3LHUA

Crystal structure of the mutant i199f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAFIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhuA00
1OYCA 3KOFA 4UR8A 2V81A 4WY0F 3TX9A 1F76A 1P0NA 1LTDA 3R5EA 2A21A 3EWYA 4K8HA 5G1TA 1RVGA 2VFEA 1OX6A 4LS0A 5H91A 1O5KA 3U6WA 1LDCA 3L21A 4IX0A 5FF7A 1ICQA 3DFPA 4YLWA 4O16A 4HSOA 4AHOA 4UTMA 1PVNA 3T4CA 1XUZA 4QJ1A 4YCOA 5EPDA 3TH6A 3GZ3A 1DKWA 2J6XA 2VENA 1ICSA 1KA9F 1P5BA 1ZNNA 1SZEA 1O94A 3UWUA 4O0ZA 5C6MA 2WSQA 2C15A 3SW6A 2OX1A 3NQ8A 3WJWA 3MI3A 5LSMA 3M43A 1VCVA 3EXTA 4WOQA 3TMLA 1R30A 5DCBA 3QMSA 4ONVA 1GVQA 1KM3A 3EWUA 4JXCA 3DZ1A 3G18A 3HPSA 3LV6A 4CLMA 1VCGA 5E93A 1W0MA 4JTKA 1TQXA 4O15A 1W31A 3W7IA 1ZALA 4BWLC 3GR7A 3P74A 5CZ0A 4NZFA 1ZAJA 3IIVA 3NDOA 4UTIA 2X1UA 1B57A 1XC4A 1XL9A 2GUUA 3HQ1A 3P60A 3NZRA 4PEKA 2Y7FA 3LI1A 5I3FA 1WQ5A 3W7KA 1YPFA 1OG0A 3TW6A 3EKZA 1FXQA 5CZSA 3PS7A 4LUJA 1EA0A 4HNVA 4MLRA 3N34A 3UY7A 4TO8A 1GT8A 3S1WA 2YDAA 3W1XA 4N6FA 1SW0A 5FESA 5KINA 1LCOA 4OBTA 2LLEA 3O6DA 3HF3A 1SW7A 3E0IA 1L6YA 2D73A 3NQ7A 1FWTA 1YADA 4AHPA 2NV1A 3W7JA 4H6KA 3NZ1A 1B9BA 1SZGA 3TJLA 1KFKA 1JRCA 4JYFA 1EP2A 4K7YA 2FLIA 2FPYA 1XBXA 3L5AA 4NJJA 3W1TA 4BK9A 3O8AA 3TC7A 3TUUA 2BZNA 2TSYA 1XKYA 3IIPA 3B0VC 3LLFA 2A5HA 1SSGA 4YMZA 1KM5A 2C1HA 2VFFA 3NQCA 1SQ7A 1UASA 2FTPA 2J9ZA 4QISA 4GUHA 1DV7A 4NT0A 4GRSA 1EX5A 1THFD 4FO4A 2YW3A 1MEWA 4FXSA 2CLMA 3N9SA 3TIMA 3HGJA 3TNOA 3UWWA 1OK4A 2R14A 1IXQA 1QFEA 4DO6A 4GUGA 3W2UA 3TDFA 3FLUA 2OT0A 1GYLA 4QM1A 2Y7DA 2EKCA 3A9IA 3JR2A 1RV8A 2VEPA 5AHEA 4PA8A 4NVTA 1I2PA 5AC8A 2CFFA 2QCNA 4CQ8A 1EP3A 4UTJA 4ORMA 4RZ4A 3UY8A 5IBXA 3GIYA 2CLKA 3TK7A 3G0SA 3HPZA 4Z08A 4WZHA 5F2LA 1SFJA 5BOOA 1FWSA 4PL1A 2B4GA 3PBWA 3W85A 5BMXA 2J27A 3HG4A 4CCEA 1VRDA 2EPHA 1OX4A 2CZDA 2RDTA 3LCFA 5HINA 4LV9A 4EOUA 4O14A 3GKFA 4IPJA 4LUIA 4JDBA 1AMKA 4O10A 3NQGA 3L65A 1VQTA 1C29A 4LY8A 5F4WA 1GVSA 1SO3A 3TW7A 1AG1O 5DXYA 3STFA 4WX2A 1MZHA 3NL5A 2Y62A 5LHEA 4RR4A 1TV8A 2ZRXA 3G1XA 1PCKA 2J24A 3H54A 2RH9A 3JRKA 1OYAA 3UZJA 1G69A 4UUIA 2AQWA 3GR8A 3MP3A 1I4NA 4OGZA 2QJIA 5F4SA 1VHCA 3EXSA 1DBTA 3G1SA 4XWUA 1NF0A 2QR6A 4FF7A 1FCQA 1OYBA 1W5PA 3M5VA 3NQAA 8TIMA 3NQ2A 5D32A 1SW3A 1R47A 4UC5A 3DFNA 4UTUA 1Z42A 2QEZA 2GQ8A 4QSHA 1LOSA 3TA6A 3B03A 3R2GA 4IOTA 3SFKA 4BI6A 2Y85A 1A5CA 1K03A 4TX9A 1LP6A 3GYEA 2E6DA 1QO5A 1KTBA 4JX4A 1KM2A 3T44A 2WSRA 3HG2A 3W7LA 1EPXA 2VFIA 4RLIA 3CTLA 3UWVA 1ZCOA 5I3JA 1FCBA 5KMYA 3UYCA 5D02A 3EEGA 5D09A 5FI8A 2ZA2A 3BPWA 3P80A 1JRBA 4Y8FA 4Z1BA 4O1BA 1KV5A 1XFBA 4XUGA 1GVFA 4FX6M 1T96A 5F1VA 3EB2A 3M6YA 3NPUA 4KKXA 3L66A 1PL9A 2ZRZA 1DORA 1CW2A 1SR9A 1NF7A 3TFXA 3EX3A 2KZHA 2QCDA 3SY5A 3BGJA 4Y6GA 1X1OA 4UMBA 4CNOA 4XKYA 1XBYA 5H2ZA 5BW6A 1W5MA 1U83A 5FEZA 3PWAA 2CLOA 2EF9A 5F2IA 2V82A 5DY2A 1OK6A 1VJIA 1TPVA 4X3ZA 1NFBA 5DBTA 4A21A 5LZLA 4UTLA 1C9DA 4PFMA 4UTHA 4U28A 1RZMA 3A21A 3G0UA 4AVFA 3VKJA 3W75A 1JCXA 1ME8A 1IGSA 5CPMA 3L68A 3W7DA 3W7HA 2Z2UA 5U4NA 3N73A 3KVMA 3P8IA 3DI1A 2YYUA 3NG3A 4KWVA 3LHWA 1RD5A 3EX6A 3R8RA 2CU0A 3NQFA 4UFJA 5K9DA 2ATMA 1O4UA 5HNRA 5G1YA 1ONRA 2ZRYA 3NPVA 1QCWA 4K8EA 4XTDA 1TMHA 2QUUA 1D9EA 3S8HA 1J4EA 4MFDA 3I65A 2TMDA 4ZZ9A 4ZQPA 1FCUA 2BX7A 1JR1A 3IGXA 4GBUA 1OFBA 2B7PA 2X30A 3INPA 4O1DA 3TR2A 4X2RA 4A29A 1S5WA 2EAWA 5U7SA 4ADUA 3QSRA 1VYSX 1UB3A 3LCHA 1GVOA 2CZEA 3PM6A 3RLVA 4RZ5A 3W9ZA 3LTPA 5D03A 2C3ZA 4LVFA 2B7OA 3DKLA 1VCFA 3WJXA 3LXCA 1S5TA 3F4WA 4ZQOA 3HG3A 2H3DA 4JD4A 1TPFA 2UV8G 5I3HA 4JYEA 3TE9A 2GPTA 2YSWA 1M7PA 5HWNA 3FS2A 3LRKA 3W1UA 3W2NA 3B04A 4CCDA 5CPNA 4TR9A 5EA9A 4DXVA 1ZAIA 3PR2A 3G24A 5BMWA 2V5LA 3NO5A 2ZZ1A 2FPTA 3QJAA 3MP5A 3DU0A 3ABRA 3BK0A 5F2GA 4O57A 1TPEA 1PE1A 4UTTC 3NR0A 3F1QA 2FJKA 1JUKA 1HO1A 4FNTA 4JN6A 3UXDA 2J9XA 3CHVA 2WNQA 3V75A 4S2CA 2ABAA 2TRSA 3GNNA 1ZY9A 4ML9A 4GWEA 4MZYA 2FPVA 2RHGA 1FDYA 2CLHA 4ZQNA 1OF6A 4R53A 2QJGA 5LNRA 3UWQA 3O07A 3MBFA 4N6EA 1QO2A 4JICA 1R46A 2PCQA 4LRTA 4UNLA 5SWUA 2ZRWA 4O0KA 3USBA 3PBVA 4H3DA 4JTGA 4MYAA 3R12A 3BV4A 3C3NA 1JCJA 3CT7A 5CPOA 4JY9A 3PC0A 3DAQA 4EF8A 1V7YA 1WDWA 3S1UA 3QFEA 3W7RA 1KV8A 1XBZA 2F7FA 3ABOA 4EWND 1GYNA 2Z6JA 3CM4A 3NQMA 4WJEA 1K7EA 1W37A 3GDMA 4O4VA 3QF0A 1EUNA 3M5XA 3LCLA 4K7VA 5GVJA 2WO5A 1RQBA 4UTWA 2ZRVA 2CLLA 3KVKA 2A7NA 3BARA 5HR6A 1V5XA 4RJEA 2A6NA 3NM1A 5D2WA 3Q2DA 5BRBA 5J5DA 3JS3A 1LLWA 3QRHA 3M5ZA 3G1HA 2VFDA 2XN2A 3W88A 1YTKA 3IVUA 1VGAA 3FIGA 2PRLA 2TPSA 4JYDA 1LLZA 3KHJA 1EUAA 3N2MA 3BW2A 5F1UA 4WOZA 2RKXA 1F74A 3C2RA 1FWNA 3O63A 1OHLA 3M0ZA 4E2BA 1IXPA 1KFEA 1M7OA 1LOLA 4LV4A 5HJLA 1PHQA 3S1XA 2ZBTA 1X1ZA 4I7VA 4AF0A 1GWJA 5CSSA 3WK0A 4IJBA 3LCXA 2WJZA 1XDLA 4GNJA 1QPNA 2H8XA 1GTHA 2C14A 1F73A 5FEWA 4FB7A 3MYPA 3QQ1A 3G0XA 5I3IA 1I8JA 1A53A 3KRUA 1QR7A 1IF2A 4DF1A 1YXYA 3S6DA 3C4UA 2DZPA 1LYXA 3P62A 2VEIA 3T40A 4WD0A 4NU7A 1FX6A 3SJ3A 4JTLA 2GQ9A 4Q33A 4POCA 4FNPA 4OHQA 3C61A 1K8XA 5AC7A 1OX4B 3A24A 4IQLA 3PB0A 4QIUA 3OIXA 2A7RA 3NL3A 4YL2A 3MMTA 5AHLA 4ALDA 1RQEA 3LTSA 4XQ6A 2Y7EA 3FYOA 2A85A 1D3GA 4JTSA 6ALDA 4DEFA 4NQ1A 3HPXA 3H53A 4R7JA 4M7TA 4DBEA 4JTJA 1EIXA 2VC6A 3QH2A 1NEYA 3W3OA 3KX6A 3QPYA 4AHQA 4DBDA 5D33A 1MEIA 3CU2A 2QCLA 3QW4B 3O05A 1TSIA 2QAPA 3QC3A 3MI2A 3FOKA 2G5WA 3L0KA 4ZQMA 2Y89A 2QDGA 3LCIA 4UMAA 2JBMA 2C16A 2ZQ0A 4TIMA 3TXVA 1FWWA 4JTIA 1K8YA 1ZHAA 3W2JA 1F5ZA 3WJZA 1GOXA 4LVAA 4UNKA 4AWSA 3SGZA 4NJGA 5ABTA 3ABSA 3QMTA 1TO3A 4AWTA 1TJPA 1SO6A 4FNQA 3W7PA 3UNDA 1G67A 3MYOA 3UD6A 1JCLA 5C2XA 4BR1A 2ISSA 3CWOX 1OVDA 4EF9A 4PTNA 2VELA 1KW1A 1K7FA 1HO4A 1TTQA 3G3MA 5FF3A 4AB4A 4O18A 5LHFA 3PG9A 1X6UA 3FKKA 1M5WA 5AYYA 3ZFHA 1W8SA 3O16A 3TQ0A 1KFBA 3W74A 4JY8A 5MHBA 2YX0A 2ZA1A 1W5OA 1DJNA 4JS3A 4UCGA 1PHWA 1MXSA 1JCNA 3N2XA 3R89A 3T55A 3S1VA 3WJSA 1O5XA 2A4AA 2X16A 3TKFA 4Z1AA 3DHFA 3LRMA 4YXGA 3CQ0A 2C0AA 3SSJA 3TV8A 3W71A 3G8RA 1TQJA 4IMGA 4JGDA 3TSDA 1GPWA 4HT3A 4IXXA 2GVLA 4N9BA 2GJLA 4BI7A 1K3UA 2QCDB 4MVAA 1TTPA 1VR6A 3TQKA 2AGKA 4XKYB 4UFHA 4X22A 1P0KA 1QOPA 2ZCGA 3WK2A 1GVRA 2GJNA 4CQ9A 1OFRA 3NXFA 3VNDA 3AO0A 4K37A 1WAUA 2YGYA 1KTCA 2F84A 3FA5A 3N3MA 1L6SA 3STGA 1QOQA 3GXNA 3BLIA 2CLFA 3I6RA 2ZRUA 4C1KA 1I2RA 4RXFA 4TMCA 3AJXA 4OQVA 1EWDA 1L9WA 3MHUA 1BKSA 1FQ0A 4MKNA 3VFLA 5IM51 2NZLA 3HMJG 4CQAA 1GG1A 3CWNA 1T99A 3NNTA 1Y0EA 3PF3A 4GJ1A 4FEZA 1I2NA 3W86A 1VPXA 4Y90A 2A1YA 4RK8A 1Q6OA 3BW3A 4MY9A 3T7VA 2GVJA 1VLWA 4N4QA 4NXKA 3TMQA 3DFSA 3NYZA 4WY0B 3SECA 1K7XA 4LT9A 4KFOA 1TCDA 5G2HA 3QMRA 5EY5A 3BG9A 5K9CA 4LTSA 4DO4A 3BG3A 2P0OA 5E1QA 1WBJA 2PC4A 3PBYA 4WXYA 3B06A 2HS6A 3L67A 3W87A 2WV8A 1TPWA 4PL2A 5D37A 3PSVA 1H63A 1VC4A 4XTIA 4CNPA 1QNVA 4XZ9A 3I7SA 3GKAA 3LHVA 3MO7A 3W07A 5CPLA 1UJPA 2B7NA 5FEPA 1G4PA 1IIHA 2BWGA 4IGHA 4WXZA 3U8GA 1HTIA 4JNMA 3S5NA 1LM1A 1VS1A 3PB2A 3LHUA 2CLIA 3MBDA 3VI2A 2H3BA 3S5YA 1T8XA 1XDMA 1ZJIA 5T26A 3W2MA 3EWBX 4GXMA 4LW7A 1TPC1 1LRQA 1W54A 4MZ1A 2PURA 4A2RA 2V2CA 1OFOA 3W1NA 4E0CA 3DKJA 2X1TA 2V5BA 3MW7A 1F7BA 2V2HA 4O53A 3BLFA 5DY3A 4FNUA 5FEXA 3V1PA 3W84A 3LI0A 3TXZA 4GFSA 3KAOA 3GXTA 4NXSA 4K38A 1H7RA 4ZL1A 1QWGA 1TPDA 4DPQA 1TV5A 4EVZA 1IIGA 2CZFA 1MO0A 2OCZA 3C2OA 3F4NA 2Y61A 1E51A 1KLYA 1OX5A 1Q6LA 4HHPA 4OV4A 3L0GA 3SGUA 5LKYA 1SZFA 4Y9AA 3QZEA 1PCWA 3GAKA 3DGRA 3N9RA 4KWWA 1OF8A 3Q58A 5A5WA 3MJYA 4MOZA 3G8EA 2BLEA 4M6VA 1FWRA 2NWSA 3C6CA 4FXRA 1UCWA 1QPOA 3MI6A 2ABBA 1GEQA 3W6YA 4ORIA 3QM3A 4PCFA 2CW6A 4MY1A 3WFAA 1K8ZA 4CNNA 3IGSA 1ICPA 1N7KA 3OBKA 2QCEA 4Q32A 3H55A 5TIMA 3UXAA 2ZZ2A 1N55A 4O12A 3STCA 5HWMA 5K4ZA 1TIMA 4LWWA 4N9CA 3LV5A 2DJXA 3ELFA 1ZFJA 5CZJA 3IV3A 1AL7A 3N14A 1A5SA 5K2ZA 3MUXA 1S5VA 3VE7A 2I9EA 2YW4A 3GX9A 3LXAA 1EWEA 5G2WA 1A5AA 2QCCA 4HKPA 4JTFA 4PC8A 5CKSA 1DOSA 4JR5A 2FIQA 3HGSA 1H62A 3THQA 2YCEA 3BVJA 3LRLA 1KM4A 4A22A 1KBIA 3QW3A 5D2TA 3DBPA 3TROA 5CGQA 1H60A 1SU5A 1KTNA 3PY2A 3L5LA 4AF0B 2Z1BA 1G4TA 1I2QA 4L4MA 3ATYA 5AC6A 2H90A 3BGGA 1IXNA 5J5RA 3W1AA 2DZSA 5EMUA 2WOQA 4O52A 3WJYA 4Z1CA 5C5YA 3GDLA 2NLIA 2R94A 3C56A 1O60A 3LCWA 1OFAA 2CWNA 2PRHA 2V8ZA 1YYAA 3PAJA 4DELA 1WXJA 2DZXA 3W23A 1TRDA 3E12A 3OHIA 4IMEA 2H6RA 2JGQA 4HNNA 3IEBA 1BTMA 5FF0A 3W22A 3W7EA 4NNCA 4N2YA 5DELA 3A23A 1QPQA 4I7WA 3C2FA 1XUUA 3W83A 4BI5A 1S3HA 3GLCA 4NX5A 3NGJA 3LHYA 1H51A 3E9AA 4UFIA 3EWXA 5TQLA 3GAYA 5E0KA 3RNDA 2A2IA 5G4EA 4P2VA 1Q45A 2YR1A 3BO9A 3OVPA 5FF2A 3DHDA 1H5YA 4C1LA 2P1FA 2ATSA 2PRMA 4R34A 3QPZA 3CIXA 2RFGA 1KM6A 1TPH1 2BTMA 1JQVA 5LNSA 4MZ8A 5K7JA 3LERA 1YXCA 3STEA 2DZVA 3Q37A 3T78A 2X2GA 4Z1DA 4DF2A 1WX0A 3SR7A 1VH7A 5DXXA 3M44A 3CLMA 4GUJA 4M6PA 4HPJA 4FIRA 4QQ3A 4CCCA 1LBMA 2ALDA 4E2DA 2GVGA 2VXNA 1Q6QA 1OFDA 3IVSA 3O15A 1LROA 1OFQA 1XCFA 2DORA 2DU2A 3F03K 1H1YA 2BSLA 3LTYA 1XM3A 3RFAA 2QUTA 4O28A 3TAOA 4H4IA 4JX5A 2GQAA 4MPQA 1F2JA 2G97A 3NQEA 1OABA 5D2YA 3GB6A 2G95A 3TQVA 3RLUA 1DVJA 2J88A 1J5TA 3OA3A 2O7QA 5D2XA 4TU1A 1LZOA 2FB3A 5AYXA 4UFMA 3BLEA 2X1RA 1SSDA 4P61A 1JCMP 3LB0A 2R91A 5AN7A 3UZ5A 5BNKA 2QCHA 3ZWSA 3MHFA 3UWYA 3RF9A 2QCGA 3G1AA 1TPUA 3K30A 1KM1A 3OVQA 3O1NA 2Y70A 3NL6A 5HUOA 1JVNA 3QQ0A 2P10A 2V0TA 1D3HA 2ZZ7A 4E38A 4QAIA 1C8VA 1FXPA 2E6YA 2E68A 4UMCA 4EIVA 3UPWA 4ZQRA 3FKRA 2H8ZA 4O1AA 1AL8A 1YDOA 5FF4A 2ZA3A 3CB8A 2WPBA 2E6AA 4LOCA 3S9YA 4DQWA 1U5JA 4FNRA 3GK0A 1VZWA 2A0NA 6TIMA 1VHNA 3NPXA 2NX3A 3I7RA 1M6JA 4O50A 3HJZA 4LU0A 3FJLA 3W7CA 4UTWC 3G1YA 4K6AA 2Y63A 4UTKA 1H1ZA 3W70A 4IX2A 3B4UA 3L5MA 4HPXA 3YPIA 3PBUA 2ZZ4A 1Q3NA 3HB9A 3FFSA 4K39A 4BWLA 3HGOA 1BEUA 1XBVA 5AYZA 1YDVA 3VCRA 2EGZA 2HS8A 5CZTA 3TC6A 1H7WA 4LS1A 5LNVA 3B0PA 1GJPA 4NJIA 4IMDA 1O95A 3I7QA 3LXBA 1H50A 1UBSA 1Z41A 4IUOA 2ZZ5A 3TU9A 3W1MA 2E77A 2OMAA 1SO4A 4G1KA 3C52A 1GQNA 2OJPA 3IIZA 3NQVA 5LGZA 1LRTA 2WNNA 4FX7A 4YWIA 4S2BA 2FDSA 2JK2A 4MJMA 1J2WA 3TAKA 1AW5A 5F2MA 2E5DA 4AAJA 1G7UA 1K02A 2J9YA 1TPB1 2DP3A 4LC8A 1GG0A 4O17A 1FCVA 2X1SA 3W73A 3ZR4A 4RCXA 3TSBA 1WYIA 3P7YA 1KFLA 3M7WA 4N4PA 3KRSA 1FY6A 3NAVA 4FHAA 2NXGA 4BF9A 5LNUA 3TCEA 3EX2A 2W6RA 2ISWA 7TIMA 1JJKA 3NPWA 1KFCA 1KLZA 1MSSA 5L6UA 3D0CA 2JKAA 3A5VA 3THAA 3NOEA 3DI0A 4WUIA 2XFWA 3GDRA 1W3IA 1Z44A 2E6FA 4K36A 2Y88A 4ICNA 4HNUA 4NJHA 4RKAA 3WK1A 5G2IA 4JX6A 5HR7A 3IVTA 3ZWTA 3RMJA 5K4XA 5L9FA 3RU6A 1YTEA 3P67A 3CEUA 1GZGA 3ZS4A 4LRSA 1ADOA 2HSAA 4O13A 5DBUA 1FDJA 4L4LA 3LHZA 1RR2A 2XN0A 3O6YX 1ME7A 2NXIA 3CC1A 4KFNA 1A5BA 1TV7A 3P61A 2VOMA 3NM3A 1SZNA 4LVGA 2WKJA 5EL1A 3W7GA 3NL2A 1LBLA 4N02A 1PV8A 4M7SA 4IPIA 2BXVA 1SO5A 1JCYA 3IIOA 2ZYFA 1X8FA 3A22A 5AHFA 4LNYA 3DFTA 2DZWA 3FYPA 2B7QA 2Q3RA 2I1OA 1KFJA 1EB3A 3PG8A 2NV2A 4RZ6A 5C55A 4LC6A 3R13A 2HMCA 3ABQA 4O54A 3M41A 3SI9A 3EKLA 1XXXA 1FUYA 3EXRA 4DPPA 1ZENA 2QUVA 2YZRA 5KZMA 2NX1A 1SUXA 1WA3A 3W7MA 4JTUA 4D2JA 4ZVJA 1HUVA 3PUDA 4X9SA 2EHHA 1QMLA 1LBFA 3IIXA 1LRNA 3WK3A 4LS2A 1UUOA 4IWWA 3PUEA 5KSWA 3N19B 1ALDA 3SZ8A 3BG5A 2VFHA 1TTJA 3BW4A 1XI3A 4RX0A 1FDZA 2I14A 3S0CA 2ZZ3A 3HGRA 4ZMGA 1H7XA 3P8JA 2QJHA 3G22A 1JQXA 5HWJA 2VEMA 3MWAA 3LGEA 3NA8A 4OWGA 3B05A 2AAMA 2A6LA 3W72A 5LGXA 2RDWA 4DO5A 3OEXA 2NWRA 3LX9A 2WQPA 3KRZA 1OJXA 3CPRA 4IXHA 1HFBA 2NXHA 1Q6RA 3C0JA 3P5YA 1HG3A 1YPIA 2V9DA 3HBLA 1NSJA 1NVMA 3OVRA 1RPXA 1W56A 4GE8A 1R2SA 5IBXC 2V2DA 1QDSA 1WOBA 4Z0SA 4DF0A 1CX9A 1BWLA 3EWZA 4I9AA 4AH7A 2QKFA 3LCGA 5D30A 3UWZA 3U2OA 5EBUA 2WSYA 2QF7A 5D2VA 1LORA 3MP4A 4B5NA 2VEKA 5EYWA 4RV8A 2A7PA 1TYGA 2Q8ZA 2YPIA 2FB2A 3B0UX 2NUXA 3O06A 5A8GA 3B8DA 3EX4A 4HSNA 4XBKA 4NX0A 3E96A 2YFOA 3HG5A 3M9YA 2CLEA 3G1DA 4O11A 5K9XA 1YXDA 1TJRA 2WNZA 5I3KA 2NX9A 4Q4KA 2C6QA 5CSRA 5G4WA 5AB3A 1F6KA 3W7OA 1FBAA 4JTEA 4S1FA 3C2EA 4LVDA 5AFDA 5AHIA 5G5IA 1BWKA 1F6PA 2IQTA 2QDHA 4GC4A 1VYPX 4IMCA 5TBOA 4O8RA 1I45A 4BFAA 3VE9A 4Z0JA 1W5NA 4MJZA 4QNEA 1ZAHA 3G1VA 1G4SA 1W3TA 5LNWA 3IRDA 3HOJA 3KVJA 2YYTA 3LBMA 4O1CA 3GDKA 1AW1A 1PS9A 3W1PA 3PVFA 1R2TA 4NNBA 2Y7GA 2FQIA 2PE4A 3DH7A 1SFLA 1EP1A 3HIJA 2FFCA 3TFCA 2JKEA 1GTEA 1LOQA 1PIIA 3UQNA 4A3UA 1WBHA 4HNTA 1VLIA 1CI1A 2CZ5A 3P82A 3PSWA 1B3OA 1DL3A 3W7QA 1H7NA 1T0OA 3MHGA 2DZUA 4JIPA 2ISVA 3FJ6A 1TRIA 3W1RA 1JULA 4UIOA 2ZZ6A 1AW2A 1DHPA 1QAPA 2W0UA 5KZEA 1EEPA 2ZTJA 1H7PA 2E5BA 3E02A 4WQ6A 2NUWA 2DZTA 4UFKA 1W5QA 3TJXA 3LOTA 1ME9A 4AXKA 4M5PA 2QCMA 3OG3A 1NAL1 4YCPA 3NQDA 3GVGA 3SIZA 1W3NA 5I3GA 2E09A 4R33A 3E49A 2ZTKA 1B4EA 3DXIA 4HN4A 4UR7A 5K3VA 3GDTA 3W7NA 4WY0A 1YLVA 4UTTA 3LBCA 1RQHA 3CIWA 4IMFA 4NZJA 5D05A 5HUPA 4NJKA 4AEOA 1A50A 3UPBA 1AK5A 4M6QA 4OV9A 4KFPA 3G1FA 5HQEA 2C19A 3NVTA 4OU1A 2Q8LA 1P4CA 1Z48A 4O19A 3I68A 5KTLA 4MFEA 3M47A 5DN1A 1UUMA 4QNWA 3L2IA 1YTDA 2HTMA 4JIQA 4RXGA 2GOUA 1DQWA 4O4WA 2NUYA 4MUZA 5HMSA 5KZDA 3S42A 5DCEA 3FEMA 4JEQA 3NEVA 4QITA 2Y6ZA 2E5CA 4I7UA 5DLCA 1X7FA 3C8FA 4TMBA 2ZDRA 3M1ZA 2V30A 1F05A 3GNDA 4MIMA 1KM0A 3ATZA 3G3DA 4FIQA 1TB3A 4MLJA 3Q94A 4OE7A 1R2RA 4OT7A 1I2OA 1SPQA 5KITA 1TTIA 2Z6IA 3LM7A 4PH6A 2JKPA 3QSTA 2TYSA 3M5YA 3DENA 4N9DA 4AMAA 4MY8A 1ML1A 4FNSA 2C18A 1OFPA 2R8WA 3DFQA 2W79A 4ADSA 1WV2A 3W1LA 3L9CA 2YXGA 4LVBA 3KVLA 3HO8A 3QYQA 4GUFA 1L6WA 2C13A 3C2VA 2OT1A 1P1XA 1W1ZA 3TSMA 5AHNA 1QPRA 4UXDA 5F4XA 2ZFAA 4UFLA 3QEZA 4JDYA 3P5ZA 4NUWA 1MEHA 2O7SA 2B0MA 3EX1A 5AHMA 1IXOA 3IGUA 5D38A 3DFOA 2XN1A 3O6CA 3W1QA 1WOAA 1L2UA 2YFNA 2Q3OA 3CEPA 4ZQCA 4FX8A 1DJQA 1HL2A 2DJLA 3W2LA 4A2SA 2JGYA 3ANYA 3LDVA 2G96A 2RDUA 1G4EA 2QAFA 1JUEA 1N8FA 2VFGA 1B4KA 2OZ0A 1G7VA 4NNAA 3EWWA 5HULA 1OFEA 1VYRA 3GXPA 3PUOA 4Y96A 3L0NA 3P84A 4U4MA 5C54A 4M19A 5D04C 4GUIA 3PULA 3KXQA 1H61A 1G6CA 5CG7A 3KFTA 3LHTA 2Z0IA 4W9TA 1DQXA 2QCFA 4MYXA 1H7OA 5EKYA 3M16A 3RK8A 1JUBA 4AWUA 3S5OA 1KBJA 2E1DA 3A5FA 3NQ6A 4HIBA 4J9JA 3W2KA 4XBSA 2VKZG 1TREA 4PODA 3LLDA 4JTHA 4JTTA 4N9EA 5AOUA 3P81A 4ADTA 5DCDA 3S5ZA 3W76A 1YDNA
chains in the Genus database with same CATH superfamily
3XIMA 2WZHA 3M0IA 2HNHA 1XRFA 4WY0F 4FP1A 3WMSA 1GORA 1LTDA 5A6AA 1PUDA 4JOMA 1L6FA 1QI4A 1KC7A 3FYYA 4WCJA 4HZ8A 1O5KA 3L21A 4IX0A 3D46A 2UY2A 4UTMA 2PDGA 4J3VA 4J2MA 1XUZA 4QJ1A 5CPSA 2FZBA 1MUCA 1VFUA 4X61A 1Q6GA 2VENA 1KA9F 1FOBA 3R25A 4KW2A 3UR8A 2WSQA 3R0DA 3JUGA 3V18A 4UOQA 2WLZA 3MI3A 2BS9A 4AIOA 4MNMA 4RW5A 7TAAA 4MKSA 1XQKA 5DX7A 2X05A 4EK7A 4ZEPA 3QMSA 1GVQA 4WVXA 3EWUA 4F3HA 3G18A 3AHZA 3LV6A 3QOKA 4GZEA 1EDTA 1W0MA 4LALA 1TQXA 4HSHA 4H00A 3W7IA 1ZALA 2VUYA 3GR7A 1NELA 5TD4A 4NZFA 3IIVA 3VVGA 5A2AA 1PTAA 1B57A 4QAWA 2WK2A 3WDQA 3GTIA 2Y7FA 3U48A 3W7KA 1RA5A 3LK6A 3SQMA 2QPXA 1OG0A 1EJXC 5CZSA 3VNJA 1GHSA 1EA0A 1OC5A 4ZFCA 3N34A 3MUY1 3CLWA 4TO8A 3PBMA 1GT8A 5FESA 4R5EA 4NI8A 3VDBA 2XDFA 1E55A 4FMVA 2C91A 3O6DA 5A6BD 1LG2A 3TOYA 1L6YA 4AZIA 1FWTA 1YADA 2ZOXA 4F66A 2NV1A 1POJA 1JD9A 1SZGA 3TJLA 1KFKA 4AD1A 4JYFA 1EP2A 3A6OA 1KQYA 4NJJA 4BK9A 2OOFA 1XKYA 2BDQA 3AOFA 2A5HA 3ARVA 1SSGA 1KM5A 4I8YA 3NQCA 1SQ7A 3B0XA 3W6MA 1XGEA 1DIKA 5JIWA 3JZUA 1RJQA 3VKCA 3QLDA 2BG5A 2CLMA 2XIOA 3QXBA 1AJZA 3LY0A 3TNOA 1OK4A 4AD4A 1RUSA 3OZYA 4KCTA 4WKFA 4DO6A 1K70A 3FLUA 4JIRA 2ZXAA 1C8YA 2EKCA 2DGAA 4FS9A 1DTUA 1GVEA 1EP3A 4LEFA 1NFPA 3M6DA 4L64A 1EBHA 2XVKA 4Z08A 1DQUA 2G37A 5HPOA 3MS8A 2B4GA 4UOJA 1H1NA 4JIEA 2PA6A 3AMCA 2J27A 4CCEA 1VRDA 2PDCA 1OX4A 4V2XA 3AIUA 2XHYA 2YL5A 4JBRA 4FOUA 3GKFA 3IAQA 3QGKC 1AMKA 6REQB 4LX4A 4H6QA 3NQGA 3L65A 1XIIA 1VQTA 1MWOA 2CBJA 2P88A 1JYVA 1AG1O 3STFA 1MZHA 3EBVA 4PBGA 3UYIA 5LHEA 2I7GA 1EIBA 1TV8A 2ZRXA 1E15A 4DJFD 1QK2A 1RD6A 3H70A 3FA4A 4MJ2A 4FK9A 1FTXA 4UUIA 1ITQA 5CEWA 2MANA 2CITA 3MY9A 3L23A 1IT8A 3QBUA 1VHCA 3IJ9A 1UD3A 4XWUA 2QR6A 1FCQA 1OYBA 4GK8A 1CIUA 2VR5A 4UC5A 3DFNA 4UTUA 1Z42A 2WXDM 3MANA 1CGYA 1WZKA 4EAMA 3WD0A 3OYXA 3OGRA 1YX1A 2HE5A 2PDJA 4B4HA 1A0DA 1A5CA 4H9TA 1K03A 1CEOA 3GYEA 4HMCA 3ISIX 4QEHA 4K68A 1JPKA 1EPXA 4JCLA 5D02A 3SIMA 3AXKA 1DE5A 4Y8FA 1C93A 3NSMA 1GVFA 3ZQ9A 3ARTA 4FX6M 2X0SA 1A80A 2ASHA 2JF7A 3M6YA 4CVUA 3GUGA 2J25A 1EDQA 3AFBA 1CW2A 1NF7A 3TFXA 4GVFA 3EX3A 3SY5A 3BGJA 3D47A 1X1OA 4CNOA 5A8OA 1TE1A 4XKYA 1XBYA 4G7EA 1Q6CA 4WEVX 1OK6A 1VJIA 4X3ZA 1EJSC 1H09A 1NFBA 3T2PA 2WCGA 3BMXA 3Q45A 4UTLA 4BF5A 1E0VA 2PDXA 3CZLA 3A21A 4AVFA 1Q65A 3L7RA 1IGSA 5CPMA 5U4NA 1XCWA 3N73A 3P8IA 3W38A 4S3FA 1O68A 2ZUUA 3EX6A 3R8RA 4DJDD 3RUBL 5I3DA 4UFJA 2INFA 3IJ8A 1R6WA 3NPVA 3L4ZA 3E0LA 1TMHA 4MFDA 2GGJA 3FXYA 1K1DA 2EJ1A 1TJ0A 1UZ4A 1MQQA 3GRIA 4A29A 4CNUA 2QQ6A 2FHFA 3QSRA 3LCHA 2CZEA 4HCHA 4RZ5A 3IK2A 3LTPA 4JTAA 4JFVA 3VINA 3N1AA 3ITVA 2Y8UA 2Q6ZA 7PTDA 3GQYA 2IS7A 2F2KA 3HG3A 2QF8A 2BY2A 4JL1A 1NDWA 5I3HA 3BJFA 4JYEA 3TE9A 3H2CA 1GZ1A 3U2ZA 1NDVA 1MXGA 4TR9A 2VC7A 4BQ5A 2VGBA 4MB3A 2OYMA 3G24A 4GY0A 3MQTA 4BJHA 4DBUA 3ABRA 5E9AA 5F2GA 1PE1A 5LA0A 5A8PA 3F1QA 1NTHA 3WH6A 2FJKA 1X97A 2WNQA 4IGMA 4CN1A 3SBFA 2PSNA 3DHPA 3I6TA 3BAXA 1XC6A 4JTCA 3PFMA 4FXFA 2CLHA 4U3CA 3QOMA 2PBOA 1XYCA 4ZE5A 3O07A 5DF0A 2BASA 4P8XA 4MNLA 2JE8A 5SWUA 4IH3A 2CLPA 3RG6A 1XLKA 2NVCA 2OGJA 4P7NA 4H9XA 3TYDA 3R12A 3BV4A 3HM7A 3B4YA 3CT7A 4RL3A 1ISXA 3GVWA 3QFEA 4Y2WA 4EWND 4QROA 3VIMA 3CM4A 4IISA 1K9EA 3M5XA 4ENLA 4K7VA 1BPLB 4LAKA 3H2OA 1RQBA 4CGTA 1Z89A 2OEKA 4XZLX 2A6NA 3NM1A 3Q2DA 5AYBA 5J5DA 5FA5A 1LLWA 3VNKA 2VR4A 4FOKA 3DOPA 3QRHA 3HQPA 5D8WA 1XYBA 4OUIA 1NWSA 3LPGA 2VFDA 3FVDA 5I09A 1PDZA 3CUIA 4DUVA 4W85A 4TX8A 5JBFA 1OHLA 3M0ZA 3N2BA 2IPFA 4IQDA 4RUBA 1LOLA 5CJ5A 1PHQA 1MMFA 4I7VA 4GLEA 4EP8C 1WZAA 1GWJA 3A4WA 4HU8A 3BJSA 3E2SA 2H8XA 3UA3A 2GDUA 3SCQA 1KGWA 5TF0A 5FEWA 3MYPA 3QQ1A 1UR9A 3G0XA 1Y65A 1OGSA 3VKKA 2XINA 4WDUA 1BKHA 3I4KA 3VM5A 1B3YA 5EB8A 1YHTA 3S6DA 3C4UA 1PKNA 3U57A 1WDPA 2VEIA 2ZC8A 4NU7A 3SJ3A 5T8GA 3DYOA 1F3XA 4JEJA 3UZYA 4W4QA 5AC7A 3NL3A 4YL2A 1ZBVA 5GQBA 1BSIA 3RO6A 3QV9A 2XGIA 4XQ6A 1UR8A 2A85A 4NQ1A 3H7VA 3H53A 4GNVA 3ZIZA 4QLKA 2EPOA 1FWEC 4DBEA 5I79A 1R7OA 4Y9PA 1JG9A 2B31A 3SADA 3QPYA 3DYPA 4AHQA 1MEIA 3AUOA 2PI6A 1OC6A 2VQUA 2FHBA 3CU2A 3RM4A 3FOKA 2Y89A 2JBMA 2VD9A 2ZQ0A 3FEQA 4IT1A 1ZHAA 2VR2A 1CGWA 3WJZA 4PCTA 2NQJA 4UNKA 5EFFA 4UQEA 4NJGA 3QMTA 3BC9A 1TO3A 3V5OA 4FNQA 1WZMA 2DUXA 1G67A 3BGAA 3MYOA 1QNQA 3WH7A 1MI3A 2PBGA 3SGGA 4EF9A 1OCNA 3RRAA 1VD6A 4RPPA 1KW1A 1TZZA 5FF3A 4ZB5A 3PG9A 1X6UA 3TZFA 1W8SA 2V38A 3QV8A 1VB9A 1ZJBA 2XM2A 3PZQA 1DJNA 4UCGA 4DWSA 1MXSA 3OJGA 1SJAA 1VFHA 4D6FA 2ISFA 1UD6A 1JCNA 3T55A 3F7JA 1E6NA 4R85A 5GJNA 4DM1A 2X16A 3DHFA 1WKEA 1JXKA 3CQ0A 3TV8A 5DMYA 3AMDA 4JL2A 4ECLA 3R94A 1PWLA 3BAKA 4BI7A 2R1MA 1VR6A 1CXEA 1C8QA 1GVYA 5GNYA 1P0KA 2ZUVA 2AL1A 1J0YA 3AO0A 2OLHA 2WCAA 1HXJA 2G3IA 1AVAA 1KTCA 2F84A 3FA5A 3N3MA 3OQEA 2XFFA 4JAWA 4AMCA 1W1TA 2VDGA 3BLIA 3MUIA 2HROA 1DTNA 4C1KA 1I2RA 4RXFA 5I24A 3TYUA 1L9WA 5EFDA 5JH2A 1FQ0A 4MKNA 1T99A 2HXUA 2REQA 2Z2BA 2PTDA 2XTKA 2A1YA 1Q6OA 4FPSA 2R1NA 3BW3A 1U1JA 2GVJA 1VLWA 3WUFA 3TMQA 3GW0A 4H6RA 1UA3A 1OD8A 5H6HA 2VZVA 1OCJA 2JIEA 2GYIA 4LT9A 3BXWA 5G2HA 3QMRA 3C0QA 5EY5A 1X1NA 4H04A 3DECA 3BG3A 2P0OA 3VCNA 2OXNA 3B0YA 2D0HA 2HS6A 2WV8A 1TPWA 2CERA 3CTTA 3TOPA 1YBQA 2IKIA 4AZHA 5D37A 4QG8A 1AZ2A 3K4AA 1CPUA 1JAEA 2BVYA 1UJPA 4UQDA 4W7WA 1HTIA 2ZICA 3PB2A 4ZB2A 2H3BA 2NV9A 2QGHA 1ZJIA 1GHRA 2VVNA 3W2MA 3DG3A 4DBWA 1HN1A 3SAZA 1TPC1 1LRQA 3N11A 1PWMA 1W54A 4B5UA 1P48A 4LB4A 2PURA 4PMRA 4E0CA 3DKJA 2WZTA 3V5CA 3UBPC 2V5BA 1F7BA 3BLFA 1UR1A 3FAWA 3CT2A 4GXWA 3RXZA 2WBGA 1XX1A 3GBDA 4GFSA 2BGSA 2WVVA 3GXTA 3IANA 4NXSA 4JIIX 4EVZA 1TV5A 5AC5A 2Q71A 1MO0A 3HTWA 3C2OA 4QLLA 3LD5A 4Y9AA 2Z2AA 3EA1A 3Q58A 4MOZA 2J62A 2BLEA 3RYSA 4GY7A 1AH3A 4A35A 2W4XA 1GOOA 1XIHA 2F61A 4D6JA 1GEQA 3GC2A 3T1GA 4IJRA 1OWQA 1UA7A 4PCFA 2QPUA 2IW0A 4DAFA 4ZOCA 4Q32A 5TIMA 4GOAA 3UETA 4S39A 4O12A 4N9CA 2YDQA 5REQB 1RY0A 2YA0A 1ZFJA 3ZLHA 4UQBA 4QP0A 1A5SA 1UQYA 1DJHA 1JF6A 3MUXA 3VE7A 3MSRA 3PZTA 2DPEA 2PTXA 3LXAA 1E4MM 1EWEA 4JPGA 2FIQA 1H62A 5I03A 1KBIA 1H41A 4NZ1A 5D2TA 3KM8A 3DBPA 1SU5A 1UIPA 4X0NA 3PPCA 1R7AA 4LCQA 5D9PA 1VFOA 1ESWA 1TA3B 4MM1A 3BGGA 3NEHA 4M0XA 4LBUA 3VIJA 5EMUA 1XPGA 3WJYA 2NLIA 1O60A 4LUTB 1UKSA 4ACZB 2XWEA 1AJ2A 2YOCA 4DELA 1WXJA 2CYGA 2ZVIA 1ZBCA 1P6WA 1TRDA 4GD0A 2QMKA 2RGMA 4OUEA 3AS2A 4IMEA 1BTMA 3SRKA 1A4MA 2VUNA 3WQDA 1EGZA 3ARUA 2PZNA 4I7WA 3W83A 4GXPA 4BI5A 1SVDA 3NZGA 4S38A 5BROA 4DBSA 3NGJA 5BXSA 3LHYA 1NP0A 3EWXA 4AZ5A 4PUMA 5E0KA 2A2IA 1UYQA 3WNOA 3D3AA 3BO9A 4J3TA 5FF2A 3LG3A 2VEFA 2R24A 3CIXA 3QPZA 1REQB 1TPH1 4MZ8A 5K7JA 2O56A 3KOWA 2QUMA 3AALA 3VD3A 1GEHA 2VMFA 4RW3A 3UJSA 1BD0A 2X2GA 1ECEA 3EPOA 4DF2A 1V6XA 1P6CA 4WSJA 3M44A 4KH2A 4GUJA 1ITXA 4HPJA 4QQ3A 2D3NA 1HJWA 2DT2A 2VXNA 4WLCA 2UY4A 1J18A 2XU2A 4GX9A 3BSGA 1BXBA 3O15A 1LROA 3C0LA 1H1YA 2ADAA 2BSLA 4B16A 1FH7A 2VD8A 4FSAA 3HV9A 5CC3A 2V5KA 2QUTA 1GW1A 4JX5A 4YYCA 2GQAA 1F2JA 4QG9A 2P8CA 5E5CA 1DVJA 2Y4SA 2J88A 4OZOA 4HA3A 2O7QA 2E67A 3EOUA 2DVTA 3BLEA 3E3HA 1SSDA 3LB0A 2R91A 4X60A 3HPFA 2HXTA 2QCHA 4EANA 1AQMA 3ZWSA 3EDFA 1R9YA 3G1AA 3H12A 4P8VA 4AZ7A 1JVNA 3GFZA 2V0TA 4C60A 4E38A 4QAIA 2FHCA 1R3RA 1FXPA 3KBWA 1E0XA 4ZQRA 4B9ZA 2IPJA 3WDRA 1AL8A 1XIEA 2ZA3A 3VCCA 4DZAA 3ITYA 4C6IA 1E71M 4NZCA 3NUKA 3S9YA 3IUDA 4DQWA 3AMGA 1U5JA 3VOCA 2A0NA 6TIMA 3S4TA 3NPXA 1M6JA 2C8NA 2V67A 1TUFA 1PSCA 1JZ5A 3N15A 3DEQA 4PTMA 4OECA 3KS5A 3B4UA 3L5MA 1UP3A 1WZLA 5MKGB 2Z00A 3OVGA 3HGOA 1XBVA 5AYZA 1NWRA 2WMFA 3WUEA 3B0PA 1KXVA 4IMDA 4NJIA 3SDOA 1G01A 4HU4A 4DM2A 2XSAA 1UBSA 3U4FA 2ZZ5A 1JZ7A 5D8ZA 5LGZA 1BYCA 2WNNA 4FX7A 3UP8A 4L6DA 4M8UA 1WCGA 3RX3A 2PLCA 1J2WA 3TAKA 2ACQA 2CIPA 5FD0A 5M1TA 1B9ZA 5M17A 3S2JA 2E3ZA 4LC8A 2G41A 1HKMA 3MSGA 4FAMA 4YVVA 1WYIA 3M7WA 1MFVA 5LNUA 2NXGA 3EX2A 4QXIA 2W6RA 1KLZA 3PJUA 3N4FA 1PZ2A 2QJMA 4X0VA 5L6UA 3A3HA 5I6SA 4WUIA 4JKKA 4C6FA 4ICNA 4HNUA 1CWYA 1JFXA 2BNJA 2POTA 1HT6A 1R3YA 5DO8A 3CQHA 3RMJA 3GE7A 2R9RA 1E4LA 1N8IA 3MU7A 1RK5A 4WDWA 3CL6A 3P67A 3C8NA 1M1BA 4WGHA 3ZS4A 3ZR6A 3WFZA 4PRWA 5DBUA 4L4LA 3LBOA 1CGVA 3O6YX 4ZCWA 4B5VA 1AODA 1A5BA 3P61A 4GI6A 3L4TA 3W7GA 3KE0A 4YHEA 2PWGA 3GU1A 1E0TA 1YPXA 5LA2A 3GU9A 4NZ4A 1W8GA 1X8FA 5A69A 3LEPA 4LNYA 3IAPA 3NVDA 2DZWA 3QN3A 2PF8A 1Q7QA 3ONCA 2B7QA 2Q3RA 4I9MA 5KETA 3PG8A 2YA2A 2CZVA 4C1NB 2X1IA 4ZSUA 3P2VA 3N2CA 4HA1A 3ABQA 4O54A 2X2YA 3SI9A 3OBEA 3EKLA 1FUYA 2O4MA 2QUVA 4NAEA 2VT0A 2NX1A 1YNYA 3W7MA 1PJ9A 4JTUA 1G94A 1L6GA 3LSBA 4G5DA 4AFYA 4ZVJA 1HUVA 3BAJA 3MC5A 4X9SA 3BZJA 1QMLA 1LBFA 3WK3A 1UUOA 3EOSA 3RPTA 5KSWA 4GGBA 2AOSA 2VFHA 3WYZA 2VJXA 4RX0A 1JZ8A 5B7YA 1ZJAA 2VCAA 3NIYA 4ZMGA 3WDJA 3IJ6A 2C71A 1GQJA 3G22A 1NDYA 3KL3A 4GYPC 3MMWA 2AAMA 2A6LA 3MDUA 5ABGA 4D8ZA 4PB5A 2RDWA 3OLIA 4C91A 3OEXA 2INEA 3CPRA 4IXHA 1HFBA 5FIPA 3OYZA 1HG3A 1YPIA 1XYMA 3HBLA 3MVTA 3OVRA 4PMVA 3PTKA 1R2SA 3EDJA 4PN2A 1WOBA 2OEMA 3EWZA 4AH7A 4CQBA 4Q8NA 1RLCL 2QKFA 3UWZA 3N9KA 2XUCA 1JIBA 1LQAA 3CK5A 2VEKA 4X9YA 2A7PA 2YPIA 4GGHA 1U22A 4KCVA 2NQZA 3KLLA 4RNHA 5IXEA 1A3HA 5DANA 1I1XA 4XBKA 3BOLA 2D2JA 3CO8A 3ABXA 3C5QA 3MSDA 3H2NA 5FJPA 3FW6A 5K9XA 3WCZA 3TW9A 3H2MA 3ZO9A 3GFYA 4Q4KA 2RUSA 3CZJA 3TJIA 1N8WA 5AB3A 1F6KA 2VYOA 3R8HA 1A49A 4ZSTA 1UHVA 2VWTA 3CGTA 2DUAA 3CH9A 3PPHA 4IICA 4GFIA 2BHZA 4IIEA 4I9TA 4GC4A 3VKDA 3KTXA 5TBOA 3HQOA 4JTQA 3BL3A 1KBBA 1VFFA 4QJ5B 1FWBC 4MJZA 2WC4A 3ZJ8A 4AIEA 4XAGA 3H21A 1XLEA 4UTFA 1ISWA 3RAOA 1Q7ZA 2I57A 3KVJA 2YYTA 1E6PA 4L9XA 1BG9A 1M7XA 4NNBA 2BV9A 2FVMA 3HIJA 5DRIA 2JKEA 1BRLA 2DIEA 3KBJA 1LUCB 3WEZA 3WL1A 1PIIA 3UQNA 3TTQA 2ALRA 3WF0A 1CI1A 5HA7A 2EBNA 5HXMA 1R3TA 1J9YA 2DZUA 4JIPA 1TRIA 4UIOA 4KIRA 1QAPA 2W0UA 2G3NA 3TTEA 1EEPA 5KZEA 2ZTJA 1H7PA 3E02A 4WQ6A 2YXOA 1JPHA 4M5PA 4AXKA 2OLSA 1EXBA 1NAL1 4C6LA 5CZKA 3PZVA 3E49A 2ZTKA 1B4EA 4OKDA 5LIUX 1IR1A 1KO0A 2GK1B 3CIVA 1J6OA 5K3VA 4H7VA 2HVMA 2ZXBA 3H2FA 1K9TA 4IMFA 3DGBA 4F2UA 5D05A 3S83A 3UG5A 1ECQA 2ZVRA 1RJRA 1R3VA 1W2PA 5LIWX 1AQFA 1HKKA 4J35A 1A50A 1I75A 2VCBA 1AFSA 2GWNA 1FWHC 3AZSA 2Q8LA 3I68A 5KTLA 5DN1A 1RP9A 1RAKA 3E0VA 4DJEA 3WFLA 2VRKA 5JVLA 1PDYA 4FOJA 3ITCA 3VX1A 3FEMA 4S3CA 4JEQA 4JCMA 4QITA 4UB9A 5DLCA 2J66A 3VZXA 2PTYA 2OELA 3C8FA 3WLKX 1JDDA 1MDLA 1F05A 3JZEA 3VZYA 1TB3A 4OE7A 3SCPA 3CMFA 5KITA 4YIWA 2Z6IA 2OG9A 4PH6A 4AY8A 3QSTA 3M5YA 1K4GA 3DENA 4AMAA 1OCBA 4MY8A 1ML1A 1ODZA 4ZO6A 1OFPA 1GZJA 3M0KA 1WV2A 3L9CA 2V63A 3LPOA 3MUAA 4LVBA 2PWFA 1T5AA 5FACA 1K6AA 3C2VA 2OO6A 1W1ZA 3TSMA 4FLRA 2PZ0A 1QPRA 3ITOA 3VGBA 3UCQA 2ZFAA 4JDYA 3P5ZA 1US3A 4BEUA 2BXYA 1VEMA 3EX1A 4XAFA 3IGUA 7ENLA 5D38A 3VD9A 2XN1A 1XKJA 2YFNA 4H7CA 4MWAB 3ANVA 2TODA 1WUEA 4FX8A 5I5RA 3WX7A 5I02A 3BCFA 1B90A 1N8FA 3POCA 3BH4A 1BLIA 4F4RA 3FHAA 4IPLA 1X98A 1P0EA 4IIDA 3DG7A 3NDZA 4PEEA 1HJUA 3PUOA 1ZP4A 5A6TC 1CLKA 1EYEA 2Z0IA 1ZBWA 1H7OA 3RK8A 1VFLA 1AH4A 3ZT5A 5FJTA 3ZJ6A 1RPKA 4CN4A 4HIBA 2GFTA 4XBSA 3W2KA 4NI3A 4PODA 1D3CA 3VGEA 1XS2A 5AOUA 1O12A 5DCDA 5E6YA 1VRXA 3LSCA 1YDNA 7REQB 1V02E 1KXQA 4XBJA 3SY8A 4UR8A 4CQDA 1S5MA 4GINA 4K8HA 1RVGA 2VFEA 1I60A 4HOWA 3ES8A 4QGCA 5IRPA 5LXEA 3U6WA 1LDCA 5FF7A 4YLWA 3RLHA 3E6EA 3KP1A 2XIBA 4LUTA 3T0TA 3VTRA 4G8TA 5EPDA 1DKWA 4QJ4B 1I1WA 4GO9A 2WHMA 2BXZA 1SZEA 4EXQA 1B3XA 2YBTA 4DUOA 3K2GA 3UWUA 3MUZ1 3IS4A 3QY8A 1JDCA 4PMDA 4PMZA 4PBEA 4UNIA 3EXTA 4RDZA 2Y8KA 5CAHA 1E1CB 3S2CA 1UC4A 1G5AA 3E38A 4ONVA 5D9NA 2GGEA 1KM3A 1RSCA 4CLMA 1E6QM 1PAMA 5HPCA 2HVNA 1P43A 5E93A 1W91A 2ZUNA 4O15A 2NVDA 4MTVA 2J7GA 3FDKA 2VDIA 4BHYA 3GU2A 2VDHA 3LNMA 3TYCA 1ZAJA 1DYSA 2X1UA 3SO7A 4J3ZA 1XC4A 2GUUA 1SR0A 3HN3A 3HQ1A 4PEKA 3LI1A 1IEWA 2WJEA 1WQ5A 1V02A 3W26A 3PZOA 3SUTA 4N7QA 3TW6A 2VO5A 1FXQA 3WEMA 4L5ZA 3PS7A 4MLRA 1OIMA 4NHVA 3ZT7A 3UJFA 3W1XA 4N6FA 1LCOA 2PC8A 3HF3A 3E0IA 3NQ7A 3U4AA 4H83A 4MF4A 2BY1A 1B9BA 3GTXA 4K7YA 2X42A 2FLIA 2PEVA 1FKXA 3TUUA 4JNYA 2BZNA 2TSYA 3IIPA 4DJDC 4Z2KA 3LLFA 4YMZA 1VPYA 5A6LA 2VFFA 2FTPA 4GUHA 4NT0A 1A4LA 4GRSA 1EX5A 1THFD 5JU6A 1XIGA 4FXSA 4PMJA 3N9SA 3SN4A 3TIMA 3HGJA 2HDJA 1IXQA 2G0WA 2EJAA 3SUUA 2OT0A 2C1IA 3REQA 2VEPA 3GG1A 4NVTA 1I2PA 5AC8A 2CFFA 4UTJA 1J0KA 3O3RA 3BLDA 2F6UA 5F2LA 2I16A 4Y7EA 4PBFA 4C6KA 3ME3A 4FF5A 3W85A 2V3GA 2HK1A 4IFKA 2C7FA 2CZDA 3OLGA 3LCFA 4WDTA 1ONEA 4ERIA 3RCNA 4IPJA 4NKCA 3K13A 4O10A 2BMBA 4UCFA 1C29A 1Y5WA 3M0JA 1SO3A 3MMUA 1Y8BA 3KOXA 4LUSA 2NVAA 3I10A 3TW7A 5AVHA 2IXUA 3S6OA 1JD7A 3URBA 1HQTA 3OODA 2WMGA 1MXDA 2RH9A 2WAGA 3JRKA 3MV11 1M68A 2UY3A 3B9DA 4ZB0A 2F6KA 3MP3A 3PZMA 1DWHM 1I4NA 1DIOA 1Q5MA 1WB0A 3WL0A 5F4SA 3UVIA 3JU2A 4ZOAA 3EXSA 4XV0A 4I3GA 4C5YA 1MDRA 1NF0A 4FF7A 2PTZA 1W5PA 1QBBA 8TIMA 5D32A 1W9PA 1R47A 1GJUA 1ENUA 2QEZA 2GQ8A 3TA6A 4W88A 3T6CA 4F0KA 1TX2A 4IOTA 1Z3NA 3R0KA 3SFKA 3AMKA 1A5OC 2Y85A 4TX9A 8CGTA 1LP6A 1VBGA 3THUA 1PIGA 4JX4A 1QI2A 1KM2A 3A64A 4L65A 4XZNX 5IDZA 2WSRA 2DDXA 4F79A 5IHSA 1ZCOA 5I3JA 4I9JA 1A5NC 2Z28A 4MNKA 5FI8A 2ZA2A 1KCXA 3BPWA 5ABFA 3P80A 4O1BA 1KV5A 1NQKA 1G0CA 4XUGA 2QNEA 4C6OA 2ZX7A 4H9MA 2BODX 3NPUA 3L66A 2WNWA 1PL9A 2ZRZA 1DORA 3V3WA 3VZZA 5G4HC 1HZYA 4M3PA 1SR9A 3VAVA 3QY6A 1R85A 1UR4A 4HHLA 1BFNA 4JQ1A 4UMBA 5C0QA 1XG4A 5BW6A 3PNUA 3WD4A 5E0FA 3VGHA 4LFYA 1E6SM 5A8NA 2IMRA 3DFHA 3LPPA 1LL6A 2VZTA 4EXAA 1PX8A 4R3UA 2WSPA 1RZMA 4YVPA 1KGXA 3OP2A 3W75A 1RBAA 1ME8A 3W7DA 3L68A 2Z2UA 3E2VA 4C6PA 1J0IA 3UA4A 3M0MA 3M4HA 3BUVA 4S3JA 2GLKA 4P7OA 4E8GA 2YYUA 3WZ0E 3RX4A 3LHWA 1QNSA 1CYGA 3H26A 2CU0A 3H4WA 3PZ9A 3L4VA 3TTSA 4D6CA 2V3DA 3N25A 1ONRA 2ZRYA 2PU0A 2GQ3A 2QUUA 2HJPA 1J4EA 3I65A 3BAYA 3W00A 3FN9A 1UPMB 4ZQPA 1DWFM 1OFBA 2X30A 3INPA 4O1DA 4C6CA 4X2RA 1W9UA 1S5WA 2QS8A 1O5RA 1UB3A 4Z2GA 2D69A 4DWSD 4PTVA 2B7OA 1JNEA 1VCFA 2WKLA 2YXXA 4REQA 4S23A 3LXCA 1S5TA 2AKZA 3DCPA 3F4WA 1KCZA 1IT7A 4LYKA 1XH1A 3C2YA 1R0MA 2ZDSA 1OGGA 3VILA 1E6RA 2YSWA 2VRQA 4JQ3A 1GQLA 3W2NA 1QNPA 4H8UA 4CCDA 3AQUA 3TONA 5EA9A 4AVOA 3OPSA 2RGLA 4D8AA 3SQSA 4JKLA 5BMWA 3VYLA 2OVLA 1PYFA 3DU0A 4H7ZA 4PFHA 4O57A 1NDZA 4F9DA 1TPEA 1GCYA 1RBOB 1R86A 3MUCA 4GIAA 2W62A 4ZO8A 4IQJA 3UXDA 2J9XA 4DYKA 1AD4A 3SQLA 3NO3A 5GNZA 3O2LA 1OZQA 3GNNA 1JF5A 3COTA 3AIEA 1TMLA 2QT3A 6A3HA 2GOKA 2RHGA 4DI9A 4ZQNA 4GH3A 1KR1A 1U5VA 4R53A 1GKRA 2QJGA 1XGDA 4HHMA 1ITUA 3MBFA 4N6EA 1KFWA 4N0RA 3RMEA 1QO2A 1DWAM 4JICA 4UNLA 3HV8A 1E70M 1XLFA 4O0KA 1EOKA 1R5YA 5HOSA 2DH2A 3B8TA 2G3JA 2HCVA 4TX6A 4Q6XA 4XK2A 3DAQA 1V7YA 4XZHA 1CENA 3S1UA 3G2GA 3W7RA 3VUPA 1I0DA 2F7FA 3ABOA 1VFTA 2WM0A 3RM9A 1ONWA 3GDMA 3QF0A 1EUNA 1TUXA 1VIWA 3LMYA 4Q4PA 1SMAA 3LCLA 2PODA 1LUCA 5B80A 3IGHX 1I9CB 5GVJA 2WO5A 4GKLA 2J78A 2J47A 2ZRVA 2CLLA 4BY3A 2J8FA 1H5VA 3WQVA 2DT3A 1YKWA 3T8QA 4HVXA 4UQ9A 1YDYA 1LWHA 2EKGA 2A3EA 4QEEA 3RX2A 3AYSA 3IVUA 1AMYA 3FIGA 1IV8A 3AHYA 2RDXA 5FJOA 2Z29A 2TPSA 3TLQA 3KHJA 3N2MA 1EUAA 4WOZA 6ENLA 3O63A 5MF5A 1KFEA 3RO8A 5HJLA 3Q65A 3S1XA 2PWHA 2ZBTA 1PKLA 4GYFA 3KCOA 4AF0A 4MWAE 3LCXA 7A3HA 4U2ZA 1QPNA 4J28A 1GTHA 4IUGA 4GC3A 2C14A 4EX4A 2Z26A 1NQ6A 1MW3A 3KRUA 3KDOA 1C91A 4ZO9A 2OSXA 2D2OA 3QR1A 4DUWA 4F40A 4FNPA 4D6HA 3C61A 4LNCA 1OX4B 3U9IA 3PB0A 4QIUA 3AIVA 3QKEA 1ZP3A 1XRVA 3R58A 3MMTA 2D20A 3PJWA 2Y7EA 2IKHA 4DNHA 2AGTA 1H0IA 5C9UA 1V6YA 5FJUA 2E8YA 4M7TA 1EIXA 2VC6A 3FSTA 3W3OA 2AL2A 5I2UA 2QV4A 4DBDA 3ZYZA 3EWCA 3QW4B 3GVQA 1MUMA 2QAPA 3MI2A 2G5WA 2QDGA 2X7VA 3WMLA 2Z7GA 2IPWA 3TXVA 3KBSA 4D1JA 3W2JA 1F5ZA 4US6A 3G5EA 1Z7AA 3WF1A 5ABTA 4AWTA 1SO6A 3WSUA 3UFYA 1M41A 3MVIA 4AVNA 3CV2A 5ECUA 2VURA 1JCLA 5C2XA 4BR1A 1LT7A 4E8DA 1OVDA 4XX6A 2E28A 4MWAA 1K7FA 6CGTA 4GZ7A 1HO4A 1TTQA 3G3MA 3QR0A 4AB4A 1OT1A 3FKKA 5AYYA 3ZFHA 3W25A 3TQ0A 5MHBA 4JY8A 2VX7A 1AZ1A 3M0VA 2O55A 4ZFMA 5BU6A 3N2XA 3R89A 3S1VA 2ZX5A 3WH9A 2A4AA 2QVHA 1L0PA 5XINA 4F0SA 1BQGA 3LRMA 4DYJA 3AIQA 3CMJA 3SSJA 3W71A 4IMGA 4JGDA 3K1GA 1VFSA 3TSDA 4IXXA 4N9BA 4H41A 3QQWA 1VEPA 3WLNA 1K3UA 4KEZA 3H7RA 3C0SA 1P0BA 4LUYA 2AGKA 4XKYB 4IIFA 3GFXA 4X22A 1QOPA 4G7EB 1GVRA 2GJNA 4CQ9A 1OFRA 2VHLA 4K37A 1WAUA 2PS2A 1RXOB 3WQ5A 1L6SA 4UQAA 2VX5A 3GXNA 1J0ZA 3ARWA 3I6RA 4PE8A 4KERA 4M56A 5J8LA 3CQIA 3EZ4A 3WQOA 4A3QA 5AZ0A 7ODCA 4B91A 4OQVA 1EWDA 2FFIA 3MHUA 4GIRA 4HA0A 4B2DA 1GG1A 4RDVA 1TVNA 4XSLA 3NNTA 3PNZA 2DSZA 4GJ1A 4J2PA 1PXGA 3EB4A 3W86A 1VPXA 4Y90A 2EXOA 4PMXA 3T7VA 5CBJA 1U33A 2DSVA 5D9MA 1H11A 1TJ2A 1E43A 2X8RA 2FDMA 1K7XA 3FJNA 3BV7A 1UKPA 2XZ9A 5M3WA 1NARA 1Q7MA 1ONXA 5T9CE 5K9CA 5IHRA 3CQKA 5E1QA 2RJHA 4JNZA 4FLQA 3L67A 2ACRA 1E1CA 4BQ3A 4PL2A 3T9PA 4MNJA 1H63A 1VC4A 5CQ1A 1SFSA 4F2TA 4B5WA 3LHVA 3W07A 3OW1A 5CPLA 3ITXA 5FEPA 5LA1A 3KLKA 1G4PA 3U8GA 2BWGA 4JNMA 2W5FA 3LHUA 3K4WA 2AQVA 1VBRA 4J3SA 4F9JA 5C7VA 4B90A 3TJ4A 4MZ1A 3GD6A 5AECA 4A2RA 1WDSA 3WN6A 5DEZA 2X1TA 3MW7A 4HK6A 1FP8A 4O53A 5HNUA 2I9UA 4K1GA 1XV8A 1S1RA 3VIHA 1GOQA 4MG4A 2YCLA 2ZX9A 1NFGA 4K38A 4XUYA 4HPNA 1V77A 5H8PA 1B5TA 5B7ZA 1XQLA 2CZFA 1GUVA 4LXFA 2OCZA 4C5ZA 1W9BM 1OX5A 5C8BB 4HHPA 1IEXA 3L0GA 3SGUA 1EGMA 3DGRA 3N9RA 1OF8A 3TEVA 4HU0A 2ZWYA 2C1GA 3G8EA 1U30A 4HJFA 1ISYA 1FWRA 2NWSA 4FXRA 4I5UA 1QPOA 3LGDA 5A94A 2ABBA 3W6YA 1TZ9A 1NH6A 5A8MA 3QM3A 3L2MA 4L4OA 4HJWA 2W27A 4ZODA 3WFAA 3PWIA 1ICPA 2QCEA 3UXAA 2F38A 3STCA 5K4ZA 1TIMA 3IV8A 4LWWA 1ZZMA 4H2CA 3GVRA 1W3JA 3GG7A 1ZLPA 3IV3A 4H9VA 3VPLA 2XZ7A 3VOHA 4RE4A 1AUSL 2G4JA 4C6NA 3CJPA 1A5AA 1V6WA 1AQ0A 3KS6A 4JTFA 1XYZA 3P14A 2YCEA 3LRLA 3V7PA 3AZTA 3LYEA 3E0WA 3FAXA 1KTNA 1UMYA 4GQBA 2Z1BA 1IZJA 1G4TA 1J10A 1RK6A 4L4MA 2WVUA 1J8VA 8A3HA 1IXNA 4O0QA 2UWFA 1IZKA 1EZWA 4TXEA 3M46A 3TP4A 4Z1CA 4CU6A 1WKYA 2EG7A 2YCKX 1JEZA 2OPJA 2CWNA 4L6OA 4GJJA 3PAJA 4QR6A 1XD0A 1ZB5A 4ATDA 3OZPA 3W23A 2QGYA 3OHIA 2JGQA 2W92A 4HNNA 2NQLA 3IEBA 3F5KA 3W22A 3N04A 3FDGA 4GI4A 1DWIM 3SRDA 4D6GA 5CH9A 1QPQA 3FNDA 4C6JA 1EX1A 4GQRA 3WNMA 3B8IA 1S2TA 3RNDA 3U5UA 1PKYA 4MB5A 2YL9A 5G4EA 2XH4A 2FVKA 1Q45A 3QY7A 3UJEA 3DHDA 2P1FA 2ATSA 4R34A 3NURA 5LNSA 4IP4A 3OG2A 1YXCA 2GUBA 2HWGA 4TV5A 1W1YA 2FZNA 4PUKA 3L4XA 1XLHA 1WX0A 3DBNA 3GG0A 3SR7A 1VH7A 3S3GA 5DXXA 4GQ0A 3CLMA 2E9LA 4FIRA 2RAGA 1O1HA 1EGVA 5AY7A 3IVSA 1OFQA 1UIOA 2DORA 2DU2A 4TUFA 1KKRA 2VC9A 1VP5A 1XM3A 3ENLA 4PUEA 4MPQA 3O7UA 2G97A 2VC5A 3GB6A 4ZBCA 1OIFA 2NSXA 3NYDA 3TQVA 3RLUA 3LS9A 2FGZA 3OA3A 1X39A 4AD0A 1FHUA 1R3QA 4DWSB 1LZOA 5CC5A 1FWAC 4XAPA 1JCMP 2ZADA 4AEFA 4OIFA 3UZ5A 3FGCA 1TZ7A 1L2QA 4KT2A 1TPUA 3K30A 1KM1A 2V3EA 4PMUA 3NL6A 4C6EA 5HUOA 4R9XA 2P10A 3CZEA 3UVAA 4GZJA 4ROPA 3W0KA 1YQ2A 1UWIA 3CNYA 4EIVA 3FKRA 5FSEC 4LAMA 4HCDA 3UT0A 4LCSA 2WPBA 3FV9A 5CAKA 4LOCA 3CH0A 3GHTA 4QS5A 4LQ1A 4MDPA 4FNRA 3T08A 1VZWA 3WEOA 1M03A 4AISA 2NQHA 3HJZA 2CHNA 5CSUA 1XLIA 4UTWC 2W61A 3G1YA 1F4AA 5CGMA 1NY1A 4DZ5A 2OQYA 2PF0A 2WHKA 1C90A 3PBUA 4LAOA 3DHUA 2WJFA 1YDVA 3VCRA 2EGZA 2REQB 4IMAA 5CZTA 1EJRC 2GDVA 3TC6A 1GJPA 3NO1A 4GVHA 1L8NA 4JHZA 3W1MA 3UZXA 2OMAA 2OJPA 3IIZA 1LRTA 1F3WA 1J0HA 1LG1A 2JK2A 2Y1HA 3UGVA 1SJBA 4MGGA 4WKHA 5DQPA 4ERGA 5IFTA 2E5DA 2PDYA 1YBQB 1GW9A 4O8AA 3TSBA 2D2GA 3P7YA 4L7ZA 4Y9MA 2PWUA 4IIBA 1FA2A 5AVNA 4BF9A 2ISWA 1KFCA 1MSSA 2XPKA 2CETA 3NOEA 3N2TA 3MO4A 4OOUA 2XFWA 3H8AA 1R87A 2E6FA 2Y88A 4V33A 2D1ZA 2IKJA 3AYVA 2V68A 3T2QA 1GJWA 3ZWTA 1PZ0A 5K4XA 5L9FA 3CBWA 3VIKA 3CV1A 4KS0A 4HPGA 3RU6A 1HJQA 3CEUA 3BLKA 2WVVB 3IK4A 4ZOEA 1XCXA 3LHZA 5EMKA 1OB0A 1RR2A 2W63A 1GVIA 5A6JA 4D72A 1S2UA 4DJED 3IJDA 4LB3A 2NXIA 3CC1A 4A6GA 3SRHA 4YTUA 2VOMA 1SZNA 4LVGA 2PDPA 1LBLA 3RJYA 4M7SA 4IPIA 1VBUA 1FH9A 4D6DA 2BVDA 1XLBA 3IIOA 2ZYFA 5CC7A 3A22A 5AHFA 2O92A 1S5NA 3DFTA 3V35A 3PBGA 2RJGA 2Y8VA 2I56A 3EPNA 3FYPA 4AIBA 1W1VA 4EAYA 1UD8A 1BVWA 5T91A 1WKDA 1XRSA 3KW3A 4CD7A 4H2HA 1A3WA 4L4PA 3M41A 4G6CA 3KEHA 4RDWA 3AZRA 4E6MA 3EXRA 4PTWA 1ZENA 2YZRA 1WA3A 4E5TA 3K4DA 3ECQA 3PUDA 3AXXA 3T0AA 3MDWA 2EHHA 3IIXA 1LRNA 5C71A 3PUEA 5FAGA 1EKOA 1D7FA 4IF2A 1RLDA 3M0YA 1UH3A 3W4RA 3BW4A 1WDRA 3VNMA 3S0CA 2I14A 4A3YA 4HQVA 2V5CA 5HWJA 3LGEA 3NA8A 2QDDA 3W72A 3NSXA 5D9OA 2PU1A 1XLAA 3LX9A 2Q02A 5HMEA 2G3MA 1Q6RA 3P5YA 4U33A 2V9DA 3GR4A 1NVMA 2D23A 3IARA 4QSFA 3IPWA 1N2VA 4I8DA 4DF0A 3V5FA 1UUQA 4Q8PA 4V27A 3U2OA 3DERA 3P6LA 4JIHA 1E1FA 1NWTA 2QF7A 2XVGA 5D2VA 2DZBA 5DFAA 4RV8A 5H8UA 2FB2A 4YJ5A 3RPMA 5BRPA 4J7RA 1EPVA 2YFOA 3HG5A 2OODA 2XWDA 2CLEA 3AS0A 3WLMA 2QJJA 4QX4A 3T8LA 4CCZA 2WNZA 5I3KA 1B3VA 2IQDA 1B1YA 3O9NA 3ZVIA 5G4WA 3W7OA 4S1FA 1QJWA 1YE6A 2G50A 4W7VA 2OEJA 4PUJA 1GK8A 5FL1A 2IQTA 4IMCA 2PMQA 4O8RA 1I45A 4BFAA 1FWJC 4Z0JA 1W5NA 2GWGA 3WQGA 5LXXA 3KHDA 1ZAHA 4KPLA 4QE5A 1CGXA 1W3TA 3FSUA 5LNWA 4V1XA 3LBMA 4O1CA 3GDKA 3DN5A 4XISA 1PS9A 3W1PA 3EOEA 1R2TA 3KUMA 2I5QA 1ITCA 2FQIA 2WYSA 3GIPA 4PR4A 4AXNA 1BVZA 1GTEA 1Q4NX 4TV6A 3ZZ1A 1WBHA 4HNTA 4X63A 3P82A 4Z2LA 3WNPA 1DL3A 4U3AA 2NLYA 1T0OA 3KZSA 1UP0A 3VD4A 1AW2A 2R1KA 1UZHA 2E5BA 2DZTA 3TJXA 2PP0A 1C8XA 2QCMA 3OG3A 4YTRA 4YYFA 2BGNE 2E09A 2PGWA 4R33A 3VNZA 5E0CA 4INFA 4UR7A 4NY2A 3A4JA 4C6MA 3LBCA 1HKWA 5HUPA 2ZIDA 3PFRA 3KBNA 2O0TA 3EMZA 2OKTA 3ORWA 3QKZA 3G1FA 4TVDA 2C19A 5A2CA 1P4CA 4O19A 2JEPA 4MFEA 3ZT6A 4IG2A 4QNWA 3L2IA 3T0CA 3PPGA 1DQWA 5KZDA 2NUYA 1KQZA 1US0A 1BF2A 1XIMA 2E5CA 3B3DA 2XIJA 2Z25A 4TMBA 2ZDRA 2VCCA 3A9BA 3VC5A 3OU8A 4MIMA 3G3DA 4FIQA 2VQTA 3NDYA 3BCJA 3FK4A 4KEUA 3CHDA 1SPQA 1VKFA 2DW6A 4EWJA 3OLDA 1F8MA 4N9DA 4BF7A 3CAWA 3MV01 4AUBA 3TQPA 4HCLA 3HO8A 4HNCA 3TYAA 2WKGA 3QYQA 4GUFA 4PSRA 1L6WA 2OT1A 4UXDA 4Q8UA 3VNIA 1FH8A 3UF9A 4UFLA 3QEZA 1HJXA 4NUWA 4YHGA 1W32A 4LCRA 2B0MA 4J5NA 1IXOA 1Q85A 3TNBA 2J8GA 3W1QA 4Q8VA 1WOAA 1O6IA 3CEPA 2JGYA 3S2NA 1V0KA 2G96A 2VZSA 2QAFA 3GM8A 3R79A 4NAFA 4HZ6A 3TN6A 3PJXA 2YCJA 3EWWA 4NNAA 5HULA 5G1MA 4Y96A 4E3TA 3L0NA 2XFYA 1Q2SA 5D04C 3T05A 4IHCA 1EH9A 3KBMA 2HRWA 4WSKA 4S3DA 3KFTA 3LHTA 2YLLA 1DQXA 2QCFA 4MYXA 4I6VA 5LIYX 1X38A 3GNPA 4BKNA 1DJXA 3T0BA 5CJMA 1ZBKA 1KBJA 4V15A 2VKZG 3EMQA 1ZS2A 3S2MA 4ATWA 4F0LA 4YWSA 1IGWA 2OU4A 2QUNA 3LLDA 4JTHA 3P81A 3WG6A 2VOTA 4ZR8A 3VIFA 2D2HA 4HBKA 3HU7A 1HIZA 1OYCA 4GY1A 1HGWA 3KOFA 2V81A 4OVXA 9XIAA 2PDMA 4NAEB 3R5EA 3EWYA 5G1TA 2HV5A 1VEOA 2WVSA 3GO2A 3ITGA 3QLLA 5H91A 1QK0A 2KAUC 5GJPA 4A8NA 4D9PA 1R3SA 4HSOA 4AHOA 2J77A 4LAUA 4PCPA 4YTTA 1TWWA 4U5IA 3DUGA 2J6XA 3VDAA 1BYDA 2HEJA 1EJ7L 1XD1A 3VIGA 3GHRA 3GS6A 2C15A 1BXNA 1W9DM 3SW6A 2OX1A 3NQ8A 3UXKA 3WJWA 5H8MA 3M43A 1VCVA 4WOQA 2VGFA 3TMLA 5DCBA 1FWGC 4E4UA 4DLMA 2XH2A 5EGRA 1CZ1A 4JXCA 3DZ1A 3HPSA 4EPBC 4S3AA 3SSZA 1W31A 2QLYA 4BWLC 4Q8TA 2XYLA 3GIQA 4CNTA 1M04A 1SFTA 4W7UA 4UTIA 4YS1A 4I5XA 1QWKA 1W3KA 2J74A 2NT0A 3P60A 4GHRA 3S46A 5JXQA 5I3FA 2VZUA 4AD2A 3GHSA 3C3UA 3FCPA 1E4IA 2OTDA 4HNVA 3DFYA 3UGRA 2C79A 3S1WA 1SW0A 5KINA 3BTNA 3ITLA 2WANA 2LLEA 3EOOA 3I3EA 2D73A 4AHPA 1J11A 4H6KA 4ILSA 4QCEA 1JRCA 2FPYA 1XBXA 4IL2A 3L5AA 2J79A 3W1TA 2BB0A 2PDBA 3UZWA 1YIXA 2YL6A 1R9ZA 5C9XA 1HKJA 4DI8A 1OT2A 3CL8A 1J93A 1UASA 4YTSA 4QISA 2DZAA 2WMIA 1DV7A 4A3HA 3BLPX 4FO4A 2YW3A 1KD0A 3AIWA 3UWWA 1BRLB 1H2JA 2R14A 2QYGA 4GUGA 1U2YA 1XWYA 3TDFA 1GYLA 1EDGA 2XGZA 2Y7DA 3B9EA 2O9PA 3A9IA 3RR1A 3JR2A 1RV8A 5AHEA 4JQ4A 5CBIA 2DQXA 4CQ8A 4R27A 1Y7VA 1DWJM 4ORMA 4RZ4A 3UY8A 5IBXA 1V3KA 1QW7A 5FJRA 3TK7A 2DH3A 4XD5A 3TZNA 2YA1A 3MTWA 3G0SA 4WZHA 4ZENA 1SFJA 3EKGA 5BOOA 1FWSA 3PBWA 3VMPA 3GC4A 4MJ4A 1W9XA 2PGRA 4GACA 3HG4A 5BMXA 2EPHA 4EOUA 2CESA 4O14A 3RRXA 4JDBA 4IIGA 1E9ZB 1JPDX 3SUSA 3A3WA 2EG6A 2GJPA 1RHCA 3M64A 5DXYA 4WX2A 4LPCA 3SEPA 3AXHA 3TTYA 2L5HA 3S5SA 2JEQA 4WRHA 2PCEA 1EBGA 4A8IA 1PCKA 2J24A 1E72M 4JFUA 1EZ2A 3H54A 1G1YA 3UR5A 4HK7A 3UWEA 4GISA 1OYAA 1G69A 1T41A 3I3DA 1MVYA 2X40A 1CXIA 3G1SA 4DAIA 3L2LA 2VWSA 5BYWA 5M5DA 3TN5A 3NQAA 3IJIA 1SW3A 5BRQA 4BEQA 4NYYA 3UXLA 3B03A 4BI6A 3TC3A 2E6DA 3EMCA 1KTBA 3T44A 3URQA 1X8CA 1F9CA 1UC5A 2FGBA 3HG2A 3W7LA 1QBAA 3D5HA 2VFIA 3UWVA 3I6EA 1ISVA 1W2VA 4OBRA 3UYCA 5A6KA 2JALA 4GO8A 1XFBA 3ARRA 3GH4A 1UOKA 3GTHA 1FWIC 3EB2A 4GG9A 4KKXA 2I17A 3VO0A 2ZUSA 3WQ6A 2KZHA 2ONEA 2QCDA 4Y6GA 4AD3A 5I06A 2VGGA 3GVVA 1A5KC 1XIJA 4OBSA 1W5MA 4HD5A 2CLOA 2EF9A 2V82A 1BVNP 3WELA 1HF6A 2J13A 1TPVA 2JFEX 5DBTA 4A21A 3MKVA 1KBLA 2OR2A 1RJPA 4UTHA 1XLCA 1XDJA 3VKJA 4L61A 3V36A 4Q7BA 3W7HA 3VOJA 3CZKA 3KVMA 4G1NA 3DI1A 3KWSA 1XG3A 1QRQA 4HZ7A 1EL3A 2J6VA 3NQFA 1O4UA 3Q4DA 5G1YA 2WZEA 3TYBA 1QCWA 4K8EA 1VJZA 2J7EA 1BTCA 1T7LA 3OBAA 3VMNA 3S8HA 1V8EA 2BVWA 4MWAD 1E3ZA 3A3XA 4ZZ9A 1S38A 1FCUA 1JR1A 2DIKA 3F5JA 3IGXA 4GBUA 1PBGA 5JH1A 2ON3A 4D6EA 3DESA 3TR2A 2GSHA 1PYMA 4US5A 1B2YA 4C7FA 5U7SA 3R4IA 4CN6A 3RLVA 3WH8A 2C3ZA 4H9YA 4LVFA 2ISDA 1LQ2A 4M81A 4PSPA 2HVOA 2PLJA 4JD4A 2UV8G 3VDCA 1IQ8A 3N6QA 3LRKA 3B04A 5CPNA 3B40A 2P8BA 3VUSA 2WHLA 1CT5A 3PR2A 4J3XA 4DO7A 2V5LA 3NO5A 2O9RA 3K1DA 2ZZ1A 1YNQA 1SYTA 3BK0A 4RNJA 4NP7A 3E5PA 1J79A 4UTTC 7CGTA 1JUKA 1TFVA 1HO1A 1CLXA 5EBAA 3V75A 3PTQA 3USZA 3WQ4A 3NQBA 2ACSA 1ZY9A 4ML9A 4GWEA 4MZYA 3BICA 1FDYA 2R1PA 4GPNA 1OF6A 1X96A 3H23A 3QGAC 1DXEA 4LANA 4FR6A 1JPMA 4XSMA 1FHLA 3I3BA 1JGMA 1R46A 4LRTA 2ZRWA 5CGTA 4HYWA 1R3WA 2WVTA 2P50A 2VX6A 3V0SA 4JTGA 4MYAA 3C3NA 1JCJA 3LZ3A 4NIRA 3PC0A 1BSLA 5CJNA 4J4KA 4QFUA 1FFRA 1MW2A 2Z6JA 4XAYA 4WJEA 1K7EA 1W37A 2WMHA 4O4VA 4D8LA 2YLAA 4JFSA 3GXDA 4XZIA 4UTWA 1ZPTA 4QDMA 2A7NA 3BARA 5HR6A 2TAAA 4R9OA 4RJEA 1TV4A 3GG8A 3WF4A 5BRBA 1S2CA 5HJXA 2P3ZA 4LY4A 1XP3A 1W17A 1EFZA 4QRNA 3SUVA 3OTRA 2XN2A 1YTKA 3UW6A 9XIMA 5DMLA 4JYDA 1EJWC 4GX8A 1ELSA 4KCUA 1F74A 3VIOA 1QW9A 2VP8A 3URAA 4Y9OA 4LV4A 1O7AA 2ANUA 3U3HA 1B0IA 3QGVA 1GKQA 5CSSA 3WK0A 4IJBA 3REQB 1J96A 3OIHA 4S3GA 5JQ9A 4FB7A 2NSOA 1DJIA 1I8JA 1QR7A 2J7HA 1IF2A 4EPDC 4XIMA 4DF1A 2DZPA 2PDQA 5KEZA 3P62A 1W6TA 4WD0A 3CHFA 1FX6A 3PZNA 2GQ9A 4Q33A 4POCA 1JI1A 1PPIA 4IFKB 4WK9A 1J01A 1K8XA 1QUMA 3H7UA 2A7RA 3VD5A 5AHLA 2ZXQA 4ALDA 3F4CA 3F2BA 1FRBA 1RQEA 3NSNA 1IEIA 2P76A 1XJBA 1JDAA 3FYOA 3KCJA 4JTSA 3R43A 3HPXA 4LUSB 3MZNA 4JTJA 3W82A 1MW0A 4L6HA 4AYSA 4NILA 3OGSA 2FMNA 1UJQA 3KX6A 3UR2A 1UKTA 2DVXA 2OFJA 4H8HA 4KMQA 2QCLA 3BJTA 3O05A 3QC3A 3L0KA 4ZQMA 1EA9C 3TWBA 1FWWA 4JTIA 4UZUA 4LBRA 2HZGA 2R6OA 2BY3A 4LVAA 4DXXA 3A12A 2HQAA 1PTGA 3XISA 5C9ZA 1TJPA 2GSEA 1IZCA 3UNDA 2FKPA 2BP1A 2NW0A 2EQDA 2ISSA 3CWOX 3MPGA 3V16A 4IGNA 2XH0A 2DY3A 2ZWZA 2OGYA 3B9NA 1M5WA 3O16A 3W74A 1JI2A 2E25A 4GI9A 2BFGA 2ZA1A 2FJUB 1DP0A 4JS3A 4Y9NA 1QI0A 4D71A 3SY1A 3KZPA 3AYRA 5ABFB 1V6UA 2DT0A 5TNVA 1OGBA 2X09A 3T0DA 1TQJA 4ML4A 1J2BA 1P0DA 4HT3A 2HPMA 2GJLA 1E9YB 1TTPA 5CPQA 4ICMA 1K9FA 4UBPC 3TQKA 3H4GA 4DUXA 1QI3A 4U2YA 4DWDA 4AX7A 3NXFA 1OM0A 1TX0A 4IGSA 2YGYA 3P0XA 1YNPA 1QOXA 1QOQA 1KRBC 2CLFA 2ZRUA 2E9MA 2WMKA 2OKOA 3CV6A 5C2GA 4PGLA 2ZX8A 4Q4SA 3L4YA 5A8QA 1SJCA 4TMCA 3MA8A 1KBKA 4LJ3A 1Q6FA 1BKSA 2NZLA 4CQAA 3CWNA 4E2VA 4U5KA 1Y0EA 3PF3A 1V03A 1QTWA 4FEZA 4C6BA 1I2NA 4RK8A 1MRAA 3R1ZA 4MY9A 2PB1A 4NXKA 3QV7A 4GIYA 3SECA 3PHAA 1OBAA 1JDEA 4KFOA 1TCDA 4HPHA 3BG9A 3RGTA 1G9HA 1IYXA 1E56A 1FKWA 1XLGA 4WXYA 5HMDA 4KGJA 3L12A 4HOXA 3S6TA 4JTRA 2G8ZA 3W87A 3LN3A 1ZUAX 4Q4RA 1XH2A 4REQB 4IPNB 2PFHA 4CNPA 2E8ZA 4KWOA 3I7SA 2E4TA 3BLLA 3MO7A 4EXBA 5A6MA 4DIAA 4HOZA