3LILA

Human mmp12 in complex with non-zinc chelating inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Insights from selective non-phosphinic inhibitors of MMP-12 tailored to fit with an S1' loop canonical conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lilA00
4Q1LA 3AYKA 4XM7A 1GKDA 3DPEA 1MMBA 4G0DA 1HFCA 2X3BA 4DF9A 1XFWA 1CXVA 3EDZA 1C3IA 1Q3AA 4IN9A 3UVCA 1GE5A 5I4OA 3KWVC 1IAAA 1CGFA 1GO8P 3K7LA 2AIGP 4L6TA 1KUIA 2KRJA 3TSKA 3AYUA 1RMZA 3E8RA 2DW2A 4JP4A 5I0LA 1EB6A 3VTGA 3KEKA 1EAKA 3B8ZA 5JMYA 1K7QA 3EHYA 4H2EA 2OXZA 4I35A 1D8FA 1JAOA 2DW1A 5L7FA 1BUVM 4PKSA 1UTTA 1ZP5A 2YIGA 3OHLA 1G9KA 3G5CA 3SHIA 1XUDA 2W15A 2DW0A 1HV5A 3LJGA 4A3WA 3HBUP 2FV5A 1EUBA 2MLRA 5I3MA 1BKCA 4PKVA 2X3AA 4XM6A 1SRPA 2DDYA 1JJ9A 1BSWA 1CAQA 4WKEA 4PKRA 3LJTA 3LUNA 3USNA 2MLSA 4GF1A 1JIWP 2WO8A 3I7GA 2MZEA 4WK7A 2XS4A 3L0TA 4GUYA 1S4BP 4ILWD 1OM8A 1HY7A 1FM1A 1CIZA 1B8YA 1CK7A 1QIAA 1HOVA 5D3CA 2Z2DA 1XUCA 4PKWA 1R1JA 2OW0A 2TCLA 1UMSA 3KMCA 1SATA 1PWVA 1GXDA 2RJPA 1Y8JA 4JQGA 1JIZA 2CLTA 1KAPP 3DNGA 1GKCA 1MMQA 1I73A 2HU6A 2OVZA 3LEAA 1G4KA 5CXAA 4QKZA 1PWUA 3EDIA 2OW2A 4H3XA 5CUHA 1G49A 3U1RA 1G05A 3V96B 3DL1A 4G9LA 3LGPA 1SLMA 2ERPA 1AKLA 4J4MA 2OW9A 1Y0VA 3F16A 3HY9A 2SRTA 1IACA 1UEAA 1OM6A 5D1UA 4FXQA 1XFVA 4A7BA 3LIRA 2ERQA 1FBLA 1MMPA 3I7IA 1O0QA 3HB2P 1UTZA 2OXUA 1ZXVA 1BQOA 4GQLA 4GWNA 2JIHA 2J0TA 3F17A 2EROA 4DD8A 1I1IP 3HDAP 3HYGA 1K7IA 4ON1A 1UMTA 2W13A 1H71P 4FVLA 2WO9A 3B92A 5BPAA 4XCTA 4L19A 2W14A 3HBVP 1BQQM 1PWQA 3ELMA 4XM8A 2X7MA 3TS4A 3ZUKA 2A8HA 3LQ0A 2N8RA 1OS2A 1KBCA 1B3DA 1Z3JA 2MZIA 2CKIA 1JKYA 1DTHA 3LQBA 2MZHA 4AUOA 3MA2A 1GE6A 2JT6A 4JIJA 3EDHA 2OY4A 4H1QA 4GR3A 1R55A 4JPAA 1K7GA 1KUGA 3HY7A 4HX3A 3Q2HA 4H30A 1O0TA 3P24A 3LJZA 1D5JA 1GO7P 3ZXHA 3DWBA 3LE9A 456CA 3N2UA 2DDFA 2OY2A 4GWMA 2K9CA 2OZRA 5CZMA 1IAEA 5I2ZA 3TVCA 2D1OA 1QJIA 2K2GA 1OM7A 5I12A 1R1HA 3WV2A 3LK8A 3G42A 1BIWA 3F15A 3F19A 1SU3A 3EWJA 2OXWA 1ASTA 3GBOA 2E3XA 3OHOA 1CGEA 4WZVA 3WV1A 2I47A 1ZTQA 4XBHA 1OMJA 1AF0A 1J7NA 4AYKA 1BUDA 2RJQA 4H84A 3KMEA 5B5OA 1ND1A 3BA0A 1ZXCA 1OO9A 5L79A 4WKIA 2OW1A 4H76A 2J83A 3VI1A 4GR0A 1XFZA 966CA 2E2DA 3LMCA 1QICA 5H8XA 2XS3A 1C7KA 1KUFA 3LILA 1D8MA 4HMAA 2WOAA 1QUAA 3RTSA 1IABA 2W0DA 1ROSA 1BKCI 5D1TA 1JH1A 1QIBA 1JAQA 3KECA 1ZVXA 4PKTA 3EDGA 1USNA 1MMRA 1XFUA 4FXYP 4EFSA 3O2XA 2FV9A 5I43A 2Y6DA 1IADA 1WNIA 2D1NA 1HFSA 2OI0A 4IJOA 5B5PA 3CKIA 1XURA 1QJJA 5D7WA 2Y6CA 830CA 3B2ZA 1Y93A 4FU4A 3KHIA 1R1IA 1XFXA 1CGLA 5LABA 2POJA 2OVXA 1GE7A 1PWPA 1CQRA 2AYKA 3LUMA 3F18A 3N2VA 2JT5A 2O36A 1ATLA 4ZR5A 4H82A 1HTDA 1BKCE 2X3CA 4DV8A 4JA1A 1RM8A 1DMTA 1ZS0A 2YB9A 3KRYA 1FLSA 1SLNA 5D1SA 5D2BA 1L6JA 1PWWA 3LIKA 2JNPA 3WV3A 4PKQA 3LKAA 3Q2GA 3HDBA 1KUHA 1A85A 3DSLA 1XFYA 2W12A 1MNCA 4DPEA 3TT4A 2USNA 5BOTA 1C8TA 4L63A 1G12A 1YP1A 1JAPA 1YCMA 1I76A 3F1AA 1AYKA 2O3EA 3KEJA 2QPJA 1BM6A 2JSDA 1KUKA 1YOUA 4WF6A 4IUWA 1SMPA 3DPFA 1BZSA 1OS9A 3NX7A 3K7NA 3ZVSA 4AXQA 1JANA 3L0VA 4I03A 2V4BA 4R3VA 3O64A 1A86A 2PJTA 3P1VA 1YQYA 3AIGA 4PKUA 4CTHA 3RTTA 1IAGA 3EHXA 1D7XA 1JK3A 2L0RA 4GR8A 4AIGA 1R54A 5BOYA 4H49A
chains in the Genus database with same CATH superfamily
4Q1LA 3AYKA 4XM7A 1GKDA 3DPEA 1MMBA 4G0DA 1HFCA 2X3BA 4DF9A 1XFWA 1CXVA 3EDZA 1C3IA 1Q3AA 4IN9A 3UVCA 1GE5A 5I4OA 3KWVC 1IAAA 1CGFA 1GO8P 3K7LA 2AIGP 4L6TA 1KUIA 2KRJA 3TSKA 3AYUA 1RMZA 3E8RA 2DW2A 4JP4A 5I0LA 1EB6A 3VTGA 3KEKA 1EAKA 3B8ZA 5JMYA 1K7QA 3EHYA 4H2EA 2OXZA 4I35A 1D8FA 1JAOA 2DW1A 5L7FA 1BUVM 4PKSA 1UTTA 1ZP5A 2YIGA 3OHLA 1G9KA 3G5CA 3SHIA 1XUDA 2W15A 2DW0A 1HV5A 3LJGA 4A3WA 3HBUP 2FV5A 1EUBA 2MLRA 5I3MA 1BKCA 4PKVA 2X3AA 4XM6A 1SRPA 2DDYA 1JJ9A 1BSWA 1CAQA 4WKEA 4L7AA 4PKRA 3LJTA 3LUNA 3USNA 2MLSA 4GF1A 1JIWP 1OZ9A 2WO8A 3I7GA 2MZEA 4WK7A 2XS4A 3L0TA 4GUYA 1S4BP 4ILWD 1OM8A 1HY7A 1FM1A 1CIZA 1B8YA 1CK7A 1QIAA 1HOVA 5D3CA 2Z2DA 1XUCA 4PKWA 1R1JA 2OW0A 2TCLA 1UMSA 3KMCA 1SATA 1PWVA 1GXDA 2RJPA 1Y8JA 4JQGA 1JIZA 2CLTA 1KAPP 3DNGA 1GKCA 1MMQA 1I73A 2HU6A 2OVZA 3LEAA 1G4KA 5CXAA 4QKZA 1PWUA 3EDIA 2OW2A 4H3XA 5CUHA 1G49A 3U1RA 1G05A 3V96B 3DL1A 4G9LA 3LGPA 1SLMA 2ERPA 1AKLA 4J4MA 2OW9A 1Y0VA 3F16A 3HY9A 2SRTA 1IACA 1UEAA 1OM6A 5D1UA 4FXQA 1XFVA 4A7BA 3LIRA 2ERQA 1FBLA 1MMPA 3I7IA 1O0QA 3HB2P 1UTZA 2OXUA 1ZXVA 1BQOA 4GQLA 4GWNA 2JIHA 1TVIA 2J0TA 3F17A 2EROA 4DD8A 1I1IP 1XAXA 3HDAP 3HYGA 1K7IA 4ON1A 1UMTA 2W13A 1H71P 4FVLA 2WO9A 3B92A 5BPAA 4XCTA 4L19A 2W14A 3HBVP 1BQQM 1PWQA 3ELMA 4XM8A 2X7MA 3TS4A 3DTIA 3ZUKA 2A8HA 3LQ0A 2N8RA 1OS2A 1KBCA 1B3DA 1Z3JA 2MZIA 2CKIA 1JKYA 1DTHA 3LQBA 2MZHA 4AUOA 3MA2A 1GE6A 2JT6A 4JIJA 3EDHA 2OY4A 4H1QA 4GR3A 1R55A 4JPAA 1K7GA 1KUGA 3HY7A 4HX3A 3Q2HA 4H30A 1O0TA 3P24A 3LJZA 1D5JA 1GO7P 3ZXHA 3DWBA 3LE9A 456CA 3N2UA 2DDFA 2OY2A 4GWMA 2K9CA 2OZRA 5CZMA 1IAEA 5I2ZA 3TVCA 2D1OA 1QJIA 2K2GA 1OM7A 5I12A 1R1HA 3WV2A 3LK8A 3G42A 1BIWA 3F15A 3F19A 1SU3A 3EWJA 2OXWA 1ASTA 3GBOA 2E3XA 3OHOA 1CGEA 4WZVA 3WV1A 2I47A 1ZTQA 4XBHA 1OMJA 1AF0A 1J7NA 4AYKA 1BUDA 2RJQA 4H84A 3KMEA 5B5OA 1ND1A 3BA0A 1ZXCA 1OO9A 5L79A 4WKIA 2OW1A 4H76A 2J83A 3VI1A 4GR0A 1XFZA 966CA 2E2DA 3LMCA 1QICA 5H8XA 2XS3A 1C7KA 1KUFA 3LILA 1D8MA 4HMAA 2WOAA 1QUAA 3RTSA 1IABA 2W0DA 1ROSA 1BKCI 5D1TA 1JH1A 1QIBA 1JAQA 3KECA 1ZVXA 4PKTA 3EDGA 1USNA 1MMRA 1XFUA 4FXYP 4EFSA 3O2XA 2FV9A 5I43A 2Y6DA 1IADA 1WNIA 2D1NA 1HFSA 2OI0A 4IJOA 5B5PA 3CKIA 1XURA 1QJJA 5D7WA 2Y6CA 830CA 3B2ZA 1Y93A 4FU4A 3KHIA 1R1IA 1XFXA 1CGLA 5LABA 2POJA 2OVXA 1GE7A 1PWPA 1CQRA 2AYKA 3LUMA 3F18A 3N2VA 2JT5A 2O36A 1ATLA 2YUFA 4ZR5A 4H82A 1XM5A 1HTDA 1BKCE 2X3CA 4DV8A 4JA1A 1RM8A 1DMTA 1ZS0A 2YB9A 3KRYA 1FLSA 1SLNA 5D1SA 5D2BA 3DTKA 1L6JA 1PWWA 3LIKA 2JNPA 3WV3A 4PKQA 3LKAA 3Q2GA 3HDBA 1KUHA 1A85A 3DSLA 1XFYA 2W12A 1MNCA 4DPEA 3TT4A 2USNA 5BOTA 1C8TA 4L63A 1G12A 1YP1A 1JAPA 1YCMA 1I76A 3F1AA 1AYKA 2O3EA 3KEJA 2QPJA 1BM6A 2JSDA 1KUKA 1YOUA 4WF6A 4IUWA 1SMPA 3DTEA 3DPFA 1BZSA 1OS9A 3NX7A 3K7NA 3ZVSA 4AXQA 1JANA 3L0VA 4I03A 2V4BA 4R3VA 3O64A 1A86A 2PJTA 3P1VA 1YQYA 3AIGA 4PKUA 4CTHA 3RTTA 1IAGA 3EHXA 1D7XA 1JK3A 2L0RA 4GR8A 4AIGA 1R54A 5BOYA 4H49A
chains in the Genus database with same CATH topology
4Q1LA 3AYKA 4XM7A 1GKDA 3DPEA 1MMBA 4G0DA 1HFCA 2X3BA 4DF9A 1XFWA 1CXVA 3EDZA 1C3IA 1Q3AA 4IN9A 3UVCA 1GE5A 5I4OA 3KWVC 1IAAA 1CGFA 1GO8P 3K7LA 2AIGP 4L6TA 1KUIA 2KRJA 3TSKA 3AYUA 1RMZA 3E8RA 2DW2A 4JP4A 5I0LA 1EB6A 3VTGA 3KEKA 1EAKA 3B8ZA 5JMYA 1K7QA 3EHYA 4H2EA 2OXZA 4I35A 1D8FA 1JAOA 2DW1A 5L7FA 1BUVM 4PKSA 1UTTA 1ZP5A 2YIGA 3OHLA 1G9KA 3G5CA 3SHIA 1XUDA 2W15A 2DW0A 1HV5A 3LJGA 4A3WA 3HBUP 2FV5A 1EUBA 2MLRA 5I3MA 1BKCA 4PKVA 2X3AA 4XM6A 1SRPA 2DDYA 1JJ9A 1BSWA 1CAQA 4WKEA 4L7AA 4PKRA 3LJTA 3LUNA 3USNA 2MLSA 4GF1A 1JIWP 2WO8A 3I7GA 2MZEA 4WK7A 2XS4A 3L0TA 4GUYA 1S4BP 4ILWD 1OM8A 1HY7A 1FM1A 1CIZA 1B8YA 1CK7A 1QIAA 1HOVA 5D3CA 2Z2DA 1XUCA 4PKWA 1R1JA 2OW0A 2TCLA 1UMSA 3KMCA 1SATA 1PWVA 1GXDA 2RJPA 1Y8JA 4JQGA 1JIZA 2CLTA 1KAPP 3DNGA 1GKCA 1MMQA 1I73A 2HU6A 2OVZA 3LEAA 1G4KA 5CXAA 4QKZA 1PWUA 3EDIA 2OW2A 4H3XA 5CUHA 1G49A 3U1RA 1G05A 3V96B 3DL1A 4G9LA 3LGPA 1SLMA 2ERPA 1AKLA 4J4MA 2OW9A 1Y0VA 3F16A 3HY9A 2SRTA 1IACA 1UEAA 1OM6A 5D1UA 4FXQA 1XFVA 4A7BA 3LIRA 2ERQA 1FBLA 1MMPA 3I7IA 1O0QA 3HB2P 1UTZA 2OXUA 1ZXVA 1BQOA 4GQLA 4GWNA 2JIHA 2J0TA 3F17A 2EROA 4DD8A 1I1IP 3HDAP 3HYGA 1K7IA 4ON1A 1UMTA 2W13A 1H71P 4FVLA 2WO9A 3B92A 5BPAA 4XCTA 4L19A 2W14A 3HBVP 1BQQM 1PWQA 3ELMA 4XM8A 2X7MA 3TS4A 3DTIA 3ZUKA 2A8HA 3LQ0A 2N8RA 1OS2A 1KBCA 1B3DA 1Z3JA 2MZIA 2CKIA 1JKYA 1DTHA 3LQBA 2MZHA 4AUOA 3MA2A 1GE6A 2JT6A 4JIJA 3EDHA 2OY4A 4H1QA 4GR3A 1R55A 4JPAA 1K7GA 1KUGA 3HY7A 4HX3A 3Q2HA 4H30A 1O0TA 3P24A 3LJZA 1D5JA 1GO7P 3ZXHA 3DWBA 3LE9A 456CA 3N2UA 2DDFA 2OY2A 4GWMA 2K9CA 2OZRA 5CZMA 1IAEA 5I2ZA 3TVCA 2D1OA 1QJIA 2K2GA 1OM7A 5I12A 1R1HA 3WV2A 3LK8A 3G42A 1BIWA 3F15A 3F19A 1SU3A 3EWJA 2OXWA 1ASTA 3GBOA 2E3XA 3OHOA 1CGEA 4WZVA 3WV1A 2I47A 1ZTQA 4XBHA 1OMJA 1AF0A 1J7NA 4AYKA 1BUDA 2RJQA 4H84A 3KMEA 5B5OA 1ND1A 3BA0A 1ZXCA 1OO9A 5L79A 4WKIA 2OW1A 4H76A 2J83A 3VI1A 4GR0A 1XFZA 966CA 2E2DA 3LMCA 1QICA 5H8XA 2XS3A 1C7KA 1KUFA 3LILA 1D8MA 4HMAA 2WOAA 1QUAA 3RTSA 1IABA 2W0DA 1ROSA 1BKCI 5D1TA 1JH1A 1QIBA 1JAQA 3KECA 1ZVXA 4PKTA 3EDGA 1USNA 1MMRA 1XFUA 4FXYP 4EFSA 3O2XA 2FV9A 5I43A 2Y6DA 1IADA 1WNIA 2D1NA 1HFSA 2OI0A 4IJOA 5B5PA 3CKIA 1XURA 1QJJA 5D7WA 2Y6CA 830CA 3B2ZA 1Y93A 4FU4A 3KHIA 1R1IA 1XFXA 1CGLA 5LABA 2POJA 2OVXA 1GE7A 1PWPA 1CQRA 2AYKA 3LUMA 3F18A 3N2VA 2JT5A 2O36A 1ATLA 2YUFA 4ZR5A 4H82A 1HTDA 1BKCE 2X3CA 4DV8A 4JA1A 1RM8A 1DMTA 1ZS0A 2YB9A 3KRYA 1FLSA 1SLNA 5D1SA 5D2BA 3DTKA 1L6JA 1PWWA 3LIKA 2JNPA 3WV3A 4PKQA 3LKAA 3Q2GA 3HDBA 1KUHA 1A85A 3DSLA 1XFYA 2W12A 1MNCA 4DPEA 3TT4A 2USNA 5BOTA 1C8TA 4L63A 1G12A 1YP1A 1JAPA 1YCMA 1I76A 3F1AA 1AYKA 2O3EA 3KEJA 2QPJA 1BM6A 2JSDA 1KUKA 1YOUA 4WF6A 4IUWA 1SMPA 3DTEA 3DPFA 1BZSA 1OS9A 3NX7A 3K7NA 3ZVSA 4AXQA 1JANA 3L0VA 4I03A 2V4BA 4R3VA 3O64A 1A86A 2PJTA 3P1VA 1YQYA 3AIGA 4PKUA 4CTHA 3RTTA 1IAGA 3EHXA 1D7XA 1JK3A 2L0RA 4GR8A 4AIGA 1R54A 5BOYA 4H49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q1L A;  3AYK A;  4XM7 A;  1GKD A;  3DPE A;  1MMB A;  4G0D A;  1HFC A;  2X3B A;  4DF9 A;  1XFW A;  1CXV A;  3EDZ A;  1C3I A;  1Q3A A;  4IN9 A;  3UVC A;  1GE5 A;  5I4O A;  3KWV C;  1IAA A;  1CGF A;  1GO8 P;  3K7L A;  2AIG P;  4L6T A;  1KUI A;  2KRJ A;  3TSK A;  3AYU A;  1RMZ A;  3E8R A;  2DW2 A;  4JP4 A;  5I0L A;  1EB6 A;  3VTG A;  3KEK A;  1EAK A;  3B8Z A;  5JMY A;  1K7Q A;  3EHY A;  4H2E A;  2OXZ A;  4I35 A;  1D8F A;  1JAO A;  2DW1 A;  5L7F A;  1BUV M;  4PKS A;  1UTT A;  1ZP5 A;  2YIG A;  3OHL A;  1G9K A;  3G5C A;  3SHI A;  1XUD A;  2W15 A;  2DW0 A;  1HV5 A;  3LJG A;  4A3W A;  3HBU P;  2FV5 A;  1EUB A;  2MLR A;  5I3M A;  1BKC A;  4PKV A;  2X3A A;  4XM6 A;  1SRP A;  2DDY A;  1JJ9 A;  1BSW A;  1CAQ A;  4WKE A;  4PKR A;  3LJT A;  3LUN A;  3USN A;  2MLS A;  4GF1 A;  1JIW P;  2WO8 A;  3I7G A;  2MZE A;  4WK7 A;  2XS4 A;  3L0T A;  4GUY A;  1S4B P;  4ILW D;  1OM8 A;  1HY7 A;  1FM1 A;  1CIZ A;  1B8Y A;  1CK7 A;  1QIA A;  1HOV A;  5D3C A;  2Z2D A;  1XUC A;  4PKW A;  1R1J A;  2OW0 A;  2TCL A;  1UMS A;  3KMC A;  1SAT A;  1PWV A;  1GXD A;  2RJP A;  1Y8J A;  4JQG A;  1JIZ A;  2CLT A;  1KAP P;  3DNG A;  1GKC A;  1MMQ A;  1I73 A;  2HU6 A;  2OVZ A;  3LEA A;  1G4K A;  5CXA A;  4QKZ A;  1PWU A;  3EDI A;  2OW2 A;  4H3X A;  5CUH A;  1G49 A;  3U1R A;  1G05 A;  3V96 B;  3DL1 A;  4G9L A;  3LGP A;  1SLM A;  2ERP A;  1AKL A;  4J4M A;  2OW9 A;  1Y0V A;  3F16 A;  3HY9 A;  2SRT A;  1IAC A;  1UEA A;  1OM6 A;  5D1U A;  4FXQ A;  1XFV A;  4A7B A;  3LIR A;  2ERQ A;  1FBL A;  1MMP A;  3I7I A;  1O0Q A;  3HB2 P;  1UTZ A;  2OXU A;  1ZXV A;  1BQO A;  4GQL A;  4GWN A;  2JIH A;  2J0T A;  3F17 A;  2ERO A;  4DD8 A;  1I1I P;  3HDA P;  3HYG A;  1K7I A;  4ON1 A;  1UMT A;  2W13 A;  1H71 P;  4FVL A;  2WO9 A;  3B92 A;  5BPA A;  4XCT A;  4L19 A;  2W14 A;  3HBV P;  1BQQ M;  1PWQ A;  3ELM A;  4XM8 A;  2X7M A;  3TS4 A;  3ZUK A;  2A8H A;  3LQ0 A;  2N8R A;  1OS2 A;  1KBC A;  1B3D A;  1Z3J A;  2MZI A;  2CKI A;  1JKY A;  1DTH A;  3LQB A;  2MZH A;  4AUO A;  3MA2 A;  1GE6 A;  2JT6 A;  4JIJ A;  3EDH A;  2OY4 A;  4H1Q A;  4GR3 A;  1R55 A;  4JPA A;  1K7G A;  1KUG A;  3HY7 A;  4HX3 A;  3Q2H A;  4H30 A;  1O0T A;  3P24 A;  3LJZ A;  1D5J A;  1GO7 P;  3ZXH A;  3DWB A;  3LE9 A;  456C A;  3N2U A;  2DDF A;  2OY2 A;  4GWM A;  2K9C A;  2OZR A;  5CZM A;  1IAE A;  5I2Z A;  3TVC A;  2D1O A;  1QJI A;  2K2G A;  1OM7 A;  5I12 A;  1R1H A;  3WV2 A;  3LK8 A;  3G42 A;  1BIW A;  3F15 A;  3F19 A;  1SU3 A;  3EWJ A;  2OXW A;  1AST A;  3GBO A;  2E3X A;  3OHO A;  1CGE A;  4WZV A;  3WV1 A;  2I47 A;  1ZTQ A;  4XBH A;  1OMJ A;  1AF0 A;  1J7N A;  4AYK A;  1BUD A;  2RJQ A;  4H84 A;  3KME A;  5B5O A;  1ND1 A;  3BA0 A;  1ZXC A;  1OO9 A;  5L79 A;  4WKI A;  2OW1 A;  4H76 A;  2J83 A;  3VI1 A;  4GR0 A;  1XFZ A;  966C A;  2E2D A;  3LMC A;  1QIC A;  5H8X A;  2XS3 A;  1C7K A;  1KUF A;  3LIL A;  1D8M A;  4HMA A;  2WOA A;  1QUA A;  3RTS A;  1IAB A;  2W0D A;  1ROS A;  1BKC I;  5D1T A;  1JH1 A;  1QIB A;  1JAQ A;  3KEC A;  1ZVX A;  4PKT A;  3EDG A;  1USN A;  1MMR A;  1XFU A;  4FXY P;  4EFS A;  3O2X A;  2FV9 A;  5I43 A;  2Y6D A;  1IAD A;  1WNI A;  2D1N A;  1HFS A;  2OI0 A;  4IJO A;  5B5P A;  3CKI A;  1XUR A;  1QJJ A;  5D7W A;  2Y6C A;  830C A;  3B2Z A;  1Y93 A;  4FU4 A;  3KHI A;  1R1I A;  1XFX A;  1CGL A;  5LAB A;  2POJ A;  2OVX A;  1GE7 A;  1PWP A;  1CQR A;  2AYK A;  3LUM A;  3F18 A;  3N2V A;  2JT5 A;  2O36 A;  1ATL A;  4ZR5 A;  4H82 A;  1HTD A;  1BKC E;  2X3C A;  4DV8 A;  4JA1 A;  1RM8 A;  1DMT A;  1ZS0 A;  2YB9 A;  3KRY A;  1FLS A;  1SLN A;  5D1S A;  5D2B A;  1L6J A;  1PWW A;  3LIK A;  2JNP A;  3WV3 A;  4PKQ A;  3LKA A;  3Q2G A;  3HDB A;  1KUH A;  1A85 A;  3DSL A;  1XFY A;  2W12 A;  1MNC A;  4DPE A;  3TT4 A;  2USN A;  5BOT A;  1C8T A;  4L63 A;  1G12 A;  1YP1 A;  1JAP A;  1YCM A;  1I76 A;  3F1A A;  1AYK A;  2O3E A;  3KEJ A;  2QPJ A;  1BM6 A;  2JSD A;  1KUK A;  1YOU A;  4WF6 A;  4IUW A;  1SMP A;  3DPF A;  1BZS A;  1OS9 A;  3NX7 A;  3K7N A;  3ZVS A;  4AXQ A;  1JAN A;  3L0V A;  4I03 A;  2V4B A;  4R3V A;  3O64 A;  1A86 A;  2PJT A;  3P1V A;  1YQY A;  3AIG A;  4PKU A;  4CTH A;  3RTT A;  1IAG A;  3EHX A;  1D7X A;  1JK3 A;  2L0R A;  4GR8 A;  4AIG A;  1R54 A;  5BOY A;  4H49 A; 
#chains in the Genus database with same CATH topology
 4Q1L A;  3AYK A;  4XM7 A;  1GKD A;  3DPE A;  1MMB A;  4G0D A;  1HFC A;  2X3B A;  4DF9 A;  1XFW A;  1CXV A;  3EDZ A;  1C3I A;  1Q3A A;  4IN9 A;  3UVC A;  1GE5 A;  5I4O A;  3KWV C;  1IAA A;  1CGF A;  1GO8 P;  3K7L A;  2AIG P;  4L6T A;  1KUI A;  2KRJ A;  3TSK A;  3AYU A;  1RMZ A;  3E8R A;  2DW2 A;  4JP4 A;  5I0L A;  1EB6 A;  3VTG A;  3KEK A;  1EAK A;  3B8Z A;  5JMY A;  1K7Q A;  3EHY A;  4H2E A;  2OXZ A;  4I35 A;  1D8F A;  1JAO A;  2DW1 A;  5L7F A;  1BUV M;  4PKS A;  1UTT A;  1ZP5 A;  2YIG A;  3OHL A;  1G9K A;  3G5C A;  3SHI A;  1XUD A;  2W15 A;  2DW0 A;  1HV5 A;  3LJG A;  4A3W A;  3HBU P;  2FV5 A;  1EUB A;  2MLR A;  5I3M A;  1BKC A;  4PKV A;  2X3A A;  4XM6 A;  1SRP A;  2DDY A;  1JJ9 A;  1BSW A;  1CAQ A;  4WKE A;  4L7A A;  4PKR A;  3LJT A;  3LUN A;  3USN A;  2MLS A;  4GF1 A;  1JIW P;  1OZ9 A;  2WO8 A;  3I7G A;  2MZE A;  4WK7 A;  2XS4 A;  3L0T A;  4GUY A;  1S4B P;  4ILW D;  1OM8 A;  1HY7 A;  1FM1 A;  1CIZ A;  1B8Y A;  1CK7 A;  1QIA A;  1HOV A;  5D3C A;  2Z2D A;  1XUC A;  4PKW A;  1R1J A;  2OW0 A;  2TCL A;  1UMS A;  3KMC A;  1SAT A;  1PWV A;  1GXD A;  2RJP A;  1Y8J A;  4JQG A;  1JIZ A;  2CLT A;  1KAP P;  3DNG A;  1GKC A;  1MMQ A;  1I73 A;  2HU6 A;  2OVZ A;  3LEA A;  1G4K A;  5CXA A;  4QKZ A;  1PWU A;  3EDI A;  2OW2 A;  4H3X A;  5CUH A;  1G49 A;  3U1R A;  1G05 A;  3V96 B;  3DL1 A;  4G9L A;  3LGP A;  1SLM A;  2ERP A;  1AKL A;  4J4M A;  2OW9 A;  1Y0V A;  3F16 A;  3HY9 A;  2SRT A;  1IAC A;  1UEA A;  1OM6 A;  5D1U A;  4FXQ A;  1XFV A;  4A7B A;  3LIR A;  2ERQ A;  1FBL A;  1MMP A;  3I7I A;  1O0Q A;  3HB2 P;  1UTZ A;  2OXU A;  1ZXV A;  1BQO A;  4GQL A;  4GWN A;  2JIH A;  1TVI A;  2J0T A;  3F17 A;  2ERO A;  4DD8 A;  1I1I P;  1XAX A;  3HDA P;  3HYG A;  1K7I A;  4ON1 A;  1UMT A;  2W13 A;  1H71 P;  4FVL A;  2WO9 A;  3B92 A;  5BPA A;  4XCT A;  4L19 A;  2W14 A;  3HBV P;  1BQQ M;  1PWQ A;  3ELM A;  4XM8 A;  2X7M A;  3TS4 A;  3DTI A;  3ZUK A;  2A8H A;  3LQ0 A;  2N8R A;  1OS2 A;  1KBC A;  1B3D A;  1Z3J A;  2MZI A;  2CKI A;  1JKY A;  1DTH A;  3LQB A;  2MZH A;  4AUO A;  3MA2 A;  1GE6 A;  2JT6 A;  4JIJ A;  3EDH A;  2OY4 A;  4H1Q A;  4GR3 A;  1R55 A;  4JPA A;  1K7G A;  1KUG A;  3HY7 A;  4HX3 A;  3Q2H A;  4H30 A;  1O0T A;  3P24 A;  3LJZ A;  1D5J A;  1GO7 P;  3ZXH A;  3DWB A;  3LE9 A;  456C A;  3N2U A;  2DDF A;  2OY2 A;  4GWM A;  2K9C A;  2OZR A;  5CZM A;  1IAE A;  5I2Z A;  3TVC A;  2D1O A;  1QJI A;  2K2G A;  1OM7 A;  5I12 A;  1R1H A;  3WV2 A;  3LK8 A;  3G42 A;  1BIW A;  3F15 A;  3F19 A;  1SU3 A;  3EWJ A;  2OXW A;  1AST A;  3GBO A;  2E3X A;  3OHO A;  1CGE A;  4WZV A;  3WV1 A;  2I47 A;  1ZTQ A;  4XBH A;  1OMJ A;  1AF0 A;  1J7N A;  4AYK A;  1BUD A;  2RJQ A;  4H84 A;  3KME A;  5B5O A;  1ND1 A;  3BA0 A;  1ZXC A;  1OO9 A;  5L79 A;  4WKI A;  2OW1 A;  4H76 A;  2J83 A;  3VI1 A;  4GR0 A;  1XFZ A;  966C A;  2E2D A;  3LMC A;  1QIC A;  5H8X A;  2XS3 A;  1C7K A;  1KUF A;  3LIL A;  1D8M A;  4HMA A;  2WOA A;  1QUA A;  3RTS A;  1IAB A;  2W0D A;  1ROS A;  1BKC I;  5D1T A;  1JH1 A;  1QIB A;  1JAQ A;  3KEC A;  1ZVX A;  4PKT A;  3EDG A;  1USN A;  1MMR A;  1XFU A;  4FXY P;  4EFS A;  3O2X A;  2FV9 A;  5I43 A;  2Y6D A;  1IAD A;  1WNI A;  2D1N A;  1HFS A;  2OI0 A;  4IJO A;  5B5P A;  3CKI A;  1XUR A;  1QJJ A;  5D7W A;  2Y6C A;  830C A;  3B2Z A;  1Y93 A;  4FU4 A;  3KHI A;  1R1I A;  1XFX A;  1CGL A;  5LAB A;  2POJ A;  2OVX A;  1GE7 A;  1PWP A;  1CQR A;  2AYK A;  3LUM A;  3F18 A;  3N2V A;  2JT5 A;  2O36 A;  1ATL A;  2YUF A;  4ZR5 A;  4H82 A;  1XM5 A;  1HTD A;  1BKC E;  2X3C A;  4DV8 A;  4JA1 A;  1RM8 A;  1DMT A;  1ZS0 A;  2YB9 A;  3KRY A;  1FLS A;  1SLN A;  5D1S A;  5D2B A;  3DTK A;  1L6J A;  1PWW A;  3LIK A;  2JNP A;  3WV3 A;  4PKQ A;  3LKA A;  3Q2G A;  3HDB A;  1KUH A;  1A85 A;  3DSL A;  1XFY A;  2W12 A;  1MNC A;  4DPE A;  3TT4 A;  2USN A;  5BOT A;  1C8T A;  4L63 A;  1G12 A;  1YP1 A;  1JAP A;  1YCM A;  1I76 A;  3F1A A;  1AYK A;  2O3E A;  3KEJ A;  2QPJ A;  1BM6 A;  2JSD A;  1KUK A;  1YOU A;  4WF6 A;  4IUW A;  1SMP A;  3DTE A;  3DPF A;  1BZS A;  1OS9 A;  3NX7 A;  3K7N A;  3ZVS A;  4AXQ A;  1JAN A;  3L0V A;  4I03 A;  2V4B A;  4R3V A;  3O64 A;  1A86 A;  2PJT A;  3P1V A;  1YQY A;  3AIG A;  4PKU A;  4CTH A;  3RTT A;  1IAG A;  3EHX A;  1D7X A;  1JK3 A;  2L0R A;  4GR8 A;  4AIG A;  1R54 A;  5BOY A;  4H49 A; 
#chains in the Genus database with same CATH homology
 4Q1L A;  3AYK A;  4XM7 A;  1GKD A;  3DPE A;  1MMB A;  4G0D A;  1HFC A;  2X3B A;  4DF9 A;  1XFW A;  1CXV A;  3EDZ A;  1C3I A;  1Q3A A;  4IN9 A;  3UVC A;  1GE5 A;  5I4O A;  3KWV C;  1IAA A;  1CGF A;  1GO8 P;  3K7L A;  2AIG P;  4L6T A;  1KUI A;  2KRJ A;  3TSK A;  3AYU A;  1RMZ A;  3E8R A;  2DW2 A;  4JP4 A;  5I0L A;  1EB6 A;  3VTG A;  3KEK A;  1EAK A;  3B8Z A;  5JMY A;  1K7Q A;  3EHY A;  4H2E A;  2OXZ A;  4I35 A;  1D8F A;  1JAO A;  2DW1 A;  5L7F A;  1BUV M;  4PKS A;  1UTT A;  1ZP5 A;  2YIG A;  3OHL A;  1G9K A;  3G5C A;  3SHI A;  1XUD A;  2W15 A;  2DW0 A;  1HV5 A;  3LJG A;  4A3W A;  3HBU P;  2FV5 A;  1EUB A;  2MLR A;  5I3M A;  1BKC A;  4PKV A;  2X3A A;  4XM6 A;  1SRP A;  2DDY A;  1JJ9 A;  1BSW A;  1CAQ A;  4WKE A;  4L7A A;  4PKR A;  3LJT A;  3LUN A;  3USN A;  2MLS A;  4GF1 A;  1JIW P;  2WO8 A;  3I7G A;  2MZE A;  4WK7 A;  2XS4 A;  3L0T A;  4GUY A;  1S4B P;  4ILW D;  1OM8 A;  1HY7 A;  1FM1 A;  1CIZ A;  1B8Y A;  1CK7 A;  1QIA A;  1HOV A;  5D3C A;  2Z2D A;  1XUC A;  4PKW A;  1R1J A;  2OW0 A;  2TCL A;  1UMS A;  3KMC A;  1SAT A;  1PWV A;  1GXD A;  2RJP A;  1Y8J A;  4JQG A;  1JIZ A;  2CLT A;  1KAP P;  3DNG A;  1GKC A;  1MMQ A;  1I73 A;  2HU6 A;  2OVZ A;  3LEA A;  1G4K A;  5CXA A;  4QKZ A;  1PWU A;  3EDI A;  2OW2 A;  4H3X A;  5CUH A;  1G49 A;  3U1R A;  1G05 A;  3V96 B;  3DL1 A;  4G9L A;  3LGP A;  1SLM A;  2ERP A;  1AKL A;  4J4M A;  2OW9 A;  1Y0V A;  3F16 A;  3HY9 A;  2SRT A;  1IAC A;  1UEA A;  1OM6 A;  5D1U A;  4FXQ A;  1XFV A;  4A7B A;  3LIR A;  2ERQ A;  1FBL A;  1MMP A;  3I7I A;  1O0Q A;  3HB2 P;  1UTZ A;  2OXU A;  1ZXV A;  1BQO A;  4GQL A;  4GWN A;  2JIH A;  2J0T A;  3F17 A;  2ERO A;  4DD8 A;  1I1I P;  3HDA P;  3HYG A;  1K7I A;  4ON1 A;  1UMT A;  2W13 A;  1H71 P;  4FVL A;  2WO9 A;  3B92 A;  5BPA A;  4XCT A;  4L19 A;  2W14 A;  3HBV P;  1BQQ M;  1PWQ A;  3ELM A;  4XM8 A;  2X7M A;  3TS4 A;  3DTI A;  3ZUK A;  2A8H A;  3LQ0 A;  2N8R A;  1OS2 A;  1KBC A;  1B3D A;  1Z3J A;  2MZI A;  2CKI A;  1JKY A;  1DTH A;  3LQB A;  2MZH A;  4AUO A;  3MA2 A;  1GE6 A;  2JT6 A;  4JIJ A;  3EDH A;  2OY4 A;  4H1Q A;  4GR3 A;  1R55 A;  4JPA A;  1K7G A;  1KUG A;  3HY7 A;  4HX3 A;  3Q2H A;  4H30 A;  1O0T A;  3P24 A;  3LJZ A;  1D5J A;  1GO7 P;  3ZXH A;  3DWB A;  3LE9 A;  456C A;  3N2U A;  2DDF A;  2OY2 A;  4GWM A;  2K9C A;  2OZR A;  5CZM A;  1IAE A;  5I2Z A;  3TVC A;  2D1O A;  1QJI A;  2K2G A;  1OM7 A;  5I12 A;  1R1H A;  3WV2 A;  3LK8 A;  3G42 A;  1BIW A;  3F15 A;  3F19 A;  1SU3 A;  3EWJ A;  2OXW A;  1AST A;  3GBO A;  2E3X A;  3OHO A;  1CGE A;  4WZV A;  3WV1 A;  2I47 A;  1ZTQ A;  4XBH A;  1OMJ A;  1AF0 A;  1J7N A;  4AYK A;  1BUD A;  2RJQ A;  4H84 A;  3KME A;  5B5O A;  1ND1 A;  3BA0 A;  1ZXC A;  1OO9 A;  5L79 A;  4WKI A;  2OW1 A;  4H76 A;  2J83 A;  3VI1 A;  4GR0 A;  1XFZ A;  966C A;  2E2D A;  3LMC A;  1QIC A;  5H8X A;  2XS3 A;  1C7K A;  1KUF A;  3LIL A;  1D8M A;  4HMA A;  2WOA A;  1QUA A;  3RTS A;  1IAB A;  2W0D A;  1ROS A;  1BKC I;  5D1T A;  1JH1 A;  1QIB A;  1JAQ A;  3KEC A;  1ZVX A;  4PKT A;  3EDG A;  1USN A;  1MMR A;  1XFU A;  4FXY P;  4EFS A;  3O2X A;  2FV9 A;  5I43 A;  2Y6D A;  1IAD A;  1WNI A;  2D1N A;  1HFS A;  2OI0 A;  4IJO A;  5B5P A;  3CKI A;  1XUR A;  1QJJ A;  5D7W A;  2Y6C A;  830C A;  3B2Z A;  1Y93 A;  4FU4 A;  3KHI A;  1R1I A;  1XFX A;  1CGL A;  5LAB A;  2POJ A;  2OVX A;  1GE7 A;  1PWP A;  1CQR A;  2AYK A;  3LUM A;  3F18 A;  3N2V A;  2JT5 A;  2O36 A;  1ATL A;  2YUF A;  4ZR5 A;  4H82 A;  1HTD A;  1BKC E;  2X3C A;  4DV8 A;  4JA1 A;  1RM8 A;  1DMT A;  1ZS0 A;  2YB9 A;  3KRY A;  1FLS A;  1SLN A;  5D1S A;  5D2B A;  3DTK A;  1L6J A;  1PWW A;  3LIK A;  2JNP A;  3WV3 A;  4PKQ A;  3LKA A;  3Q2G A;  3HDB A;  1KUH A;  1A85 A;  3DSL A;  1XFY A;  2W12 A;  1MNC A;  4DPE A;  3TT4 A;  2USN A;  5BOT A;  1C8T A;  4L63 A;  1G12 A;  1YP1 A;  1JAP A;  1YCM A;  1I76 A;  3F1A A;  1AYK A;  2O3E A;  3KEJ A;  2QPJ A;  1BM6 A;  2JSD A;  1KUK A;  1YOU A;  4WF6 A;  4IUW A;  1SMP A;  3DTE A;  3DPF A;  1BZS A;  1OS9 A;  3NX7 A;  3K7N A;  3ZVS A;  4AXQ A;  1JAN A;  3L0V A;  4I03 A;  2V4B A;  4R3V A;  3O64 A;  1A86 A;  2PJT A;  3P1V A;  1YQY A;  3AIG A;  4PKU A;  4CTH A;  3RTT A;  1IAG A;  3EHX A;  1D7X A;  1JK3 A;  2L0R A;  4GR8 A;  4AIG A;  1R54 A;  5BOY A;  4H49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...