3LI8A

Crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
263
Chain Sequence
KLAYEKSIEMAGNYANQFDAQMEANQAIARTLACTMAEYGSQDREEAMSIIKRILNENPQLIGVYLGYEPDAFDGRDKNYINAPGHDSTGRFVPYCNKINGPVIIEPLVHYDSSDYYQLPKTTGKDTLTEPYFYEGIFMVSYDSPIFKNGEFAGIAGVDVPLEYVDDVASSIRTFDTGYAFMVSNTGIFLSHPTQKNWIGEKSLSDFDVEEIKNAASDIREGIGGHVEIKDPITGKTVIMFYEPVKTGDFSFVLVVPKEEMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical sensory transduction histidine kinase
publication title Structural characterization of the predominant family of histidine kinase sensor domains.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Signaling protein
total genus 70
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2010-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li8A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li8A02
2YKFA 3G6OA 4LRXC 4I39A 4BBUA 4EW7A 3SW1A 1F98A 4E04A 1XFQA 3H7WB 3K3DA 3LYXA 3D72A 4H6JB 4PKYG 3ICYA 4HJ6A 4GHIB 4F3LB 2PR5A 2Z6DA 5KIZA 4L9EA 4I3AA 1OTIA 1T19A 1V9YA 5G4YA 1N9OA 3FG8A 5IU1A 1OT9A 3CAXA 4JGQA 1LSWA 3VE4A 3CLOA 5J3WA 5A8BA 3C8CA 3RH8B 3K3CA 3LIEA 3MFXA 3B33A 1EW0A 2W0NA 3NHQA 4WN5A 5EFWA 3KX0X 1XFNA 3UB9A 5HSQA 3UB8A 3LIFA 3RTYA 2PD7A 5HWTA 1LL8A 2H28A 3F1PB 1DP6A 2B02A 2VV6A 3GECA 2PR6A 3LIAA 2HV1A 4KQDA 1N9LA 4HI4A 4R3AA 4YWZA 1S4RA 1S4SA 3VOLA 4I5SA 1T1BA 2A24A 1F9IA 3EEHA 1UWNX 1GSXA 4PKYA 2PD8A 4LRZE 4L9FA 4R6LA 4NXFA 3T50A 4HJ3A 4K08A 1MZUA 2PYRA 3IBRA 1S1ZA 1WA9A 1OJGA 1OT6A 3HJIA 4EQ1A 4MN6A 2VEAA 4JGOA 3EWKA 4HOIA 1TS8A 1OTEA 4GCZA 1BYWA 5J7EA 4GW9A 2ZBBA 2M1CA 1ODVA 3A0VA 1LT0A 1XJ4A 5HZHA 5HDSA 2VV8A 3PYPA 2WKPA 4HQAA 3IS2A 5F5YA 1XJ2A 2R78A 3MJQA 3UB6A 3F1NA 4JGRA 1VB6A 4HIAA 5DKLA 1OTAA 3NJAA 2P7JA 2CMNA 4R70A 3LUQA 5DJTA 4B9OA 3MQQA 3OLOA 3ULFA 3GDIA 5TBMA 1T1CA 4WL9A 1GSWA 1UGUA 2OOLA 3LIDA 2A24B 2W27A 2V0WA 2L0WA 4I38A 1TS7A 4HHDA 5F68A 4WF0A 1DP8A 1TS6A 4LLOB 1XJ6A 4NXBA 2VV7A 3LIBA 4LRYC 2PDRA 3UMEA 3H9WA 3MXQA 4NXEA 1OJ5A 4EXOA 1D06A 4EEPA 2V1BA 5HWVA 1DRMA 4RQ9A 4HP9A 2KX6A 2L1MA 5J4EA 1UWPX 4DJ3A 1TS0A 4MN5A 2QWSA 3CWFA 3E4QA 2D01A 4HJ4A 3IS2B 3A0RA 3UMDA 3F1NB 1KOUA 3E4OA 3UE6A 2OWJA 3H82A 2JN7A 2QHKA 3A0SA 4KUOA 5TBMB 4KUKA 1S67L 5F6AA 1S66L 3NOPC 2L4RA 1S1YA 4EERA 3PHYA 4WLAA 2ZOHA 3BY9A 3HJKA 5HWWA 3ZQ5A 1JNUA 4M4XA 3F1OA 3NOUC 4XT2A 3LI8A 1V9ZA 1LSVA 3MR0A 2JHEA 3BWLA 3VE3A 2J80A 2ZOIA 4EEUA 1LSXA 2V9AA 2WKQA 5HD3A 3BY8A 3E4PA 2VLGA 4HP4A 2K7SA 4HH3A 1T18A 3C2WA 1DP9A 2V0UA 5IS1A 1OTBA 1D7EA 5AVFA 5G4ZA 5HDCA 2EA9A 4WUJA 4GS9A 2D02A 4BBVA 4DJ2A 4I3JA 2V1AA 5I5LA 5AVEA 5HDDA 3H7WA 4HY8A 2YKHA 3H82B 1Y28A 4H6JA 1T1AA 1P0ZA 2QKPA 4GHIA 3UB7A 4F3LA 1XJ3A 2GJ3A 2INWA 4HNBA 1GSVA 4EESA 2QJ5A 4NXGA 3LICA 4I3IA 2I9VA 5DJUA 1N9NA 1NWZA 1OTDA 3F1OB 3LI9A 2OWHA 4XT2B 3P7NA 5DKKA 4EETB 5F69A 4LPZA 2Z6CA 3NOTC 1P97A 1X0OA 2KDKA 3MQOA 2WKRA 4R38A 1G28A 4HH2A 4BBTA 5HD5A 3F1PA 3FC7A 4JGPA 2PHYA 2PYPA 4L9GA 2BASA 2QJ7A 4GS9B
chains in the Genus database with same CATH superfamily
3OCLA 4LRXC 2XR0A 4EW7A 4ID4A 3CI6A 3IXDA 1YAXA 1F98A 2OLVA 3ZHHA 3ZFZA 2EX2A 4ZDXA 3KSHA 3N8LA 1W7FA 1ZG6A 3D72A 3VP1A 2XH9A 4D60A 3ICYA 4GHIB 2HDUA 1ERMA 5LBRA 2ZL1B 1BUEA 5L07A 1OTIA 1SCWA 3BRMA 2V8CA 3FG8A 5G4YA 5IU1A 3IBJA 3BQAA 4JGQA 3BW6A 4BLMA 4QY6A 5A8BA 4Y3IA 3RH8B 5FATA 1IFQA 3K3CA 5AJGA 3NDGA 3WS2A 1CK3A 3VOYA 4ARZA 1RP5A 1ES3A 3C7UA 4Y17A 2V8FA 4PAUA 3G30A 1YMSA 3PBRA 5EUAA 4C3QA 4B88A 3S7OA 4XUXA 4Y7PA 4E6XA 1CI9A 2HDSA 3GRJA 4JXGA 3VSLA 3RTYA 3MBZA 4IBXA 2PD7A 2V1ZA 4NG2A 1MWTA 4F94A 5CEDA 3ZCZA 4OPRA 1LHYA 4N1XA 1NZUA 2B02A 5F82A 3LIAA 2X71A 2HV1A 1K4EA 1PW8A 2WGIA 4R3AA 4DKIA 5L09A 5EPHA 5GHZA 1S4SA 1FCOA 1PI5A 3VOLA 1YLTA 2J8YA 1F9IA 1K56D 3EEHA 4GDNA 3NBLA 2DMWA 2HP5A 4PKYA 2JKTM 2PD8A 4LRZE 3DTEA 3ZG0A 4Q0JA 3CMZA 2WAFA 4RX2A 2OAP1 4K08A 4O0PA 4JXWA 5IT5A 1S1ZA 1BT5A 1WA9A 2BTFP 5CTMA 1QMEA 3S1YA 3D4FA 1ES4A 2A49A 2ZC7A 4YINA 4BD1A 1FIKA 4JGOA 5EVIB 4GOGA 2OV5A 4S2IA 4UA6A 2Y2MA 4DE0A 5FQJA 4NK3A 2Z2LB 4GCZA 4EUZA 4Y5FA 5E2EA 1ONGA 5HAPA 3V67A 1ODVA 1XJ4A 4ZJ1A 5HDSA 3PYPA 3ZG7B 1MXOA 2WKPA 3IS2A 3NCKA 2W3HA 1XJ2A 4OQGA 3UO9A 2C5WB 1I2SA 1VB6A 1EROA 4HIAA 3T4SA 2P7JA 5FI2A 1WE4A 4IJGA 3ULFA 1T1CA 2WK0A 1CEGA 4PPRA 2JKRI 1H0MA 1P9RA 2A24B 2W27A 1Q2PA 2W3FA 4I38A 3VP3A 2WGWA 1E25A 4WF0A 1DP8A 4PM8A 5IHVA 1L3LA 4FD8A 3IX4A 5EE8A 1AXBA 4OOMA 3ZNTA 4CQHA 1OJ5A 5HPFA 1VETA 2EFUA 2Q9NA 2XFSA 3HVFA 1DRMA 3LR4A 4HP9A 1BLHA 2KX6A 5HW3A 4UAAA 5J4EA 2ZC3B 4WMCD 4FCFA 4OPQA 1XP4A 2WZXA 4MMNA 4MN5A 2QWSA 3G32A 4X1MA 1FSWA 4PM9A 3BFFA 2Y79A 1YLZA 3IHAA 3IH9A 3F1NB 2R9WA 3H82A 5L10A 1DJCA 2QHKA 3A0SA 3C38A 2GNXA 5FAQA 3UPNA 4KZ8A 3LY4A 3FYZA 1S1YA 2ZM8A 2XGNA 4EERA 3JVVA 2M7VA 2XLNA 1YKDA 3C7VA 3BY9A 3W4OA 3T4JA 4EBPA 5HL6A 3UPOA 1K6RA 2Y8HA 3F1OA 2GDNA 2IWBA 1TD5A 4WELA 5DF9A 3GR2A 3S7NA 3VE3A 5L2FA 2V9AA 3UE3A 5FDSA 2UV0E 4Y0UA 3ZG9B 3E4PA 4HP4A 3IWIA 3M2KA 5FA7A 5FI6A 2XFTA 5IS1A 4O7DA 1OTBA 3C5AA 1GA0A 4JF6A 5HDCA 4Y2FA 4C6YA 1FSYA 3N4IA 2EA9A 4WUJA 2Z2MB 3G35A 3MFDA 2V1AA 3AGDA 1BSGA 4BD0A 2Y2GA 1HTZA 1NLZA 3MF0A 4X68A 1BLPA 5AQBA 3OPPA 3BYDA 3DW0A 5DTTA 4BMWA 2QKPA 4PM6A 3JPUA 1XJ3A 2W3EA 3NI9A 4EU0A 3PXPA 4BENA 3VP4A 3PAGA 3HBRA 3IX8A 4OQIA 4EESA 3KSIA 4NXGA 2J9OA 2I9VA 5CGXA 3ZYTA 2ZQCA 3SH9A 1N9NA 1KDWA 3A3DA 3CUEA 3O87A 4XT2B 1HLUP 3P7NA 5J8XA 4M3KA 1MKIA 5DKKA 2WZZA 4LPZA 1K54A 5A90A 1ZG4A 1X0OA 4U0XA 4HESA 3E98A 4IBRA 2UWXA 4R38A 2WKRA 4MEZA 1G28A 1NYMA 4Y13A 4HH2A 4BBTA 5FQMA 5HD5A 3F1PA 2BLSA 1M40A 4RYEA 4GS9B 2QPNA 4BBUA 4B4ZA 4X6TA 4DF6A 3MZEA 1K4FA 5GLBA 2ZJ9A 4X25A 3H7WB 4E3JA 2JKFA 2ZQ7A 3K3DA 4Z9QA 3LYXA 5GLDA 2O0YA 3SH8A 2PR5A 3DTMA 2VX8A 4GNUA 4I3AA 5CXWA 1MC0A 4LV2A 1N9OA 1Z09A 1SZVA 4E3NA 3CAXA 3VE4A 1FR1A 4K0WA 2HF6A 1VHMA 2KLIA 3MZFA 5TGFA 1XA7A 4KG2A 2ZMAA 2AVXA 2EXBA 3L9KA 4OPYA 3B33A 1EW0A 2P74A 3NHQA 4U0TA 3UPPA 4WN5A 2WYXA 5EFWA 3KX0X 1XFNA 1K38A 1TDLA 5AQ7A 5HSQA 3T1XA 3NY4A 4LV0A 1MWRA 2VA0A 3OBFA 3UB8A 3VSKA 1LL8A 1IYOA 4R3JA 2H28A 1KE3A 4N92A 3A3IA 4QHCA 3UDFA 1DP6A 1QMFA 3B47A 2PR6A 3UDIA 1SKFA 2B5RA 2Q9MA 1W63Q 1K55C 1KVMA 4YWZA 1PYYA 3AGFA 2B95A 1S4RA 3Q1FA 3W8KA 1G5UA 3TRCA 3GVBA 3VOZA 1T1BA 2IA2A 5GHYA 4S2LA 4DDYA 1UWNX 5E2FA 4NKPA 1MKMA 4NXFA 5K5BA 3T50A 3TE8A 4HJ3A 3MQ0A 4QJGA 1KGFA 3KYQA 2W3GA 1TVFA 3L7HA 1K57A 4XUZA 2VEAA 3TG9A 1P9WA 4DE1A 3C4PA 5FL3A 4ZBEA 2J3TC 1CJFA 4ARZB 1YM1A 5J7EA 5KSCA 4HEFA 1K6SA 2H5SA 4GW9A 1SKOA 5HX9A 2OAQ1 3IXBA 1XPBA 3EQUA 4G3WA 4WBGA 1FILA 1YSPA 4HQAA 3LCEA 3HLFA 5F5YA 1WYBA 2JCHA 2ZMVA 3KSFA 2ZQ9A 2M7UA 4S2KA 5I94A 5EM0A 3NJAA 3SOIA 2Y2JA 2WKEA 3PBTA 4B9OA 4GJ4A 3CPTA 5A92A 3FPWA 4A5RA 3T4LA 1GSWA 4EV4A 3EOIA 2L0WA 3DAVA 3P98A 4HHDA 3O5YA 2WADA 5FAPA 1OMEA 1XJ6A 4NXBA 1ERQA 2VV7A 3IF5A 1PWCA 3GV9A 2JE5A 3DTIA 1W63M 2PDRA 2FH5A 3UMEA 3ZDJA 4GZBA 1MPLA 2W1TA 2P9VA 3Q82A 4EEPA 2PRFA 2O99A 2QYBA 3ISGA 1OPXA 3N7WA 1KE4A 1LL5A 4UHUA 2MJ6A 3E0YA 2PU4A 2ZMFA 5F83A 4OQHA 1H8YA 1XKZA 2P04A 1TS0A 3CWFA 2D01A 4HJ4A 3IS2B 5DFXA 1NY0A 3ITBA 1N9BA 2HDQA 3BFEA 3UN7A 4OH0A 4Y0TA 4EBNA 2J9PA 2WKIA 3LY3A 5DF8A 4IEDA 2O9BA 4O01A 2X02A 2V2FF 5U47A 1YLWA 5TR7A 3NOPC 2L4RA 4EQIA 1VM1A 4DMZA 1PZPA 2Y2QA 2LB5A 3MMHA 3HJKA 2WGWB 3LGOA 3ZQ5A 1H8MA 1SHVA 3NOUC 1XXMA 4KZ3A 3LR5A 3ZVTA 4II7A 2DCFA 2ZOIA 1ONHA 4S2NC 1VETB 3SZTA 4OOLA 2OSUA 5HD3A 4PM5A 3QHYA 5C5KA 5MC7A 1XX2A 2PU2A 1T18A 3C2WA 5FI7A 1FQGA 3ZVWA 3T1QB 2ZQ8A 3SS5A 2XF3A 3NIAA 4QY5A 3T4TA 2D02A 3IX3A 2PBDP 2XSSA 1KVLA 5AVEA 3P09A 3WRTA 5HDDA 4EBLA 1DJBA 3H82B 2IWCA 1Y28A 4HBTA 4H6JA 5CHMA 3E2LA 4JBFA 2G2WA 2GZAA 3UB7A 4F3LA 3HLCA 4RA7A 4X1LA 1DJAA 3A3JA 4RVAA 4GD8A 2GJ3A 4HNBA 1GSVA 3BQ8A 4DXCA 2XDMA 3LICA 4X69A 5JYPA 1IYPA 1JTDA 3Q07A 2KOIA 3F1OB 3BLSA 4JF5A 5EVLA 2OWHA 3CITA 1TF1A 5FQIA 4MBFA 3HLWA 3IF6A 1G6OA 2BG1A 2H10A 5M1AA 1K55A 4DDSA 4CLCC 1P97A 1M6KA 2VK3A 2XD1A 3Q7ZA 3QNCA 2EX6A 5FEGA 1W8QA 3MQOA 1NXYA 2FFFB 1VEUA 1HVBA 4OLGA 4D2OA 4KQRA 2V20A 3MKEA 4KZ5A 2LB9A 3UDXA 3C4OA 1JWPA 2ZC5B 3Q7VA 3FC7A 1YLJA 2PHYA 2EXAA 1RGZA 5CRFA 4BL2A 4KQOA 4DE3A 1G68A 4P87A 3R4KA 4G3KA 4KZAA 3NULA 2Y2LA 3RFBA 3UE0A 1S0WA 2RL3A 1MWUA 2Q0OA 3LR0A 3TOIA 1F2KA 1AWIA 4FUWA 1LSWA 2EWVA 2A2LA 3QP6A 3CLOA 3EEAA 2Y91A 2JKRM 1XGJA 2PT7A 3C8CA 1KE0A 4IVIA 3LIEA 3MFXA 3TSGA 5E43A 4XXRA 5D3OA 4NETA 3BEBA 2HJ9C 1JWVA 1EWZA 5CX7A 4P6BA 5HARA 3NECA 1W8YA 2HGVA 5GHXA 3HUMA 4N1HA 1PI4A 4H8RA 3LIFA 1W79A 4KG6A 5FQ9A 5GLAA 5HWTA 4WZ4A 4QWOA 3HCYA 4YNRA 2PBYA 5EV0A 3F1PB 2Y2OA 2EX9A 5CECA 3D9YA 3GECA 2NUTC 4KQDA 1N9LA 4DE2A 4JXSA 4HI4A 1W5DA 1YLYA 1N4OA 3RXWA 5HFOA 4OVDA 2H0TA 4E3MA 4MDZA 4X55A 4K91A 3OZHA 5M19A 4K0XA 4R6LA 1GHMA 3QP8A 3VMAA 3G34A 2PYRA 3FPVA 3IBRA 1NRFA 1SDNA 2W3DA 1IYSA 1OJGA 3HJIA 1BULA 1HZOA 2GX5A 3M2JA 1IKIA 3ZG8B 4MN6A 1O7EA 3LFVA 2JKGA 1ZTUA 4WYYA 1IKGA 1TS8A 1OTEA 1VQQA 5A91A 1PRQA 5E2HA 2ZBBA 3CG5A 1XA1A 3C30A 1S6RA 5HZHA 4DN0A 2X01A 3V50A 2VV8A 3ZGAB 4JF4A 5A93A 3MXRA 3NC8A 4R4RA 5EVIC 1E3UA 5G18A 3MJQA 3UB6A 2XROA 4JGRA 3P01A 4E6WA 1OTAA 1ACFA 1SDEA 2CMNA 5DJTA 3MQQA 3OLOA 1J9MA 1LL9A 3GDIA 5TBMA 1K0KA 4S2MA 5DTSA 3V39A 3HL9A 2WGVA 2OLUA 1UGUA 4IUKA 3U4LP 2Y2IA 2E8JA 2K31A 2V0WA 4E3LA 3JYIA 3T4OA 1TS7A 3T1RA 3R7WA 3E2KA 4HBUA 5FAOA 3W4PA 4E3OA 1CQAA 2FZ0A 3LIBA 3BECA 3S7QA 4EXOA 1D06A 3LO7A 2V1BA 5GLCA 4QB8A 2L1MA 2ZQAA 1UWPX 4IUHA 3V3SA 4LGWA 1L0FA 1SKOB 2Y2KA 2K2NA 3IXHA 3G2ZA 4DJ3A 3WWXA 3PBSA 2CC1A 4CLCE 5KMWA 4Y15A 3KYZA 3E4QA 3BJNA 2VGLM 3A0RA 4BWIA 2XA7S 2JKTI 4BQMA 3UMDA 2EFXA 1KOUA 3HUNA 3E4OA 3PBQA 3UE6A 4YOFA 1EI5A 5EVEA 5CGWA 1PWGA 1KGEA 3T12B 4DXBA 3K2NA 4KUOA 3ZG5A 3CPTB 4YFMA 4X56A 5EOOA 5F6AA 4C75A 1S66L 4CLCA 1JVJA 3Q81A 3CZDA 3PHYA 4JKTA 4EUVA 4WLAA 2ZOHA 1ZC2A 1YMXA 3SH7A 5HWWA 1IOUA 4OQ0A 2E8IA 4LENA 3QP1A 5L8MA 1HD8A 4ESPA 1L0EA 3W4QA 3SS4A 3PBNA 3WS5A 3BWLA 5CTNA 3OC2A 3TW8A 5DF7A 1Z6FA 2J80A 2W1TB 2P9VB 1GHPA 3W2ZA 3IHBA 5BOHA 3OPLA 4P0MA 2WKQA 1O07A 3IQAA 5F1FA 3BY8A 3UE1A 3GQZA 3T4QA 2VLGA 4KZ7A 4MLLA 1BTLA 4R0QA 4KQQA 2K7SA 1STZA 1DP9A 2V0UA 1PWDA 1LLBA 4E3IA 4MBHA 1D7EA 1CF0A 5AVFA 5G4ZA 3M6HA 1FCMA 2ZC6B 4BBVA 1GHIA 3EGDC 3N8RA 4WM9A 3EGXC 1C3BA 3EQVA 4Q0IA 2WUQA 2YKHA 2ZC4B 1MY8A 3O88A 4MNRA 4MBKA 1T1AA 1P0ZA 4GHIA 1ES5A 3HLEA 4DRTA 5EECA 2EX8A 2ZL1A 2P08A 2INWA 2G7UA 3CUEC 2QJ5A 4KZ9A 3LEQA 1I5QA 2ZM0A 1ESIA 4OLDA 3ITAA 1NWZA 4BJPA 1H8ZA 3DTKA 1K54C 4EETB 5F69A 5EM1A 2Z6CA 4CJNA 5M18A 4R23A 3OPRA 2XQZA 3HLDA 4IHQA 5E2GA 3O3VA 1PFLA 5FASA 1GCEA 2C6WB 3D3OA 1JTGA 2HDRA 4OOYA 2XEPA 4Q8IA 4Q0HA 2PYPA 3SS3A 3HREA 4WZ5C 2QJ7A 3FV7A 1PIOA 3S22A 5DVAA 2YKFA 3G6OA 5CHJA 4I39A 4NEED 3I7JA 3SW1A 1YPRA 1MBLA 4E04A 2G2UA 4JXVA 1XFQA 4R1GA 4QPRA 5FSRA 1E3UD 4OPZA 2WAEA 1Y4OA 1PZOA 1XGIA 4H6JB 4PKYG 4AFIA 4HJ6A 2DRWA 2R9XA 4KZ6A 4F3LB 4WEKA 4UQIS 4GN2A 3VV4A 2Z6DA 3MXSA 5KIZA 3FWLA 1RCJA 4L9EA 3VP2A 1T19A 1V9YA 2XA7M 3BLMA 1OT9A 4P6ZS 4GD6A 5DTKA 5FDHA 5J3WA 3QP2A 5EVIA 2IWDA 3QP5A 2B18A 4OONA 5EOEA 3IF6B 2W0NA 4KG5A 3VP0A 5FQQA 3NDEA 3T1SA 3V5MA 4GB7A 2Y2PA 5FEFA 4EWFA 4Z1WA 3UB9A 3A3EA 1YSQA 1VEUB 2Y55A 3UY6A 4G3VA 2XK1A 4ETZA 3B3XA 3MKFA 1PW1A 3Q7VB 3KSGA 3CHWP 4JLFA 2VV6A 1ZHHB 4RX3A 2O9CA 3LR3A 4LFUA 1BLSA 1G6AA 5JYOA 5CGSA 4I5SA 1PNEA 2A24A 2PAVP 1GSXA 3O86A 4L9FA 1IELA 4MCWA 2Y2NA 5KSHA 1L2SA 3OCNA 1MZUA 3UB5P 1IYQA 1LI9A 1K57C 3DBAA 4CLCD 3GSGA 1OT6A 4GKUA 4S2PA 2WKHA 4EQ1A 1Q2QA 3DWZA 1NJ4A 1YQSA 2HP6A 1ZKJA 3G31A 4UA9A 1KGGA 3EWKA 1NYYA 4HOIA 4FTXA 3DWKA 1BYWA 3OOVA 2Y2HA 1ESUA 3WS4A 4KZBA 2M1CA 3WS1A 3A0VA 1J3WA 3MZDA 3GMWA 2XD5A 1LT0A 5F1GA 3B42A 1FCNA 1H3QA 1BLCA 5HL1A 1FOFA 3AGEA 5AQ9A 1E4DA 1L0GA 1IEMA 5AQAA 2R78A 3VFFA 3F1NA 3JVUA 4PHTA 2I72A 5DKLA 3T4KA 4R70A 3LUQA 4WL9A 2VGLS 3U2AA 3BFDA 4LV3A 2Y4AA 4FH2A 2OOLA 1CI8A 1I2WA 3LIDA 5DFYA 4LCMA 4S2JA 5F68A 4R4SA 3QP4A 3RXXA 1TS6A 4LLOB 3WS0A 2VJWA 4QD4A 4LRYC 2ACGA 2J3WA 3H9WA 2VZWA 3MXQA 4NXEA 4WEJA 4FH4A 2H0YA 3WRZA 4O8GA 2VGKA 3PAEA 3HLBA 3S7PA 3LEZA 4UQIM 5HWVA 4RQ9A 5CHUA 4JPMA 1L0DA 4KZ4A 1H5XA 4UA7A 4P6ZM 3ZNYA 5HAIA 2RCXA 4UEYA 2JBFA 1KDSA 3A3FA 3G4PA 4L0LA 3GTCA 4KENB 5HAQA 1BZAA 4ZAMA 2VKSA 4QU3A 3V3RA 4FOFA 4IVKA 1K56A 2OWJA 3KYEA 3MSHA 2QZ6A 2JN7A 4U3TA 3KO6A 4ZTKA 1TEMA 5GL9A 5TBMB 4KUKA 1TDGA 1S67L 5TJJA 5CERA 1YT4A 3G2YA 3UNWA 1CEFA 2JC7A 1NLYA 4X53A 4R3BA 4MN7A 5FQKA 5TFQA 3QNBA 3CJMA 1JNUA 4M4XA 4B4XA 3R7WB 3IXGA 4XT2A 2HPBA 3LI8A 4ETXA 4OP5A 1V9ZA 1LSVA 3IT9A 3MR0A 2JHEA 4WZ5A 1D1JA 2ZLYA 3M6BA 2ZD8A 4EEUA 1LSXA 3S4XA 4N9LA 5CEBA 1NRJA 2ZM2A 5EVID 3HUOA 4GLQA 4FSFA 4S2NA 4BL3A 3N6IA 3MS6A 4HH3A 3PR6A 4GDBA 2O9AA 4CPKA 4N9KA 4ZJ3A 3FKVA 3PTEA 1RGYA 4GS9A 3N8SA 1WYCA 4DJ2A 4I3JA 4ZJ2A 5I5LA 5HPIA 4P85A 3H7WA 4HY8A 1ES2A 4PM7A 4Y0OA 3BFCA 1K25A 2HJEA 1MWSA 2VGJA 3VFHA 2XRNA 2A3UA 1F5MA 4ZRRA 5KZHA 2HZ5A 3HLGA 2EWWA 3FKWA 4CLCB 3OPHA 3BM6A 3TJZC 1JWZA 1NZOA 4I3IA 3IWQA 5DJUA 3IWOA 3FZCA 3IF6C 1OTDA 4E3KA 1DY6A 3LI9A 3BFGA 1ALQA 3RJUA 4OP8A 2DNSA 1GA9A 4WMCA 1U60A 4PMAA 4LV1A 3NOTC 2Y59A 1YLPA 2W1RA 2ZQDA 2QMIA 2HP9A 2KDKA 4LCLA 3PBOA 1LI0A 2FFYA 3IH8A 2J7VA 4OKPA 1Y54A 1FR6A 4ME4A 1A0KA 4JGPA 4B93A 4L9GA 2J3TD 2BASA 4S2OA 2NUPC
chains in the Genus database with same CATH topology
3OCLA 2YKFA 3G6OA 4LRXC 4I39A 4NEED 4BBUA 4EW7A 3CI6A 3SW1A 1YAXA 1F98A 4E04A 3H7WB 1XFQA 3R4KA 4G3KA 4QPRA 3KSHA 3K3DA 3LYXA 3D72A 4H6JB 4PKYG 4AFIA 3ICYA 4HJ6A 3RFBA 2O0YA 4GHIB 4F3LB 2PR5A 3LR0A 4WEKA 4UQIS 3VV4A 2Z6DA 5KIZA 2VX8A 5LBRA 4L9EA 4I3AA 1OTIA 1MC0A 1T19A 1V9YA 2XA7M 5G4YA 1N9OA 3FG8A 5IU1A 3IBJA 1OT9A 3BQAA 3CAXA 4P6ZS 4JGQA 3BW6A 1LSWA 3VE4A 2EWVA 2A2LA 2HF6A 3CLOA 5J3WA 3EEAA 1VHMA 2JKRM 2KLIA 5A8BA 2PT7A 4Y3IA 3C8CA 3RH8B 1IFQA 2B18A 3K3CA 5AJGA 3LIEA 3MFXA 3B33A 1EW0A 2W0NA 4ARZA 3NHQA 4WN5A 2HJ9C 4PAUA 5EFWA 3KX0X 5CX7A 1XFNA 3PBRA 4Z1WA 3S7OA 3UB9A 5HSQA 2HGVA 2VA0A 1YSQA 3OBFA 3UB8A 3LIFA 4G3VA 3RTYA 4ETZA 2PD7A 5HWTA 1LL8A 3HCYA 2H28A 4YNRA 3F1PB 3KSGA 1DP6A 2B02A 2VV6A 1ZHHB 3B47A 3GECA 2PR6A 3LIAA 2HV1A 2NUTC 4KQDA 2O9CA 1N9LA 1W63Q 3LR3A 4HI4A 4R3AA 4YWZA 1S4RA 1S4SA 3TRCA 3VOLA 4I5SA 1T1BA 4MDZA 2IA2A 2A24A 1F9IA 3EEHA 1UWNX 1GSXA 2DMWA 4PKYA 2JKTM 2PD8A 4NKPA 4LRZE 4L9FA 4Q0JA 1MKMA 4R6LA 4MCWA 4NXFA 5KSHA 5K5BA 3T50A 2OAP1 3OCNA 4HJ3A 4K08A 1MZUA 2PYRA 3FPVA 3IBRA 1S1ZA 4O0PA 3TE8A 3MQ0A 5IT5A 1WA9A 2W3DA 3DBAA 4CLCD 3KYQA 1OJGA 1OT6A 3HJIA 2W3GA 4EQ1A 2GX5A 4MN6A 2VEAA 4JGOA 1P9WA 3EWKA 3LFVA 5FL3A 1ZTUA 2J3TC 4HOIA 1TS8A 1OTEA 4ARZB 4GCZA 1BYWA 3OOVA 5J7EA 4Y5FA 4GW9A 2ZBBA 3V67A 2M1CA 2OAQ1 1ODVA 3A0VA 3EQUA 4G3WA 1LT0A 1XJ4A 3C30A 5HZHA 4DN0A 3B42A 5HDSA 1YSPA 2VV8A 3PYPA 1H3QA 2WKPA 4HQAA 3IS2A 5F5YA 2W3HA 1XJ2A 2ZMVA 2R78A 3KSFA 3MJQA 3UB6A 3F1NA 2XROA 2M7UA 3JVUA 4JGRA 1VB6A 4HIAA 4PHTA 3T4SA 3P01A 5DKLA 3T4KA 1OTAA 3NJAA 2P7JA 2CMNA 4R70A 3LUQA 3PBTA 5DJTA 4B9OA 3MQQA 4GJ4A 3OLOA 4IJGA 3ULFA 3FPWA 3GDIA 5TBMA 1T1CA 4WL9A 3T4LA 1GSWA 2VGLS 3U2AA 2JKRI 1UGUA 1P9RA 4IUKA 2OOLA 3EOIA 3LIDA 2A24B 2W27A 5DFYA 2K31A 2V0WA 2L0WA 2W3FA 4I38A 3T4OA 1TS7A 4HHDA 5F68A 3O5YA 4WF0A 1DP8A 1TS6A 4LLOB 3R7WA 1XJ6A 4NXBA 2VV7A 2FZ0A 2VJWA 3LIBA 4LRYC 2J3WA 4OOMA 1W63M 2PDRA 2FH5A 3H9WA 3UMEA 2VZWA 3MXQA 4CQHA 3S7QA 4NXEA 1OJ5A 2W1TA 4WEJA 4EXOA 1D06A 5HPFA 4EEPA 2O99A 4O8GA 2QYBA 3S7PA 2V1BA 5HWVA 4UQIM 1DRMA 4RQ9A 3LR4A 1OPXA 4HP9A 2KX6A 2L1MA 5J4EA 2MJ6A 1UWPX 4IUHA 4P6ZM 3E0YA 4UEYA 2ZMFA 2K2NA 2P04A 4MMNA 4DJ3A 1TS0A 3PBSA 4MN5A 2QWSA 4CLCE 3CWFA 3KYZA 3E4QA 2D01A 4HJ4A 4L0LA 3IS2B 5DFXA 3BJNA 2VGLM 2Y79A 3A0RA 4BWIA 2XA7S 2JKTI 3UMDA 3F1NB 1KOUA 2VKSA 3E4OA 3PBQA 3UE6A 4FOFA 4YOFA 2OWJA 3H82A 2O9BA 2JN7A 3KO6A 2QHKA 3A0SA 3C38A 2GNXA 4O01A 3K2NA 4KUOA 5TBMB 4KUKA 1S67L 5F6AA 5TJJA 1S66L 4CLCA 3NOPC 2L4RA 1S1YA 4EERA 1NLYA 3JVVA 3PHYA 4DMZA 2M7VA 4EUVA 1YKDA 4MN7A 4WLAA 2LB5A 3MMHA 2ZOHA 3BY9A 3HJKA 3T4JA 5HWWA 1IOUA 5HL6A 3ZQ5A 1H8MA 1JNUA 4M4XA 2Y8HA 3F1OA 3NOUC 5L8MA 3R7WB 4XT2A 3LI8A 1TD5A 4ETXA 1V9ZA 4WELA 1LSVA 3PBNA 3MR0A 2JHEA 5DF9A 3BWLA 3LR5A 4II7A 3S7NA 3OC2A 3TW8A 3VE3A 2J80A 2W1TB 2ZOIA 4EEUA 1LSXA 2V9AA 3W2ZA 2WKQA 3UE3A 4OOLA 1NRJA 5HD3A 4GLQA 3BY8A 5C5KA 3E4PA 3T4QA 2VLGA 5MC7A 4FSFA 4HP4A 2K7SA 4HH3A 1T18A 3C2WA 3PR6A 1STZA 1DP9A 2V0UA 5IS1A 1OTBA 2O9AA 1D7EA 5AVFA 5G4ZA 5HDCA 4Y2FA 3T4TA 2EA9A 4WUJA 4GS9A 2D02A 4BBVA 2XSSA 4DJ2A 4I3JA 2V1AA 5I5LA 5HPIA 5AVEA 3EGDC 1NLZA 5HDDA 3MF0A 3H7WA 3EGXC 4HY8A 3EQVA 2YKHA 4Q0IA 3H82B 2HJEA 1Y28A 2XRNA 4H6JA 1T1AA 4BMWA 1F5MA 1P0ZA 2QKPA 4GHIA 4ZRRA 2GZAA 3UB7A 4F3LA 1XJ3A 2EWWA 2W3EA 4CLCB 4EU0A 3PXPA 2P08A 2GJ3A 2INWA 4HNBA 1GSVA 2G7UA 3CUEC 3BQ8A 4EESA 3KSIA 3TJZC 2QJ5A 4NXGA 3LICA 4I3IA 2I9VA 5DJUA 3ZYTA 1N9NA 1NWZA 2KOIA 1OTDA 4BJPA 3F1OB 3LI9A 3CUEA 2OWHA 4XT2B 3P7NA 5DKKA 4EETB 3CITA 1TF1A 5F69A 1G6OA 4LPZA 2Z6CA 3NOTC 4CLCC 1P97A 2W1RA 1X0OA 4IHQA 3E98A 2KDKA 3PBOA 3MQOA 2WKRA 3D3OA 4R38A 1G28A 4HH2A 4BBTA 2LB9A 4ME4A 5HD5A 3F1PA 3FC7A 4JGPA 4B93A 2PHYA 4Q0HA 2PYPA 4L9GA 2J3TD 2BASA 2QJ7A 4KQOA 4GS9B 2NUPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKF A;  3G6O A;  4LRX C;  4I39 A;  4BBU A;  4EW7 A;  3SW1 A;  1F98 A;  4E04 A;  1XFQ A;  3H7W B;  3K3D A;  3LYX A;  3D72 A;  4H6J B;  4PKY G;  3ICY A;  4HJ6 A;  4GHI B;  4F3L B;  2PR5 A;  2Z6D A;  5KIZ A;  4L9E A;  4I3A A;  1OTI A;  1T19 A;  1V9Y A;  5G4Y A;  1N9O A;  3FG8 A;  5IU1 A;  1OT9 A;  3CAX A;  4JGQ A;  1LSW A;  3VE4 A;  3CLO A;  5J3W A;  5A8B A;  3C8C A;  3RH8 B;  3K3C A;  3LIE A;  3MFX A;  3B33 A;  1EW0 A;  2W0N A;  3NHQ A;  4WN5 A;  5EFW A;  3KX0 X;  1XFN A;  3UB9 A;  5HSQ A;  3UB8 A;  3LIF A;  3RTY A;  2PD7 A;  5HWT A;  1LL8 A;  2H28 A;  3F1P B;  1DP6 A;  2B02 A;  2VV6 A;  3GEC A;  2PR6 A;  3LIA A;  2HV1 A;  4KQD A;  1N9L A;  4HI4 A;  4R3A A;  4YWZ A;  1S4R A;  1S4S A;  3VOL A;  4I5S A;  1T1B A;  2A24 A;  1F9I A;  3EEH A;  1UWN X;  1GSX A;  4PKY A;  2PD8 A;  4LRZ E;  4L9F A;  4R6L A;  4NXF A;  3T50 A;  4HJ3 A;  4K08 A;  1MZU A;  2PYR A;  3IBR A;  1S1Z A;  1WA9 A;  1OJG A;  1OT6 A;  3HJI A;  4EQ1 A;  4MN6 A;  2VEA A;  4JGO A;  3EWK A;  4HOI A;  1TS8 A;  1OTE A;  4GCZ A;  1BYW A;  5J7E A;  4GW9 A;  2ZBB A;  2M1C A;  1ODV A;  3A0V A;  1LT0 A;  1XJ4 A;  5HZH A;  5HDS A;  2VV8 A;  3PYP A;  2WKP A;  4HQA A;  3IS2 A;  5F5Y A;  1XJ2 A;  2R78 A;  3MJQ A;  3UB6 A;  3F1N A;  4JGR A;  1VB6 A;  4HIA A;  5DKL A;  1OTA A;  3NJA A;  2P7J A;  2CMN A;  4R70 A;  3LUQ A;  5DJT A;  4B9O A;  3MQQ A;  3OLO A;  3ULF A;  3GDI A;  5TBM A;  1T1C A;  4WL9 A;  1GSW A;  1UGU A;  2OOL A;  3LID A;  2A24 B;  2W27 A;  2V0W A;  2L0W A;  4I38 A;  1TS7 A;  4HHD A;  5F68 A;  4WF0 A;  1DP8 A;  1TS6 A;  4LLO B;  1XJ6 A;  4NXB A;  2VV7 A;  3LIB A;  4LRY C;  2PDR A;  3UME A;  3H9W A;  3MXQ A;  4NXE A;  1OJ5 A;  4EXO A;  1D06 A;  4EEP A;  2V1B A;  5HWV A;  1DRM A;  4RQ9 A;  4HP9 A;  2KX6 A;  2L1M A;  5J4E A;  1UWP X;  4DJ3 A;  1TS0 A;  4MN5 A;  2QWS A;  3CWF A;  3E4Q A;  2D01 A;  4HJ4 A;  3IS2 B;  3A0R A;  3UMD A;  3F1N B;  1KOU A;  3E4O A;  3UE6 A;  2OWJ A;  3H82 A;  2JN7 A;  2QHK A;  3A0S A;  4KUO A;  5TBM B;  4KUK A;  1S67 L;  5F6A A;  1S66 L;  3NOP C;  2L4R A;  1S1Y A;  4EER A;  3PHY A;  4WLA A;  2ZOH A;  3BY9 A;  3HJK A;  5HWW A;  3ZQ5 A;  1JNU A;  4M4X A;  3F1O A;  3NOU C;  4XT2 A;  3LI8 A;  1V9Z A;  1LSV A;  3MR0 A;  2JHE A;  3BWL A;  3VE3 A;  2J80 A;  2ZOI A;  4EEU A;  1LSX A;  2V9A A;  2WKQ A;  5HD3 A;  3BY8 A;  3E4P A;  2VLG A;  4HP4 A;  2K7S A;  4HH3 A;  1T18 A;  3C2W A;  1DP9 A;  2V0U A;  5IS1 A;  1OTB A;  1D7E A;  5AVF A;  5G4Z A;  5HDC A;  2EA9 A;  4WUJ A;  4GS9 A;  2D02 A;  4BBV A;  4DJ2 A;  4I3J A;  2V1A A;  5I5L A;  5AVE A;  5HDD A;  3H7W A;  4HY8 A;  2YKH A;  3H82 B;  1Y28 A;  4H6J A;  1T1A A;  1P0Z A;  2QKP A;  4GHI A;  3UB7 A;  4F3L A;  1XJ3 A;  2GJ3 A;  2INW A;  4HNB A;  1GSV A;  4EES A;  2QJ5 A;  4NXG A;  3LIC A;  4I3I A;  2I9V A;  5DJU A;  1N9N A;  1NWZ A;  1OTD A;  3F1O B;  3LI9 A;  2OWH A;  4XT2 B;  3P7N A;  5DKK A;  4EET B;  5F69 A;  4LPZ A;  2Z6C A;  3NOT C;  1P97 A;  1X0O A;  2KDK A;  3MQO A;  2WKR A;  4R38 A;  1G28 A;  4HH2 A;  4BBT A;  5HD5 A;  3F1P A;  3FC7 A;  4JGP A;  2PHY A;  2PYP A;  4L9G A;  2BAS A;  2QJ7 A;  4GS9 B; 
#chains in the Genus database with same CATH topology
 3OCL A;  4LRX C;  2XR0 A;  4EW7 A;  4ID4 A;  3CI6 A;  3IXD A;  1YAX A;  1F98 A;  2OLV A;  3ZHH A;  3ZFZ A;  2EX2 A;  4ZDX A;  3KSH A;  3N8L A;  1W7F A;  1ZG6 A;  3D72 A;  3VP1 A;  2XH9 A;  4D60 A;  3ICY A;  4GHI B;  2HDU A;  1ERM A;  5LBR A;  2ZL1 B;  1BUE A;  5L07 A;  1OTI A;  1SCW A;  3BRM A;  2V8C A;  3FG8 A;  5G4Y A;  5IU1 A;  3IBJ A;  3BQA A;  4JGQ A;  3BW6 A;  4BLM A;  4QY6 A;  5A8B A;  4Y3I A;  3RH8 B;  5FAT A;  1IFQ A;  3K3C A;  5AJG A;  3NDG A;  3WS2 A;  1CK3 A;  3VOY A;  4ARZ A;  1RP5 A;  1ES3 A;  3C7U A;  4Y17 A;  2V8F A;  4PAU A;  3G30 A;  1YMS A;  3PBR A;  5EUA A;  4C3Q A;  4B88 A;  3S7O A;  4XUX A;  4Y7P A;  4E6X A;  1CI9 A;  2HDS A;  3GRJ A;  4JXG A;  3VSL A;  3RTY A;  3MBZ A;  4IBX A;  2PD7 A;  2V1Z A;  4NG2 A;  1MWT A;  4F94 A;  5CED A;  3ZCZ A;  4OPR A;  1LHY A;  4N1X A;  1NZU A;  2B02 A;  5F82 A;  3LIA A;  2X71 A;  2HV1 A;  1K4E A;  1PW8 A;  2WGI A;  4R3A A;  4DKI A;  5L09 A;  5EPH A;  5GHZ A;  1S4S A;  1FCO A;  1PI5 A;  3VOL A;  1YLT A;  2J8Y A;  1F9I A;  1K56 D;  3EEH A;  4GDN A;  3NBL A;  2DMW A;  2HP5 A;  4PKY A;  2JKT M;  2PD8 A;  4LRZ E;  3DTE A;  3ZG0 A;  4Q0J A;  3CMZ A;  2WAF A;  4RX2 A;  2OAP 1;  4K08 A;  4O0P A;  4JXW A;  5IT5 A;  1S1Z A;  1BT5 A;  1WA9 A;  2BTF P;  5CTM A;  1QME A;  3S1Y A;  3D4F A;  1ES4 A;  2A49 A;  2ZC7 A;  4YIN A;  4BD1 A;  1FIK A;  4JGO A;  5EVI B;  4GOG A;  2OV5 A;  4S2I A;  4UA6 A;  2Y2M A;  4DE0 A;  5FQJ A;  4NK3 A;  2Z2L B;  4GCZ A;  4EUZ A;  4Y5F A;  5E2E A;  1ONG A;  5HAP A;  3V67 A;  1ODV A;  1XJ4 A;  4ZJ1 A;  5HDS A;  3PYP A;  3ZG7 B;  1MXO A;  2WKP A;  3IS2 A;  3NCK A;  2W3H A;  1XJ2 A;  4OQG A;  3UO9 A;  2C5W B;  1I2S A;  1VB6 A;  1ERO A;  4HIA A;  3T4S A;  2P7J A;  5FI2 A;  1WE4 A;  4IJG A;  3ULF A;  1T1C A;  2WK0 A;  1CEG A;  4PPR A;  2JKR I;  1H0M A;  1P9R A;  2A24 B;  2W27 A;  1Q2P A;  2W3F A;  4I38 A;  3VP3 A;  2WGW A;  1E25 A;  4WF0 A;  1DP8 A;  4PM8 A;  5IHV A;  1L3L A;  4FD8 A;  3IX4 A;  5EE8 A;  1AXB A;  4OOM A;  3ZNT A;  4CQH A;  1OJ5 A;  5HPF A;  1VET A;  2EFU A;  2Q9N A;  2XFS A;  3HVF A;  1DRM A;  3LR4 A;  4HP9 A;  1BLH A;  2KX6 A;  5HW3 A;  4UAA A;  5J4E A;  2ZC3 B;  4WMC D;  4FCF A;  4OPQ A;  1XP4 A;  2WZX A;  4MMN A;  4MN5 A;  2QWS A;  3G32 A;  4X1M A;  1FSW A;  4PM9 A;  3BFF A;  2Y79 A;  1YLZ A;  3IHA A;  3IH9 A;  3F1N B;  2R9W A;  3H82 A;  5L10 A;  1DJC A;  2QHK A;  3A0S A;  3C38 A;  2GNX A;  5FAQ A;  3UPN A;  4KZ8 A;  3LY4 A;  3FYZ A;  1S1Y A;  2ZM8 A;  2XGN A;  4EER A;  3JVV A;  2M7V A;  2XLN A;  1YKD A;  3C7V A;  3BY9 A;  3W4O A;  3T4J A;  4EBP A;  5HL6 A;  3UPO A;  1K6R A;  2Y8H A;  3F1O A;  2GDN A;  2IWB A;  1TD5 A;  4WEL A;  5DF9 A;  3GR2 A;  3S7N A;  3VE3 A;  5L2F A;  2V9A A;  3UE3 A;  5FDS A;  2UV0 E;  4Y0U A;  3ZG9 B;  3E4P A;  4HP4 A;  3IWI A;  3M2K A;  5FA7 A;  5FI6 A;  2XFT A;  5IS1 A;  4O7D A;  1OTB A;  3C5A A;  1GA0 A;  4JF6 A;  5HDC A;  4Y2F A;  4C6Y A;  1FSY A;  3N4I A;  2EA9 A;  4WUJ A;  2Z2M B;  3G35 A;  3MFD A;  2V1A A;  3AGD A;  1BSG A;  4BD0 A;  2Y2G A;  1HTZ A;  1NLZ A;  3MF0 A;  4X68 A;  1BLP A;  5AQB A;  3OPP A;  3BYD A;  3DW0 A;  5DTT A;  4BMW A;  2QKP A;  4PM6 A;  3JPU A;  1XJ3 A;  2W3E A;  3NI9 A;  4EU0 A;  3PXP A;  4BEN A;  3VP4 A;  3PAG A;  3HBR A;  3IX8 A;  4OQI A;  4EES A;  3KSI A;  4NXG A;  2J9O A;  2I9V A;  5CGX A;  3ZYT A;  2ZQC A;  3SH9 A;  1N9N A;  1KDW A;  3A3D A;  3CUE A;  3O87 A;  4XT2 B;  1HLU P;  3P7N A;  5J8X A;  4M3K A;  1MKI A;  5DKK A;  2WZZ A;  4LPZ A;  1K54 A;  5A90 A;  1ZG4 A;  1X0O A;  4U0X A;  4HES A;  3E98 A;  4IBR A;  2UWX A;  4R38 A;  2WKR A;  4MEZ A;  1G28 A;  1NYM A;  4Y13 A;  4HH2 A;  4BBT A;  5FQM A;  5HD5 A;  3F1P A;  2BLS A;  1M40 A;  4RYE A;  4GS9 B;  2QPN A;  4BBU A;  4B4Z A;  4X6T A;  4DF6 A;  3MZE A;  1K4F A;  5GLB A;  2ZJ9 A;  4X25 A;  3H7W B;  4E3J A;  2JKF A;  2ZQ7 A;  3K3D A;  4Z9Q A;  3LYX A;  5GLD A;  2O0Y A;  3SH8 A;  2PR5 A;  3DTM A;  2VX8 A;  4GNU A;  4I3A A;  5CXW A;  1MC0 A;  4LV2 A;  1N9O A;  1Z09 A;  1SZV A;  4E3N A;  3CAX A;  3VE4 A;  1FR1 A;  4K0W A;  2HF6 A;  1VHM A;  2KLI A;  3MZF A;  5TGF A;  1XA7 A;  4KG2 A;  2ZMA A;  2AVX A;  2EXB A;  3L9K A;  4OPY A;  3B33 A;  1EW0 A;  2P74 A;  3NHQ A;  4U0T A;  3UPP A;  4WN5 A;  2WYX A;  5EFW A;  3KX0 X;  1XFN A;  1K38 A;  1TDL A;  5AQ7 A;  5HSQ A;  3T1X A;  3NY4 A;  4LV0 A;  1MWR A;  2VA0 A;  3OBF A;  3UB8 A;  3VSK A;  1LL8 A;  1IYO A;  4R3J A;  2H28 A;  1KE3 A;  4N92 A;  3A3I A;  4QHC A;  3UDF A;  1DP6 A;  1QMF A;  3B47 A;  2PR6 A;  3UDI A;  1SKF A;  2B5R A;  2Q9M A;  1W63 Q;  1K55 C;  1KVM A;  4YWZ A;  1PYY A;  3AGF A;  2B95 A;  1S4R A;  3Q1F A;  3W8K A;  1G5U A;  3TRC A;  3GVB A;  3VOZ A;  1T1B A;  2IA2 A;  5GHY A;  4S2L A;  4DDY A;  1UWN X;  5E2F A;  4NKP A;  1MKM A;  4NXF A;  5K5B A;  3T50 A;  3TE8 A;  4HJ3 A;  3MQ0 A;  4QJG A;  1KGF A;  3KYQ A;  2W3G A;  1TVF A;  3L7H A;  1K57 A;  4XUZ A;  2VEA A;  3TG9 A;  1P9W A;  4DE1 A;  3C4P A;  5FL3 A;  4ZBE A;  2J3T C;  1CJF A;  4ARZ B;  1YM1 A;  5J7E A;  5KSC A;  4HEF A;  1K6S A;  2H5S A;  4GW9 A;  1SKO A;  5HX9 A;  2OAQ 1;  3IXB A;  1XPB A;  3EQU A;  4G3W A;  4WBG A;  1FIL A;  1YSP A;  4HQA A;  3LCE A;  3HLF A;  5F5Y A;  1WYB A;  2JCH A;  2ZMV A;  3KSF A;  2ZQ9 A;  2M7U A;  4S2K A;  5I94 A;  5EM0 A;  3NJA A;  3SOI A;  2Y2J A;  2WKE A;  3PBT A;  4B9O A;  4GJ4 A;  3CPT A;  5A92 A;  3FPW A;  4A5R A;  3T4L A;  1GSW A;  4EV4 A;  3EOI A;  2L0W A;  3DAV A;  3P98 A;  4HHD A;  3O5Y A;  2WAD A;  5FAP A;  1OME A;  1XJ6 A;  4NXB A;  1ERQ A;  2VV7 A;  3IF5 A;  1PWC A;  3GV9 A;  2JE5 A;  3DTI A;  1W63 M;  2PDR A;  2FH5 A;  3UME A;  3ZDJ A;  4GZB A;  1MPL A;  2W1T A;  2P9V A;  3Q82 A;  4EEP A;  2PRF A;  2O99 A;  2QYB A;  3ISG A;  1OPX A;  3N7W A;  1KE4 A;  1LL5 A;  4UHU A;  2MJ6 A;  3E0Y A;  2PU4 A;  2ZMF A;  5F83 A;  4OQH A;  1H8Y A;  1XKZ A;  2P04 A;  1TS0 A;  3CWF A;  2D01 A;  4HJ4 A;  3IS2 B;  5DFX A;  1NY0 A;  3ITB A;  1N9B A;  2HDQ A;  3BFE A;  3UN7 A;  4OH0 A;  4Y0T A;  4EBN A;  2J9P A;  2WKI A;  3LY3 A;  5DF8 A;  4IED A;  2O9B A;  4O01 A;  2X02 A;  2V2F F;  5U47 A;  1YLW A;  5TR7 A;  3NOP C;  2L4R A;  4EQI A;  1VM1 A;  4DMZ A;  1PZP A;  2Y2Q A;  2LB5 A;  3MMH A;  3HJK A;  2WGW B;  3LGO A;  3ZQ5 A;  1H8M A;  1SHV A;  3NOU C;  1XXM A;  4KZ3 A;  3LR5 A;  3ZVT A;  4II7 A;  2DCF A;  2ZOI A;  1ONH A;  4S2N C;  1VET B;  3SZT A;  4OOL A;  2OSU A;  5HD3 A;  4PM5 A;  3QHY A;  5C5K A;  5MC7 A;  1XX2 A;  2PU2 A;  1T18 A;  3C2W A;  5FI7 A;  1FQG A;  3ZVW A;  3T1Q B;  2ZQ8 A;  3SS5 A;  2XF3 A;  3NIA A;  4QY5 A;  3T4T A;  2D02 A;  3IX3 A;  2PBD P;  2XSS A;  1KVL A;  5AVE A;  3P09 A;  3WRT A;  5HDD A;  4EBL A;  1DJB A;  3H82 B;  2IWC A;  1Y28 A;  4HBT A;  4H6J A;  5CHM A;  3E2L A;  4JBF A;  2G2W A;  2GZA A;  3UB7 A;  4F3L A;  3HLC A;  4RA7 A;  4X1L A;  1DJA A;  3A3J A;  4RVA A;  4GD8 A;  2GJ3 A;  4HNB A;  1GSV A;  3BQ8 A;  4DXC A;  2XDM A;  3LIC A;  4X69 A;  5JYP A;  1IYP A;  1JTD A;  3Q07 A;  2KOI A;  3F1O B;  3BLS A;  4JF5 A;  5EVL A;  2OWH A;  3CIT A;  1TF1 A;  5FQI A;  4MBF A;  3HLW A;  3IF6 A;  1G6O A;  2BG1 A;  2H10 A;  5M1A A;  1K55 A;  4DDS A;  4CLC C;  1P97 A;  1M6K A;  2VK3 A;  2XD1 A;  3Q7Z A;  3QNC A;  2EX6 A;  5FEG A;  1W8Q A;  3MQO A;  1NXY A;  2FFF B;  1VEU A;  1HVB A;  4OLG A;  4D2O A;  4KQR A;  2V20 A;  3MKE A;  4KZ5 A;  2LB9 A;  3UDX A;  3C4O A;  1JWP A;  2ZC5 B;  3Q7V A;  3FC7 A;  1YLJ A;  2PHY A;  2EXA A;  1RGZ A;  5CRF A;  4BL2 A;  4KQO A;  4DE3 A;  1G68 A;  4P87 A;  3R4K A;  4G3K A;  4KZA A;  3NUL A;  2Y2L A;  3RFB A;  3UE0 A;  1S0W A;  2RL3 A;  1MWU A;  2Q0O A;  3LR0 A;  3TOI A;  1F2K A;  1AWI A;  4FUW A;  1LSW A;  2EWV A;  2A2L A;  3QP6 A;  3CLO A;  3EEA A;  2Y91 A;  2JKR M;  1XGJ A;  2PT7 A;  3C8C A;  1KE0 A;  4IVI A;  3LIE A;  3MFX A;  3TSG A;  5E43 A;  4XXR A;  5D3O A;  4NET A;  3BEB A;  2HJ9 C;  1JWV A;  1EWZ A;  5CX7 A;  4P6B A;  5HAR A;  3NEC A;  1W8Y A;  2HGV A;  5GHX A;  3HUM A;  4N1H A;  1PI4 A;  4H8R A;  3LIF A;  1W79 A;  4KG6 A;  5FQ9 A;  5GLA A;  5HWT A;  4WZ4 A;  4QWO A;  3HCY A;  4YNR A;  2PBY A;  5EV0 A;  3F1P B;  2Y2O A;  2EX9 A;  5CEC A;  3D9Y A;  3GEC A;  2NUT C;  4KQD A;  1N9L A;  4DE2 A;  4JXS A;  4HI4 A;  1W5D A;  1YLY A;  1N4O A;  3RXW A;  5HFO A;  4OVD A;  2H0T A;  4E3M A;  4MDZ A;  4X55 A;  4K91 A;  3OZH A;  5M19 A;  4K0X A;  4R6L A;  1GHM A;  3QP8 A;  3VMA A;  3G34 A;  2PYR A;  3FPV A;  3IBR A;  1NRF A;  1SDN A;  2W3D A;  1IYS A;  1OJG A;  3HJI A;  1BUL A;  1HZO A;  2GX5 A;  3M2J A;  1IKI A;  3ZG8 B;  4MN6 A;  1O7E A;  3LFV A;  2JKG A;  1ZTU A;  4WYY A;  1IKG A;  1TS8 A;  1OTE A;  1VQQ A;  5A91 A;  1PRQ A;  5E2H A;  2ZBB A;  3CG5 A;  1XA1 A;  3C30 A;  1S6R A;  5HZH A;  4DN0 A;  2X01 A;  3V50 A;  2VV8 A;  3ZGA B;  4JF4 A;  5A93 A;  3MXR A;  3NC8 A;  4R4R A;  5EVI C;  1E3U A;  5G18 A;  3MJQ A;  3UB6 A;  2XRO A;  4JGR A;  3P01 A;  4E6W A;  1OTA A;  1ACF A;  1SDE A;  2CMN A;  5DJT A;  3MQQ A;  3OLO A;  1J9M A;  1LL9 A;  3GDI A;  5TBM A;  1K0K A;  4S2M A;  5DTS A;  3V39 A;  3HL9 A;  2WGV A;  2OLU A;  1UGU A;  4IUK A;  3U4L P;  2Y2I A;  2E8J A;  2K31 A;  2V0W A;  4E3L A;  3JYI A;  3T4O A;  1TS7 A;  3T1R A;  3R7W A;  3E2K A;  4HBU A;  5FAO A;  3W4P A;  4E3O A;  1CQA A;  2FZ0 A;  3LIB A;  3BEC A;  3S7Q A;  4EXO A;  1D06 A;  3LO7 A;  2V1B A;  5GLC A;  4QB8 A;  2L1M A;  2ZQA A;  1UWP X;  4IUH A;  3V3S A;  4LGW A;  1L0F A;  1SKO B;  2Y2K A;  2K2N A;  3IXH A;  3G2Z A;  4DJ3 A;  3WWX A;  3PBS A;  2CC1 A;  4CLC E;  5KMW A;  4Y15 A;  3KYZ A;  3E4Q A;  3BJN A;  2VGL M;  3A0R A;  4BWI A;  2XA7 S;  2JKT I;  4BQM A;  3UMD A;  2EFX A;  1KOU A;  3HUN A;  3E4O A;  3PBQ A;  3UE6 A;  4YOF A;  1EI5 A;  5EVE A;  5CGW A;  1PWG A;  1KGE A;  3T12 B;  4DXB A;  3K2N A;  4KUO A;  3ZG5 A;  3CPT B;  4YFM A;  4X56 A;  5EOO A;  5F6A A;  4C75 A;  1S66 L;  4CLC A;  1JVJ A;  3Q81 A;  3CZD A;  3PHY A;  4JKT A;  4EUV A;  4WLA A;  2ZOH A;  1ZC2 A;  1YMX A;  3SH7 A;  5HWW A;  1IOU A;  4OQ0 A;  2E8I A;  4LEN A;  3QP1 A;  5L8M A;  1HD8 A;  4ESP A;  1L0E A;  3W4Q A;  3SS4 A;  3PBN A;  3WS5 A;  3BWL A;  5CTN A;  3OC2 A;  3TW8 A;  5DF7 A;  1Z6F A;  2J80 A;  2W1T B;  2P9V B;  1GHP A;  3W2Z A;  3IHB A;  5BOH A;  3OPL A;  4P0M A;  2WKQ A;  1O07 A;  3IQA A;  5F1F A;  3BY8 A;  3UE1 A;  3GQZ A;  3T4Q A;  2VLG A;  4KZ7 A;  4MLL A;  1BTL A;  4R0Q A;  4KQQ A;  2K7S A;  1STZ A;  1DP9 A;  2V0U A;  1PWD A;  1LLB A;  4E3I A;  4MBH A;  1D7E A;  1CF0 A;  5AVF A;  5G4Z A;  3M6H A;  1FCM A;  2ZC6 B;  4BBV A;  1GHI A;  3EGD C;  3N8R A;  4WM9 A;  3EGX C;  1C3B A;  3EQV A;  4Q0I A;  2WUQ A;  2YKH A;  2ZC4 B;  1MY8 A;  3O88 A;  4MNR A;  4MBK A;  1T1A A;  1P0Z A;  4GHI A;  1ES5 A;  3HLE A;  4DRT A;  5EEC A;  2EX8 A;  2ZL1 A;  2P08 A;  2INW A;  2G7U A;  3CUE C;  2QJ5 A;  4KZ9 A;  3LEQ A;  1I5Q A;  2ZM0 A;  1ESI A;  4OLD A;  3ITA A;  1NWZ A;  4BJP A;  1H8Z A;  3DTK A;  1K54 C;  4EET B;  5F69 A;  5EM1 A;  2Z6C A;  4CJN A;  5M18 A;  4R23 A;  3OPR A;  2XQZ A;  3HLD A;  4IHQ A;  5E2G A;  3O3V A;  1PFL A;  5FAS A;  1GCE A;  2C6W B;  3D3O A;  1JTG A;  2HDR A;  4OOY A;  2XEP A;  4Q8I A;  4Q0H A;  2PYP A;  3SS3 A;  3HRE A;  4WZ5 C;  2QJ7 A;  3FV7 A;  1PIO A;  3S22 A;  5DVA A;  2YKF A;  3G6O A;  5CHJ A;  4I39 A;  4NEE D;  3I7J A;  3SW1 A;  1YPR A;  1MBL A;  4E04 A;  2G2U A;  4JXV A;  1XFQ A;  4R1G A;  4QPR A;  5FSR A;  1E3U D;  4OPZ A;  2WAE A;  1Y4O A;  1PZO A;  1XGI A;  4H6J B;  4PKY G;  4AFI A;  4HJ6 A;  2DRW A;  2R9X A;  4KZ6 A;  4F3L B;  4WEK A;  4UQI S;  4GN2 A;  3VV4 A;  2Z6D A;  3MXS A;  5KIZ A;  3FWL A;  1RCJ A;  4L9E A;  3VP2 A;  1T19 A;  1V9Y A;  2XA7 M;  3BLM A;  1OT9 A;  4P6Z S;  4GD6 A;  5DTK A;  5FDH A;  5J3W A;  3QP2 A;  5EVI A;  2IWD A;  3QP5 A;  2B18 A;  4OON A;  5EOE A;  3IF6 B;  2W0N A;  4KG5 A;  3VP0 A;  5FQQ A;  3NDE A;  3T1S A;  3V5M A;  4GB7 A;  2Y2P A;  5FEF A;  4EWF A;  4Z1W A;  3UB9 A;  3A3E A;  1YSQ A;  1VEU B;  2Y55 A;  3UY6 A;  4G3V A;  2XK1 A;  4ETZ A;  3B3X A;  3MKF A;  1PW1 A;  3Q7V B;  3KSG A;  3CHW P;  4JLF A;  2VV6 A;  1ZHH B;  4RX3 A;  2O9C A;  3LR3 A;  4LFU A;  1BLS A;  1G6A A;  5JYO A;  5CGS A;  4I5S A;  1PNE A;  2A24 A;  2PAV P;  1GSX A;  3O86 A;  4L9F A;  1IEL A;  4MCW A;  2Y2N A;  5KSH A;  1L2S A;  3OCN A;  1MZU A;  3UB5 P;  1IYQ A;  1LI9 A;  1K57 C;  3DBA A;  4CLC D;  3GSG A;  1OT6 A;  4GKU A;  4S2P A;  2WKH A;  4EQ1 A;  1Q2Q A;  3DWZ A;  1NJ4 A;  1YQS A;  2HP6 A;  1ZKJ A;  3G31 A;  4UA9 A;  1KGG A;  3EWK A;  1NYY A;  4HOI A;  4FTX A;  3DWK A;  1BYW A;  3OOV A;  2Y2H A;  1ESU A;  3WS4 A;  4KZB A;  2M1C A;  3WS1 A;  3A0V A;  1J3W A;  3MZD A;  3GMW A;  2XD5 A;  1LT0 A;  5F1G A;  3B42 A;  1FCN A;  1H3Q A;  1BLC A;  5HL1 A;  1FOF A;  3AGE A;  5AQ9 A;  1E4D A;  1L0G A;  1IEM A;  5AQA A;  2R78 A;  3VFF A;  3F1N A;  3JVU A;  4PHT A;  2I72 A;  5DKL A;  3T4K A;  4R70 A;  3LUQ A;  4WL9 A;  2VGL S;  3U2A A;  3BFD A;  4LV3 A;  2Y4A A;  4FH2 A;  2OOL A;  1CI8 A;  1I2W A;  3LID A;  5DFY A;  4LCM A;  4S2J A;  5F68 A;  4R4S A;  3QP4 A;  3RXX A;  1TS6 A;  4LLO B;  3WS0 A;  2VJW A;  4QD4 A;  4LRY C;  2ACG A;  2J3W A;  3H9W A;  2VZW A;  3MXQ A;  4NXE A;  4WEJ A;  4FH4 A;  2H0Y A;  3WRZ A;  4O8G A;  2VGK A;  3PAE A;  3HLB A;  3S7P A;  3LEZ A;  4UQI M;  5HWV A;  4RQ9 A;  5CHU A;  4JPM A;  1L0D A;  4KZ4 A;  1H5X A;  4UA7 A;  4P6Z M;  3ZNY A;  5HAI A;  2RCX A;  4UEY A;  2JBF A;  1KDS A;  3A3F A;  3G4P A;  4L0L A;  3GTC A;  4KEN B;  5HAQ A;  1BZA A;  4ZAM A;  2VKS A;  4QU3 A;  3V3R A;  4FOF A;  4IVK A;  1K56 A;  2OWJ A;  3KYE A;  3MSH A;  2QZ6 A;  2JN7 A;  4U3T A;  3KO6 A;  4ZTK A;  1TEM A;  5GL9 A;  5TBM B;  4KUK A;  1TDG A;  1S67 L;  5TJJ A;  5CER A;  1YT4 A;  3G2Y A;  3UNW A;  1CEF A;  2JC7 A;  1NLY A;  4X53 A;  4R3B A;  4MN7 A;  5FQK A;  5TFQ A;  3QNB A;  3CJM A;  1JNU A;  4M4X A;  4B4X A;  3R7W B;  3IXG A;  4XT2 A;  2HPB A;  3LI8 A;  4ETX A;  4OP5 A;  1V9Z A;  1LSV A;  3IT9 A;  3MR0 A;  2JHE A;  4WZ5 A;  1D1J A;  2ZLY A;  3M6B A;  2ZD8 A;  4EEU A;  1LSX A;  3S4X A;  4N9L A;  5CEB A;  1NRJ A;  2ZM2 A;  5EVI D;  3HUO A;  4GLQ A;  4FSF A;  4S2N A;  4BL3 A;  3N6I A;  3MS6 A;  4HH3 A;  3PR6 A;  4GDB A;  2O9A A;  4CPK A;  4N9K A;  4ZJ3 A;  3FKV A;  3PTE A;  1RGY A;  4GS9 A;  3N8S A;  1WYC A;  4DJ2 A;  4I3J A;  4ZJ2 A;  5I5L A;  5HPI A;  4P85 A;  3H7W A;  4HY8 A;  1ES2 A;  4PM7 A;  4Y0O A;  3BFC A;  1K25 A;  2HJE A;  1MWS A;  2VGJ A;  3VFH A;  2XRN A;  2A3U A;  1F5M A;  4ZRR A;  5KZH A;  2HZ5 A;  3HLG A;  2EWW A;  3FKW A;  4CLC B;  3OPH A;  3BM6 A;  3TJZ C;  1JWZ A;  1NZO A;  4I3I A;  3IWQ A;  5DJU A;  3IWO A;  3FZC A;  3IF6 C;  1OTD A;  4E3K A;  1DY6 A;  3LI9 A;  3BFG A;  1ALQ A;  3RJU A;  4OP8 A;  2DNS A;  1GA9 A;  4WMC A;  1U60 A;  4PMA A;  4LV1 A;  3NOT C;  2Y59 A;  1YLP A;  2W1R A;  2ZQD A;  2QMI A;  2HP9 A;  2KDK A;  4LCL A;  3PBO A;  1LI0 A;  2FFY A;  3IH8 A;  2J7V A;  4OKP A;  1Y54 A;  1FR6 A;  4ME4 A;  1A0K A;  4JGP A;  4B93 A;  4L9G A;  2J3T D;  2BAS A;  4S2O A;  2NUP C; 
#chains in the Genus database with same CATH homology
 3OCL A;  2YKF A;  3G6O A;  4LRX C;  4I39 A;  4NEE D;  4BBU A;  4EW7 A;  3CI6 A;  3SW1 A;  1YAX A;  1F98 A;  4E04 A;  3H7W B;  1XFQ A;  3R4K A;  4G3K A;  4QPR A;  3KSH A;  3K3D A;  3LYX A;  3D72 A;  4H6J B;  4PKY G;  4AFI A;  3ICY A;  4HJ6 A;  3RFB A;  2O0Y A;  4GHI B;  4F3L B;  2PR5 A;  3LR0 A;  4WEK A;  4UQI S;  3VV4 A;  2Z6D A;  5KIZ A;  2VX8 A;  5LBR A;  4L9E A;  4I3A A;  1OTI A;  1MC0 A;  1T19 A;  1V9Y A;  2XA7 M;  5G4Y A;  1N9O A;  3FG8 A;  5IU1 A;  3IBJ A;  1OT9 A;  3BQA A;  3CAX A;  4P6Z S;  4JGQ A;  3BW6 A;  1LSW A;  3VE4 A;  2EWV A;  2A2L A;  2HF6 A;  3CLO A;  5J3W A;  3EEA A;  1VHM A;  2JKR M;  2KLI A;  5A8B A;  2PT7 A;  4Y3I A;  3C8C A;  3RH8 B;  1IFQ A;  2B18 A;  3K3C A;  5AJG A;  3LIE A;  3MFX A;  3B33 A;  1EW0 A;  2W0N A;  4ARZ A;  3NHQ A;  4WN5 A;  2HJ9 C;  4PAU A;  5EFW A;  3KX0 X;  5CX7 A;  1XFN A;  3PBR A;  4Z1W A;  3S7O A;  3UB9 A;  5HSQ A;  2HGV A;  2VA0 A;  1YSQ A;  3OBF A;  3UB8 A;  3LIF A;  4G3V A;  3RTY A;  4ETZ A;  2PD7 A;  5HWT A;  1LL8 A;  3HCY A;  2H28 A;  4YNR A;  3F1P B;  3KSG A;  1DP6 A;  2B02 A;  2VV6 A;  1ZHH B;  3B47 A;  3GEC A;  2PR6 A;  3LIA A;  2HV1 A;  2NUT C;  4KQD A;  2O9C A;  1N9L A;  1W63 Q;  3LR3 A;  4HI4 A;  4R3A A;  4YWZ A;  1S4R A;  1S4S A;  3TRC A;  3VOL A;  4I5S A;  1T1B A;  4MDZ A;  2IA2 A;  2A24 A;  1F9I A;  3EEH A;  1UWN X;  1GSX A;  2DMW A;  4PKY A;  2JKT M;  2PD8 A;  4NKP A;  4LRZ E;  4L9F A;  4Q0J A;  1MKM A;  4R6L A;  4MCW A;  4NXF A;  5KSH A;  5K5B A;  3T50 A;  2OAP 1;  3OCN A;  4HJ3 A;  4K08 A;  1MZU A;  2PYR A;  3FPV A;  3IBR A;  1S1Z A;  4O0P A;  3TE8 A;  3MQ0 A;  5IT5 A;  1WA9 A;  2W3D A;  3DBA A;  4CLC D;  3KYQ A;  1OJG A;  1OT6 A;  3HJI A;  2W3G A;  4EQ1 A;  2GX5 A;  4MN6 A;  2VEA A;  4JGO A;  1P9W A;  3EWK A;  3LFV A;  5FL3 A;  1ZTU A;  2J3T C;  4HOI A;  1TS8 A;  1OTE A;  4ARZ B;  4GCZ A;  1BYW A;  3OOV A;  5J7E A;  4Y5F A;  4GW9 A;  2ZBB A;  3V67 A;  2M1C A;  2OAQ 1;  1ODV A;  3A0V A;  3EQU A;  4G3W A;  1LT0 A;  1XJ4 A;  3C30 A;  5HZH A;  4DN0 A;  3B42 A;  5HDS A;  1YSP A;  2VV8 A;  3PYP A;  1H3Q A;  2WKP A;  4HQA A;  3IS2 A;  5F5Y A;  2W3H A;  1XJ2 A;  2ZMV A;  2R78 A;  3KSF A;  3MJQ A;  3UB6 A;  3F1N A;  2XRO A;  2M7U A;  3JVU A;  4JGR A;  1VB6 A;  4HIA A;  4PHT A;  3T4S A;  3P01 A;  5DKL A;  3T4K A;  1OTA A;  3NJA A;  2P7J A;  2CMN A;  4R70 A;  3LUQ A;  3PBT A;  5DJT A;  4B9O A;  3MQQ A;  4GJ4 A;  3OLO A;  4IJG A;  3ULF A;  3FPW A;  3GDI A;  5TBM A;  1T1C A;  4WL9 A;  3T4L A;  1GSW A;  2VGL S;  3U2A A;  2JKR I;  1UGU A;  1P9R A;  4IUK A;  2OOL A;  3EOI A;  3LID A;  2A24 B;  2W27 A;  5DFY A;  2K31 A;  2V0W A;  2L0W A;  2W3F A;  4I38 A;  3T4O A;  1TS7 A;  4HHD A;  5F68 A;  3O5Y A;  4WF0 A;  1DP8 A;  1TS6 A;  4LLO B;  3R7W A;  1XJ6 A;  4NXB A;  2VV7 A;  2FZ0 A;  2VJW A;  3LIB A;  4LRY C;  2J3W A;  4OOM A;  1W63 M;  2PDR A;  2FH5 A;  3H9W A;  3UME A;  2VZW A;  3MXQ A;  4CQH A;  3S7Q A;  4NXE A;  1OJ5 A;  2W1T A;  4WEJ A;  4EXO A;  1D06 A;  5HPF A;  4EEP A;  2O99 A;  4O8G A;  2QYB A;  3S7P A;  2V1B A;  5HWV A;  4UQI M;  1DRM A;  4RQ9 A;  3LR4 A;  1OPX A;  4HP9 A;  2KX6 A;  2L1M A;  5J4E A;  2MJ6 A;  1UWP X;  4IUH A;  4P6Z M;  3E0Y A;  4UEY A;  2ZMF A;  2K2N A;  2P04 A;  4MMN A;  4DJ3 A;  1TS0 A;  3PBS A;  4MN5 A;  2QWS A;  4CLC E;  3CWF A;  3KYZ A;  3E4Q A;  2D01 A;  4HJ4 A;  4L0L A;  3IS2 B;  5DFX A;  3BJN A;  2VGL M;  2Y79 A;  3A0R A;  4BWI A;  2XA7 S;  2JKT I;  3UMD A;  3F1N B;  1KOU A;  2VKS A;  3E4O A;  3PBQ A;  3UE6 A;  4FOF A;  4YOF A;  2OWJ A;  3H82 A;  2O9B A;  2JN7 A;  3KO6 A;  2QHK A;  3A0S A;  3C38 A;  2GNX A;  4O01 A;  3K2N A;  4KUO A;  5TBM B;  4KUK A;  1S67 L;  5F6A A;  5TJJ A;  1S66 L;  4CLC A;  3NOP C;  2L4R A;  1S1Y A;  4EER A;  1NLY A;  3JVV A;  3PHY A;  4DMZ A;  2M7V A;  4EUV A;  1YKD A;  4MN7 A;  4WLA A;  2LB5 A;  3MMH A;  2ZOH A;  3BY9 A;  3HJK A;  3T4J A;  5HWW A;  1IOU A;  5HL6 A;  3ZQ5 A;  1H8M A;  1JNU A;  4M4X A;  2Y8H A;  3F1O A;  3NOU C;  5L8M A;  3R7W B;  4XT2 A;  3LI8 A;  1TD5 A;  4ETX A;  1V9Z A;  4WEL A;  1LSV A;  3PBN A;  3MR0 A;  2JHE A;  5DF9 A;  3BWL A;  3LR5 A;  4II7 A;  3S7N A;  3OC2 A;  3TW8 A;  3VE3 A;  2J80 A;  2W1T B;  2ZOI A;  4EEU A;  1LSX A;  2V9A A;  3W2Z A;  2WKQ A;  3UE3 A;  4OOL A;  1NRJ A;  5HD3 A;  4GLQ A;  3BY8 A;  5C5K A;  3E4P A;  3T4Q A;  2VLG A;  5MC7 A;  4FSF A;  4HP4 A;  2K7S A;  4HH3 A;  1T18 A;  3C2W A;  3PR6 A;  1STZ A;  1DP9 A;  2V0U A;  5IS1 A;  1OTB A;  2O9A A;  1D7E A;  5AVF A;  5G4Z A;  5HDC A;  4Y2F A;  3T4T A;  2EA9 A;  4WUJ A;  4GS9 A;  2D02 A;  4BBV A;  2XSS A;  4DJ2 A;  4I3J A;  2V1A A;  5I5L A;  5HPI A;  5AVE A;  3EGD C;  1NLZ A;  5HDD A;  3MF0 A;  3H7W A;  3EGX C;  4HY8 A;  3EQV A;  2YKH A;  4Q0I A;  3H82 B;  2HJE A;  1Y28 A;  2XRN A;  4H6J A;  1T1A A;  4BMW A;  1F5M A;  1P0Z A;  2QKP A;  4GHI A;  4ZRR A;  2GZA A;  3UB7 A;  4F3L A;  1XJ3 A;  2EWW A;  2W3E A;  4CLC B;  4EU0 A;  3PXP A;  2P08 A;  2GJ3 A;  2INW A;  4HNB A;  1GSV A;  2G7U A;  3CUE C;  3BQ8 A;  4EES A;  3KSI A;  3TJZ C;  2QJ5 A;  4NXG A;  3LIC A;  4I3I A;  2I9V A;  5DJU A;  3ZYT A;  1N9N A;  1NWZ A;  2KOI A;  1OTD A;  4BJP A;  3F1O B;  3LI9 A;  3CUE A;  2OWH A;  4XT2 B;  3P7N A;  5DKK A;  4EET B;  3CIT A;  1TF1 A;  5F69 A;  1G6O A;  4LPZ A;  2Z6C A;  3NOT C;  4CLC C;  1P97 A;  2W1R A;  1X0O A;  4IHQ A;  3E98 A;  2KDK A;  3PBO A;  3MQO A;  2WKR A;  3D3O A;  4R38 A;  1G28 A;  4HH2 A;  4BBT A;  2LB9 A;  4ME4 A;  5HD5 A;  3F1P A;  3FC7 A;  4JGP A;  4B93 A;  2PHY A;  4Q0H A;  2PYP A;  4L9G A;  2J3T D;  2BAS A;  2QJ7 A;  4KQO A;  4GS9 B;  2NUP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...