3LIPA

Open conformation of pseudomonas cepacia lipase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIACYL-GLYCEROL-HYDROLASE
publication title The open conformation of a Pseudomonas lipase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 122
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lipA00
3AIOA 3IVMA 4UBLA 5I7UA 1TKRA 1YASA 5E4JA 3DNMA 1WPRA 2VT7A 5SYMA 5HF8A 4J0KA 2ROQA 2Q0XA 2WSLA 1YA8A 2VT6A 2HA0A 3DS8A 5KBYA 1BEEA 4BB0A 4CG3A 4XJVA 1AUOA 1YCDA 5DYWA 2OCGA 3DYVA 3WIOA 5FV4A 1FFBA 5DYTA 1J06A 3AZQA 2J3DA 2OAGA 1A88A 1BCRA 4HZGA 1HPLA 1MX1A 7YASA 3G0CA 1CUDA 1GZ7A 2Y6VA 4QWWA 1CEXA 2ZYIA 5AOAA 4UPDA 4PO3X 1MPXA 5CURA 1EB9A 2XLBA 3ZLTA 4JH0A 3DKRA 5EIAA 4C87A 4GXNA 3QMWA 5AJHA 3MVEA 3D2BA 3O95A 1UKBA 2CB9A 1DTEA 3O4IA 3DQZA 3H2KA 4KACA 1CUGA 3QVMA 1D07A 2W22A 1C4XA 2R8BA 4L3WA 3M83A 3RARA 1QO9A 4NMWA 5FOQA 5ALOA 1PJAA 1E8NA 3ZWQA 4S0XA 5DTJA 1EI9A 3VXKA 4AO6A 3OURA 2XLCA 2WJ6A 2HM7A 4I19A 3STTA 3P2MA 4H35A 3BDIA 1EDDA 3WK9A 1EK1A 1CUXA 4DIUA 4KJXA 1L7RA 2VQ6A 4J0IA 1DU4A 1EX9A 2ZJFA 2WIGA 4H0CA 3IBTA 2ACKA 1XLVA 5AKEA 2PPLA 3Q0TA 1LPPA 4HVTA 2XUHA 2WUEA 3O4HA 2BGNA 4UHDA 1T2NA 1Q0RA 1VOTA 1VA4A 1J2EA 3A2NA 4QLOA 3A2MA 5CH3A 2BUAA 4O08A 1VJ5A 1O6GA 3X3HA 1ZD4A 2OCLA 2QJRA 4YPVA 4HXFB 3D2CA 4Y2QA 2JIDA 3D3NA 2HRRA 3QMVA 1EB8A 2OLEA 1OILA 1QFSA 1ORWA 3I2JA 4C89A 2G63A 4OCZA 3QH4A 4JEIA 1GGVA 4X00A 1G42A 5DJ5A 1JMKC 2CEKA 1TCBA 4BTLA 3G9TA 2C7BA 4LXGA 3B3QA 4OYYA 4C4YA 1XZLA 2Z8ZA 4MYDA 1XFDA 3WWPA 5JZSA 4Y2YA 4E11A 4LXIA 4W1SA 4B85A 5EGNA 2Z3WA 4DNOA 5LYYA 5EIHA 4BC0A 3FCXA 4UFOA 4MEBA 3ILSA 5ALHA 2PSHA 4EUSA 4UFPA 5LZ7A 2XUAA 1G4HA 3TGLA 4CFSA 1IMJA 3SK0A 2WG1A 3E0XA 4OYLA 2H7YA 1VE6A 1CV2A 2CZQA 5FRDA 3G9UA 2XUPA 5JALA 1JMYA 4XX1A 5JZBA 5IVHA 4ZWNA 3N2ZB 2DCMA 2J4FA 3OC0A 1HDEA 4U2GA 3G9XA 2B9VA 1BRTA 3WKBA 2OCIA 4BC1A 3FAKA 4G4IA 4TGLA 4B9AA 4IO0A 2H1IA 3W04A 1H23A 2OXEA 2WHPA 4HTAA 1NU6A 2HA6A 3VVMA 5JZ9A 5AOCA 2HRQA 5AHXA 2XUJA 4WFKA 4J0GA 1H2XA 4QA9A 1SCKA 3WWEA 4PNZA 2IITA 4QZVA 4ZRDA 3A70A 3UUEA 1W52X 5YASA 1XRMA 5KREA 1WB5A 4TVKA 4EHBA 4Q34A 4B81A 5ALVA 1VE7A 2WUDA 3WIBA 1YSCA 2WJ4A 2PVSA 5ALUA 1EINA 2CBGA 3L1JA 5A6VA 2O2HA 4UHBA 3HACA 2QXUA 4JNCA 5I8PA 1CUHA 5IH7A 1Y7HA 4AX4A 2XMGA 1UKAA 5HQ3A 2XT0A 2EDAA 3C70A 4OD0A 3GZJA 2G5PA 4X95A 4PSDA 1UK8A 3FWHA 1GT6A 2RI6A 5DWDA 5AKKA 1UK6A 2D0DA 5BV7A 4CIBA 5T4EA 2HHAA 3FVRA 2HFKA 3STWA 3WQHA 2XQKA 1ZGBA 3R3ZA 5FXMA 1MTZA 3HLKA 4G9EA 3YASA 4BP9A 4H7KA 2DHCA 4BZZA 2D5LA 3WKCA 5C7YA 3RLIA 4H7IA 4ZREA 3H19A 2RONA 5IKXA 2Z8XA 5LZ4A 4DLNA 1QIDA 4FLMA 3F8SA 3PF9A 1ZD5A 3DCNA 4OB7A 4YASA 3S2ZA 4FBMA 5FP0A 3S8YA 4ETWA 4DMKA 3GFFA 1R88A 2QTBA 1XZEA 1F0NA 3NWOA 4FBLA 3WL5A 3KDAA 4W63A 3WJ1A 2B61A 2PU7A 2WG0A 3D0KA 1KU0A 3DL4A 1EVEA 4ARBA 5AI5A 2PL5A 4CG2A 1JU4A 2VJBA 4I3FA 2YASA 4FMPA 4BAGA 2XUKA 4XVCA 2XMSA 3HEAA 2QT9A 5A7FA 3WWDA 1WHTA 4EY5A 5CT5A 1AX9A 1CUYA 4FLEA 1MAHA 2H7CA 2NW6A 4V2IA 2OGTA 4X6YA 1ZI6A 4EY6A 5A71A 3O4GA 2VF2A 5CXXA 2XMCA 1N5MA 3GA7A 5EI5A 3WWOA 4RE6A 1SCIA 3PI6A 1F0PA 4J0HA 5E2IA 3H1BA 4X93A 2FX5A 1QOZA 5JATA 1JKMA 3AINA 4W1QA 1ZICA 3W9BA 2WFMA 4G8BA 1LBTA 3PICA 4QDOA 3EF3A 5FPQA 1XQWA 3ANTA 4JUIA 1J1IA 3ICVA 4PQEA 1C7JA 4NS4A 3DDUA 2C0PA 1XZIA 4MWTA 3ZV7A 2VJAA 1UK9A 4B80A 4ARAA 1X2EA 4QDUA 1C7IA 5DNUA 2DQZA 2QMQA 1EDEA 1THTA 4FWBA 3DYIA 2ZJ6A 4U2DA 3WLAA 3IDAA 3C6ZA 1QIJA 2RIPA 1XZJA 4EY4A 5LZ2A 4BAZA 2JBWA 3DJYA 2DQYA 3BL8A 4J0DA 4GLBA 3DL7A 5FUMA 2PSFA 5HFNA 3VJMA 1VA5A 4H7EA 4Y2SA 1WCYA 5HZGA 3STUA 5ALRA 3EQ8A 5K3FB 4EBBA 3RKSA 2YXPX 5CT8A 3JYHA 1ODCA 1W75A 1E5TA 4G9GA 3WI7A 3R3WA 1DWQA 2WM2A 4KEAA 4UUQA 3H18A 4UHEA 5IVKA 5LKRA 1XZCA 2I78A 1GKKA 4P08A 4BYMA 2DFPA 1E66A 2AJLI 4HS9A 3MUNA 4CG1A 4UBJA 1MNAA 4AN0A 5ALDA 4OSEA 3D59A 3IURA 3IUMA 2XUOA 3Q8WA 4PSUA 3H04A 5CTAA 1DWOA 4Y2UA 1I6WA 4B7ZA 2OQIA 3VISA 1RWQA 3HRHA 4B9EA 2DR0A 2XUGA 3R3VA 4XWGA 3C45A 4H7DA 3W05A 1XRPA 1QIMA 4CI9A 3I1YA 1LPNA 3W2TA 2QOEA 3GROA 3VJLA 3PUHA 2HIHA 4P9NA 5FPPA 3WZLA 3NOXA 5ALMA 4DM7A 2VAXA 2OG1A 2C5FA 1CUBA 4OB6A 2XB6A 4GECA 1LPAB 1TIBA 3GELA 5C8ZA 5HF5A 2UZ0A 5ALKA 5KWJA 4BVLA 1BN6A 3AJAA 1DT5A 5K5EA 2FJ0A 3G02A 4C6HA 3V1KA 1XKTA 5CMLA 1BCSA 1ODTC 4MQLA 2XMQA 5LZ5A 5ALZA 5AI6A 3FLBA 5A7GA 2AJCA 3WL7A 2AJBA 3WK8A 2LIPA 1MAAA 2VTVA 2ACEA 5CT6A 3UUFA 3EIOA 1GQRA 3IULA 1Z68A 4QDTA 3AIMA 3AIKA 1X2BA 4CCWA 1K6EA 5JD4A 4DMHA 3VDXA 5LKAA 4QDZA 1GKLA 4LYEA 5JANA 4L9AA 5D7BA 3WL8A 1CUZA 1A7UA 4DYHA 1IUNA 3VKFA 4B6GA 4FLFA 1N5RA 1XZHA 1R9NA 4P92A 1MT3A 3QZUA 4K5QA 4EA6A 3H2IA 1MJ5A 1ACLA 5EFZA 2WILA 3R3UA 3U1TA 1WPXA 1DINA 1WM1A 4QNNA 4F60A 1XRRA 5F4ZA 2I3DA 3IUJA 4D9JA 3NGMA 1BN7A 5AKGA 1JU3A 2QUAA 1LPMA 1ZJ4A 5AI4A 1XZAA 4KR0A 1P0QA 2C0QA 2Z3ZA 3G7NA 4Q05A 2WFLA 4CCYB 2ZSIA 3V1MA 3TJMA 4GDMA 1H2ZA 5SYNA 4BVJA 1R3DA 5HK8A 1CUFA 5HQ3B 2VAVA 5EHXA 2X5XA 3CN7A 5ALGA 1CUWA 3FOBA 3HJUA 5EHQA 4IH1A 2OGZA 1CR6A 2RHTA 4G4GA 2BAGA 4MEAA 1ZD3A 3C43A 3TRDA 2Y2UA 1ZGCA 3F98A 5HF6A 3H2HA 2YYSA 5ALSA 1HQDA 3H2JA 1LLFA 4WJLA 1QLWA 2V9ZA 2QKYA 1XRQA 1WOMA 2G4LA 4N8EA 2BUCA 2CJPA 4QLAA 1QGED 4PF1A 4LKOA 1EK2A 2VJDA 3AFIA 1QFMA 4U2EA 4A5SA 4KYVA 1Y7IA 4U2FA 1LNSA 3K6KA 4LXHA 2AJ8A 3RM3A 2WTMA 4BE4A 1WB4A 3WKEA 3FLEA 4WY5A 2I3ZA 4QDXA 3GUUA 4KE7A 1UT6A 5EIEA 1K8QA 1CPYA 2JGEA 1B6GA 1SC9A 4X85A 5T4FA 2JGLA 3PDCA 5DYYA 3IIIA 4OU5A 3ICWA 5JAHA 1EVQA 4G1FA 4IH9A 2WQZA 1CUSA 2XDWA 4B0OA 1IUPA 5CH5A 1XZFA 4BDSA 5AM0A 5EHNA 5ALTA 5AM2A 2HDWA 1BS9A 3C5WP 2H9YA 5D6OA 5LZ9A 3I2FA 1F8UA 1TCAA 4EZIA 2ECFA 4UHCA 4FNMA 3STXA 3STYA 5AM3A 3C87A 3QBJA 2CKMA 4M0MA 5AI9A 5CH8A 2XMBA 2HU5A 2ZYHA 3QITA 1ZD2P 4W1RA 1Y37A 2ORYA 3PE6A 1HLGA 5EHZA 1JI3A 3WMRA 1H22A 3H17A 3R40A 5HK9A 4WDQA 4BE9A 4ZXFA 3SX4A 3W06A 1DT3A 3UMJA 4H7FA 2YH2A 1MU0A 5ALWA 5T4BA 2XUDA 1VXOA 1R4ZA 2BGRA 1UWCA 1KU6A 1AZWA 4FOLA 1YAHA 1YAJA 4PW0A 3OTQA 1XZDA 3WK7A 2VSQA 1ZIXA 1AKNA 4UBOA 1XZGA 1W1IA 3IB3A 4UBNA 4P93A 3WKAA 2QZPA 3QPDA 1CLEA 3HABA 1E8DA 4Q3LA 1ISPA 2OCKA 4X90A 4AO7A 4L0CA 3AZPA 4K2AA 5K3DA 2JEZA 2HA2A 1DQYA 3WA6A 2Y6UA 4DNFA 4GI1A 3WKDA 1IUOA 4QE3A 1QIEA 3FYTA 1XKLA 2PSEA 4IH4A 1QIHA 3HZOA 1W76A 2BCEA 1HBJA 2O2GA 1VKHA 4MYSA 5ALNA 1KEZA 1UXOA 4KRYA 4BBZA 1IZ8A 2XE4A 5AK5A 2WJ3A 5DNWA 3TEJA 3R0VA 2PX6A 5JD6A 1L7AA 3V9AA 2Y1KA 5AH0A 1FFAA 2HA3A 3H0CA 5FKJA 3STVA 4AO8A 4EY8A 3PFCA 5ALJA 3M81A 5ESRA 4BAUA 1QONA 4WY8A 1ZJ5A 1CVLA 1K63A 2RHWA 4DSZA 5C81A 3DD5A 5K3EA 1LGYA 2HU7A 2O7VA 4HXGA 1U8EA 5AKLA 4AMZA 1QIIA 1VZ3A 1FFCA 3EBLA 3HI4A 3KD2A 3QPAA 2V96A 2C5GA 1VXRA 1JFRA 2QS9A 5CW2A 4PSCA 2DHDA 1P0IA 1IVYA 3LLCA 4GBGA 4J3JA 2AJDA 4KE8A 5LZ8A 1LZKA 2O7RA 5ALYA 1DQZA 1GPLA 2PBLA 4K6HA 1ZIYA 1QIGA 1VZ2A 2JGKA 5JARA 2EEPA 1Q0ZA 2WHQA 1ZOIA 1H2WA 2IX9A 5DTIA 1A8UA 4ROTA 3DOIA 2HA7A 4C88A 2WU4A 1M33A 3ED1A 4F0JA 1CUUA 2RGUA 3C6BA 1DX4A 3CN9A 3FNBA 5ALQA 5BWCA 4K6KA 2PM8A 1FJ2A 3OG9A 2XQFA 4OU4A 1CUEA 1XZMA 4X91A 3ZLVA 4KE6A 2WFZA 2DHEA 3R41A 4KAFA 3IUQA 3ZLUA 3DEAA 1EH5A 3ZPXA 1CUJA 4BCBA 1YA4A 5D3KA 3BF8A 3FYUA 1E3QA 2PSJA 4HRYA 5JAUA 4F21A 2J4CA 4G8DA 2QUBA 5AIBA 3M3DA 3WZMA 3WYDA 1DWPA 5AI8A 2WFLB 1EA5A 3K2IA 3D5EA 5FDFA 2GYVA 1SFRA 2HADA 5CRIA 5ALIA 1L7QA 3WK4A 4EB0A 3KSRA 3SC2A 1AGYA 2V97A 4AB1A 4H7JA 5ALXA 3K9BA 2ZYSA 3VJKA 5A2GA 4J0JA 2WUFA 1XQXA 3OPMA 2GBGA 4I4CA 5AM1A 2WU3A 4FFWA 5AM5A 4X94A 5CBKA 4IHAA 1QTRA 3OM8A 4DMFA 3ESBA 1THGA 3KXPA 2FJPA 4X92A 4DTCA 3N0TA 3I1IA 4IQ4A 5AKJA 1AURA 1YB6A 3F9CA 2PUJA 3QPCA 2PUHA 3CXUA 4UBMA 4Y9SA 1OXMA 3PUIA 3BIWA 5K3CA 3V1LA 2WLSA 1Q83A 2X8BA 1XROA 3A6ZA 1Q84A 4NVRA 4BATA 2JGJA 3V1NA 4LHEA 1CQWA 4RPCA 2JGIA 3BIXA 1U4NA 2B4KA 2GZRA 2BKLA 3QYJA 5DNVA 2GYUA 1XZBA 4Q3KA 2XI4A 4L72A 3EQ9A 3WYNA 2PKYX 5LIPA 1TCCA 4GEGA 4MXDA 4EY7A 3A2LA 4WFJA 4FHZA 5KWIA 3BE8A 5CT9A 2RAUA 4UHFA 3JW8A 2QM0A 1UK7A 4F5ZA 4MQMA 3FSGD 1B41A 4N8SA 1CUVA 2C4HA 4K6GA 1NX9A 4NZZA 2BUBA 3WA7A 4Y2RA 5AK6A 2XUQA 6YASA 4B83A 3PFBA 2B20A 5HCUA 3F97A 2JGFA 4W9RA 4U2BA 1ETHA 2BFNA 1R1DA 5AIAA 3IUNA 4GHWA 4X97A 3PF8A 3I6MA 2WHPB 3G8YA 2HA5A 3O9MA 5CXUA 1TAHA 3FCYA 3HSSA 1UFOA 1YS1X 3BJRA 3VVLA 1G66A 4H7HA 4Q82A 1MX5A 2XUIA 3O9VA 1CIJA 1CUAA 1QO7A 4ZI5A 4INZA 1A8SA 1RYYA 1BE0A 5JADA 2GBCA 1CQZA 1XLWA 1CRLA 1MNQA 1DX6A 3I6ZA 5AK4A 5AO9A 3GBSA 3WK6A 1QIKA 3WL6A 3V48A 4G4JA 4HXEB 3FSGA 1R50A 2X76A 5LP1A 4C4XA 3MGAA 4PV7A 4WDRA 1AMNA 4J0CA 3BF7A 3HXKA 1HL7A 4RNCA 3D4LA 4LYDA 3E4DA 1T4MA 2K2QB 1RP1A 1CUIA 3BXPA 3IA2A 4DNQA 2ONCA 3I28A 5K3FA 2WUGA 4AQDA 1NU8A 5AICA 2WHRA 2ZYRA 1K4YA 5AM4A 3AZOA 3JWEA 2PSDA 1UOPA 4XIIA 5ISMA 3CCCA 4E15A 5A62A 3CCBA 4AN1A 1FSSA 1QIFA 4DMCA 4MWSA 3H2GA 4BCCA 2XQJA 1A8QA 1UOOA 4ZGBA 4WCVA 4ITVA 1MX9A 4Q3OA 4UBKA 1TK3A 4DNPA 2JEYA 3ESCA 3WWCA 4B84A 5AKHA 2WIKA 3SWWA 2AXEA 3E1GA 1FFEA 4FFVA 2GYWA 4WFIA 5K3BA 3B5EA 3R3XA 3DKKA 2J3QA 5E4TA 2HA4A 3LCRA 4Y2JA 5AKYA 3B12A 3O0DA 4BRSA 3I6YA 3H1AA 2XUFA 2I03A 3I2HA 4BP8A 5IVDA 4FDMA 3O4JA 1HKHA 4X6UA 2QJWA 5AI0A 4W1PA 1N8SA 3LIIA 2HFJA 2VA9A 4X6XA 2CUTA 2QR5A 2PU5A 1ACJA 1UZAA 5ALEA 3L1IA 1ZI8A 2VATA 4QEKA 5HKBA 1W6RA 4HAIA 4OUKX 1GPNA 4N5IX 4Z49A 3G0IA 3LIPA 4HRXA 2V98A 5CT4A 3I2GA 3M82A 2CMFA 2E3JA 3R3YA 3BDVA 1AQLA 3QMMA 4H77A 4J03A 1R9MA 2GBFA 2Y2VA 1JJIA 4U2CA 3F67A 1CUCA 2XMZA 1SCQA 1J07A 4TPKA 3C8DA 1XQVA 4OPMA 4E14A 3L1HA 2WKWA 3EQ7A 3MUOA 1TRHA 5ALPA 2WG2A 2ZJ7A 2O2IA 4ZV9A 3FVTA 2VEOA 4YK7A 1EDBA 1ODSA 3BJMA 5DLPA 5C8XA 5JAOA 4ZV7A 4OB8A 5ALFA 5HFAA 1WHSA 4X71A 2C58A 1U2EA 2XMRA 4AZ0A 4X3CA 2JF0A 2W6CX 3ZI7A 1YS2X 5AK3A 1XLUA 2OQVA 1U65A 1VLQA 2Z5GA 2WIJA 1P0PA 1ZI9A 1F6WA 2WIFA 3FYUB 2QRUA 4CCYA 2QVBA 1H2YA 4BZWA 1E8MA 1EXWA 3C6YA 4Y2XA 1XQYA 3G0BA 1OCEA 4C4ZA 1AC5A 1S8OA 4MJ3A 4LIPD 1MO2A 2BJHA 3KWJA 5AP9A 3WK5A 4Y2PA 4FNGA 3U0VA 1O6FA 1IZ7A 4KRXA 4X7BA 5JASA 5JAPA 3FBWA 5BOVA 3ESDA 1K5PA 4DGQA 3HYSA 2ES4A 5D3ZA 3D7RA 2OGSA 4FTWA 2QXTA 1BROA 4JYMA 5AKXA 3I2KA 4AMYA 1EHYA 3T52A 4B82A 4BTVA 2H7XA 4JYPA 1XZKA 3LS2A 1QE3A 4N8DA 1BEZA 3C8HA 4AZ3A 1PFQA 2VJCA 3DLTA 5C8VA 4RE5A 1E89A 1QTIA 4G8CA 4QWMA 3C5VA 5JD5A 1PV1A 2WTNA 1QZ3A 3DOHA 4BVKA 1LZLA 1YR2A 4M0EA 1GXSA 4KAJA 2EDCA 5HKAA 1YB7A 5AKIA 4YX9A 2HL6A 5BWBA 3G0GA 2ZSHA 3KWFA 1USWA 5A7HA 5FLKA 1UKCA 3HC7A 1SOMA 4A16A 4A23A 1GPKA 4G5XA 1UOQA 2P8SA 4E46A 4Q1VA 2FUKA 5K3AA 3G9ZA 4AXBA 3G0DA 4N5HX 5AKZA 2R11A 4DSAA 4FKBA 4Y2VA 2OAEA 4BCDA 1BU8A 1GQSA 3D2AA 3I2IA 1MN6A 1XRNA 2WIDA 4M0FA 4Y7DA 4C01A 5AOBA 3ESAA 4UFNA 1P0MA 1WB6A 1X70A 2XMDA 4UBIA 3FLAA 3NUZA 3OOSA 5LLSA 1LPBB 4UHHA 3WJ2A 5IVIA 1JT2A 5HF9A 2ZVDA 4B0PA 2GZSA 4CIAA 1W4LA 1QJ4A 1CFJA 5I9IA 1JJBA 5T4HA 1G5FA 5E4YA 5JYCA 4H18A 2JGMA 1FFDA 4GW3A 4J7AA 3AILA 3AUKA 2IIVA 5H3HA 2OPHA 1ORVA 4KE9A 1TQHA 1LPSA 3T4UA 1XRLA 3ANSA 3LP5A 4Y2TA 2HU8A 2GBIA 3E3AA 4GWLA 4KAAA 3FYUC 4BRZA 5ALLA 3BWXA 3W9UA 3RK4A 1LPOA 3F96A 5J3JA 2G5TA 2XQIA 1N1MA 3KOOA 1LBSA 2XQGA 4BDTA 1JJFA 2DSNA 4RGYA 3QM1A 5JIBA 3C6XA
chains in the Genus database with same CATH superfamily
2G36A 3I73A 3IVMA 4UBLA 4YJHA 1I5EA 2NV0A 1ZA2A 1KXZA 2PUVA 2X4IA 3DLCA 1XTUA 5B5SA 1U11A 4B3GA 2ZTMA 3ILHA 4CR8A 3W4KA 4Q3NA 4YJFA 1PUIA 4E5KA 3B48A 3KLNA 3KEOA 4Z9BA 2WSLA 3C3MA 2XWQA 1ORDA 3C16C 4JLUA 3SQLA 5HVNA 4LGMA 3UB3A 5CX1B 1AF4A 2V8OA 4HV4A 5K09A 1U6IA 3NLLA 5IEBA 4IILA 1KJQA 1VJRA 1YZUA 3DEKA 1GG2A 2I2FA 4HFJA 4RDCA 4YO7A 3G0HA 1RU3A 2GUGA 5FBZA 3KOMA 1KZ7B 1M1NA 4M6WA 3W90A 3BSWA 1ADCA 4WRRA 3I6IA 4BB0A 4QVIA 5FTLA 4CKXA 1ANKA 2PUTA 2C5SA 4ENSA 4ZN6A 2C3MA 3BGSA 2IH4A 4JYAB 4MVJF 3GRCA 4F9FA 1L4UA 1YCDA 2ZAYA 5CGZA 4OQEA 5KVVA 3DDWA 3VR4D 2OCGA 3ZEAA 4KQKA 4J94A 1FFBA 1NRIA 2GNPA 3OY7A 2C83A 2NXCA 3AOGA 3CLUD 3RWOA 1N9ZA 1GZSA 5DM0A 3DAPA 4TZKA 2OAGA 5H81A 2IWHA 3IXMA 2GPTA 4UASA 1V5FA 4GVXA 4GI2A 5C7LO 5HDQA 1A50B 5JI2E 3R9KA 4MYUA 1IOWA 1RI2A 4LJLA 4JUFA 3VC2A 3AHEA 4LVOA 3KOWA 3T5GA 1WZ2A 2FQQA 1MX1A 3FE2A 5E1BA 4X45A 2QN6A 2W2KA 7YASA 2GR9A 1NWCA 2XODA 2ZJYA 3L4EA 3I0MA 3LE8A 4ZI7F 1CUDA 5IHXA 1WY5A 2Y6VA 3TPCA 2PWZA 3LAWA 2Y1WA 3OLCX 2A7XA 4NBTA 1AKYA 1RLTA 4LK2A 4MZXA 1N6HA 2JIZA 3G88A 2GJAA 1SBHA 1W36C 4UPDA 3HBLA 4P0QB 5C5IA 3D8TA 3GEPA 4W5JA 2EZ9A 1YR7A 1KC3A 2MOKA 2MYUA 4CE6A 3FR7A 2YIJA 4I3GA 3K8OE 2HTFA 2AZDA 4HC4A 3UK0A 4AF7A 4DG8A 5CFMA 2W83A 3RFTA 4WXHA 4BMNA 4J7XA 4CUZA 2P75A 2XRZA 2NO9A 2PRJA 1UJBA 2OE2A 2WZQA 4YCNA 5AD1A 5LMNB 2BLNA 2OK7A 1U7DA 3ICPA 4LGYA 4DDMA 1GEEA 2ZE8A 4UQPA 3PQ3A 2JLZA 5ELXA 1WOYA 2A0YA 3O95A 5HPYB 3WJ7A 1UKBA 4PPGA 3PNPA 4CUJA 1CUGA 3CMCO 4KQHA 3QVMA 4BMPB 2YBEA 4IMJB 3SF8A 4D2IA 3GDOA 4G1BA 1VFNA 2W22A 3ZW8A 3ABRB 1DXYA 5F2OA 3Q8LA 1YQTA 2ENUA 2QG4A 4L3WA 3NRBA 2OHXA 4R5HA 3RARA 2IY8A 1QO9A 4OM7A 4C07A 1FFHA 1MUUA 3MAGA 1HA3A 1Q44A 1RAEA 2IZ7A 2QG6A 5E9WA 1P2GA 3MS4A 2JAOA 4XIYA 1EESA 2W2TA 4S3MA 2WJGA 1M6NA 3P5BA 1XG5A 2P9YA 3A6FA 3OMWA 1E8NA 3IRUA 4FONA 1IHYA 2W6JA 1PG0A 4TXHA 3WO0A 5BURA 4CEJA 4AP5A 3C3DA 4RIGA 2VP0A 4ND6A 4Q9NA 4HFMA 1J5EB 3PNOA 1LRLA 2DLCX 1M34A 3C8UA 4LY3A 4AO6A 3RJZA 2I66A 2AMYA 3I83A 3W6PA 1CC1S 2J9FB 1SC3A 4I19A 3ZWOA 1QQBA 1I36A 2CXQA 3D43A 3LMKA 3S70A 3ZG6A 2MYTA 2R79A 1CF2O 1GG9A 3ESZA 5DNYB 4UAVA 1DHRA 4QAQA 3QPWA 2VRWA 2LDBA 2Q9UA 4Z7JA 2NU8A 4AMUA 2G88A 1E3LA 3TBHA 5KCMA 4KJXA 1L7RA 2JA1A 3W1WA 4ZGGA 4J0IA 1Z6PA 1DU4A 5KCZA 2CNOA 3RJTA 1KMIY 5IJWA 2H8GA 2PZKA 4F97A 3DO6A 3HJAA 4FSXA 3VBCA 1ILEA 2HXSA 1JUDA 1G21E 4DJJA 3N70A 3JQFC 4G5GA 3RSSA 4HKTA 4XYLA 3ZW7A 3DTVB 4YCSA 3T5AA 2I99A 2D59A 2PPLA 3EVZA 3U0BA 4BWGA 5A3QA 2PS1A 3L6UA 1KS9A 3FI9A 5C80A 2WUEA 4DSUA 5EIXA 2WPDD 4HUQB 4R31A 4WLUA 1N2ZA 2VDJA 4RX1A 3LH5A 4MW4A 4NPCA 3JQ7A 5SICE 1GN8A 4MUMA 2RHHA 3DEYX 3KOXA 5CH3A 5EJGA 2A9QA 3ABSB 4CU5A 1P7PA 4NCKA 2ZTSA 4Q4JB 2P67A 3KQLA 1HT1E 1VJ5A 3HGTA 5ADHA 4IOLA 1L5RA 4PRYA 1U2DC 4XGNA 2HMAA 2ZYDA 3PENA 4XRRA 2NSYA 3QMPA 4PYQA 2W4QA 3ICOA 2VUIB 4V0NA 1QTNA 4MIYA 2HRRA 3QMVA 4BNHA 2Y4NA 1LJUA 3CSUA 2Q7XA 3NS7A 3ORHA 4IXTA 4M36A 4U7FA 3QA3E 1SBCA 1XZNA 4KDFA 3M4NA 3DMTC 3UK2A 1ZDMA 2OLEA 4KNYA 5EZSA 5F35A 1P4AA 4GNRA 3C3JA 3DP7A 1G7CA 1WQ1R 1ZM9A 4NDZA 5ULLA 4C9BA 2XVYA 4C89A 5CYGA 2BELA 4OCZA 3WBKA 4YP5A 3QH4A 3HB9A 4XPZA 1GGVA 2LWIA 5IVKA 4MI9A 2A94A 1TYZA 4MPTA 2XA9A 4JUCA 4N0PA 4X00A 4FXPA 1Y6FA 5DJ5A 3FRHA 3VZCA 1JMKC 2VPQA 4Q6BA 3VO1A 5EUMA 1TCBA 3SKVA 4A3SA 1L5KA 3GF4A 4GZLA 4O8ZA 4PWYA 5DBIA 5F5LA 3OH8A 3U4AA 3VU0A 3Q9UA 4QT0A 5I9MA 3CZMA 3NHJA 3DXYA 4BFXA 3RR2A 2BFCB 2RHMA 4MVJD 3DQQA 4GKJB 4OYYA 5H80A 4ZZ2A 5T3UA 1U1CA 2JFFA 3UTCA 3G2IA 3O73A 1I4OA 5GP1A 4V0MA 1FW6A 3RUDA 1Z4IA 4FYVA 5JTUA 4J1TA 4JDUA 1N1EA 2AB0A 5A05A 5JZSA 4P0PB 1DE0A 2GAAA 1BHQ1 1L1QA 2GCIA 4M1TA 2GXQA 3GWZA 5ECWA 3KTAA 4BNIA 5DDIP 4BZQA 4E11A 4W1SA 3SOZA 4B85A 1YR1A 1NULA 1KMMA 4IDPA 5LYYA 1FP7A 4U3JB 3U7HB 1E9EA 3LYHA 4RORA 1TM1E 1UDRA 4ISBA 4BC0A 4ZEVA 5F9FA 3FHTA 1D2AA 2KSQA 3SVZA 4WXRA 1YV9A 3I37X 5ALHA 3TTYA 1GJRA 3MTAA 4WIAA 4HDAA 2HRBA 2WAMA 3MJDA 3U16A 2ZB8A 1C0EA 1Y4UA 2X41A 1R12A 1ZNYA 2QN3A 2WAXA 4LHXA 4UFPA 1PJ8A 1U1DA 1YQGA 2MINB 2QQGA 2XUAA 4YQEA 5LZ7A 3TGLA 2N42A 5KU1A 4Y0VA 1J7JA 2GEKA 5FOXA 4HWTA 1FP6A 3SK0A 3D8HA 1TVKA 1O95A 1P80A 1QHGA 3L0PA 4YT2A 3BT7A 5CNMA 1LA2A 1Z2AA 3KU4A 5E6RA 5KYKA 3ABZA 3QOFA 2WWWA 3A9RA 1AH2A 3EHEA 3PR1A 4YDSA 3VU9B 3UNXA 4GFDA 1PBNA 1I1QB 2VPPA 1UAGA 1FBNA 1C0KA 2I4MA 1TU0A 2C04A 1QB8A 5FRDA 2E5FA 1X15A 1O4WA 2XUPA 4GYJA 4FFNA 2IYRA 1Q57A 1VSUA 2OBFA 4LVCA 3N8NA 2HRDA 4O4IB 4XX1A 4UU1A 5TR9A 5CCXA 4JOCA 4RZUA 2LTAA 3VYVA 2W42A 2DQKA 2D2VA 2X7XA 3OIVA 3FXAA 4J75A 1Y89A 1JDNA 2J4FA 3IAEA 4PC3A 4GWKA 1VHDA 2VXBA 4LC1A 3GJ4A 1PHPA 2Q1YA 4C0QC 3EPLA 4JBHA 4FYYA 2QTNA 3QG1A 3KWMA 3R5JA 1BWQA 4MARA 4WW0A 1I0IA 2CV1A 5GGYA 1J0BA 1JT9A 3ZIAD 1YULA 1A8HA 1DMSA 2NO1A 4Z7NB 1NNEA 4EA8A 4FGZA 4KSCA 1VL2A 2J9GA 4G4IA 4WQMA 4TGLA 5EWMA 5J1TB 4AD8A 1ZJ6A 5IX8A 2V5AA 3OQNA 2XF2A 5BP7A 1RWNA 2C94A 1W5TA 3DDCA 3IP6A 3LQFA 5JNRA 1AA6A 2VTBB 1EWQA 2GTHA 3FHLA 4LKRA 2WHPA 2ZT7A 2VSXA 4HTAA 1NU6A 1Z82A 2HA6A 3VVMA 1MDFA 2O1XA 4EI7A 5L7YA 4JUDX 4GG1A 5AHXA 2Q6LA 5AOCA 1RJ9A 1EP3B 2HPAA 4EEZA 4YY3B 2ID8A 2FEOA 3FSEA 1GNTA 2W2NA 1G5TA 1Q0UA 1XVIA 1B3BA 1UOEA 2V65A 1H2XA 1QR2A 3GPCA 4J0GA 1CVRA 2LZ0A 1KAGA 4QBGB 2I22A 1I7NA 1SCKA 1Y4SA 4G5HA 4RPKA 2IITA 2W58A 4W5WA 1G3QA 3FAZA 2UVPB 3OFSA 4LJ7A 3A70A 5F1YA 1MD9A 3NNNA 4PINA 3SLRA 3UZUA 1W8DA 3E3NA 1XRMA 3I04A 3S0JA 1JBQA 3A1CA 5JFTA 5LMZA 2BGUA 4NG5A 3URKA 1KBQA 3BQNB 4OH1A 2ZS7A 4TVKA 1P9NA 4WLEA 4Q34A 1RQXA 5ALVA 3LC0A 3UMRA 4ABYA 1GT91 1OGJA 1VE7A 4JBXA 2QZSA 5FOUA 3IBYA 3H6KA 3WIBA 4KQ2A 3T5BA 2VUSA 3BHIA 4UM8B 4TKLA 4QUDA 4L0QA 3H11A 3UMGA 1OWOA 3HY3A 3OZTA 5ALUA 1NBAA 3BXOA 3X1ZA 4E5PA 4B6RA 5HJEA 3U3RA 4Q93A 5C8DA 1RE0A 1QBGA 2O20A 3AB8A 4JCCA 3U7EB 5B6JA 3AFGA 3L1JA 4D5GA 4C7OB 1JA9A 3HDQA 3U4QA 3FPGA 4HZUA 2HGZA 1JAXA 5I8PA 1GG8A 2JRCA 1RHQA 2IPXA 3Q8XB 3QOWA 3TNJA 3VR4H 5CB4A 1SOVA 1MIOB 1XAIA 3L8MA 3GRZA 2PXAA 4EKDA 2P91A 1G8MA 4G56A 2VIIA 4PPFA 1X9IA 1UMKA 4R7GA 3HU2A 4KMSA 4PVDA 1RXWA 3IALA 3CNOA 3TLGA 5HQ3A 2B8EA 3GZ4A 1E6KA 3TDMA 2XT0A 5TB5A 1GAXA 5H7XA 2WT8A 5JAZA 4M0LA 4N9WA 1TF7A 5G2OA 1SBYA 2YCLA 3PQ4A 2XTMA 4OD0A 5CVCA 8GPBA 1JEYB 5CDTA 2G5PA 1KO1A 2JC3A 2QTGA 4CKWA 4NXNB 1SM4A 3DNFA 2WYWA 4G0YA 5K8JB 3SC2B 1UK8A 4IDEA 5IABA 5J2TB 4QM7A 3THYB 4KXLA 3ICCA 1IOZA 1N5OX 1II8B 1Q91A 1YDHA 1ZHFA 4MW5A 3TZLA 5BSFA 5KYNA 5KSZA 3EXHB 3B1JA 4IICA 1DO0A 4UEQA 4WZAE 1JLRA 1NW3A 4BFZA 3F90A 5BV7A 4DV6B 4OGGA 4ALJA 2WK1A 4FKZA 4IIUA 1GFIA 2OXCA 4IJUA 4R9UC 3ZGOA 2HHAA 4OP2A 2IEDA 3JAWB 3CB2A 4FHDA 2YYZA 4IVRA 2PZFA 3STWA 1AV6A 1VE5A 2EHJA 4U7GA 2AK2A 3K05A 2NVBA 4KQ1A 3NHLA 3COYA 4G24A 1TADA 1T9GR 3PDWA 1LBEA 5FXMA 1XTBA 3RYTC 4URXR 4AECA 1MTZA 1OC4A 1VE9A 1WDLA 1Z5GA 2J1LA 2JFPA 5K45A 1PWYE 2MR5A 3F78A 3WDKA 4BZZA 4HX2A 1GFSA 1PD0A 2P9FA 3VO9A 2JHAA 1EBBA 3AG5A 4PAQA 3E27A 1ZCZA 3H19A 3JASA 4QOJA 4ZREA 2Z8XA 2DH6A 4BEWA 1U4OA 4PFQA 3IDFA 1GNSA 1P1FA 4MDFA 1WNTA 2LR0A 1S2MA 3O1LA 3AR8A 4FLMA 5IMSA 3P0IA 5A5VA 2A4KA 5IF9A 3SDSA 2R6GA 1ZD5A 2CVHA 2VYCA 2FWPA 3DCNA 3F1KA 3I4CA 3NHPA 4NU6A 2OYCA 2JI6A 4TRRA 2QM8A 4TLEA 4Q4DA 5CVJA 2YDXA 4FBMA 1VL5A 4G0MA 5JDCC 2BMEA 1DBWA 3QKTA 1VYVA 2EOAA 1M1NB 2LE0A 2NO4A 3B5JA 3M4JA 1MFZA 4QXMA 1R88A 2BE7A 4NZMA 2B9EA 2YWDA 4Q6WA 4XGRA 4FBLA 3WL5A 4JKIA 3KDAA 2QX8A 3ZZMA 3LVQE 1UP6A 1UM9B 1XWWA 2IELA 3GWGA 3UJ9A 3UENA 3X1MA 3GJ6A 4BO6A 4ZJYA 5DLEA 2CF6A 4MQ4A 2HRCA 2ZWIA 2GAFA 3GDWA 3JQAD 4AMVA 2NZUG 2ZSFA 3FMGA 1EVEA 3FFXA 4ARBA 4K05A 3T4XA 5JRZA 1N7HA 2HR1A 2PL5A 4OEHA 3U7QB 5TLSA 4CG2A 4AG3A 4WLVA 1JU4A 4PLGA 4I3FA 1C8BA 1SUDA 1UIRA 2E9SA 3G1UA 4FMPA 3CUKA 4GKVA 1EVKA 4YUVA 2XOKD 4XVCA 4N3CA 4MZDA 4O2AA 4UMDA 1C5KA 3IP5A 4Y2HA 1IBLB 4MLZA 2ZGVA 1AKQA 3UJ6A 1I7LA 2QT9A 2XNSA 3AG6A 4QUBA 2IH2A 5LOVA 1IU9A 2X3FA 3MMXA 4P5DA 3GLKA 4ZIRA 3LT1A 1KDYA 3MINB 1N5DA 2GN6A 3MEQA 1PJCA 4B3MB 4TUYF 4N1AA 4V0QA 2IZ0A 3L77A 2G4VA 5GOZA 2V9PA 1M83A 4FMDF 3V8PA 3SG0A 1ETUA 4OLJA 5SYAA 2NW6A 3N2KA 1U2GA 3RABA 4C08A 5CPBA 3DBOB 3ZQKA 2G17A 4TV8F 1UM8A 4BFUA 3ETGA 1M5UA 4EY6A 5JFOA 2XMCA 1M6WA 1FDOA 1TXGA 1N5MA 5LA6F 4IF6A 2Q9AA 3DO5A 1PT8A 4ARVA 1F0PA 2ZI9A 2K6GA 3H1BA 2NYUA 2FX5A 4EQ6A 1UBEA 2AW5A 4AJPA 1ONOA 4OI4A 1QB7A 2ZUCA 4BQNA 4EG0A 6REQB 3HL4A 1HNWB 2FZLA 3AINA 3IGFA 3IVGA 3D7KA 5G0WA 1SVNA 2JCVA 1AGNA 4JS0A 1ZICA 1SKQA 4W4TA 3LUKA 4HLUC 2AUMA 1U9JA 2X86A 3KUKA 1AUPA 1SD2A 3UJCA 4C06A 3EBOA 2J3IA 2WFMA 1O97D 5EL0A 2XKJE 1K6IA 1WUTA 4E08A 4PQGA 4KODA 1E1YA 3C7TA 4KXXA 3IMCA 2BRUC 4M9QA 2FWJA 3JTEA 4IKPA 5AVKA 1XMVA 5DHRA 5FOTA 1GLGA 4OMDA 2VG8A 4ZT5A 1DIGA 1SKYB 3HA2A 2C3UA 1C7JA 4CEJB 2XDQA 4XDGA 1RZ3A 4NHOA 4O4HA 4U1RA 5LUBA 2O2CA 3WISA 4KTTE 3DDUA 4IVNA 4MWTA 1FYVA 1IEWA 1M34B 5J2UF 2PKQO 3JSAA 5CNKA 1ISFA 2J7KA 5LSAA 4KH1A 4B8ZA 3ZHQA 5HP4A 2VF8A 3OD5A 4IEFB 4NH0A 4OHFA 1C7IA 2IXEA 3PUWA 3DE2X 1EDEA 2ANBA 4XSVA 1ECFA 1TM5E 3DYIA 2NU8B 1DDIA 1PNTA 1F20A 4W9MC 1O0CA 1OBVA 3DBHA 2P6RA 2PL1A 1SWVA 2O14A 5JRJA 1XEWY 2CMHA 3C6ZA 3GRRA 3PKZA 3GFBA 3VKVA 5CD1A 1RZRA 2BGGA 4Q1AA 1TM7E 2RIPA 1Z5PA 3PUZA 4ZQFA 4FJ1A 1XZJA 3PC8A 5D86A 4UTXA 4D6YA 4MVJE 1I9CA 4BAZA 4F3YA 4EUNA 1XKXA 2H3EA 1NMQA 4I5IA 3W7BA 2P68A 4A73A 1JQLB 1GTVA 4GLBA 4X44A 4JIGA 1ZVJA 4D4GA 1IC6A 1WCV1 4DV0B 1VA5A 4H7EA 1Z8HA 1YVDA 1QJCA 3LBFA 4KO1S 5IJ0A 2ZCVA 1CNEA 1WXWA 2QW1A 4NR0A 3STUA 3N53A 3IA7A 1TPZA 5ALRA 4D4JA 1XDBA 2INGX 3UY4A 4HDRA 1LC3A 3BWBA 3HM9A 4GH5A 1OXBB 2WSSA 4EBBA 5FPYA 1H6AA 5K05A 5CT8A 3SFVA 1OMOA 1DPFA 1ZGAA 4BO2A 2D7CA 1COZA 4MEJA 4L76A 4OFZA 3EJ6A 3ZJYA 4INJA 4DLPA 1GYQA 1ZRNA 1EBUA 3KB8A 2IOYA 2YNMC 5F3RA 1QH8A 2MR6A 4J76A 2Z1MA 3ZGVA 4G9GA 3EK2A 3WI7A 1XEFA 3IOEA 3WLRA 3R3WA 5EJ7A 2X4DA 5U4XA 3ULKA 1QCCA 1UWKA 2BONA 1HYGA 3VC3A 5JRDS 5M2QA 3HWSA 1CS0A 1UFQA 4UUQA 4ZDJA 1P4RA 2XF8A 2YMQA 1R0YA 2FEAA 2OO5A 3IAHA 1D09A 1L1RA 2W8ZA 3LHSA 4I9UA 1KAEA 4N7MA 5KHLB 3O8NA 4H7PA 3PC4A 1E66A 1PG2A 2DGDA 3UXHA 2PLRA 1R74A 2D1SA 3EXHC 4UBJA 1MNAA 1ZUWA 3PHGA 3P45A 2DOKA 3IURA 2F1IA 5KWVA 3O93A 2CSXA 2NV6A 3Q8WA 1PJRA 4PSUA 4BN0A 3H86A 1FL9A 4JVOA 1FDRA 4MUNA 4EFMA 4JLJA 4JHLA 3EIXA 3UAYA 1L9XA 1NBHA 1RWQA 2PYDA 4FMCB 1T5OA 4YQFA 2NWQA 5AJVB 1IBSA 1T2AA 2H1RA 3HRHA 1O9HA 3RUAA 5CEFA 2O1EA 2BGTA 4XWGA 4RL4A 3W05A 1QWOA 4AJHA 3ITEA 1K3UB 4PYOA 4D4KA 4FFBB 1QIMA 3EAGA 3IAM6 1W4CA 3E9NA 3R9IA 3UMSA 1KY4A 4FN4A 4GLJA 4BP1A 4CI9A 3LX8A 4FEEA 2QOEA 2LCQA 3WGOA 2GAJA 5E95A 1VKJA 4RHUA 2D5IA 3KTAB 4MS1A 5CNJA 3PUHA 4GGOA 4QU0A 3L1UA 5BYJA 1YACA 4KZKA 2TMDA 2OSVA 1F3OA 3DVSX 3NOXA 3WZLA 4ZD6A 3R76A 1RHMA 2CXRA 1RI3A 3E9CA 2FXVA 3AV0B 4RZHA 2CVFA 2V9CA 4DM7A 4ENUA 2RKOA 2DXIA 4XVRA 3QWFA 3CG0A 2OG1A 5DEIA 1JXQA 5DLQC 4G0WA 4PLWA 2HB6A 3DV2A 3NYQA 2NLOA 1CUBA 4PFSA 5FEUA 1U8CB 1X3LA 1HOTA 4Q1BA 5LYJF 4ZK6A 2QRZA 3GLVA 2Y71A 3MLBA 1EE1A 2J09A 3MXTA 4H0NA 2FZCA 1PTKA 3AERA 5C8ZA 1ECGA 5EJAA 5HF5A 4L57A 3TPZA 3ONVA 4KV7A 2UZ0A 1E7YA 2QZ4A 4RJIA 3PVZA 3MMPA 2WOJA 5FV7A 5ALKA 3P9PA 4BXOA 3FKSD 5KWJA 1I3OA 6LDHA 4Z0HO 4FHCA 1TVKB 2RH9B 3CA8A 2FDXA 4ALKA 3PP8A 1G8KA 1C14A 2HJSA 3QW2A 4YJGA 4D92A 5E6RB 1B23P 2CHVA 1R5BA 2EW2A 1X6VA 2EWWA 4LCBA 4NNPA 2QDKA 4RXTA 4B8YA 1XKTA 2GEBA 2GA8A 5BXYA 1EFDN 1WW3A 3VPCA 4A8JB 2BGIA 1I3LA 1ODTC 1ONSA 1DG9A 4O2BA 5IUJC 1M74A 5G0SA 1PQWA 3IO5A 2FG5A 4ZVVA 2R8PA 1QHHA 2E82A 5LZ5A 4EYKA 2HWYA 1JB1A 1Y8CA 1JTVA 3FLBA 3F71A 4KFCA 2CVOA 2OZKA 5A7GA 3W5UA 3WL7A 3WYCA 3FOEC 4ZOQI 2AJBA 3MWGA 3NC0C 2ZBDA 4I55F 4NYIQ 2JK0A 4RFLA 3WK8A 5CB4F 3ZVKA 3P27A 1OI2A 3CZQA 3RAJA 5DRYA 5CD9A 2IF2A 3ZOZA 3SHQA 5B55A 1PVDA 3EIOA 1Z68A 4QDTA 3AIMA 5D5HA 4MNTA 1OH6A 1VI2A 4H2DA 4M55A 1MV5A 3HDYA 2B5OA 3H5TA 4MUIA 2PZBA 4Q9KA 1JZTA 4KR7A 4KGXA 5LKAA 2L0XA 1O6BA 2ZUTA 4QODA 5EWMB 1NBWB 1O58A 2J0VA 1YGPA 2WJAA 2Q7OE 3WL8A 1QG2A 1LRJA 3O6VA 4LJ6A 4R6XA 1A7UA 4KVAA 2D0OB 1IUNA 5H3LA 5CVTA 4PC6A 4UAUA 1A71A 4EGAA 4DKJA 4R2KA 4ZODA 3KETA 4D41A 2V54A 3GMTA 1CIPA 1FNNA 1RJ9B 1ODIA 3RWBA 1WVGA 1R9NA 5AMXA 3RIXA 1V9CA 3ND9A 3KTOA 3PCXA 2FFHA 3FPFA 4HATA 4P92A 2NPOA 3WSVA 4RVSA 4EM6A 2VQ3A 2ZJOA 4EA6A 3HWX1 2JLYA 1MJ5A 3QFSA 2EZ4A 4K03A 2VCYA 2J32A 4EGJA 4LTNA 1YB2A 1CZHA 1RYMA 1FRNA 3EEQA 2GX6A 1I6MA 2WWGA 3EULA 1GPJA 3HB5X 3U1TA 4KPEC 1TTQB 1V39A 2ORWA 4QNNA 4JFRA 1AXGA 2QAIA 1U3FA 1XRRA 2DY1A 4MMXB 5F4ZA 4DLUA 4OI2A 5HTKA 5TGZA 1N2JA 1QFZA 2RB4A 1WUJS 2PZAA 2HJVA 1JHOA 4YDHB 3CNNA 4O4LB 3OI7A 3TIVA 1W2GA 1XD2A 3AU9A 2QNBA 2OB2A 1JU3A 1KFKB 3GFQA 4RVFA 1NVVR 4XD7D 3PDJA 4AT1A 2X6TA 2X58A 1FDSA 1TCUA 3G9QA 3GNQA 3VR3A 2WABA 3G7NA 4UAJA 4ER6A 2PRKA 4HZUB 3U4QB 3IDSA 3S2SA 1M6VA 1OBHA 2R44A 4EW1A 2W2QA 3TLKA 3BRWA 3AI7A 4FIDA 5E0OA 3IEKA 4N03A 4CF5A 1V4VA 4RA6B 2H0RA 4ZEWA 1E9FA 5D1NA 4EFKA 2F90A 3JATA 4L5CA 1PRYA 3H3FA 4YREA 5SYNA 4YEDA 2H1LA 2H51A 1QAQA 2JJ1A 4R2LA 4WZZA 2FN9A 1OJLA 4KLZA 1UKYA 3ME5A 2FUG1 3TLGB 5HQ3B 3HCEA 3H97A 4MDYA 1F38A 3OP1A 2Y1XA 1R16A 3UJDA 4CQJA 3QYFA 2X5XA 5LNK6 4WZ6A 1CUWA 3FOBA 4ZMBA 3DDNA 3DJFA 5EHQA 5IM4A 1EFLA 4IH1A 4WNAA 3RI3A 1Y5NA 4QJIA 1VB3A 2J0EA 1J21A 1WF3A 1CR6A 1H85A 1R6VA 2DBZA 4G4GA 4OXYA 4HH4A 1T5LA 1C29B 1TLTA 2IXDA 4DJDC 1GFZA 1IBCA 1B2LA 3G2HA 1J5XA 3K1YA 2IK8A 1QP7A 3JVDA 4LAFA 1H8EA 1NVWQ 4GF5A 2ZIXA 4MEAA 1MEEA 1ZD3A 2PL3A 3QVXA 1E2FA 3WAKA 3IXQA 4C14A 5TT1A 4OFXA 4TWJA 4RL6A 3TRDA 4DANA 2X0JA 1XP5A 1PKXA 1YZYA 3BCUA 5HF6A 4W7IA 2JAHA 2FH5B 3H2HA 3T9CA 3PHLA 2XV1A 4O4JA 5ALSA 4YDQA 3LFTA 2VI5A 1HQDA 1T35A 4F8EA 4IKEA 1L0BA 1GZUA 2Q4BA 3IMGA 4P84A 1UJNA 4CWAA 1MAWA 5IYZA 1RI4A 2EX4A 2PIAA 4B31A 1LNQA 4OHMA 1QLWA 2V9ZA 3MTIA 3K1ZA 4H6PA 1OH8A 2A6PA 5HTOA 4MA4A 2G4LA 4Z0TA 1THZA 3V34A 3M5WA 4O0LA 1AHHA 2CJPA 2I2XB 4NENA 2X9NA 5INTA 1QGED 2J3KA 1TU3A 2J6BA 1OT3A 1Z0KA 3D1JA 3JASB 5JO9A 1WW2A 1CF9A 2PMFA 3MRVA 4XASA 3W0LB 4B40A 3N75A 1IZ9A 2X4GA 1OXUA 4H3VA 2PO7A 1QFMA 2X7HA 4TN5A 4WI1A 4A5SA 1WU7A 2Q5HA 3HCBA 2GFIA 4R16A 4EHHA 5H02A 2VO1A 1PJ4A 1HDZA 3TMKA 5JMOA 1OR8A 3K6KA 3ZU5A 2ZU6A 1JI0A 4PRZA 2DUJA 4C0LA 1MOPA 5LFAA 2VZLA 3WRVA 2WTMA 4PCAA 1JR3A 4R51A 1VJTA 3QLUA 3TZEA 2XGJA 1XTVA 1JIIA 1SVWA 1WBJB 4N0DA 2W70A 4BNNA 2BGMA 1QV9A 4GR9A 1GPWB 2YRWA 3JV7A 4DA7A 1FVFA 1RC0A 4B7XA 1G41A 3G2NA 2BFDB 4TZ0A 4PXSA 3UJ8A 221PA 1AGRA 3KVYA 2ZPAA 4ZU3A 4DT1A 4OK6A 3SBOA 3D6TB 1OWNA 3DZ8A 3MPOA 4O4HF 5AJWA 5KUTA 1L5HA 4HSGA 4EGQA 4IXMA 4UXIA 1R4NA 1ZIOA 2ZRFA 2YJTD 2ALJA 2EFCB 4JNKA 1DRKA 1U99A 2JGLA 5EXPA 2C2XA 2YVQA 5DYYA 4AS3A 3ZWPA 2AFHE 1GXSB 3PJFA 1WZIA 5CW1A 1XK7A 1NKSA 3RCBA 1AM4D 4ZVOA 5GJBA 4CFZA 4JSRA 3VNRA 4IH9A 4P32A 3AL0C 4UCWA 3QKIA 5JS2A 1RHKA 1ZO8A 1CUSA 4O2AB 4E4RA 3SE0A 1IUPA 3SE7A 4B0OA 2V0GA 3E9ZA 1XZFA 3AONB 3KL4A 2ORVA 3KX2A 1JSZA 1DAEA 2QXYA 3D6HA 2BM1A 2RHGB 4RZIA 4RADA 3MBOA 5LOVB 3MJRA 4RKQA 4K87A 3BEDA 5HILA 3ZE8A 4ZIRB 4I50A 4XI9A 4KPYA 4ACBA 3M4ZA 4QGBA 1Y98A 3DKVA 5BWLA 2H9YA 4AYWA 1G21B 3OBBA 3HB7A 2WDPA 3DFUA 4Y6PA 5LQDA 4JT8A 1B0AA 1MQ9A 4HCJA 4P6VF 2Z8YA 3GXBA 3CKKA 1TYCA 1TCAA 3OLZA 1O95C 2F7SA 3N2KB 4HBGA 4MA0A 4C4OA 4OJYA 5BXQC 4AK9A 4QXPA 2CVZA 1AQUA 3U7RA 5KDDA 3CFYA 1JG2A 1ZBQA 1OYYA 2ZE5A 4HN2A 2NUAB 3QGMA 3SSMA 4ALMA 4XUCA 3RGGA 2C4VA 3PK0A 4I6EA 4R0NA 4UHCA 4FNMA 4BMDA 1ZJWA 1OF1A 5SY4A 4B5LA 1JWLA 1NLMA 4A8JC 3CC8A 4WGGA 5EHIA 4ZZ0A 3GFTA 1I1NA 3GLSA 3KZCA 3QBJA 2CKMA 3FYCA 3WNZA 4EQ6B 2A9KA 4YMTA 3T61A 5EY5B 1XL0A 4QPDA 4KQEA 4E7PA 4HYQA 3PI7A 2HU5A 5TPZA 1IQ0A 5EINA 4C29A 1AS3A 1FSGA 2CSUA 2O2DA 3WG9A 1MVOA 3NUQA 1OXVA 3ASUA 1KO7A 4GU5A 4YJ3A 4C7XA 3JQDA 4ZQCB 2ZJ3A 2TECE 5AJUA 3SU8A 4A0SA 3BH6A 2Q5EA 1ZRHA 2GBPA 5AHWA 1NASA 5AVQA 5B4VA 3EN0A 5G1PA 3CJRA 1JI3A 2GEJA 1HDCA 5HRAA 1XEXB 5BN5B 3N9IA 3J81k 2HSGA 2XDQB 4NBNA 3LKDA 2I3GA 3U3XA 1B6TA 4BE9A 3IB6A 3PPXA 5D5QA 1MABB 2BW0A 3PPIA 1C7QA 2A0FA 2H3HA 3D8RA 3OM9A 5E3JA 4U6NA 4ZXFA 2N47A 4MICA 2VPXA 4KBGA 3ZHRA 1KEKA 3GLGE 1BA2A 3W06A 5EKUA 1KK3A 2Z2XA 4HGNA 4RTQA 1DAFA 5AUQA 1KYQA 2R6HA 3PC2A 1Y1QA 3PHJA 4QL3A 4XQ9A 3UMJA 3V8QA 4I36A 4OXXA 2OGUA 2FQWA 3O75A 2YH2A 4CTKA 1MU0A 1HQKA 1PV2A 1QRAA 2XUDA 5ALWA 4CIYA 3NTOA 3R1IA 4YRIA 3CTPA 3KYIB 3DBHB 3OECA 3NAQA 2AVNA 4KB5A 1N2BA 2W2LA 3UH1A 1EZZA 5A0FA 1YUNA 5HHTA 2A8YA 2BYTA 4LJ9A 1T1SA 1QHIA 1ZAKA 4LMRA 4MVYA 4Q9HA 2CV0A 1E6WA 1U9CA 3AYZB 1F1JA 5JXWA 1DXHA 2REQA 1SBIA 1YAHA 1WCIA 2XYHA 4IGEA 4JCOA 4LOAA 1JZSA 4G6ZA 4F1WA 4ENTA 2ZVQX 3G68A 5HWSA 2DFDA 1G9SA 2G6BA 3OTQA 4G9BA 4HWPA 4I0WB 3WWZA 2Y0DA 1OZHA 1YRWA 3GYGA 1I4WA 3MRSA 1DIRA 1KP9A 3LY9A 2GK6A 3W2GA 5EHZA 4PTLA 2R2AA 2C3OA 3QEAZ 3I92A 1XZGA 4P4GA 2I6XA 1IRIA 1SN7A 1VJCA 2QRVB 3C4QA 3ZE2B 4A0FA 4AN4A 4MUGA 3C3WA 4RNDB 4HDRB 5KQRA 1RRFA 3EB9A 2EL9A 4RSMA 3DLBA 3IT1A 1Q17A 3FOAA 1JSXA 4RS4A 3GARA 1AVTA 1BX0A 3CH4B 4RBNA 2ZZKA 5HDBB 2OB1A 2I9PA 2QTHA 5JPDA 3V4SA 3W6UA 3KSUA 2OCKA 4I2NA 4BS9A 4GQIA 4JT9A 4KO4S 2DECA 2DWPA 4L0CA 3JZFA 3GAZA 5E9AA 3WLEA 3ISTA 4QYSA 1B8NA 5AW0A 4RTJA 2F55A 3KO8A 2VTDA 1IM5A 4K0RA 3DEHA 4FWIB 2XECA 2WWXA 3LM8A 4M46A 4UNIA 5K3DA 3T3MB 2HF2A 1KI1A 2HA2A 1DQYA 1MPTA 3GDHA 5DTQA 3F7MA 2VCHA 4JHXA 1KI2A 3LCUA 4LGVA 5H83A 4HH3C 3ZQ4A 3T95A 5G53C 1WABA 2GBLA 1MDBA 1IUOA 4OUDA 4D4IA 2F3PA 4PYJA 4XJSA 1NI4A 3BSYA 3QYPA 5A06A 5LWHA 2JD0A 1U1GA 2XXAA 1QIEA 3JQGB 1BOFA 2B83A 2H2FA 3E0QA 3KQOA 1NI5A 3GZNA 2E4UA 3K0FB 1U2PA 3FYTA 1Y9AA 3OZVA 4GC9A 1N57A 1XKLA 2I7XA 4J4BA 3ENWA 2JG3A 4INPA 3GU3A 1GGNA 3JAKB 4D8WA 3NWBA 1XYYA 4IO1A 5T6BA 4AURA 1VKHA 2WHYA 2PJZA 1GCUA 2PT9A 3PBKA 2EF0A 5IVPA 6ADHA 4P3NA 1UXOA 3PXAA 1EGAA 4BBZA 2F4NA 3H84A 1G6HA 3TAHA 3VM6A 4MV9A 1K06A 5DSTA 2ECOA 3TFWA 1REQB 1C9JA 4HDMB 3WB1A 3A6KA 3F5QA 5C7IO 4DCCA 2D3TA 3MD9A 4KV9A 5E38A 1T8RA 1YIOA 3LLVA 3LXXA 2BFMA 1NOKA 4RH1A 3K70D 2BH9A 2P4HX 5AW5A 5KVSA 2I67A 4GOXA 5C2JB 5FKJA 2HA3A 5JZMA 1J2TA 1R66A 1VECA 4KXWA 3AVWA 1OAOC 3R0QA 2GUWA 1CZLA 5JZOA 3QE2A 5TEVA 4H3KB 4WY8A 4B71A 1ZJ5A 3LUCA 4ZQHA 3AMVA 1VB5A 3U4MA 3CF2A 1Q7GA 3RFCA 3UVEA 2C1XA 4RTNA 3BC1A 1JE0A 1LGYA 3D1VA 2HU7A 2OC9A 1QE5A 2WINI 2GEDA 4OQMA 1RWMA 1L7BA 2DSTA 2B78A 2QPLA 3IT0A 5AKLA 4G67A 2YVAA 4AMZA 1VZ3A 5JCJA 4NFYA 3VVBA 3RJ9A 4LY6A 2Y05A 4BXOB 4LECA 4RD6A 1ISSA 3UBMA 2ID7A 4M8IA 2PG3A 2L69A 2ZSJA 1R5JA 5CW2A 1RXUA 5HCIA 5K3OA 4X64B 3WFIA 2HEGA 4L8YA 1D8TA 1XA4A 2DHDA 1FTNA 2LGJA 4KQCA 2ZUUA 4N6GA 4YJGB 3VRHA 1ZC3A 3G5UA 1H5NA 3HN7A 3LBNA 1W96A 2VRBA 4KFUA 4KW7A 4IMPA 3DHYA 3WOHA 1YD7A 4M9XA 5HS4A 4O2BB 1JJAA 1XCGB 2AJDA 5CM9C 4KWTA 1CDDA 1CD5A 1XXHE 3VTFA 1QHHB 3OC6A 4KE8A 1LF0A 3L0DA 2GVNA 4KUGA 3ROTA 4R1UA 2GHQA 2YTZA 3TG2A 1VLVA 4AQYB 4OQYA 3C14C 3QF4A 1F8XA 2A5GA 2FF7A 3MOIA 3B1FA 4REOA 1KY2A 2IEBA 5IK2A 4GX5A 4QRHA 1DQZA 1F8YA 2NTYC 5EP2A 5U4QA 5GONF 1P81A 1MA0A 2R8EA 4K6HA 3TRJA 2BM0A 1E92A 4CNQA 1JVNA 2PFKA 2JGKA 2NXJA 1SVMA 3LKZA 2QGFA 3FZEA 3LKVA 3MMSA 2RK6A 3MT9A 4HNTA 1ZOIA 3HR7A 2IX9A 4QBKA 3MWDA 2F1JA 4B4VA 3MELA 1UJ4A 1ZJJA 2NV2B 4JR1A 4CNBA 1V8OA 3KOZA 3DHWC 3ZBPA 3ED1A 3OLQA 3L7KA 3PIDA 4NESA 1Z73A 1AG9A 4F0JA 1CNFA 1PSWA 5BQPA 3A6PC 4MWEA 1MG5A 4FR5A 2B3DA 3I12A 3BSFA 2D5AA 2QAGA 1E0AA 2OORA 3EIWA 4CLRA 4OGKA 3L7CA 5DTRA 3I30X 4ZAZA 4D96A 1AO3A 2OCPA 3BCSA 3UKJA 3U44A 3RLFA 3JWHA 3ONDA 4U9IS 4ZTUB 1ILWA 2JFGA 4LRTB 1FJ2A 4WZAB 1ZH6A 3X1KA 4XGKA 4AZVA 1QQ5A 4J2OA 5EKSA 4MUEA 4Q3CA 4EDFA 5K0NA 3SS7X 1VG9B 3EISA 2X6RA 1U3WA 4KJZA 3VSEA 2FNAA 4DQVA 1TYEB 4DV2B 4O4JF 3V42A 1P1IA 2I1QA 4NPHA 4D8UA 2O6LA 4MVJG 2QN2A 3RKRA 1K2VN 2DHEA 5IYZF 1NXSA 1E2MA 5K0GA 1YJXA 2AG6A 3AWIA 1K6XA 2ZWVA 4KYIB 1L7DA 2A5JA 1E4OA 2RDMA 5M7EA 1J1UA 1QC5A 3A8TA 2CCKA 3DW3X 1SU7A 3K9HA 4GM1A 1YA4A 5D3KA 2R5WA 1XD2B 3HJFA 4CKCA 3B78A 2HY7A 4M1MA 4TX1A 1MO5A 4Z86A 4AU1A 1XCBA 3DULA 3WAGA 2R00C 1G17A 2C82A 1WPQA 3WZMA 3UCXA 5KPDA 3WYDA 4H9GA 4UUPA 2OCDA 4K46A 3S3TA 3BAZA 1NPDA 5AI8A 1ZBDA 4A6EA 4BPRA 4HT3B 5BMVF 1X7YA 1E0SA 1K66A 2NVUA 3QRWA 2HAEA 1M6VB 3R7WA 4J4HA 1IULA 3H2SA 5KYTA 2HHCA 5IFKA 4I5DA 1LTQA 2QMEA 3D5EA 4RE6A 5FDFA 3WRYC 3OU7A 3K9FC 1Z29A 4WKPA 5F5XA 3N2NA 4N47A 1FUKA 2VQDA 3DDHA 4XH9B 3RIMA 5L3VA 3KEFA 5CRIA 3EYWA 4C7KA 1EZ1A 1FYFA 3DPSA 2JHCA 2FWBA 1P77A 3BIOA 2C03A 4M88A 4U8HA 5EIBC 3AF3A 3ZH9B 2BWJA 2J5BA 3GPDG 4IDNA 1T29A 4GOMD 4JJFA 5J4LA 1C7EA 2C9YA 3EC2A 3I9OA 3BMOB 3ANXA 3VJKA 1EVZA 5ALXA 1TVMA 3QIAA 3DFFA 5AUNB 2AQKA 2WUFA 9LDBA 4TLBA 3CZAA 3TM4A 1JHZA 1XQXA 5AVOA 4C0AC 2PD6A 4YRMA 4KR3A 1P74A 4LDQA 8ABPA 1U4SA 3RROA 2CLMB 2F8SA 1P1HA 5IW8A 4DSNA 1E6CA 1KEVA 4BC1A 3QX3A 3J7TA 1I7PA 4X65B 4ZRMA 3KPVA 5CBKA 1CF4A 4KIFA 3KB6A 1JDJA 1NMSA 1F3LA 2Z0MA 2EP7A 5FL7D 2WTUA 4KRGA 4ZVNA 5KNBD 3ID6C 1D7OA 3E5RA 5IXYA 3TLAA 2FJPA 3KR0A 2ZIXB 4IYRA 4GPTA 1VL1A 4DTCA 3AEUA 1A72A 3O7WA 4E3WA 4YRBA 1WMSA 5AKJA 4OQQA 2C97A 3QPCA 3F9CA 5D8DA 4GP6A 5EOVA 1DAMA 4Z1OA 2ISCA 3IAS1 5I6DA 1D3AA 2W0SA 1N77A 3KE9A 1P2UA 4I50F 1QH9A 2N75A 1GVNB 4RGVA 2AOVA 4U00A 4CFYA 1TMOA 2JK1A 4UBMA 4BNJA 2AEMA 3GGPA 4G5QA 5D6NA 4B6QA 3ROEA 3VHXA 2WKPA 1T1GA 3JXEA 3PUIA 2QQ5A 4M9SA 5K3CA 2DPMA 4BJ6A 5ADUS 5EJ8A 2YXLA 1EVJA 3L6EA 1ZLYA 3EAQA 1N2SA 3KALA 1VDMA 1I13A 2ZBEA 4BATA 4ZYYA 4NENB 3EA5A 2HMSA 2BV3A 1QXSA 1GYRA 3FMFA 4HN4B 2GCNA 1EVLA 3U31A 4A2WA 4OREX 2JGIA 2JH3A 5CEEA 1GUZA 1PLLA 3IQHX 1NLFA 3D8UA 2GZRA 3QYJA 3L8GA 3CVJA 4GIBA 3LY7A 4RGBA 4WKOA 4D1YA 4F6LA 1MVLA 2ZDGA 4G2TA 4Q3KA 1U5BA 4BKUA 1C2TA 2XI4A 4L72A 5EVCA 3I6BA 4HD8A 3EQ9A 3EWNA 1UPFA 2CC2A 2H85A 2C7RA 3LWNA 4YGXB 4DADA 1E9VA 1G0OA 1LSSA 2HV9A 3BXGA 5AESA 2DPLA 3A4TA 4HWKA 4RD3A 4LBYA 1QGUB 2AQ8A 1LCIA 4GEGA 2V6GA 1XCOA 2WSBA 3NETA 2CLLB 1Y8ZA 5C8YA 4DT1B 5JLAA 4FHZA 5L3RA 1A3CA 3LO5A 2WWFA 1L5HB 4JXZA 4REQA 4JQCA 5GWXA 3SZMA 3BE8A 1R4NB 3CCFA 2AWNA 2OL4A 2JLBA 3BD6A 1FBTA 4DPLA 1JYFA 3JW8A 3V8NA 1ZW1A 4HLDA 4O5AA 4BN5A 3GLGA 4AC9A 2WT9A 3BRWD 4C2BA 4EW2A 2R4UA 1JH9A 5IC6A 3DHNA 4N39A 5EE1A 4H16A 3ROKA 5CX4A 3Q85A 1NX9A 4I66A 3RS0A 5EYPA 1WULS 1NYTA 1T2EA 3WA7A 5DSXA 3DE7X 4RY0A 4WKNA 2IQIA 3DVAA 1Z0IA 2XUQA 1SOUA 3NJ8A 4B83A 1PTJA 4QVKA 1E2IA 3KKZA 3RIYA 3PNLA 1PX2A 1V3TA 4OKSA 3PX3A 2Q9BA 3TFQA 1ETHA 3COPA 3I9V1 2OLKA 2NG1A 1D2CA 3E9QA 4NABA 1NBIA 3BTOA 1UEJA 3HU1A 2UYGA 3LVRE 1C8KA 2BKXA 4Z8XA 4D3SA 5BMOA 5DHAA 1WQ3A 2QVYX 4L8GA 4AKIA 2A9RA 1BX3A 1M2GA 1NC3A 5TVKA 5I01A 2M6SA 2HA5A 2HMTA 5BVGB 4FGLA 3IS3A 4DQLA 1ODLA 4OK5A 4DWOA 5CXUA 1OX6A 3FUCA 1NG1A 2HN9A 3RQSA 4WZBE 3H5WA 3RYIB 2ICAA 2X0KA 3DLHA 1VL6A 4BMOB 2PA0A 2Y0CA 3H9BA 1WDKA 4DIMA 4ZVLA 1K6JA 3C97A 4YJ3B 5JBIA 1K68A 3D3QA 4IHQA 1E5XA 3PNBA 3QEKA 4Q82A 1ECBA 5EJFA 1C7ZA 1CIJA 1RAHA 4ZI5A 4Q3BA 3TZ6A 1NN0A 1D1TA 3L3BA 4JT4A 3FZGA 1A8SA 4HL6A 3LY8A 1RYYA 1T4CA 1H9BA 2PBRA 2YUIA 4B3SB 5IFLA 1CQZA 3E7FA 2H1SA 4C4RA 1ONPA 1V8BA 2GPWA 2L18A 3UUWA 3L1KA 4EX7A 4ZI2A 5BWMA 4TT3A 1ZD1A 2DFTA 3E3MA 1MJGM 1RIFA 4PZUA 3MQ4A 4QTUB 5AO9A 2QP4A 4QTTB 1QIKA 3CLUC 3HDJA 2C98A 2CXHA 2H4HA 1JR3D 3H7IA 1OY1A 5DP2A 1B0PA 3WJAA 1HFWA 3QWHA 3DWEX 1U0GA 4LZJA 1KZ1A 3G2JA 3TCNA 4RTOA 3LT5A 1YRYE 4ODIA 3OIUA 2AZXA 1I8TA 3MGAA 4X3OA 4DR5B 4R3NA 4XR9A 3TUJC 1ZD9A 4Z4GA 2VJOA 3HXKA 2H2HA 2G25A 2JIQA 2Q0QA 4RNCA 1BVRA 3EZNA 1K8RA 1Z6ZA 1ZIPA 7REQB 3CF4A 1SXPA 3P26A 3LDUA 5C32A 3MK31 1NJSA 1OPRA 2NAPA 1NXQA 3SBXA 2REQB 1MCZA 1T3HA 1WCIB 1DBQA 3O2QB 4QASA 3BXPA 4DLBA 4YR7A 4W5TA 4AQDA 1OFTA 2X22A 3KLMX 1QUFA 2ZJ4A 4MX8A 3W4IA 4BNWA 2BCGY 4ISCA 4ETNA 4AKGA 2B6HA 2BLLA 3L9WA 3DB1A 3HHPA 3IMEA 1G1MA 1W581 1Y0BA 4PYMA 5C1DA 4OQPA 4J0FA 2FCAA 2RHOA 3REGA 4B3RB 1E1QD 1UOPA 4UJ5A 2RGGA 4E15A 3X2EA 2HI0A 4EF5A 5A62A 1CJTC 1T2CA 3RAFC 3R4VA 2FMXA 4R41A 4PYIA 3DE1X 1GQFA 3H4TA 4DHEA 2IS1A 4AN1A 3ONFA 1QIFA 4C43A 1UEIA 1J8QA 5KO2A 1RJWA 3KXKA 2J0UB 3SLGA 2VJPA 2VJYA 3H2GA 3NV9A 1V0JA 3BJZA 1MORA 3BWDD 4NBWA 3OIYA 1V41E 4Y9TA 3RRMA 4ZGBA 3DEZA 1OVMA 1EIWA 5ITVA 2AOXA 3OVMA 4JJGA 1U7ZA 3BH7A 3UPDA 3ZJVA 4RTMA 4BVHA 1CZUA 1KRXA 3GCXA 1O5OA 1QVWA 3SM9A 1UXHA 1EE2A 2EL7A 5PGMA 4NL4H 1M2VA 5DHUA 3RVPA 2NSLA 4RLQA 4DNPA 4CEHA 4IOMA 3DD1A 4UCQA 2GLUA 1YQ9A 1AGXA 3ESCA 5CGQB 3RBXA 3SC6A 2R86A 2PHZA 3VOTA 1M2OA 2P6OA 2C0CA 9ATCA 1N2HA 4ND3A 1JR4A 3R20A 2CXPA 3UJBA 2WIKA 3M9LA 2AXEA 1RYFA 2IHJA 3DZKA 5EJMA 2OCBA 3AKCA 4FFVA 2TSYB 3TZKA 5AW4A 5K0JA 1ZITA 2GYWA 1ISRA 3SSNA 4OUDB 4WFIA 5FH9A 1XMOB 2DQSA 5TF4A 3V8VA 1BHJA 5E1OA 4KFTA 3JPYA 3ER8A 1YZ3A 2HXGA 3FFAA 4ZYTA 5AKYA 3KZVA 3B12A 4A7PA 1XXHA 5J63A 4BRSA 4Z4CA 1ZR4A 3KLOA 5FPHA 3GZNB 2XUFA 4PG6A 5IAOA 3I2HA 2ZPUA 1NF9A 1I5RA 2A2ZA 4P83A 4MR7A 4UHKA 2WF8A 1JIJA 4ZA2A 2FPGA 2Z58A 5IT9A 3O4JA 4R1OA 1ZFNA 5JC8A 2WZCA 3PNMA 1HKHA 1Q0SA 3SYRA 1WSBA 5DWVA 4E07A 3RF7A 4DZRA 4CM9A 4QSHA 5TQ2B 4ZVRA 2OWDA 2HPHA 3CEAA 3O8OA 5JDIA 4FYKA 4Q5IA 1YRAA 2XRYA 4R3UC 4BOYA 1PUXA 4CUKA 1YHZA 3AUFA 4HEA1 4RHXA 1ACJA 3IEUA 1UZAA 3G8BA 2IV2X 1F06A 2CCGA 4G01B 5G4KB 1KE1A 2OLJA 2H08A 4C7VA 2Y0BA 1D7AA 5DBEX 3BGIA 4DXDA 3H9GA 3TF5A 1U2ZA 1QFYA 2FWMX 4M1OA 5T67A 4PAGA 5CM8B 5D5PA 2VKTA 3F5SA 3DP9A 2KM1A 1JYSA 1SOAA 2CLIB 1QCYA 1F0KA 2P4EA 1XYVA 2KBFA 2W2LD 2YX1A 4MVJM 2GF2A 4W5NA 4YAWA 1OWLA 1KYWA 3N07A 1NYLA 3NHFA 3UATA 3L4JA 2QUIA 1KIFA 3QHAA 1A69A 1Y4DE 5CT4A 3VZQA 1R0BA 3ET4A 1YQEA 4PG4A 2HTEA 2YYYA 5CB8A 2QF7A 1NHWA 2PH5A 3G6WA 2ZW9A 4F3NA 1LD3A 2PAFA 5JBQA 3RS8A 3FROA 3BZWA 3QELB 1QU3A 3CT4A 3QMMA 2WUVA 4OIFA 4FQ8A 3RTAA 2PUGA 4HY3A 5ICEA 3VTZA 4H77A 1J42A 3ZVMA 2DRIA 4OI1A 5AW9A 4JMPA 4XE5A 3E15A 1KKUA 2KHZA 1GV1A 2GBFA 5FQOA 1RWXA 1L3CA 5KVCA 3A6HA 1MJFA 4RWZA 2J59A 3I5MA 5KAPA 3D6JA 3AEKB 2GA9A 3RFUA 2BBWA 3PWKA 2WMOB 2EG9A 1E5QA 3F67A 1SK8A 1UODA 4KN5A 4M99A 1Y8RA 1CUCA 5EJEA 2XMZA 1E96A 4KLAA 3ROPA 3L93A 5I7WA 5K0EA 2YHUA 5KNDD 4PLPA 1Y9ZA 5DX1A 5CHYA 3PEYA 4LFAB 4OHYA 1SWWA 4TPKA 4MHTA 3SOPA 3GP8A 2PFSA 4FK8A 1DKQA 2VK1A 3DSRA 1XVTA 1IIRA 1VGVA 2QLMA 3BWYA 3C8DA 3KZKA 1PWXA 1OE0A 3DOFA 1SXJE 3KQSA 4O59O 3C7AA 1JBEA 5ED0A 3WP0A 2YN0A 3IJPA 1O1YA 4EBFA 1KR2A 2OZLA 5CCEA 3PTLA 1ESNA 4JK3A 2EAUA 3Q1KA 3B3AA 5BSWA 5LDGA 3HDTA 1ZCFA 1HL3A 2YHBA 4B3FX 3AQ4A 5ALPA 3ZXYA 1MO4A 2NSJA 3I9LA 3HBAA 3MWDB 4LQDA 5C1IA 3FNHA 1ODFA 2PQMA 4RVDA 4ZV9A 1HDOA 3FPAA 3INYA 4HNAA 1EK6A 1Q15A 5EMMA 1DBSA 1U28A 3LA8A 5F77A 3VPHA 6Q21A 4M86A 4R69A 1NIJA 1I0LA 1ODSA 1ECJA 1AKRA 2QIPA 2VHZA 3CNEA 1C30A 3ENVA 1J25A 2IRWA 3FW1A 3I72A 3PFKA 4WV3A 4CL8A 4WNYA 4DUPA 3G13A 2FGKA 5FT9A 3U44B 2YWCA 1P0CA 1QRRA 3A3OA 3BPSA 3MIIA 4JOQA 3WFJA 1QS0A 4LXQA 1U2EA 2XMRA 5KDOA 2K2WA 4JENA 2I76A 3SHFA 1SQ0A 5BSRA 4QFBA 2BTQA 1KK2A 4UCFA 5IXSA 5JYBA 2QNIA 1QO0D 3QWBA 4KHPB 3AK4A 3GZTB 2FEPA 2PLFA 2YMMA 3AR7A 1TO2E 3D0QA 4II3A 1NDQA 5ICSA 5LP6B 2YFQA 4G84A 4GM0A 3PTZA 1X7XA 4EG5A 5EP1A 2H2IA 5JO0A 1D6JA 1T8PA 4QPZA 3ZWKA 4CKCB 1H2YA 1R0XA 3LC1O 4LOLA 1RI5A 5EPUA 1MC4A 4OQZA 2HPVA 2ESRA 2VPZA 4QD3A 3Q41A 3SNHA 5DM60 1RQLA 4FIZA 4KP7A 2WSYB 4G0UA 3U40A 1XQYA 2Z4RA 4ZC1A 3WS7A 1K3TA 1OCEA 5I5EA 4MR8B 3FTFA 2IBTA 4EATA 5FHQA 1C9YA 2IEGA 1MO2A 1SD1A 3R7WB 2BJHA 3KWJA 2PKEA 1NUPA 3DAYA 2IU0A 4ZFNA 1UMCA 1EBFA 3P9XA 4R0MA 5JCJD 2JH8A 1USUA 2P9ZA 4YAEA 3O47A 5GY7A 3QWIA 1B2RA 3AF4A 4NJMA 3I1JA 4PHHA 4AJ2A 3WK5A 3PG5A 2LCIA 4QGGA 1UZNA 2GWHA 4E51A 1PGQA 2IEAA 1W48A 3GNSA 1OWMA 4R83A 1WG8A 3N74A 3E18A 4R1QA 4XSHA 3MGKA 3P0EA 3NVMB 2REBA 3ORYA 1TUEA 2CVPA 3VOSA 4IOKA 2ZWAA 2Q2NA 2XKKA 3R5KA 3Q7RA 2P6UA 4H08A 3I3OA 4Q7JB 3AFMA 5EXSA 4AZTA 5JAPA 2WB4A 2J0QA 3DV0B 4CLDA 2HSZA 3ZC3A 2RHBA 3ESDA 1K5PA 1BVHA 1YIDA 3TD6A 4DGQA 3HYSA 1T8TA 4CCSA 4NRDA 3D7RA 2OGSA 2QVZX 5GM2A 3KQUA 2MIIA 4I3HA 4M0KA 2EBUA 5DMXA 4UQLA 1PJZA 3GO4A 1X1DA 3AEUB 5H16A 4JYMA 1ORTA 5ILGA 4ALNA 2GKOA 2ZUBA 4JLSA 1A5BB 4XM2A 3W5SA 1ZUNA 2EX1A 3A1TA 4PBTA 3KKQA 3DDZX 3WLJA 1BDIA 3S2GA 4C21A 4WBNA 2GN0A 3GEMA 3TE7A 1RVV1 4CM7A 3IIKA 3EXIA 1XHEA 2ZRQA 4JGGA 4FSHA 1N2XA 3L49A 4N8DA 3QKRB 5IT4A 5IAEA 2B1QA 2Z2ZA 1HNNA 1OU0A 3KOYA 1BEZA 2OV3A 4OP1A 1SUAA 3SJCA 3R7DA 5BUSA 4YHHB 1RKBA 3SYKA 4AZ3A 3IQWA 5JVDA 2J08A 1W4RA 5IKMA 5KOYA 2GPSA 1OBFO 1LEHA 3KJGA 2HCJB 3GAFA 1YJCA 3OQBA 3FTEA 3E22A 2O4UX 4RE5A 5FI1B 4XCQA 1QTIA 2HX1A 3KZ1E 4MK4A 1RYDA 3K53A 4QYTA 3RS7A 3V1TC 1ZUIA 1G5QA 1U5BB 4WZBA 5JD5A 2O52A 1P1RA 4R7TA 3RW9A 2R6CA 4C0WA 2J9RA 5BQXA 5JSZA 5EUQB 4Y6QA 1E4EA 1QZ3A 2JLVA 4BVKA 4HQ0A 3R9WA 3D9QX 3OX3A 1UXKA 2OUIA 4M1SA 5E9JA 3A3YA 1UXIA 1YR2A 3CZ9A 2LW7A 3FNIA 4H4EA 1IB6A 4S2EA 1E0KA 3ZHXA 2AYZA 3U60B 2ATIA 4JGBA 1GQ2A 4AZWA 3H8VA 5DZSA 1G64A 1EA7A 3OTGA 1MMFB 3IR5A 3EGXB 4ZT7A 5C8YB 3CW2A 1DELA 1ZW6A 2GKGA 2EDCA 2NO5A 3AOEC 4EG3A 2AV6A 2HL6A 3TD9A 5BWBA 4REQB 4CF6A 4EGSA 5B37A 3DMPA 4RQUA 3IUSA 4RM2A 5T3YA 4D9KA 1USWA 2W6QA 3GMDA 2QD5A 3P2YA 3GLGB 1YZVA 5FEMA 3CVXA 3AY0A 3HC7A 2F2TA 3PE4A 1FZQA 5GQSA 4MDEA 2PWAA 2WY2D 3S2UA 5EYPB 3TTVA 2ZB2A 2DC1A 2V7UA 3NHKA 1KSGA 1DKPA 1T3LA 3PDHA 3EMBA 2P8SA 1RABA 3IKLA 3DVAB 2BMJA 1GNRA 4Q1VA 1KMCA 4FS8A 3LDFA 4YCMA 4MJLA 1BD4A 1P60A 1PWHA 3E8XA 1J33A 2QRGA 1G98A 4DWVA 1R8SA 1LTHR 2AD5A 1Y3FE 2M1XA 4B8WA 1H05A 1M9NA 2H48A 4UNRA 1V43A 4XTCS 1EUDA 3AJ8A 1MAUA 2H4YA 2ZSAA 3G0DA 3ZUGA 5F23A 2BISA 3ZWBA 2HSJA 2I80A 2YZMA 4FKBA 1JDSA 3OX1A 4NYJQ 1VJ0A 2P7IA 4CF4A 3R5FA 4XDZA 3MERA 4BCDA 3CZ4A 5ES4B 3P2IA 5FA6A 2Z5FA 4D46A 1Z39A 2PZGA 3DHVA 3VR6H 1KWGA 2HUPA 2IP1A 2FWAA 2C2YA 3L6BA 1N2CE 3KL2A 3OWHA 1P17A 5KSPA 5T8KA 3V2GA 1T0IA 2WIDA 2OKGA 2FRDC 4DG9A 2VDVE 2CHGA 4YFVA 3DBVO 4KQ6A 5AOBA 1NDUA 3P0HA 3QSYA 4R8RA 2H2WA 5DULA 4UFNA 3L8YA 4R8MA 1GCOA 1OSNA 3LT0A 2XMDA 3BCHA 3IOMA 1I1HA 1USKA 2V0NA 4UBIA 5K8VA 4RIIA 3D8BA 2RGWA 5GVSA 1CX9B 1R9JA 2VDPB 1Y34E 1LPBB 5B1EA 1NR7A 3WLKX 4ENPA 4P8RA 4N65A 4KWHA 1V9LA 1Z5VA 5JY6A 4K9MA 3SIXA 2AFIE 2P62A 1T4CB 4P4LA 5LU8A 2GZSA 4CIAA 1O0SA 1W4LA 3E58A 4F84A 4NBUA 1JVBA 2FK8A 5T4HA 1RQ2A 4MUFA 1EJ2A 5BN4A 3LOQA 2ZRCA 1XU7A 2YV5A 4OA8A 3UM9A 4C05A 3GJ3A 2OORC 4H18A 3K09A 5DNDA 3ADPA 3C6KA 3JALA 2V3CC 2IUEA 3LQQA 3C3XA 2BEWA 5L45A 3B7WA 1EP9A 3KHSA 4J7AA 5EAIA 4F92B 2ZK7A 1W4AA 4WINA 4YRFA 1HLDA 2AOTA 3WRWA