 2BXVA 2IKHA 1B90A 3ZYZA 4PFHA 4P2VA 3W01A 1I9CB 3CQIA 2D24A 2ZXAA 3MP5A 2JQXA 3BPWA 1EPXA 3G18A 1NQKA 4DZ5A 1Q4NX 1LOSA 3TX9A 3VIKA 4DO5A 1QAPA 2X42A 3PFMA 4GVIA 3NEVA 4KQNA 2C79A 3PF3A 2XWEA 1ZU8A 4OFCA 4RDVA 4PFMA 1TJRA 1RHCA 5F7UA 3MDWA 2CLOA 1M3UA 1EWDA 1GOMA 2WNQA 1JL8A 2SFPA 1X38A 1FWAC 3IK2A 2Q8XA 2FHCA 2YL6A 3TFXA 1YKWA 4LUSB 1QNQA 1AL7A 3N2CA 4TQTA 3K1GA 4DM1A 3L4WA 2VZVA 5EU9A 2E9MA 4Z0SA 3EKGA 3APGA 1WZLA 2DZUA 4JTHA 3O05A 3BAXA 1VC4A 3N2BA 2OKOA 1BVNP 4MYAA 2YSWA 5LNRA 2NX1A 4UFHA 2WSQA 5K4XA 4X22A 1QOPA 2DVTA 2J8TA 3SRFA 1JI2A 3UQNA 3U7BA 1ZY9A 3I6RA 3G1RA 4JX5A 4F9JA 2R1PA 1FFQA 1XLBA 2OQHA 4I9AA 2D20A 1X39A 5FIPA 3UCCA 5EGRA 2G96A 1CGTA 1ODUA 3DFYA 1F3TA 4AZHA 3LHVA 3S5SA 1GKPA 2X1RA 5D9NA 5D02A 3FY1A 1DEDA 1NWRA 3UWYA 4LVFA 1TIMA 1UWRA 3SB0A 2WBKA 3KTXA 4DO6A 4AIOA 1O6IA 2ZXQA 4AX6A 4AIUA 3T4CA 3I4KA 4UTWC 1JCTA 4Y2WA 3MQTA 4JKMA 3LHZA 4AWUA 4K39A 1SYTA 2E5BA 2BVWA 1RUSA 3PSVA 1I1WA 3VNYA 4IJBA 4JAWA 2J7GA 3P93A 4ZVJA 4QG9A 2PBGA 1KM4A 3PWIA 1TPC1 1BLIA 4AAJA 5FJTA 4K37A 3MKKA 3RM9A 5BXSA 2VXNA 1FWFC 2VX6A 3WL1A 4MB5A 4V33A 3N14A 2J74A 1JNDA 1J18A 2ZZ6A 2WMJA 3VC5A 4WY0B 5A69A 1VBHA 3WBWA 2O4QA 1SW3A 3H7UA 1JUBA 1I2PA 4QGCA 5CSYA 3INPA 1HKJA 2ONEA 4OT7A 4ADUA 4Q4KA 4DJFC 4TTGA 3HG3A 2EG7A 1IR2A 3HZ3A 5LNWA 4S3JA 4D6DA 1TTPA 4U31A 3APTA 3FDGA 4O54A 1TJ1A 4INFA 3THCA 4LT9A 3SEPA 5HQEA 4AWSA 4GYPA 4LUYA 1Q2RA 4LYRA 1XDMA 4GC3A 4C7FA 3SI9A 1U1JA 4PMJA 4GBDA 3H2FA 4O8RA 5E1QA 4U3AA 1TELA 2GLKA 3TA6A 3W7JA 5H91A 4PMOA 2OG9A 1B3ZA 3R0UA 4GY1A 3CC1A 5CPLA 5G4WA 5ECUA 1QO5A 4JN6A 3ARYA 2IKIA 1NIUA 3TYAA 4Q4SA 3KL0A 3AMGA 5LA0A 2Z1XA 4BJHA 4GK8A 3WDPP 1T99A 1AD1A 4ERIA 4CNTA 1H41A 1FWBC 3ALFA 3GVVA 2CETA 2ZYFA 1MW3A 3WQCA 2G41A 2KX9A 1XIJA 4CVUA 2IKJA 3COTA 2D22A 4GA8A 4X2PA 4GLEA 1SO5A 4I7UA 3N04A 1SFLA 5EKYA 2I9EA 5CJNA 4GPNA 4IGNA 2VURA 3SSZA 2Q01A 4U10A 3H2CA 4KW2A 1AH0A 3LQLA 2WM1A 1FWTA 5C9WA 3UR5A 1ADDA 1PZ3A 2PI6A 4HP5A 1EF2A 2XVGA 3R11A 1Z41A 5AHNA 2WSPA 4X9SA 1LTDA 4FSAA 1Q4WA 3DFNA 5JQ9A 5IBXC 1H0GA 3EWZA 3W71A 1MQRA 3FEQA 2ACSA 1UWTA 4QM1A 5DRIA 2DIEA 2DZWA 1P0NA 3H4XA 1JXKA 3ABSA 4UFJA 2QMKA 1JZ3A 4JTFA 4BFAA 4D8LA 4OBRA 3DBPA 2ZWYA 3BUVA 4UBPC 1NAL1 1H50A 2YL5A 4I5UA 4AZIA 3UNDA 1XGEA 4J9JA 5FL1A 3FN9A 5BMXA 3P14A 2PDGA 3D6NA 4NQ1A 3TEVA 3ZMRA 4UCGA 3FA3A 2WKJA 3W24A 4JQAA 4M6QA 2VGBA 2ZZ1A 2GFTA 2DH3A 2EPOA 3TTQA 1ECEA 2B31A 3W7DA 2WLZA 3DCPA 1KFEA 1B31A 5BXRA 4JL2A 3SCTA 3AALA 1AMKA 4US5D 4W7WA 4WY0A 3ES7A 1P0BA 1H5VA 2WSKA 5KTLA 4DYJA 2GQ8A 2NT0A 4XBJA 1DXFA 2HE8A 1TPDA 2D2GA 4HNOA 5KINA 2CHOA 1L6FA 4GZIA 3L21A 4AHOA 4GNKB 2X16A 5SWUA 3AO0A 3VX0A 4ACZA 3OO2A 1BRLB 2TRSA 4MAVA 1UOKA 2ZC8A 3L2LA 1TCDA 4J28A 4Z0JA 5HATA 3NQAA 3NPUA 5CG7A 3GC4A 2F8QA 4TX8A 4Y9OA 4JPGA 4IPLA 3S2JA 2JIWA 3JW7A 4O28A 1CI1A 2ISVA 4QSFA 8RUCA 3RF9A 4ZZ9A 2WXDM 4HPGA 4NILA 2CFFA 5TNVA 2JFEX 3CPRA 4MM1A 2A5HA 4HGXA 3WLRA 3MWCA 2I9UA 4QR6A 2P8BA 4GO9A 1PBGA 1QPQA 1ZLPA 2BHZA 1I75A 3M44A 4DI9A 3HGSA 1E4IA 3QEZA 4DUVA 1PB0A 2FDSA 2OZ3A 2GQ3A 3TOPA 1GOXA 4A35A 1BXNA 2CBUA 1K8YA 3IGXA 2QULA 5HDRA 3W85A 3IS4A 4CNUA 3WJSA 2CZVA 1ONEA 1DJWA 2E6AA 3KRZA 4TOQA 3EDDA 3HFTA 4LYQA 4AEEA 2Z0IA 4XWUA 2GJXB 4PC8A 2DIJA 1BYCA 1OFDA 3RPTA 1Q5MA 2YW4A 4O13A 4C6OA 1ML1A 2PF0A 3BMXA 5HR7A 1S1RA 3SGUA 4HIBA 2PPGA 1Q6OA 2XWDA 2ZQ0A 1W5NA 6TIMA 4MB4A 2RH9A 5D4YA 1J10A 1E3ZA 1V8EA 2B0MA 3UPWA 1TVPA 5D8WA 3BCJA 5AN7A 1K7FA 1TV4A 4IMDA 2A21A 1U5VA 2C1GA 4QQUA 3PZOA 5CXPA 3M0KA 4JNMA 1DJXA 5CC5A 4LF1A 2Y2WA 4NAFA 5CC3A 4LYKA 1IHIA 4MY1A 5F1VA 4Q8PA 3SCVA 2HMCA 3GQYA 4WGHA 3VOIA 2G37A 1UJQA 5I24A 4AZBA 3CASA 2QDEA 1R3QA 4B16A 5A1AA 4HCDA 2YL9A 3OGVA 3VE9A 1OG0A 1V77A 2GDUA 3BSMA 2WHLA 2CXEA 1T5AA 3QR3A 1TO3A 3NQVA 3MV11 1V6VA 4PODA 4JQ2A 4J4KA 4JQ3A 1DE5A 1BWVA 2JEQA 5C9RA 4JHZA 1TMLA 3R58A 4IGMA 3GS6A 1AUSL 2PCQA 2X1UA 1EDQA 5HQMA 2PE4A 3DFPA 1QNSA 2WANA 5A6AA 3NYZA 3WQ5A 4PBGA 3WLOA 3I7QA 4BWLA 2Z6IA 4HNCA 3SDOA 3WN6A 1OGSA 1IXPA 2QIIA 1JYWA 3QV6A 3CHDA 1SW0A 3MZ2A 4JTQA 3EXTA 3C56A 4XD6A 2BSLA 1IEQA 1L8PA 2OKTA 3UGVA 3W2MA 4JX6A 4C6BA 3AYTA 3QY8A 2VP8A 5IHSA 2OO6A 2QQ6A 3M5VA 4ZFCA 5HPCA 3K2GA 1Q65A 1M5WA 3CUGA 5AYIA 5K9CA 3M0MA 2Z28A 3RMEA 4FOKA 4C6DA 3G24A 3STFA 1XLJA 3VM5A 5TD4A 2J78A 1VQTA 4W8LA 3H2EA 2CLKA 2CC0A 4H6KA 1MEIA 5GJMA 1LT8A 5JMUA 2PCEA 1BYAA 1VCGA 1FWRA 4I7WA 1BD0A 4L6OA 4WY0F 1YE6A 4CN1A 3CBWA 2R9RA 2CBJA 1WDRA 3FA4A 4WHBA 3IARA 3TNBA 1OFBA 4D8AA 3EWBX 4M7SA 4XD3A 1R2RA 2W0UA 4MWAA 4CQDA 2WCGA 2IPJA 3ZT5A 3RCMA 1FHUA 5CPNA 3LCLA 1A5OC 3N17A 3EX6A 1NH6A 3H2MA 1NFGA 3QHOA 4LBRA 1SFJA 2NQHA 3NQMA 3LS9A 1Q45A 2VQTA 1DP0A 4GQRA 3RO8A 3F03K 4NZCA 3B8SA 1O12A 1OCQA 4DXKA 1K03A 3T08A 3HFYA 3RX3A 3WY1A 3C0SA 3AMLA 3OBAA 3WQEA 4O0QA 2YLAA 2HVOA 2H8ZA 3AROA 4N42A 3PZNA 3E5PA 1O5RA 1QFEA 4QISA 5HJLA 1S5VA 3DESA 2GSJA 4QEHA 2VEFA 4MY9A 4Q8VA 5FL0A 1R38A 1ISWA 1U2YA 2V3FA 4W8AA 2HPMA 1B3WA 3QRHA 4XVEA 1W3LA 3CUHA 4RNFA 1YDYA 3ATYA 3VNMA 4HZ7A 4IF2A 1UPPA 1MW2A 3W1MA 4ORIA 1QI3A 1GTEA 3PUGA 3ARXA 1XUUA 2BVTA 3BW3A 4YYCA 4MADA 4BEQA 1P43A 4BA0A 4F66A 3TC7A 4WXYA 2OX1A 3E3HA 3KFTA 5A8GA 4A21A 3HA1A 2E25A 3AUOA 3O15A 1FHDA 5M1TA 3LLFA 3NZ1A 4HOXA 2A2IA 3NQEA 4C7DA 3M0VA 1EH9A 4MWAE 6REQA 3VE7A 4C1NB 5CG0A 1ITUA 1BPLB 4MKSA 1MDRA 3TA9A 1WOAA 4HT3A 2A3EA 1OGBA 4IWWA 4GXMA 1PYMA 2PDYA 1TQXA 4H04A 1O4UA 4F0RA 3HTWA 2E09A 4Z1CA 3H2OA 1GVFA 2ZX6A 4XUGA 2CLIA 3SW6A 1MQQA 4S3AA 3VIOA 4DELA 4ATDA 3GFYA 4LH8A 1PZ1A 2Z7GA 3L7RA 5DXXA 4ZEPA 5EMJA 1E4MM 2VOMA 3GHSA 4EWND 1ISYA 4H9ZA 3LZ5A 3LGDA 3TAOA 1I60A 1W1A1 3W7QA 3QYSA 5T9CE 4WDWA 3MUZ1 2P0OA 3SRKA 2Z27A 1J0KA 2XH0A 4NNCA 4E2BA 3NL2A 5FF3A 1UROA 3AIRA 1XSIA 2MUCA 1EDGA 2QS8A 3PVFA 4P7LA 1POKA 2RJHA 3T0DA 1WAUA 4PMUA 2JBMA 4ZMGA 3CZJA 3UWWA 1MVYA 2VC5A 4EXQA 5LYRA 4E0CA 3T81A 1DJIA 4ZB0A 3VNZA 3M46A 3U2OA 5FESA 1IWPA 1UUMA 5FEPA 3OEXA 3WLPA 3KOZA 3EX4A 5HMSA 4WGXA 3O7UA 3O16A 4QITA 3S9ZA 1WKFA 3W7EA 5DY3A 4JQ4A 5AY7A 3SZ8A 1S3HA 4DBDA 2PWVA 4RNHA 2QYGA 2Z7KA 1SQ7A 1W9BM 1GEQA 2WNWA 3TWBA 2HVMA 1ZL1A 1Z69A 2D0HA 1XDJA 3AIVA 4ML4A 4FLSA 1B4KA 2NQZA 1UCWA 3UVIA 5A6KA 4L4MA 3QPZA 4HA1A 1YTDA 3WIJA 4PMDA 7ENLA 3QH2A 1YE4A 1L6WA 1DWGM 1SSDA 3KW3A 3LHUA 3P80A 4G5DA 3W84A 1BYBA 3LPPA 2GGEA 3QSRA 1EHAA 4IP5A 1XC4A 4UFLA 3HIJA 3VC6A 1JCMP 4LFYA 3UJ2A 1L6SA 6REQB 2VZUA 3E2SA 1ZJBA 2GPTA 2OGYA 4DJEC 4X63A 3LNMA 3S1WA 5FKYA 2IS7A 1HQTA 5C2XA 4GH3A 4AVFA 4PGLA 2FKPA 3LU2A 4I9JA 4AY7A 2YZRA 4ZO9A 2PA6A 5CAKA 3BAYA 4XSMA 7ODCA 4R33A 3AS1A 4JKLA 1F74A 2VCCA 4PTWA 2ALRA 4OE7A 3ZVHB 2CYGA 4LGXA 3W1RA 4CN6A 5K3VA 4JEJA 1XG4A 1SO3A 4QIUA 3VGEA 1XFBA 3LG3A 3R10A 4QAIA 1QUMA 3W2KA 4RE2A 4M3PA 1EUAA 3MYPA 3WNOA 2Z1WA 3GAYA 2J27A 4LRTA 1XRFA 4RPQA 3HJZA 4LCRA 4HU8A 2ZVIA 2G3NA 3SO7A 1KFBA 2AL2A 2RJGA 4R27A 1GT8A 4DZHA 3HPZA 4O19A 3PTMA 2VO5A 3MUXA 3B8TA 4HTBA 2OLHA 5MKGB 2Q02A 1IT8A 3ARPA 3SADA 2FMNA 4JTKA 1GUVA 1C92A 1VHNA 2DPEA 5M2FX 1QATA 4AFYA 1NVMA 2INFA 5IDIA 3HV9A 1OSEA 4XAFA 3I3DA 2BODX 4MIMA 3R1ZA 1OY0A 3QGAC 4LEQA 1P1XA 3TYUA 1R86A 1XYCA 2NSOA 3P5YA 5F4XA 1PTAA 4O14A 1E0XA 2HZGA 1UG6A 4PMVA 3THAA 3GG0A 3UCDA 2J88A 3TSBA 2WK2A 2WMFA 3UU0A 1KQZA 4M51A 4H3DA 1G4PA 2V2DA 2J24A 3MTWA 1BKHA 3CO8A 1MEWA 3N34A 5D32A 1QPKA 2GOUA 3WNMA 3NA8A 3UNTA 4C1NA 5D09A 4KS0A 4UOZA 2E6FA 4RJEA 3ARTA 4IFKA 3WLHA 4Z1DA 1J9YA 3YPIA 4XKYB 3PZUA 1NDYA 2P76A 3B9NA 2IPWA 3WJYA 3WDJA 3EB3A 2YBVA 4JTRA 3S5ZA 2HXUA 3SAZA 2P0IA 2V3DA 4JIQA 2XN2A 4KWSA 1NP2A 4FPSA 2X7WA 4H7ZA 1GCYA 3HGRA 5HNRA 4BZYA 2P3EA 2J7DA 1RV8A 4LTSA 1MRQA 4U4MA 3T7VA 4HU4A 4MY8A 1WKEA 4QEEA 1F3WA 4MNMA 3DX5A 2XIIA 1C9WA 3DG6A 3UJSA 1JPHA 3NPXA 3VMNA 4FF5A 4G8TA 2ZIDA 3TROA 1PIGA 3NFUA 2BP1A 3WNKA 2PEVA 2QVNA 4XIAA 5IFTA 1WB0A 1U30A 4OJYA 3OVPA 3OU8A 2VC7A 1QI4A 2YGYA 1DQUA 3GRIA 4NT0A 2E3ZA 2DSWA 2BZNA 3W70A 2VR5A 3CQJA 3A4XA 1XYMA 4PTNA 1SJBA 1VYRA 1JG9A 1R87A 3A9BA 1EHNA 4I6KA 3GSMA 3G1DA 1C7TA 1V4YA 3W72A 3N2MA 2EG8A 5JVLA 3BURA 1F76A 4H2CA 4NAEA 2QCHA 3D47A 3AHXA 4JCMA 5C5YA 2GGIA 1RP8A 1V0MA 5C6MA 1NF7A 1P0EA 3EMCA 1ZAIA 3HU7A 4JBRA 1LDCA 1JZ7A 3E6EA 4WR3A 3VO0A 5AHFA 1JJKA 1MQPA 4ADTA 1H4PA 5IM51 1WCGA 3QMRA 1LP6A 2CCRA 3PUOA 5DO8A 2WQPA 4NVTA 3N18A 1FCUA 3L4ZA 4Q8WA 2HNEA 3FS2A 1F6KA 4XZWA 3QN3A 3SM0A 2QZRA 3L2MA 1PKMA 3WX7A 1EDTA 4H4IA 1ZCCA 3POHA 3TYBA 1UC5A 2OO0A 3ZT6A 1VFHA 4QLLA 5BCAA 3BW4A 5BOFA 2V63A 4ORMA 2QF8A 4KFOA 2D0GA 1ONWA 3W7CA 3AZTA 4S38A 1ALDA 3ELFA 2VD8A 4DLMA 4WSHA 3AYRA 4YJ5A 4CU6A 1AFSA 2IQ0A 2QCCA 3WD1A 3MBDA 5T91A 2OYKA 5DANA 1HJUA 4Z17A 4MFDA 1YMYA 4R5EA 4ZL1A 3STPA 1XLKA 3IWPA 3PBUA 3ZVHA 3G77A 3NVDA 4A3YA 4C6CA 2NX3A 3KBJA 2P5NA 2XGBA 3G22A 3RIKA 3T0CA 4XBSA 1J0HA 4REQA 1KR1A 3PBMA 4J3VA 1VAHA 1TPFA 2H90A 2YOCA 1E5JA 2VTFA 5DELA 3IJ6A 4UZUA 5AC8A 5E93A 4DAFA 4AD1A 3NWRA 1XRSA 1KRAC 4FLRA 3BLOA 2DVUA 2EBNA 3W81A 5DXYA 1PX8A 2CXGA 3TSDA 1MXSA 1JZ4A 4GVHA 4GE8A 4Q22A 3GHUA 3XINA 4HN4A 5EYWA 5JIPA 1W5MA 2QHAA 3PB0A 1X6NA 2PDPA 2VCAA 2PDCA 4HBKA 3NZPA 3QKZA 2O56A 1PKLA 2WVSA 5AOUA 3VIIA 3N4AA 5ABFA 5I06A 2O7SA 1XIFA 3AXKA 1O5KA 4ZOCA 4G7EA 1ADOA 2NXIA 2WPBA 3IJLA 1VBUA 1Q6CA 1Q85A 3NO5A 3QMSA 4I6VA 2AQWA 2AQVA 4EKJA 5A8MA 2HBXA 5CBJA 5D8ZA 1Q6RA 2ZKMX 1E51A 3AIWA 5I3FA 2HRWA 1KKRA 4MZYA 1E55A 4NZ1A 2EPHA 3KVMA 4GXWA 4V1YA 4EK7A 3TW6A 4GCXA 3ME3A 3CT2A 3EOSA 1MWOA 3F2BA 4YS1A 2Q3RA 2PWUA 4QJ1A 2VFFA 3LQGA 5C7HA 3XIMA 2Y85A 3WQDA 7XIMA 4E8DA 3QJAA 2F38A 3F4NA 4WQ6A 1KM0A 3HQ1A 4KCWA 3ERPA 3CU2A 4GVGA 3OPSA 4ROPA 3VFLA 1XBVA 4NYUA 2XJ7A 2WLYA 3NM3A 2DT0A 2FGBA 2V68A 4WEVX 1FVPA 4AZ5A 3TTSA 4QNWA 4EPKA 1SJDA 4GQQA 3WLMA 4KIRA 4EPDC 3NGJA 4F2UA 3G1XA 1AJ2A 1H7OA 3ZR6A 1JDFA 1TTIA 3VGBA 3VIMA 5A6TC 5BRBA 2E1WA 3KXQA 2XFRA 4LUJA 3Q67A 1CTNA 2MNRA 4C6PA 4BWLC 1K4HA 1RA0A 2ODOA 4GFSA 4ZOBA 4S23A 4HB7A 4A3HA 2YKKA 3S4TA 3DFTA 4R34A 1IXNA 1ZBCA 2Y5JA 1T8XA 3WDIA 1H1ZA 4N9BA 4H9YA 4QX4A 1FUYA 3S1VA 3PAOA 1PYFA 3CTTA 1K9TA 2HBVA 3VOCA 3MSRA 4DO7A 5EFDA 1F4AA 1OHLA 4HKPA 1EP3A 5HANA 1BKSA 3OB8A 4EOUA 3QZ6A 3KVLA 3HQOA 3C2YA 5TAOA 4BQ5A 1T8QA 4LS1A 3W02A 4MLRA 3IJ9A 1WX0A 1CCWB 3OLEA 4KETA 4HN8A 4LNCA 3WFZA 3JUGA 3OTRA 1BSLA 2YA0A 3AZRA 1IT0A 1M1BA 2D0FA 1RQBA 1MZHA 1KFCA 4LRSA 4JS3A 3DGRA 4JFWA 3CL8A 3OZYA 1W1VA 2O9RA 4KEZA 1A5KC 5AVNA 3NO1A 3TXVA 1YRRA 3B06A 1QNRA 2RDXA 5DCBA 1UPMB 2B7NA 4F4RA 1C8QA 2OU4A 5E0KA 5BOOA 4M8UA 4W93A 2FDMA 3S3GA 1XYBA 1YDNA 3W7KA 1Q7MA 1T96A 1I45A 4LUTA 3N25A 1UD8A 5FJJA 3VZXA 3EYPA 1XYZA 2JKPA 1UD2A 4RCXA 1V6UA 4B2DD 5A6LA 1BGGA 1OG6A 4PUMA 5FF7A 4F0LA 3RG6A 3H24A 4RK8A 3L12A 3M07A 1GZGA 2G3JA 4ZBCA 2ZXDA 3A3XA 3ARQA 3RYSA 1WZKA 5H8PA 1GYLA 1ODZA 4N02A 2EHHA 3BLKA 4O16A 1DJYA 2V5LA 1VS1A 4C6LA 3GW3A 2VDIA 2CZFA 4KEMA 2UWFA 2E8YA 3UD6A 1BWKA 3IAPA 1H11A 1TV3A 3OODA 3WQOA 4GVFA 1E9IA 2W92A 3QW3A 4B5SA 3ID7A 4K36A 1RJRA 2Y7EA 1YTKA 2V30A 2X41A 1ITXA 5I79A 3AC0A 4IUGA 5CGMA 5A2AA 1ZB5A 3SIMA 3ARSA 3E38A 4OUIA 2NSXA 4R85A 5HMEA 1UZDA 4IPNB 1R0MA 1B30A 4X9YA 5C2GA 3K8LA 5BNKA 2CLMA 1ZSXA 1OVDA 3MY9A 3EAUA 1UZHA 4S3BA 1OX5A 3QTGA 1LZOA 1XIBA 3N9SA 1MNZA 3CZ8A 4HPHA 3SCQA 1A0DA 2WZTA 3R79A 1J0ZA 4FP1A 4L1GA 4R53A 3FXYA 2REQB 4IOTA 3THDA 3W1QA 1TKKA 1V6WA 2YDQA 3GBEA 1K6WA 4GACA 3SUUA 4FXJA 4ZO6A 3I6TA 4HZ8A 4QDMA 4DO4A 1F61A 3HPFA 1OM0A 1H1NA 1KTCA 1VH7A 1JZ6A 3KVKA 1XQKA 1L6GA 3RILA 1ZENA 2QCNA 2DZAA 2YCKX 1TJ0A 2FMOA 1D8CA 4DB7A 1B2YA 2AKMA 4O11A 1TWDA 4JTGA 4E4PA 2ZA2A 5F2GA 4UQ9A 3BLLA 4UNKA 5G5IA 4DWSC 1REQB 4PUJA 1AD4A 1E1CA 1KV8A 4HHLA 4X60A 2HTMA 1KD0A 4IP7A 2YXXA 3AMCA 3KAOA 4ZQCA 5G1TA 3VDHA 2DSUA 4EE9A 1A5MC 2E5DA 1TPWA 4R88A 2ON3A 3WDQA 2ESCA 4NJHA 1K70A 3GBDA 1OCBA 4U2ZA 2EJAA 1CECA 1UB3A 2DIKA 5A6BD 3R13A 1US3A 1IYXA 1ME7A 4DJDD 2REQA 3OGSA 4L1WA 2ACQA 1N2VA 4UTKA 1QDSA 3UVAA 3D46A 4REQB 4RV3A 2QF7A 3M0LA 4JYDA 3B9DA 1PX3A 1KGXA 3GKFA 2BASA 4M1RA 3FAWA 2OR2A 4JGDA 2J25A 1J11A 3GTXA 4PUDA 4W7UA 2DT1A 2Z26A 1VKFA 2EG6A 3ZJ7A 1DHKA 1NJJA 3DI1A 4NRRA 2HISA 1S2WA 2XIBA 4LB3A 2YLLA 1XWYA 3E12A 3SRDA 3GFXA 8XIMA 4QDWA 4C7GA 3PM6A 1V3IA 3THUA 2DSVA 5I3KA 2NVDA 1AJZA 1WKDA 5E9AA 2F6XA 4XX6A 3CM4A 1LLWA 4O0ZA 3UZYA 2XG9A 1VLWA 3GO2A 5MKGA 1UR3M 3EEGA 1FWWA 4E6MA 2Q71A 2C0AA 3KVJA 4XIMA 4TIMA 3VIPA 3C2RA 2GZXA 1OJXA 2FFIA 4N9EA 4JL1A 1X1OA 2C6QA 2V6AA 2C91A 3M0YA 3FA5A 2BWGA 2BS9A 2PGRA 2FB2A 3CJPA 3PPHA 1E15A 4IPPA 5HULA 1PCKA 4S39A 1Z48A 1W9DM 3A9IA 3W75A 3P82A 1TR9A 3EDJA 1YBQA 1JDDA 3UY7A 3N2TA 1CLVA 3BMWA 1XYLA 4NZFA 2E68A 4R7WA 1E1CB 1DL3A 3VAVA 1UZ1A 3GKAA 1XQLA 1HT6A 4DZAA 4PA8A 3R43A 5KZ6A 5DMMA 7CGTA 4I5RA 1UR1A 3ZXWA 1SMDA 1J12A 3UP8A 3MSYA 4EX4A 1YIXA 3DG3A 2OOFA 4NI3A 4ZQNA 3PBVA 1GVQA 4FNRA 1TV2A 3BAWA 2CLLA 2GVEA 3KCOA 4HCLA 4J35A 1Q6DA 1TCMA 4LS2A 1IXQA 3BAJA 4ML9A 1W1PA 3KZSA 3HG2A 4S3FA 4XAGA 1GVYA 1LM1A 1XKYA 3QKEA 3VIFA 3VX1A 1KGWA 4ZE4A 4M56A 4OOUA 4O15A 1VBGA 1CGYA 1RK6A 1Y65A 2BY0A 2R1LA 3W7MA 1G0CA 3BCDA 3DHDA 5HUOA 1B3XA 4NZJA 3S42A 1VYSX 3KUMA 4RUBA 1NARA 2QJJA 3DXIA 4Z2JA 2J9ZA 2GVLA 4XB3A 2WJDA 5EMUA 2VUYA 4JFTA 1EGMA 4MG4A 3C0LA 4RNJA 4D6CA 3N1AA 1LL7A 3WK2A 3JS3A 4DIAA 4EWJA 1S3TC 5JBFA 1XLAA 1WZAA 4HOZA 4ZFMA 1J2WA 4GJJA 3SY8A 2ZA3A 1H7PA 1OGGA 3R2GA 1BYDA 2WZIA 1VR6A 2OXNA 3FFSA 4P7NA 4YXGA 4J3UA 3IEBA 3GVRA 1RCXB 1YXCA 5FEXA 3W9ZA 2EPNA 1FWSA 1RPKA 1RBOB 5KZDA 1DJGA 3LA4A 1QASA 3RPMA 4U28A 1QI2A 1E70M 1VFSA 2O4MA 4RZ5A 3WD3A 4HMDA 3RN6A 2P3ZA 1FKXA 3KP1A 1TWSA 2VFHA 2G8ZA 4XAPA 2E8ZA 4XTDA 3A64A 3M6DA 2V3GA 3FDKA 1HJXA 4P5UA 2O92A 3SCRA 1C91A 4M6VA 4W9TA 2CBVA 2YCJA 3SECA 5JIWA 2ZRXA 5I6SA 4A2SA 3I10A 3K1DA 2ABAA 3USZA 4Q8UA 2PS2A 4GUFA 1EBGA 4UXDA 1XFCA 4XZBA 2AQOA 2PDIA 3W7OA 2FGLA 4V27A 2E4TA 3QBUA 3SRHA 4D6FA 4PRRA 4TV6A 1HXJA 3NGFA 2F61A 4JEQA 4AG0A 3D5HA 5FAGA 3UG4A 2XN0A 2PURA 1OC7A 3JRKA 1TTQA 4KKXA 4O1FA 3PZVA 1EJRC 1UKQA 3W2NA 1R9YA 1RLCL 1H49A 3CQHA 4OZOA 3FCPA 4JICA 2DUXA 2QT3A 1W3HA 1W54A 2J8FA 4F8XA 1WUFA 4NASA 2YBTA 2WM0A 1FBAA 2J7BA 3B0UX 2OGJA 1S5WA 5F1UA 4WLCA 3GDKA 3VKKA 3TN6A 1W1YA 4MKVA 3TN3A 1M6JA 1M7PA 1WO2A 4D6JA 5EL1A 1A4LA 4WXZA 2WO5A 1ENUA 1IV8A 2NUXA 4ZTXA 2J47A 1US2A 3GXMA 4F2BA 1DHPA 1JDEA 4CD7A 3A5VA 3OA5A 5KSWA 1XIMA 1TV7A 2C15A 5EMYA 2G4FA 3W29A 2NLYA 4HHHA 2W6RA 1B3VA 3L2IA 1EWEA 3A47A 1YPFA 4I3GA 3QTPA 4ZQRA 3M5ZA 3OVQA 1Q7QA 2OSYA 1P4CA 4EF8A 2YJQA 1N8WA 1TPEA 3P74A 3W1UA 4XO6A 4I8YA 5FF0A 4LNYA 5AC4A 4TR9A 1SZGA 4BCEA 3H12A 2VC9A 2E40A 4IMAA 4YHEA 4ZCWA 3C6CA 2YCLA 2DZPA 3TJ4A 3BJTA 5L9FA 3EB4A 2VVNA 3G0XA 1V02E 2WAGA 1W5QA 1FWIC 1TIWA 3VD9A 4MHBA 2BMBA 3BO9A 1T0OA 4RXFA 4WK9A 1L2UA 1ZALA 5HINA 1Q2SA 3FIGA 4UQAA 3FK4A 3S1GA 3ZZ1A 4PMNA 1XIHA 5BW6A 4N4PA 3QPYA 3BG5A 3P62A 1QTWA 4C6FA 4RDYA 5H1WA 3H2AA 3WSUA 3KP0A 4AD5A 2EJ1A 3UETA 2BHYA 3VDBA 1J6OA 1FWNA 1JFXA 1FX6A 5I03A 1BXBA 1TPB1 1R3WA 4O8AA 1ZCOA 1EX1A 5H8UA 1T7LA 3EDKA 2QIWA 1OIMA 4WRHA 4PMZA 2W63A 1XINA 3TJIA 4JIRA 2W91A 2PDQA 4QS6A 1U5JA 3TSMA 2PSNA 2TSYA 3R6IA 4UQCA 4N7QA 2P10A 3PSWA 2ZC1A 1VJSA 2I16A 5LSMA 1ZZMA 4LBSA 2WV8A 2WSYA 3DU0A 2ZRVA 4UNLA 1XYAA 2J8GA 3FXGA 5EMMA 2GL5A 2XIOA 3AHYA 1ZJHA 2I5GA 1GYMA 1W8GA 5LIWX 2ATMA 4DBEA 2IKGA 3IIVA 4QNEA 3ISIX 5LIUX 3BL3A 1X98A 2VYOA 4TMCA 5CGQA 2PDFA 4J27A 5CPMA 2ACRA 1ICSA 4EPEC 3V3WA 3AYVA 2QCEA 1V6TA 2PLKA 3EOLA 2ZZ5A 1QPRA 3MJMA 3U6WA 1Z7AA 3TFCA 3TC3A 2NX9A 1A5CA 1GEHA 1ITQA 3ZFHA 3TYZA 4GY7A 2YDSA 4XZIA 3K4WA 4AU0A 3AZSA 1GWJA 1CW2A 4PL2A 3RITA 1UKOA 3FW6A 4IFRA 3EOOA 3ZO9A 1VFLA 5D33A 1WE5A 1NDWA 4PRWA 3FKRA 4H9VA 3Q4DA 3WQPA 1E1FA 4PTVA 3KL3A 3AS2A 4WDTA 2ISDA 4IMCA 4DWDA 3B9AA 4F48A 2QPSA 3OYXA 4J1OA 3L65A 1HNYA 1H7WA 3LXBA 4WF7A 3LXCA 4AC7C 5U4NA 4DWSB 1SO6A 3CWNA 1CWYA 3TOYA 3CPGA 3BDKA 2YDRA 4UFMA 1RZMA 2W5FA 3K46A 2HROA 2QAFA 1Z42A 4P8WA 2A6LA 1NM9A 1LQAA 4TV5A 4YMZA 3D0CA 4JYEA 1IQ8A 5C55A 4RZBA 2J79A 1PL9A 1A0CA 2QUNA 3SUVA 2FVLA 3E96A 2WJEA 2RGLA 3BV4A 4ZQMA 4AZ7A 5CPQA 2NT1A 1ZNNA 3L4UA 3O1NA 1W9XA 3H2NA 5FSDC 1J6PA 1QK2A 3P8JA 2XZ9A 1Q6GA 4IG2B 3V1PA 4NJGA 4RDWA 2OFJA 2W9MA 3WBEA 5HJXA 4MZ8A 3TW7A 4D1IA 1MUWA 3URQA 4GG9A 2IW0A 3OZOA 1M41A 4LW7A 2OTDA 4NNAA 1UC4A 2POTA 1HIZA 2A4AA 4J3TA 2PDKA 4Q7IA 4L64A 1KRMA 2AKZA 4IPJA 3GTIA 3RX2A 1PE1A 3AXXA 2GUUA 4FS9A 3E0VA 4J2PA 3QHMA 3MHUA 4K8HA 2ISSA 4PTDA 3QQWA 1XP3A 3QR1A 4PUNA 2R1KA 2JF7A 3EX3A 3MC5A 4FI4A 4Q8OA 1EF3A 3BLPX 4UB9A 3TQKA 3FJ4A 2WHJA 1K8ZA 1VFTA 1UKPA 2VNCA 3E0IA 2DZSA 3VK5A 3CAKA 3DFSA 5JH1A 4O52A 4IIGA 4QAWA 4XG1A 8XIAA 1LYXA 2O9OA 1M7JA 2VCBA 3RM4A 4CU8A 1GW9A 3CH9A 3G0UA 4OUEA 3C8NA 5EFFA 1F8IA 3BJFA 3UPMA 3W28A 4PL1A 1MXDA 4ZA0A 5AHLA 1ISXA 4DJFA 1IR1A 4KCUA 3FYOA 4G56A 4HSOA 4C6JA 1W2VA 2G3IA 3GNDA 3VMOA 3RJYA 1QRQA 2HE5A 4Q4PA 5FA5A 2VD9A 1KCLA 3LBMA 3LRKA 4Y9NA 3T2OA 6XIMA 2HK0A 3N73A 4Z2HA 1T41A 3WEMA 2VL4A 4NYYA 3WMCA 2Y61A 4GHRA 1M9HA 4PN2A 2XUCA 2NWRA 4FEZA 1GONA 3DHPA 3TTOA 5FJRA 3VIHA 2FQIA 4NF7A 3EWXA 4UFKA 2HSAA 2ZXBA 5AYZA 3A4JA 3S2LA 1G7UA 5CZJA 1JPDX 1GJUA 3PUEA 5DX7A 1W3JA 1AW1A 4D8ZA 1YBQB 4WDUA 2BY2A 1S5MA 3LPGA 2O0TA 1RD6A 3C0QA 4NNBA 5DFAA 3VOJA 1K02A 4FX7A 4LCSA 1W3NA 4CNOA 3CTLA 2H9AB 1VPYA 2J7CA 3AAMA 5CPOA 2I7GA 3WBAA 2WYSA 1S38A 3EDEA 4D1JA 4UTWA 1V0LA 4GI4A 3WH8A 4XD4A 4GQBA 2DQWA 3CK5A 4AUBA 4MNKA 5LIYX 4JTEA 4E2VA 2PLJA 4CQCA 2WZMA 4R7OA 1EA9C 2D1ZA 4XAYA 5CSSA 1EO7A 1V3LA 4A2RA 3CB3A 4KF1A 3KLLA 3MBFA 3L4XA 3B3DA 1UIPA 3O63A 1ZPTA 2Y7GA 1KXHA 3OHMB 4U3CA 3GNRA 3GNOA 3K30A 4PH6A 1J0JA 1UP3A 2EKCA 2XSBA 3VOFA 1B3YA 3BANA 4AIBA 1X7FA 3F4CA 3GNNA 2ZZ3A 2XM1A 3H4GA 1UR2A 4KFNA 4DLFA 4D71A 5H2ZA 3H23A 5LGZA 4ZGYA 1O60A 1XCFA 4JTAA 3UXAA 4ERGA 1QI5A 3R7MA 2WJZA 1PDYA 3BVJA 3LHTA 4NG3A 3IGSA 2HS6A 2XU2A 4PZVA 1RVGA 3D3FA 4AZCA 2X0HA 5CZTA 5IHRA 4ZB2A 5HK4A 2QW5A 3LXAA 1ZBKA 3SSJA 1XW8A 1QNPA 1GGOA 2FTPA 3ABOA 1JR1A 1VYPX 1KLYA 4F2TA 1FXPA 3TUUA 4KWVA 4UTFA 3SQSA 4V2XA 4HYWA 3GDBA 1CGXA 2WHKA 4NU7A 1NDVA 2BXZA 4JTLA 5CPSA 3LCXA 4E5TA 4GD0A 3ZJ8A 1HL8A 3MPGA 2VEGA 1RLDA 4IISA 4PCNA 1G7VA 4HTYA 2BNJA 2F84A 1IZJA 3BLEA 2XYLA 3GTFA 2Q8ZA 3VMPA 5BWFA 1T6MA 3BOLA 2WCSA 4XD5A 4DWSD 3ZIZA 4NXKA 3AMKA 4K7VA 5CBIA 3K8KA 4YTQA 4DNMA 2DEPA 4S3KA 2OZTA 2JKEA 3WNNA 5A6MA 1XBZA 1OABA 1S2TA 3G3DA 2VQUA 1JYXA 4WUIA 2XIMA 2NW0A 4RDZA 1P6BA 4IZGA 3SJNA 1E43A 2CWXA 3QVQA 3BJSA 5D38A 1HL9A 4QJ5B 1H1YA 1KNWA 1LWHA 2QJMA 2XHYA 3W6YA 2ZTKA 1TE1A 1SUXA 4JFVA 2EPLX 4NY2A 3BGAA 4DBWA 2YL8A 1PJ9A 3VKJA 3G6LA 2AMGA 1E6NA 1BVZA 3EPNA 1KA9F 4KEUA 2YB4A 3VI2A 1QW8A 3VNKA 5CGTA 1LORA 3A4WA 3RX4A 1P7TB 4HJWA 3UJFA 1W1B1 4QLKA 2BOGX 3UCQA 5BXTA 3OQ8A 4NP7A 1OF8A 3QC3A 5M5DA 2CLEA 3L0GA 3V5FA 1IEWA 3DFQA 1JGIA 3L5AA 1FWGC 1HN1A 2XGZA 4E8GA 3LI0A 3PBYA 3DYPA 3NDOA 4PTMA 1EX5A 4C6QA 4PBEA 1CB7B 1GG1A 2DJXA 3LTYA 4Y96A 1O95A 1OYBA 4UMBA 5AKQA 4FX6M 4QCEA 4N0RA 4Q4OA 1O68A 1A5AA 1EC9A 3BH4A 4LV9A 1U22A 3LOTA 1S2CA 4ZXLA 3M7WA 3B03A 2VZOA 1V93A 4R7JA 2QCDB