3LIPA

Open conformation of pseudomonas cepacia lipase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The open conformation of a Pseudomonas lipase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRIACYL-GLYCEROL-HYDROLASE
total genus 122
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lipA00
1QLWA 1XZCA 2D5LA 2JGFA 2O7VA 4W63A 3FSGA 4QE3A 3G0CA 3FLBA 4BC0A 1LPNA 4WCVA 3WL5A 1DQZA 1W75A 2HDWA 2UZ0A 4BP8A 4B0PA 3AZQA 5JD6A 1CQWA 1JI3A 1AKNA 3O4JA 4E11A 5AI9A 1GKKA 3IVMA 1P0QA 1W4LA 3WWOA 5AKLA 1HPLA 3C8DA 4QLOA 4V2IA 1QGED 4AN0A 5LZ8A 1J07A 1XROA 2WG0A 4Q3LA 4HRXA 5T4BA 3SC2A 2DHDA 3STVA 6YASA 3PF9A 5EIHA 2XMSA 3U1TA 1EDBA 3BF8A 1X2BA 1MX5A 1ZI8A 1WHTA 3DKKA 4X6UA 1EA5A 4DGQA 4QNNA 1UZAA 3IURA 2HU7A 1WHSA 4WY5A 4BAGA 1VLQA 4CCYB 1Y7HA 3QYJA 4MYDA 4C4XA 1U4NA 1ODCA 2Z8ZA 1N1MA 2HA3A 1IZ7A 3C5WP 2WUDA 4X94A 1SCQA 5DTJA 3BWXA 5DLPA 3K9BA 4QEKA 2H7CA 1YAJA 2XUJA 5AJHA 4HXGA 1XQVA 3WK8A 2VTVA 4HZGA 1N5RA 4QA9A 1XFDA 3WL7A 3E4DA 3ED1A 4EZIA 1HDEA 4MXDA 1W6RA 5HQ3A 4BTLA 5K3DA 4XJVA 1JMYA 4PSUA 2IX9A 3QPCA 3DYIA 1UK7A 2QJWA 5AKGA 3IUMA 4DLNA 2YH2A 2WKWA 2W22A 4FTWA 1XLWA 5ESRA 2Z5GA 4U2EA 4NS4A 4QDOA 4ITVA 4W9RA 4Q3OA 3DD5A 3WZMA 1ZI9A 5AM3A 4GHWA 3BIWA 5KBYA 4BAZA 5K3FA 1CUZA 3ZPXA 4N5HX 2FJPA 1XQWA 2E3JA 2JEZA 1SCKA 4IQ4A 1LPOA 1K63A 1UT6A 2B20A 2I3DA 2GBIA 1LBTA 1XZMA 2XUKA 1U65A 2QMQA 3N0TA 5AM2A 5EHZA 1FSSA 3E3AA 2PVSA 3T52A 1F0PA 2BUCA 5JAPA 1ORWA 3KWFA 2ZYSA 2Z8XA 4BCCA 4CG2A 3AJAA 2VAVA 1S8OA 1R9NA 2OQVA 1EXWA 4AQDA 3WYNA 4G1FA 4KRYA 2AJ8A 4LHEA 5SYMA 4W1SA 3B12A 2CEKA 1VE6A 4M0EA 3ZLTA 1O6FA 1EK1A 2WFZA 4OYLA 5J3JA 3BDVA 1O6GA 2C0PA 3HJUA 3C6XA 5SYNA 5JYCA 4DNOA 5JANA 1QE3A 2GBGA 1FJ2A 4MQLA 1FFBA 3LS2A 2PM8A 3IDAA 3ESDA 1AX9A 2RHWA 1SOMA 2WIGA 1YCDA 1PV1A 2XE4A 4FBLA 4JNCA 3DOHA 2ECFA 4WFKA 3HEAA 1F6WA 3O9VA 2WHQA 3DKRA 3KXPA 2VJCA 3FVRA 1ODTC 3STWA 4N5IX 1LBSA 3Q8WA 4Z49A 1CUXA 4GLBA 2FJ0A 4ZV7A 5HF9A 5HF6A 3F8SA 4DTCA 1F0NA 5H3HA 4BRSA 4BTVA 1TCCA 4HTAA 3NUZA 3VXKA 3LCRA 3ICWA 2CKMA 2G5PA 4N8SA 5ALJA 5AK5A 2XI4A 3IUNA 2HA4A 1QIJA 4B84A 3I2KA 1GQRA 2XUGA 2OXEA 4A16A 4F21A 2CBGA 3I6YA 3QPDA 2EEPA 3R3UA 1JT2A 1GKLA 5ALRA 1CQZA 2RI6A 5K5EA 3FSGD 3I6MA 2XLBA 1CUIA 4X7BA 2I3ZA 1UKCA 3H1AA 3DOIA 3X3HA 4L72A 1ORVA 4GW3A 5HFAA 2AJCA 2H7XA 3CCBA 1MNAA 5AK4A 2G63A 3WQHA 3F97A 3I2GA 2C5GA 3G9ZA 5D6OA 1YB6A 4QWMA 3Q0TA 1MU0A 1OCEA 2HA2A 4RE6A 4EY5A 5AOBA 2VJBA 3B5EA 5AKEA 2WHPA 4IH1A 5FPPA 2FX5A 4HS9A 4C88A 4Y2XA 1GT6A 4KE6A 2XQIA 2WLSA 4FMPA 1QIKA 3OPMA 4PSDA 2D0DA 4M0FA 3QITA 4CG1A 4OPMA 4YX9A 2JGEA 1XRNA 1W76A 4XVCA 4Y2PA 4P08A 2HA0A 5K3CA 3BE8A 2QXUA 1ACJA 3SK0A 4WJLA 3QM1A 5LKAA 2H1IA 4B7ZA 5KWJA 2R11A 1A8QA 1KU6A 2ZJ7A 4ARAA 4BB0A 5CMLA 1UK8A 1CEXA 5ALXA 4G9GA 3R40A 1UWCA 4GXNA 4FDMA 1YA8A 3H1BA 1UKAA 2CJPA 1QIHA 2WFMA 1EHYA 2OPHA 5IVHA 4LKOA 4DSZA 1CUWA 5DYYA 1QIMA 2X76A 2YASA 1OILA 1DX6A 4Q1VA 2C4HA 4UHBA 1IUPA 1GQSA 3WL8A 1M33A 4B9EA 4P93A 5AHXA 5AKJA 5ALEA 2VT6A 4ZREA 3HXKA 3KD2A 4ZRDA 4UPDA 3TRDA 4B83A 4Y9SA 2JIDA 4C4YA 4WDRA 5K3FB 2OAEA 4EUSA 1HL7A 2AJLI 1QTRA 4CG3A 3H04A 4PNZA 3WKCA 1BEZA 5IVIA 2C5FA 1ETHA 2QT9A 2VA9A 2JGMA 3L1IA 2XUOA 4C01A 1TIBA 3WA7A 3LIPA 1LPBB 3F96A 3W9UA 5A7HA 1AUOA 2LIPA 3DJYA 3R3ZA 3FVTA 1VA5A 1NX9A 1QO9A 4CIAA 3A70A 4P9NA 5JAHA 3H2KA 3DCNA 3FCXA 4AX4A 1R4ZA 3G9XA 5AK3A 1LPMA 2C0QA 2GBFA 3STXA 4QDZA 4BVJA 3P2MA 2XUHA 1E8DA 4H77A 3C70A 3RK4A 2WILA 4G8BA 1XZLA 3JYHA 1VOTA 1UOOA 1XQYA 1BN7A 1BU8A 4FBMA 3W06A 5C8ZA 5EHNA 5LYYA 3STTA 1EI9A 2JGIA 5ALZA 2RONA 2B61A 1Q0ZA 4DNQA 2XB6A 5A7GA 4L3WA 2FUKA 1UK9A 3G9TA 2EDAA 3QZUA 5DWDA 1GZ7A 5AM1A 2PSDA 4PW0A 2VEOA 3BIXA 4S0XA 2XMCA 1J1IA 1SCIA 3ZLVA 4I4CA 1XZBA 3DLTA 2OCLA 3ANSA 1MNQA 4K5QA 1EB9A 5JALA 3FBWA 4CI9A 2HU5A 1XZDA 5BWBA 3HI4A 4LYEA 1CV2A 4QDXA 2BCEA 5JIBA 1THTA 4H7DA 4EY4A 1E8MA 3GA7A 1YS1X 3M82A 4DYHA 1XZIA 2JF0A 4OD0A 3PF8A 5EIAA 5T4EA 4JH0A 3DYVA 4MEBA 2VSQA 5FLKA 2QUBA 1B41A 4LXHA 4AN1A 2Z3WA 3KDAA 3DEAA 5LZ5A 4J3JA 3PUHA 3EQ7A 4PSCA 2BUAA 4NMWA 4UHHA 1T4MA 1QO7A 2BKLA 2ZYHA 1MAHA 2WU4A 4EA6A 1AMNA 3SX4A 1YS2X 4PQEA 5CTAA 4GEGA 1J06A 1Q83A 2PKYX 1TAHA 1LLFA 3TGLA 4ZI5A 5DYWA 3PE6A 3QH4A 4Y2TA 4H7JA 4ZXFA 3H2GA 4MJ3A 2QUAA 2PU7A 4W1RA 2IITA 3O4IA 2PSJA 2DQZA 1DX4A 5EHXA 4KAJA 3STYA 4K6GA 4DMKA 4G8CA 5E4TA 1WB4A 4UFNA 3GZJA 5C81A 3HC7A 4BE4A 5DNWA 4UBMA 4C89A 5EHQA 3ZV7A 4KAFA 5AKXA 1C7IA 3NWOA 4ETWA 1MO2A 2GZSA 1YAHA 2JBWA 2XQGA 4G5XA 5KREA 2HADA 1YASA 2WIKA 1QIFA 4FNMA 1EINA 3R3YA 4F0JA 1ZGBA 3HSSA 1IZ8A 4JYMA 1JU4A 2J3QA 1EDEA 3V1KA 3WZLA 2V97A 4INZA 1VZ3A 1CFJA 1CUUA 3IUJA 1JMKC 2HL6A 4D9JA 1VXOA 1ODSA 3R3VA 1E8NA 2XUAA 1E66A 4LXGA 2JGJA 1BE0A 1LPPA 2XUQA 3UUEA 2BJHA 5K3AA 1X70A 2H7YA 2XUFA 3WL6A 4OSEA 3D3NA 2WUGA 4B9AA 1CUFA 1H2WA 3WI7A 1WB6A 4IH9A 3QMMA 5CH3A 2WHPB 1ZIYA 3E0XA 1SFRA 2PBLA 1MTZA 3B3QA 3EQ9A 3VVLA 5DNVA 3BL8A 3E1GA 2Y2VA 5ALYA 4ARBA 3VDXA 5AOAA 2XQJA 4UBIA 3V9AA 5AH0A 1I6WA 2DR0A 4FNGA 2JGKA 2QRUA 2GBCA 1J2EA 2J4CA 2VATA 2PSEA 5C7YA 5LP1A 3PFBA 4LXIA 2ONCA 2ZYRA 1A88A 3HACA 4W1PA 1JFRA 1N5MA 4AZ3A 4K2AA 2V96A 4H7FA 4RGYA 5A62A 4J0KA 1A8UA 3H19A 1GXSA 1MJ5A 2QXTA 3UUFA 3IULA 1K4YA 2IIVA 2QVBA 2X5XA 1CLEA 4X3CA 4ZV9A 2GYVA 3A6ZA 5LKRA 3V1LA 2QJRA 1AQLA 4OB7A 2WUEA 5ALMA 5HFNA 1WPRA 1P0MA 1BN6A 1QFSA 3MUOA 4X85A 3VJKA 3S8YA 4H0CA 5D3ZA 1IVYA 2WHRA 1YR2A 1BCRA 1DQYA 5D3KA 1H22A 3G0GA 1IUNA 5ALUA 4NZZA 2QTBA 1WB5A 1EB8A 3AIKA 5DYTA 3WWPA 1H2YA 4H7EA 1MAAA 3WWDA 4LIPD 4ZGBA 1FFAA 3FYUC 4C6HA 1YSCA 1LNSA 5DNUA 2QKYA 1C4XA 3ZLUA 1EX9A 3C6ZA 3OM8A 2OGZA 2QR5A 3IB3A 3FOBA 5AO9A 4UBNA 4X90A 3I2IA 4IO0A 1DINA 5CURA 5AI4A 2R8BA 2XQFA 4JYPA 1TRHA 1CUCA 1IMJA 1QOZA 2ZVDA 4HXFB 3WK9A 4Y2UA 4UFOA 2WFLA 1CUSA 1W52X 1FFEA 2DHCA 4QLAA 4UBOA 3VJMA 1JU3A 5ALPA 3QMVA 3JW8A 2ZJ6A 1C7JA 1DWOA 1FFDA 1XZFA 3PFCA 5CT9A 5D7BA 4Q82A 1GPLA 2ROQA 1TCAA 4KRXA 4FHZA 5CBKA 3WJ1A 1L7AA 5AM5A 1CUVA 2ZYIA 3G0IA 2B9VA 4KJXA 5AIAA 1ZOIA 4X91A 5AK6A 3A2MA 4B0OA 1BROA 5JAOA 5FPQA 2OAGA 1XZHA 4BDTA 3WJ2A 3I2FA 1K5PA 3U0VA 5HK8A 3V48A 4F60A 3WYDA 4X6YA 4EHBA 1GPNA 1NU6A 3D7RA 4U2DA 2Z3ZA 2O2GA 1VA4A 4QDTA 1F8UA 2O7RA 5HK9A 3FCYA 2GZRA 4FOLA 3PI6A 1DT3A 2J4FA 3O95A 3OG9A 4Y2JA 5EGNA 4U2BA 3C43A 1Y37A 2WTMA 1P0PA 5JASA 4Y2RA 4UHEA 1GGVA 2OQIA 5A2GA 5ALGA 5HF5A 3WWEA 4AXBA 5AP9A 4BDSA 3V1NA 3C6BA 2HA7A 2OCGA 3T4UA 1A8SA 2HA6A 1U8EA 2WU3A 2YYSA 2PUHA 3C5VA 1XQXA 1BEEA 3A2NA 4BAUA 4ZWNA 4AZ0A 1D07A 1QIIA 4WFJA 2HU8A 5ALQA 3OOSA 1WCYA 2XUIA 4EBBA 2ES4A 3EF3A 5HZGA 3ESCA 3D5EA 4AO7A 4BYMA 5A7FA 3M81A 4BE9A 4WY8A 4BCDA 2XMGA 1ZD3A 3AIMA 3IUQA 5I7UA 1QIDA 2QM0A 3NOXA 3LP5A 5CH8A 3EIOA 1ZD2P 4BBZA 3L1JA 3W2TA 1CUEA 3I2HA 3RM3A 1QONA 2JGLA 2WSLA 4U2CA 2XDWA 1G42A 5FV4A 2ORYA 1MPXA 4BZZA 5HQ3B 4Y7DA 2RAUA 3DNMA 4A5SA 4B81A 3WA6A 1XZJA 4H7KA 1VJ5A 1E5TA 5F4ZA 4DMCA 5FDFA 5JARA 4KEAA 2C58A 5C8VA 5CT4A 3FLEA 4BATA 3K2IA 3TJMA 3F9CA 2JEYA 5CXUA 2PSHA 2PUJA 1PFQA 3DDUA 3R3WA 2BFNA 1EVQA 1DWPA 4J7AA 3IBTA 3BF7A 5AKYA 2V98A 1E3QA 1TQHA 3H17A 1LPAB 1ISPA 2HFKA 4N8EA 4C4ZA 4AMYA 2CMFA 4X71A 3H2HA 3F67A 3O4GA 4OB6A 5E2IA 1XRRA 3FYUB 1YB7A 5ISMA 3N2ZB 1ACLA 2QZPA 3FNBA 4NVRA 4CIBA 1SC9A 1N8SA 3I2JA 1Q0RA 3CN9A 3C87A 5CXXA 2XUPA 1MT3A 4TPKA 5K3EA 3G8YA 2XMQA 2XQKA 4QZVA 2AXEA 1BS9A 1XZKA 4GWLA 1VXRA 3VKFA 2AJBA 1DTEA 1DWQA 3H2JA 3HYSA 5ALVA 3G0BA 1XRLA 3DL7A 1TCBA 4KACA 1THGA 2WG2A 4WFIA 4X00A 3H0CA 5JZSA 1P0IA 4HXEB 4KYVA 2WM2A 3A2LA 1ZIXA 3GFFA 1JJIA 4DSAA 2I03A 2NW6A 5CT5A 3W04A 5LZ4A 5JATA 1Q84A 3GELA 1XZEA 4E14A 1EK2A 2HRQA 3D4LA 3DQZA 4G4GA 3IIIA 4IH4A 1PJAA 5JZ9A 3BJMA 3KWJA 1CVLA 3VJLA 2WUFA 5AI6A 4AO8A 4J0DA 2WIDA 4J0IA 2ZJFA 5IVDA 5K3BA 4UHDA 3FLAA 4HAIA 1MX1A 5CH5A 4B6GA 3TEJA 3ZWQA 4N8DA 5IH7A 1AZWA 4FKBA 4XWGA 2PU5A 1RWQA 4H18A 2HM7A 3W9BA 1CR6A 1CUJA 1UOQA 1UOPA 1AC5A 4Q34A 1CUHA 3WK5A 2WJ3A 5ALDA 5A71A 2BGRA 5LZ9A 3VISA 1LPSA 4IHAA 3G02A 1QFMA 4UHFA 3R0VA 2HFJA 4FFVA 1CUAA 2VT7A 2BGNA 5FXMA 5HKBA 1XRQA 3FAKA 1KEZA 1OXMA 2OCIA 4B85A 1FFCA 1ZGCA 5LLSA 4X92A 1CRLA 1ZI6A 4BP9A 2C7BA 3WK6A 5EI5A 2HHAA 2WFLB 3K6KA 2P8SA 3GBSA 3O0DA 1YA4A 1B6GA 2J3DA 3ICVA 3WIOA 1ZJ5A 2VQ6A 4KR0A 5AKHA 5ALOA 4A23A 4YASA 5YASA 3SWWA 4J0HA 5EIEA 1L7RA 4CCWA 2OGTA 1E89A 4LYDA 3RLIA 4CFSA 3BJRA 3F98A 4FLMA 1RP1A 3O4HA 4OB8A 4BVKA 1JJFA 4L9AA 3BXPA 2G5TA 2DHEA 3C8HA 5ALFA 4X95A 4OYYA 5A6VA 4UHCA 4J0GA 2VF2A 3PICA 3IA2A 2WIJA 1QIGA 3WK7A 3WKEA 2XT0A 1R9MA 2WTNA 1K6EA 2Y2UA 3HABA 4DMHA 4J0JA 3OTQA 5ALKA 3LIIA 4I3FA 1AURA 3WLAA 4KE8A 3GUUA 3R41A 3AUKA 1CUYA 1ZICA 3GROA 4MYSA 4J0CA 2ACKA 4TVKA 4YK7A 3JWEA 4MQMA 1TKRA 3D2CA 4KAAA 1JJBA 1ZJ4A 4U2GA 4UFPA 4CCYA 2XMZA 1VE7A 2XMRA 1R50A 5DTIA 3WK4A 3HRHA 3MVEA 3QMWA 1AGYA 4WDQA 4Y2VA 1EH5A 3D0KA 3PUIA 3D2BA 1XZGA 3WKBA 3AZPA 5CRIA 2YXPX 5AI0A 4Y2SA 4UBJA 3G0DA 3HZOA 1JKMA 2ZSHA 5AIBA 4DIUA 1WM1A 2X8BA 3CXUA 4HVTA 1EVEA 3RARA 2PX6A 5JAUA 5ALWA 1XKLA 4EB0A 2VJAA 1R88A 5FUMA 4F5ZA 3QPAA 3C45A 5AKZA 5LIPA 4J03A 2OG1A 2OCKA 4PF1A 4KE9A 1QIEA 3AFIA 1A7UA 1HBJA 4L0CA 2BUBA 2GYUA 2WG1A 3MUNA 5AI8A 4JUIA 4W1QA 4EY8A 4QWWA 2WJ6A 1XKTA 1HLGA 2RGUA 2AJDA 1QZ3A 2RIPA 1XRMA 3L1HA 5FOQA 1LZKA 1EDDA 3W05A 3FYTA 3BDIA 2HIHA 2B4KA 3OC0A 4EY7A 3WIBA 4GBGA 1UXOA 4DM7A 4BVLA 5ALTA 5ALLA 2Y6UA 3G7NA 3ANTA 4B82A 4DMFA 5AI5A 5KWIA 2Q0XA 4ROTA 3QVMA 5HKAA 1Y7IA 2VJDA 4JEIA 5JD4A 3D59A 5JD5A 5AOCA 3I1IA 3V1MA 2EDCA 1VKHA 5FP0A 4X97A 1IUOA 3O9MA 2BAGA 1XRPA 5ALIA 5E4JA 1K8QA 2WQZA 4XIIA 1HQDA 3OURA 1MX9A 2O2HA 4RNCA 5ALNA 3KOOA 1UKBA 2K2QB 3H18A 4H7HA 1H23A 1U2EA 3DL4A 4AO6A 1QJ4A 3RKSA 5EFZA 2XMBA 3ILSA 3ESAA 1CPYA 4X93A 3CCCA 4KE7A 5I8PA 5FKJA 4I19A 1R3DA 2CB9A 4K6KA 2O2IA 3M83A 4GI1A 3S2ZA 1H2ZA 4G4JA 5AICA 4FLFA 5I9IA 4BZWA 3I1YA 4PV7A 4HRYA 4Q05A 5CW2A 4FLEA 1DT5A 5HF8A 1W1IA 5AM4A 4BCBA 4MWTA 2Y1KA 4Q3KA 4DNFA 1KU0A 1R1DA 2DFPA 2GYWA 4H35A 3ZI7A 5ALSA 4MWSA 4B80A 4C87A 5AKIA 4EY6A 3KSRA 1RYYA 2DCMA 1G4HA 2XMDA 2V9ZA 3AINA 2QOEA 5T4HA 1BRTA 4QDUA 4PO3X 4AB1A 2H9YA 1LZLA 2CZQA 4OCZA 3WKDA 1LGYA 2WJ4A 3H2IA 4DNPA 2RHTA 3I28A 3ESBA 4E15A 4XX1A 1BCSA 1ZD5A 3WKAA 2XUDA 1XZAA 5ALHA 3FWHA 2ACEA 2PPLA 3C6YA 5HCUA 3R3XA 3YASA 2DSNA 2Y6VA 4M0MA 5FRDA 2HRRA 1CUDA 3EBLA 3UMJA 1WOMA 1T2NA 4OU4A 5C8XA 2I78A 4UBLA 2QS9A 5BOVA 1H2XA 4FFWA 1CIJA 3I6ZA 4BC1A 4BRZA 1CUGA 2HA5A 5AKKA 1VZ2A 1XLVA 2WIFA 1UFOA 5AM0A 2W6CX 3NGMA 5BV7A 5JZBA 5E4YA 3FYUA 1CUBA 1UK6A 5T4FA 4UBKA 2DQYA 4Y2YA 4GDMA 4RE5A 3WWCA 5LZ2A 5DJ5A 3QBJA 3HLKA 1WPXA 2PL5A 2ZSIA 2PSFA 2VAXA 1G66A 1NU8A 3AILA 3VVMA 4P92A 4U2FA 4E46A 4GECA 3LLCA 1GPKA 1HKHA 4TGLA 1L7QA 4O08A 3CN7A 4MEAA 5IVKA 2OGSA 1G5FA 4Y2QA 1ZD4A 3EQ8A 1Z68A 3M3DA 2XLCA 4YPVA 1XLUA 5IKXA 5JADA 2CUTA 4G9EA 4G8DA 3D2AA 4OUKX 3WMRA 1DU4A 4AMZA 3STUA 3G9UA 2G4LA 1USWA 5BWCA 5LZ7A 4K6HA 4FWBA 5CT6A 2OLEA 5CT8A 1QTIA 1MN6A 1TK3A 3MGAA 1X2EA 4G4IA 7YASA 3AIOA 3DS8A 4OU5A 3AZOA 4RPCA 4UUQA 4H7IA 3PDCA 4X6XA
chains in the Genus database with same CATH superfamily
1QLWA 2YXBA 2CMGA 3JQFA 3R4VA 5L3QA 2OK8A 2D5LA 2O7VA 3RRYA 3O31A 4W63A 2QMOA 3FSGA 2IE8A 3GPIA 1BGXT 4MRNA 2AIRA 3G2MA 4RDHA 4WCFB 4AKTA 3LYLA 3GLFE 1GZHB 2ZR8A 1UFRA 3FLBA 1LPNA 2QRQA 2I1VB 3H1FA 1MABA 2OZVA 1FMCA 4H6VA 5ENDA 5JD6A 4C30A 1Z6YA 1AHHA 1T9DA 4MYHA 3EFBA 1OBHA 4H6WA 4D3YA 5EE5B 5L3QB 2C61A 3GJYA 1M73E 3H86A 4QU8A 3BB4A 4AECA 5BSHA 3MCTA 5JNTA 1ADCA 3SM9A 3H0KA 3BCRA 3OPYB 4ML3A 4GKAA 2O7SA 4ZQGA 3OCUA 4QUAA 4I4TA 1GKKA 3FFXA 4ZCMA 1G5QA 5A3JA 3IVMA 1Q0TA 5ECYA 1PR3A 3OF5A 3F9IA 2JVKA 1ODJA 4MUGA 1ZD8A 2GCOA 3VMMA 1TK2A 4OBXA 3NAGA 4NEQA 3ZXIA 3A6PC 3QXXA 4EUNA 2FP4B 4JT2A 3BZBA 1O95A 1B2RA 4MV1A 1F17A 2R6CA 4EELA 2HSEA 2NZ8A 4M9RA 3MLBA 3T9CA 5KJFA 4B6OA 5JYDA 2XCSB 1QGED 2W83A 4AN0A 3VDQA 1GAEO 1J07A 4FMBB 1PR6A 2XXJA 4RELA 4Y1RB 3Q40A 3WRWA 1JW9B 1YNOA 4OKNA 2RGRA 3JQRA 2G8NA 4D99A 4WBNA 3R76A 4A8JB 4HWKA 3GRYA 1MA0A 4D3XA 3BMQA 2DHDA 2QRLA 3SC2A 5ADUS 5H81A 1PYGA 4LRXA 2OESA 4O3FA 3STVA 5CB4B 2R8RA 6YASA 3H6GA 1NQUA 5HHTA 5FTKA 1EDBA 2PEYA 2Q1TA 3KZKA 3DFZA 3PFGA 1WU8A 5DP1A 3WBJA 4YCCA 1WHTA 5C7LO 3DKKA 2HTEA 1D1QA 1T1GA 4DGQA 1M2OB 2E48A 4QNNA 3WVNA 4RZHA 3IURA 2C9MA 3NH9A 4CR7A 5G3ZA 3PX7A 3NM6B 3UJ8A 2PT7A 1X94A 4ESEA 1C0PA 2CFRA 4TMTA 1EEHA 3V6MA 3LHDA 1XCMA 1Z8FA 2VVTA 2JCGA 4FZRA 1ZK3A 4YDHB 5GGYA 2ZAYA 4BFXA 1WDMA 4HLQB 3GV0A 3OIGA 4PZZA 5B4UA 4CQNA 3VH4A 5ESDA 3LZDA 3ZGXA 3C5WP 2UUBB 2WUDA 1SCQA 1YOVB 1Z4KA 4ZEWA 1C9EA 2WRZA 3AVYA 2ZE7A 1KSHA 3BRCA 4M8SA 1YAJA 2XUJA 3FCAA 2H2WA 3JWHA 4IWYA 3K09C 4CTKA 5AJHA 5CD9A 3LVQE 1V8DA 3HO1A 3RIXA 1PF7E 2XWJI 3P9ZA 4R01A 4QC2A 1YQQA 1GAJA 1HT1E 2DWUA 2J9YB 2NWQA 3WK8A 3W5BA 4RA9A 4G0UA 5CVDA 4I5EA 5JPCA 5LQDA 2O3SA 4HZGA 1N5RA 2A1IA 4UTXA 3WL7A 3ND7A 5IDQA 5JNSA 3NBQA 2WHEA 4KITB 4D6XA 4EZIA 1NJSA 4LMPA 2Z9DA 1SXHA 3FDIA 4YXWD 2O5VA 1YB2A 1RBMA 5E9QA 3ACCA 3D5TA 3D6FA 2JPDA 4IVQA 4LNHA 4YP0A 2OG2A 2R6AA 1B0PA 3C98A 5K3DA 1E3EA 4PG6A 5DTMA 5D5HA 3Q0EA 4RS4A 2IX9A 1T5OA 2VJMB 2Q45A 3LWDA 3DYIA 1UK7A 3DC2A 2Z6VA 4TKVB 1JHMA 4YI3A 2J5XA 3EOAI 4RVCA 3OTWA 5BPHA 1ESZA 3WADA 2VA8A 3LFUA 4BNUA 4E33A 4MCAA 2AX3A 1XLWA 1I1HA 3P2OA 4JLBA 4NDAA 4HEQA 2Z5GA 5F3RA 2R2GA 1H65A 4U2EA 4WGGA 1U0SY 1FRFS 1DRVA 4NS4A 4WY2A 1PK7A 4N41A 1BQ4A 3L7JA 1TCUA 2Q9UA 2Z04A 5C46F 3ETEA 4W99A 3TFOA 3MWFA 3GP3A 3UT0A 1ZL2A 4M37A 3IOMA 1WQ4A 3V2HA 5E6RA 3BIWA 1CTQA 1RYHA 4DG8A 3T9EA 1BAPA 2VC2B 3N2IA 3SIWA 4MO2A 1HORA 3WMXA 1PL8A 3RC3A 1M3SA 2FJPA 3Q12A 3V00A 2OBMA 1FJHA 3BGWA 5JAMA 3AV0B 3UATA 2JEZA 3JYQA 4RIIA 5IC4A 2C29D 1Y5IA 1QP7A 2NO0A 4MS1A 4D46A 5TS2A 2Y66A 2J6CA 4P32A 4PO8A 4B33A 2EF1A 2B20A 1ONNA 3VKWA 3DAPA 4YJ2B 1MW8X 1M5UA 1E3TA 1IONA 3CNLA 2BPOA 1LBTA 3ZGZA 1FDRA 1EQUA 1I4OA 1WCXA 1IZ0A 2NV0A 2QMQA 4OFXA 3WNZA 3GBVA 5F77A 4HEA1 3WGLA 3AEYA 2Y93A 1EVZA 1KI7A 2H0RA 3DF7A 5DM70 4Q66C 4ITUA 2ZYTX 4HWOA 4IDDA 5G0WA 4ZZ3A 1F0PA 1W36C 4EA7A 1AXGA 1S02A 4GF5A 3W2GA 2IJGX 4WOBA 3X2FA 3JD2A 1GNPA 4KR9A 3C3KA 1E20A 4L4SA 2B8EA 2EU8A 2Q1SA 1JWAB 2WAMA 5KKAA 1QP0A 3IUEA 2ZYSA 4R1UA 3GUVA 1YIOA 3EE6A 3CLUD 4EPYA 4RIHA 3NBKA 3VKHA 5EMKA 1SXJA 1U31A 3WAJA 3EC1A 1R9NA 4CE6A 2OQVA 3OTHA 3ZIAA 3CB4A 3WYNA 4AQYB 4DC9A 3NHPA 2LGJA 1UBFA 3Q7TA 3UVEA 4ASUD 2AJ8A 4LHEA 3U1VA 5I45A 3DFKA 5IN5A 5JISA 2XH8A 1O5IA 3IRVA 3PJGA 4R1LA 1MQAA 2GJKA 3VV3A 4FZJA 3TPCA 2DM6A 2Q62A 2CEKA 4L6IA 4MRVA 1QNFA 4W8OA 3C5EA 2BGTA 1MCZA 4DQDA 2XKKA 2P2CA 1O6FA 1ISFA 2CJWA 4OYLA 2ZI4A 5TIIA 4YC7A 2AOUB 1PZMA 1XTQA 4MRSA 1PCXA 4BL5A 1TO6A 4M1EA 2P4EA 3KNZA 5FA8A 4OLBA 1NBMD 4MI1A 2B6NA 1P75A 3HCCA 3WGZA 4FYMA 1CS0B 3RG2A 5B2EA 2PNFA 1U0BB 3E5RA 4L8YA 4Y1RA 4OK3A 5LUBA 2FPPB 2E1PA 5DHQA 5TPZD 3ENNA 3NHMA 3IDOA 5DV9A 5G1OA 2PA3A 4DHWA 4YH1A 2CHVA 2GJAA 3DL0A 4CEHB 1ZRNA 2AH5A 3DLIA 1Z4IA 4JP8A 3G6WA 3ZDCA 4DNOA 1ZH2A 1KR2A 1MC8A 2KWIA 1QE3A 2A8YA 1QYCA 2UUPA 3DH0A 4LN1A 4IV5A 4Q1DA 1N6OA 1ZNZA 3D64A 1GZ5A 3VZDA 3N53A 4FT2A 1DXQA 3GP8A 4ND5A 3TW0A 4CW7A 1AD2A 4OLJA 1W46A 1MO4A 3F3KA 5BUSA 4M6WB 1AX9A 1M2WA 1R74A 1YCDA 4FBLA 4URHA 3K71B 1NTOA 4L2IB 3KV1A 1O5OA 1RCTE 3N59A 4BNNA 2TMKA 3HEAA 1KMMA 3O9VA 1EFHA 2COKA 3DKRA 3JR3A 4G0QA 5CVVA 3FNRA 4EHAA 3S1LA 1ODTC 1W36D 3M4NA 4JVNA 4HGOA 4WLOA 3RUCA 4QODA 3O83A 1ZG3A 3Q8WA 4PLGA 1RVDA 2Q3FA 3JU3A 1K75A 4TT8A 1QCCA 4BUZA 1NQ5A 5JCPA 1AF4A 5EPOA 1TTHA 3ZBPA 3N75A 2V3CC 4JBLA 5HIJA 2O59A 1YZQA 5H3HA 3CO0S 3LUDA 1C8LA 2WJYA 4IKEA 2RGXA 3F5QA 1XN1A 1R4MA 1Z6GA 3ZD7A 1RYMA 1PQYA 3AY6A 3JD0A 1MENA 3W4JA 4AJPA 1RHQA 3BXHA 4HTAA 4H6XA 2PG3A 3D43A 5FNVA 3VXKA 3EB9A 5ED0A 5KNDH 2V7GA 2O6HA 2BFFB 3HU3A 4DJFC 5EWLB 3HB0A 4GSKA 4HLDA 5C1IA 4K26A 3H83A 5AK5A 5IYZB 3CZQA 3IUNA 4K8RB 2HA4A 3HI6A 3C3WA 4YMUA 4G37A 5T57A 3OQVA 3PIDA 1WMSA 4X20B 3H9EO 1PJZA 2XCQA 2H1LA 1YULA 2I7TA 3FHOA 3I9JA 3MT9A 2JL1A 3I2KA 1DAIA 3IP6A 4NZPA 4URFA 4A82A 4XUDA 2OXEA 1KP2A 1BFKA 2EC5A 1J0BA 4PO1A 2PUTA 3VAZA 2CBGA 1UZUA 1CR0A 1KZ7B 1W34A 2P9YA 2R7MA 4OATA 2EEPA 4TN5A 3UK0A 5HKOA 1RRCA 4R0MA 1LEHA 1J9ZA 4R4JA 1GKLA 1EZ1A 1SUCA 2H2FA 2G36A 4NC9A 5ALRA 4ZTZB 5BVHB 2XGSA 3FSGD 3FZYA 1DO2A 1CUIA 3DOOA 3EDCA 3GCGA 3OZ7A 4BVGA 1X9HA 3DBHA 4F4JA 5CA1A 4MLZA 2HSJA 5JJ5A 2G04A 2HJSA 3FR7A 3LI2A 3USCS 2GM9A 3DOFA 1WXGA 3LYHA 3HL0A 1HDZA 4TV9B 2AZDA 2QN3A 4LRTB 5G4KA 5HFAA 3R8CA 4EKYA 3NCHA 4M0CA 4OQMA 4A10A 5GZ3A 2Z2KA 1PSZA 4BWVA 1MNAA 3T3HA 2XWSA 1BHJA 1F9AA 1Q6YA 4EGFA 4EW6A 3N74A 4OM8A 4P5DA 2C7QA 4IIXA 1Q0UA 1TQ8A 1RBYA 2R1TB 4PNPA 4ZGWA 2VZ9A 1DAHA 1X7XA 4NFYA 2PGOA 3Q0IA 2DBRA 1Y4AE 2WSSD 3BWMA 5K1ZA 3WYFA 1QU2A 3PXBA 5KSYA 1GL9B 3NWBA 3SOPA 3HJRA 3UJ6A 3IE1A 1I13A 3OBBA 2FX5A 3GLIE 2A58A 4P5PA 4HS9A 4C88A 1AS2A 2LIVA 4Y2XA 4A3SA 2AV6A 4XUGB 2L0XA 3FYSA 3MHPA 4IXNA 2X22A 3F90A 4IHJF 4QQNA 4YJDA 3WL3A 1HRKA 5A4FS 3ETJA 5I8WA 1ENYA 3PR2B 4IXWA 4UE2A 4CN8A 1W8IA 4QOFA 1Y9EA 4QEZA 1G98A 7GPBA 1Y1TA 2RH9B 1GIAA 2OYRA 3ELDA 3K9LA 2A9JA 2ORIA 4WT7A 1EFPA 3EH1A 1JH8A 1HC7A 2ZETA 1OE0A 2ZYVX 4Y1EA 2FFQA 1XRNA 3ZHQA 1W35A 3LPAA 1KEWA 2PSSA 2O8CB 3OZRA 2X2EA 5IUJC 3OC6A 1IAVA 4AI6A 1TVMA 2G7MC 1ISRA 5ELLA 3W4IA 2EIXA 5K3CA 3VU9B 2P1ZA 1KXJA 3COJA 5TX7A 1A9QA 3M6WA 2XCUA 1NV8A 4G0OA 4TLBA 2AN3A 2O3QA 4DSOA 5F7JA 3D7MA 1V3TA 1JEJA 3EMDA 3RRZA 4E5KA 3QE0A 4KB5A 1KMHB 1TTPB 1B6TA 3ZVMA 2Z6AA 5LA6B 1XJCA 5DHTA 3VM6A 3RRMA 2H1IA 1NVEA 1WWKA 1PL6A 1EUQA 3VUFA 2JK0A 4LV6A 2QRNA 2F1HA 6GPBA 5KBYA 4B7ZA 2IA5A 3DM5A 1MLDA 1A8QA 4XB1A 5CA0F 3H9BA 4N9QA 1E9BA 2R44A 2H1VA 4HTFA 3ZIDA 4DDTA 4LEIA 1NVAA 1MH1A 4AZTA 4JT8A 5DASA 1FS4A 3PXAA 1Z0IA 2FCAA 4LE1A 1P44A 3FUCA 2GXUA 3PBKA 4OQXA 5MGNA 5ALXA 5H70A 2EZTA 1VCIA 2W2QA 2VTEA 3H9QA 3R40A 4GXNA 4P4NA 2QTZA 3VR4D 4FDMA 1ZJWA 1D2HA 1QVAA 2QDXA 1D9XA 1GGNA 1PNTA 2X23A 3K6RA 3OT1B 3GPLA 2FJUA 3DOUA 1UKAA 2QTWB 2GETA 1JR3E 2Q2WA 3AJ9A 4MWCA 2G6TA 1MEJA 1VKJA 3QVGA 4RZIA 5DWQA 4K9RA 1EHYA 3RUDA 1TVKB 2B5WA 4DDHA 2DUNA 4ZOLF 4J16A 3IESA 1L6IA 3LYUA 3JYLA 4G5QA 1HWYA 1A0OA 3KLPX 4Z8XA 4ZKEA 3BN3A 4KNYA 5IVHA 3EVZA 3KKEA 1CUWA 4QRHA 1OPXA 4DCNA 4TWJA 4C5CA 3H9GA 2Z6QA 3TL2A 2PA0A 3VPBA 4QPNA 3AEUA 1V8FA 1Z0DA 1N8NA 2IDKA 2PRYA 1RP7A 4MCJA 2QTCA 5CCDA 3WLSA 2EYUA 5JJBA 3F1KA 3PD0A 3MCWA 2H5IA 4GVLA 4LGCA 4EI9A 4LJSA 4UHBA 5FI1B 1L5YA 1BFUA 4LQDA 3O1LA 3UEOA 2VQDA 2EARA 1YL7A 4IP0A 3RYHB 1C7QA 5JPIA 3V7YA 1KIFA 1QGYA 1M33A 3D3WB 4O4IB 3TKYA 1X9GA 3OOWA 1UM9B 2IKSA 3QBEA 3QRWA 1P62B 2ZRKA 3CUWA 1LJUA 3PHIA 3TRFA 3A6EA 2VSNA 3BTOA 3X1JA 1C3EA 2JJQA 3RSGA 4UZSA 5EJEA 5GGXA 3ZGLA 4B83A 4G9BA 3V34A 4TLCA 3QU5A 2UV8A 4YAGA 2JIDA 1ZOPA 3EXHC 1C1XB 3TSAA 1V9SA 2OAEA 1EX1A 2ADOA 5CEFA 1U9IC 1S3FA 2OM6A 2VKQA 3MWDB 4WHMA 3UT6A 2A6PA 1MW9X 1QTRA 3JWIA 1B74A 1DBQA 1YB1A 5ILGA 3Q9NA 2PGJA 2GLUA 4PNZA 4XB6B 1GZ6A 3AXTA 3D3KA 1O5TA 1QP4A 1JDZA 1EUDB 3BK1A 1MZVA 1NQTA 4NBKA 3AUSA 4DGSA 3S5UA 2PRIA 4CM8A 5FD8A 2AC2A 1N33B 4UUMA 2QMHA 1P4SA 1ISJA 2HJGA 2QT9A 2Z4TA 1KQFA 1GSHA 1A5BB 4KG7A 2ZWAA 4UNPA 2ZE5A 2P6RA 1FX0A 5HIIA 1DMRA 1QU3A 2OZPA 3IMGA 3GEPA 2OR3A 4HH1A 1PR9A 3WLEA 1FJXA 3F96A 3CLRD 1JAYA 4D98A 1NUPA 3DBHB 4DJAA 2ATCA 5BUQA 2Q6LA 3L5KA 4B3IA 3LSTA 5JCZA 1VA5A 2VP0A 3HKBB 1ZYUA 2IZ0A 2A67A 3OX3A 1TT5B 2HF9A 3R75A 221PA 7MDHA 3C48A 1SXJD 1LJ8A 1NL3A 2CD9A 4P7FA 3JRXA 3A70A 4MRAA 4U5QA 1N9GA 4WBSA 3H2KA 2BISA 3MD9A 4CIAA 5JAHA 4X54A 5AHOA 1XCPA 3CIOA 1KFJB 3UC9A 3V4VB 1NUQA 4AX4A 4C14A 4ALMA 3EG5A 5ECDA 1SELA 4V1CA 3E9RA 1J2YA 1NPYA 4ZMSA 4FKMA 2WAYA 3UPDA 3ZZ0A 4CV2A 3NYRA 1SY7A 1KBQA 4OX9B 2WOOA 3ISJA 2GBFA 3G6KA 3K5HA 5BORA 2B25A 3H1EA 4TKUB 4WI1A 4M9SA 4Q9KA 3RD5A 2XGOA 3P2MA 4JBHA 5GONF 2R1UA 5J63A 5B2ZA 4E7PA 1E8DA 1UQRA 1Z6QA 3V55A 2BGLA 1ZNWA 5BO5A 2QIOA 2CJXA 2O1WA 3KEFA 3W8NA 2HN9A 4QBIA 3RK4A 4V39A 4OI0A 4G8BA 3NHKA 3JYHA 1VOTA 4CYMA 3KJHA 1NBMA 3OJ0A 4JDUA 4D1YA 1L7OA 4XIJA 1XZPA 3W06A 4ZQCB 5FF9A 2C57A 2IRWA 2DFNA 2NVUA 3AGPA 3KK0A 3NANA 3FHTA 1Q3KA 4C06A 5ALZA 4GXQA 1OX6A 3HPRA 5DHPA 2SKDA 5C2JB 2TMYA 1OXXK 3OF2A 4WJKB 4HNUA 3OM1A 4IPTA 2J09A 2MYPA 2ZRCA 4KO8A 3QG1A 2PJRA 4EABA 2ZYGA 3ADBA 1NA5A 3BERA 2Z5LA 5F2NA 1E2FA 4ZEMA 2NADA 2R8OA 4FUQA 4CIWA 3VU9A 2XB2A 3F3SA 3KB8A 3P0FA 4MQEB 1T4BA 2QX7A 5DWDA 1P72A 3Q5DA 5AM1A 3OJXA 4MJXA 2PSDA 4PW0A 3KKMA 3BIXA 3ILVA 2MR5A 3BHNA 4JIMA 5JSZA 1E59A 1PS9A 1YL6A 3N87A 3ZLVA 1W0KA 2WF7A 3G2LA 4R9VA 2A94A 2YWHA 3LQRA 3SAJA 4AF7A 4IDQA 4J1QA 2IHYA 4RGVA 4BNIA 1QM5A 4U8HA 3COZA 1DTWB 1J49A 5J4LA 3ANSA 5KX5F 4A6XA 5FL7A 1EB9A 5E6UA 2A59A 4NXMB 3W6NA 4HP8A 1QB8A 1DAOA 4GU5A 1IOVA 1NT2A 2IOYA 1GLNA 1QZUA 1R18A 2HU5A 3H42B 1Y1PA 4CTJA 2X2FA 1ZNYA 3HI4A 2DHRA 4LYEA 5LFAA 3Q7IA 3EWNA 3ETGA 2W98A 1EZZA 4UDYX 3TLKA 3GLTA 5B5SA 5JIBA 2W2LD 3M4YA 2CLIB 3BXZA 3NHAA 4PC7A 3HDJA 3H87A 5D87A 5JCXA 3GA7A 3UB2A 1O9BA 1V2HE 4RQBA 3W8FA 1NVKA 1EWKA 4MMZB 1RMTA 1FSZA 2BEVB 3J7AC 1IQUA 3DHNA 1GUDA 2D0OB 1X7ZA 2AJTA 4PAOA 3TI9A 2Y0DA 3ZCPA 5BUZA 1V7ZA 2H65A 4G0ZA 2GAIA 4CMAA 1K5HA 1PWEA 2BFCB 3UJPA 2AMFA 3K73O 3P45A 5HUJA 4FHFA 3L92A 4OD0A 5LQAA 1YBFA 2C5LA 1UMCA 1NQXA 2HBQA 2V6BA 2J8ZA 4QXAA 5EIAA 4XJXA 2KI5A 3P0RA 4JLVA 3WIVA 1V8OA 4JH0A 4JLNA 2H57A 1VG9B 2HMYB 3UXHA 2HQ1A 4IDAA 3RTCA 4FDUA 4R7TA 3K3PA 3AC0A 3L49A 3I0NA 2QRMA 1E94E 2Z3WA 3IAXA 4G56A 3DEAA 2V7EA 1CR4A 3CV3A 1O4VA 1OLXB 2FQXA 1NLZA 2CVQA 5D3MA 3NHWA 5J23A 1YC5A 5AVJA 1CEYA 4P22A 1ZGHA 1V8ZA 2ORVA 3KAPA 4G2NA 4YA6A 4DA0A 4PR0A 4G63A 5JH7B 4FCTA 3SJBA 3X1MA 4AJHA 4LC9A 3PT9A 3RH0A 1C0KA 3WYAA 3Q2IA 1MAHA 1EXMA 1Z63A 4HWSA 4HAWA 4PNEA 1PFYA 4GZMA 3RS0A 5HCIA 1N2CE 1RXSA 2Z58A 5JVDA 3CE6A 3SQXA 2Y1OA 1W93A 3W3AD 4KNVA 2JFWA 4GPTA 4DIKA 3JQAA 1QNLA 2YV5A 3P2YA 1BMFA 1VC2A 3MGGA 1NIPA 1WCV1 4ZI5A 1C29B 3IBYA 4QM6A 2DB3A 1ZC4A 3KDSE 3SSMA 2ZWVA 2ZUSA 1W4ZA 3JSAA 3OJLA 1N2HA 1H0HA 2FUEA 3QH4A 2VXBA 4TMXA 4DMLA 2GZAA 2OV8A 1NY5A 4ZXFA 2GI4A 5B12A 5KNDA 1PVOA 3C39A 1ZXLA 5EXEA 3RJ9A 3WB2A 3UHPA 4UTNA 2FSPA 1N3BA 4YRRA 5H82A 5JS6A 2AZXA 4DMMA 3FI9A 1BTOA 2PQ6A 2Q4RA 2HWXA 2QUAA 3HCOA 5H4HA 4OHXA 3VAYA 1G1AA 3VR3A 4RPGA 5JEDA 2D7JA 3PDJA 2NZJA 3TNFA 2B0CA 3T61A 1OFGA 2R7NA 2XXAA 2H2IA 1V41E 2C59A 3W8DA 5KTOA 4JOBA 4QVKA 1BGWA 2A14A 1HZJA 1UR5A 2EX0A 3B9RA 4YV0A 4HFRA 4KRGA 4PQFA 4JL8A 3KZVA 4AJ9A 2ET6A 3B53X 4G8CA 4EPRA 5E4TA 4GWGA 4QG7A 1CR2A 1JVNA 2D1SA 4XFDA 1U7WA 1WSDA 1Y1SA 2PS3A 3JQ7B 4A27A 1X87A 3MTAA 2V4ZA 3HDQA 4BE4A 4Z4FA 1DBRA 3OEHA 3R6LA 5DNWA 4BX0A 3HWSA 3A27A 4KVFA 4YJ3A 3A1NA 1KJYA 3ZV7A 4C89A 3R7SA 1PEKE 5P8WA 4WVLA 1BW9B 3K30A 3ONEA 4KQKA 4KR6A 2ZPUA 1GPAA 1ZHFA 4WN3A 4RJIA 4EG8A 1V35A 1WDKA 4JI8B 3AF3A 2Z2IA 1JIQA 1GXSB 1RWNA 4PLWA 5H1YA 2BR5A 4TLEA 5SICE 2G7ZA 1Z38A 3TNLA 1KEPA 1IRXA 1FFHA 2JBWA 3HQ4O 3P0HA 3QUQA 4MKGA 2HSWA 1VDMA 3SY8A 2WFAA 1JHPA 5B58T 5KREA 1C3XA 4QYMA 3IQHX 4C20A 2I1QA 4D5EA 1YASA 4UTPA 2FB9A 2C96A 2ODBA 3EZXA 3FDZB 3WOVA 3VR6H 4CU2A 5IYZA 4NCIA 1Z0ZA 4BWFB 3MPOA 2BLNA 4WCDA 2ZXUA 4A8PA 2PZGA 3FPGA 1QFJA 1TTTA 4EKIA 4M1ZA 2IUEA 5K8CA 3O3NB 2P2ZA 3CW8X 4KXNA 3WSTA 2JAQA 3H16A 3A6DA 2JLRA 5JWRA 3O92A 2O2ZA 3PRJA 3JAWB 4MLCA 3WZLA 1FP4B 1W94A 2RHGB 2DQ4A 2PUDA 3HA7A 4B76A 1SG9A 4C76A 2ONKA 1DCKA 1LVGA 1RBQA 3HJNA 1VZ3A 4MRPA 3HEBA 3MXTA 1ID1A 2HCFA 4BQIA 3VU0A 5H8WA 1H4QA 1JLSA 1CUUA 1JMKC 4N7JA 4URVR 1MV5A 1JR4A 4XPIB 1D04A 2WWFA 1EFRD 1TMOA 3R0JA 1XO1A 2EEZA 2ILVA 3GLHB 3H6KA 1ITZA 1MRZA 3FPEA 5U9CA 5BR8B 3R3VA 1ZISA 3INNA 3UMFA 4DDKA 5C53B 2F3QA 5BPFA 3GR6A 4LXGA 3JAWA 4XGRA 4QJ3A 1BE0A 3E7PA 4JITA 2ACWA 4U9IS 3RC9A 1PJ2A 4BNFA 1T0HB 3GFTA 2QL5A 1E1CA 2BJHA 1X70A 3D3NA 3TQHA 4WUTA 2HT6A 2J6HA 4DG5A 1CUFA 2E49A 3NWJA 5HIMA 4K3UA 4J2HA 3LHKA 1Q44A 1JFLA 2I4NA 3QIVA 4IH9A 5DISB 3WGUA 3TI7A 4M38A 3TMYA 2W71A 2OVFA 1UH5A 2C78A 3GARA 1I1QB 4YONB 2PBZA 3QV1A 4F85A 4IEIA 3I42A 1OH8A 3V9PA 4RQTA 1E3IA 1U7OA 2EFGA 2OXRA 1E1DA 3B3QA 3F3YA 1ZW6A 1U3TA 3GGSA 2C2OA 1GZUA 1IE3A 4RA6B 4CMJA 1RPJA 3BL8A 5CVTA 4K0KB 1O08A 2HRDA 3R8XA 2Y2VA 3F47A 1DELA 2CXRA 4EPVA 5IXJA 2AG0A 2QLLA 3HBFA 2CYAA 4RY9A 5JSUA 2WM8A 2GD1O 4H0FA 4FWTA 2HNAA 2Z4RA 5AUQA 4MS3A 4P4UA 2P41A 1I6WA 1IM2A 3PKIA 3S1AA 1H42A 1P4GA 3O75A 3LBAA 4GR4A 4PHHA 1LC3A 2NM0A 3HR7A 4FNGA 2JGKA 1LQTA 4FOOA 4NG4A 5E9AA 2I6FA 2HCJB 1IOWA 2QRUA 3FRHA 2OBYA 3HUUA 1HSOA 4UEJA 1PZHA 2GBCA 4WKNA 4XKJA 3CF4A 2BT4A 1L4GA 1KMHA 1P2TA 1GZDA 2VATA 1Y9JA 3C7KA 1FU8A 3FKQA 1GZVA 3AL2A 5BN5B 2PSEA 3LBHA 5B7QA 4B6FA 2HPZA 4RQAA 1F4PA 1P7VA 4TRRA 2O8NA 4AYTA 4LVCA 1E7QA 4IXTA 1ZVVA 2ONCA 4PC1A 2ZYRA 4AKHA 1A88A 2AYYA 4BLQA 1KEEA 4W1PA 1F7VA 1SBNE 2BF4A 2ILTA 3HB1A 3A1DA 4UC0A 3FZQA 2J08A 1PQ4A 2VDKB 2HLHA 4RMGA 4L08A 2XCLA 4C1BA 1I5EA 2BJWA 2JD0A 5F7ZA 4HO1X 1P77A 4ND8A 4B3BA 3E7FA 4F9GA 4ETNA 1EQAA 3VTZA 4AZ3A 5AVSA 4D4MA 5IC6A 2D2FA 3O84A 5LYJF 4F3TA 2VPZA 2AA3A 1FMTA 3K15A 4G5SA 1G5HA 2QLBA 4Q4CA 3NHBA 2FN3A 3UOWA 4D79A 2BFMA 2QMEA 2ZUWA 3B6IA 5DHAA 3U13A 1A8UA 3H19A 1XAIA 4CKEB 3P7MA 3TE7A 3OLXA 5ITZB 2VP2A 2I7VA 3REFA 2WTAA 3HV0A 5EAIA 1P6XA 3ZHZA 5F73A 4C2BA 3KYCB 1N0IA 1H4TA 4Q4JA 5GY7A 1I5RA 1NOJA 1RAGA 2JAPA 4ND8B 2IIPA 1JLKA 2V55B 4NFLA 2XB4A 1QPGA 1T25A 4DC1A 4QTYA 5C4IA 5KC9A 1GFWA 3K5WA 2PEZA 1DJNA 2GYVA 1KRWA 2W93A 2QZJA 1SXGA 2HD4A 1D0IA 3DMHA 1E92A 3KPVA 1JR3A 2FOXA 1HG0A 3EODA 4QYIB 4E30A 4E2YA 4MK4A 5AVYA 5I51A 3UTDA 5SZKB 1T8WA 1ZR4A 1K8ZB 2GSWA 2P9CA 3I5XA 2FEKA 2GM5A 3R9IA 2G9RA 5THXA 2A4MA 4YS6A 3IJEB 2E2WA 3IRUA 4PFSA 2WUEA 1WPRA 1NVUQ 2QTHA 2JBAB 3AM1A 1BN6A 1QHYA 2XIQA 3DHYA 1JDTA 5A4DA 5I4BA 1W0JD 5IMSA 1LSJA 1I32A 2VJLA 1K2VN 2BGJA 2X3UA 3FFBA 1Z7GA 3MRSA 4LNUA 3PPIA 4UEKA 4ZPXA 3SFVA 2H2HA 3TAXA 1EJ6A 4MP6A 2GF2A 1R15A 4IUYA 4FR2A 3TTUA 4EKGA 4EPTA 2RGWA 3DG9A 1RI4A 1EP2B 1WMAA 3HFGA 1LWNA 2P6NA 3PZRA 4YAOA 1H8HD 2WABA 2Y8EA 3T12A 5JY1A 2I2WA 2P6OA 2JAWA 4PFQA 1RHMA 3G8CA 2WSSA 1TZCA 2I91A 2CHGA 1PJCA 1RHJA 2TMGA 3IOBA 1WUKS 3O47A 4N3AA 1DEOA 4TMVA 2IOFA 4LJ8A 2IPNA 3ZE8A 1WB5A 2OAQ1 4HGZA 2FPGB 4YJ2F 1UJ4A 4DY4A 2FRVA 3HLYA 3WISA 1A9YA 4R0VA 1BMFD 2J87A 4V02A 2QAGC 2TS1A 2E4WA 1XA4A 4H7EA 5JAQA 5BR4A 4CWAA 5I7EA 1XZQA 2ZUDA 4GEKA 3LVFO 3R9KA 3QKWA 3VO8A 2BW0A 2CXQA 2XWPA 4MVJI 5EIOA 3ZNQA 3A6JA 3ELWA 2NAFA 2Q6OA 4UTOA 1RLIA 3Q3VA 1Z2PX 1LNSA 3TAUA 1PJ4A 1ORDA 3FNEA 3N2YA 1C4XA 3ZLUA 4ZYYA 3HKBA 4UCXA 3ROXA 4K6CA 1KTVA 1ZM3A 3AETA 3DBIA 3IUYA 3E0QA 3OM8A 3L6EA 4PONA 1DKNA 2AG1A 1A76A 3HCBA 1SXJC 1FRVA 3FOBA 1UPBA 4PN7A 4IM7A 2JDIA 4D4LA 4CU5A 1DINA 5CURA 4DSTA 2QUHA 2C84A 1NYTA 4RSGA 1LX6A 1Z15A 5LSAA 4NI5A 1TKAA 1JSZA 4JYPA 1TRHA 5K4AA 4CM9A 5CDSA 1G7CA 3MBIA 1CUCA 2AQHA 2I8LA 3MUEA 4LFCB 4C7OA 1Z33A 1IMJA 1QOZA 3LHIA 1HGXA 1KGSA 3EPHA 3OESA 2GHRA 3EUEA 4G1VA 2PUFA 4O8ZA 2BN4A 5DOVA 3Q3IA 3K70C 1PFWA 1V1MB 4F2HA 3CH4B 9LDBA 4TUYA 3EVAA 3AB7A 4QLAA 1J21A 5HDQA 4UAGA 1K8XB 4YDSA 1TFRA 2XKJE 3DDSA 2VF5X 5DGTA 2QW0X 3JW8A 3RFUA 4GGMX 2G6BA 3AL0C 1XVIA 1UBTS 1ECCA 3BX1A 3MB8A 1OR8A 1YV9A 1C7JA 2PZAA 1KVSA 3OEEA 4G5HA 3ZH2A 3IIMA 4FSHA 1XCJA 4KYTA 2Q9AA 3RNOA 2ZDGA 2C9OA 2P9TA 4F3NA 3PQFA 4H0NA 2CLKB 1M1NA 4YGXB 1XU9A 4D4HA 3KLMX 4Z51A 3QVUA 3C85A 1HTTA 3QBDA 3CU5A 4HDKA 4DQLA 2VNJA 2G5CA 4BB6A 1ECFA 1A9TA 2Z5VA 1JIIA 3IERA 4Q12A 4EJMA 4FGKA 4ZZIA 3CBQA 1NBME 3BAFA 5I01A 5JXWA 1T13A 3RVMA 3DE4X 4KMOA 3G0IA 3OO1A 2X5OA 1G8MA 4IRUB 4RVNA 2B9VA 2YIJA 4LZZA 4O4LA 5C8YF 2QUKA 3QLTA 4URXR 4YP6A 3P2JA 2NU6B 4I8IA 5TRTA 4KBYA 1HE5A 3LDUA 1D09A 1QHEA 4QXRA 2QX9A 4QM7A 1ZOIA 3D7KA 3MAAC 1X38A 4FOTA 1L5SA 2H4WA 2ZWIA 4N54A 1U5CA 2X9LA 4B0OA 1IXYA 1TYEB 2WAOA 1U0FA 3AEUB 2HMWA 4LZJA 3H97A 4OP3A 2G17A 4FMCF 3WJ2A 5C1DA 4KHPB 4RIEA 1K5PA 1KOFA 3DV9A 1XF1A 2G88A 2OWEA 3U0VA 4E70A 1ZD1A 4MROA 5HK8A 2QPLA 3MLAA 4WEQA 1NMEA 4WINA 2ARKA 3FWYA 1ODIA 2OM2A 1BCRB 2EQAA 4XQGA 3V48A 1RQRA 1YDGA 1PEAA 3UOAB 4POOA 2C3OA 3WYDA 3ASVA 3FMVA 3ZQ6A 1DAEA 2F59A 2FRDC 2PO7A 3KCNA 1NXWA 1JPVA 1NU6A 3PXXA 3R5HA 3D7RA 1FP1D 1NX6A 2Q5QA 1TYBE 1TMGE 1TQDA 4I1VA 2O2GA 4ZD6A 1E2GA 1FLVA 4HGRA 1SA0B 4Z9YA 4GMDA 3Q6NA 1F8UA 3OA2A 1FVXA 1TU3A 2XWQA 1UKVY 2H51A 2GZRA 2JIZA 2IXGA 2WLTA 1Z0AA 1DDOA 4HH0A 2R2AA 2P9ZA 1VP3A 1DRKA 3URMA 3K4HA 3EH2A 3UMVA 4C6RA 4R2JA 2FZKA 3TRHA 1N5KA 1EFLA 1ESMA 1QHGA 2BHTA 2J33A 1PD1A 4KODA 5GADl 1Z83A 2ISCA 2O20A 3EBOA 3OG9A 3OICA 4H15A 5LYJB 2ZBUA 4U2BA 4YROA 5BQPA 3QYFA 4NBVA 5FUXA 1COWD 4OHYA 2WTMA 1NYRA 1ZGZA 3I5MA 4RO0A 1P0PA 3K4PA 1DCMA 3ZIAD 4XYLA 2NP6A 2AR7A 4UREA 4Y2RA 4A8JA 1GGVA 3R6GA 4J9VA 3TFWA 3UPTA 2A7XA 2CLMB 4HS4A 5A2GA 3P9YA 2O5RA 2AWOA 2PFSA 5K9ZA 1E4EA 2O2XA 1I30A 3WWEA 3X1ZA 4F4UA 2H08A 4HK4A 5BRNA 3ZU2A 1FZTA 2XZOA 5AP9A 4BDSA 5JH7A 1IY9A 1VGVA 4LXQA 3HUEA 3V7FA 4CT5A 3T1YB 5T64A 1YJAA 1JQ5A 2OCGA 3GN2A 1QTQA 1T3GA 3ZD6A 2ADFA 3WO1A 4O2BB 5J43A 2WU3A 2GDJA 2C88A 2HMVA 3QHQA 4WOPA 1JXAA 2HBZA 2QL9A 2EIHA 3VTFA 2H31A 3AR6A 3OHSX 2QRVA 3C5VA 2XYGA 1W85A 5CLIA 1BEEA 2Y0EA 1P91A 2IYRA 4BX9A 1XSEA 4LRSB 2CJFA 1JEEA 1T8SA 2PMEA 3KR1A 2E5LB 2B99A 2DWCA 5ER9A 2F9FA 4XGIA 3SHQA 4OYRA 1JYEA 1BWQA 3ORQA 4P35A 5CM8B 5ARBA 2DERA 1EWYA 2EZ8A 3TAHA 1L8XA 2WW8A 1Y1LA 5I7WA 3I2YX 3G1UA 3CTPA 3KHSA 4BYMA 3PTAA 5REQA 1S9DA 1Q50A 4G1EB 3HH8A 3A1VA 4OIMA 2ZS8A 2ZXEA 1IXKA 3OT4A 1KY4A 2MSWA 1EE9A 1OF1A 4HDAA 1ZD3A 3AIMA 3ZUPA 4BKUA 4LBYA 1U2GA 3WHLA 3ICOA 5JQWA 3ADPA 2PH3A 3WQSB 5FLXA 2Q49A 4YMSA 4V1CI 3ZBQA 5IJWA 1OI4A 2NZ2A 3W1WA 3IP8A 4ZJPA 4Q6WA 5EZSA 1RZVA 2QM0A 2X7HA 5DCYA 1ILEA 3UHJA 1P7ZA 2TMDA 1G8GA 3LCUA 3LP5A 5KTPA 3E8MA 3EIOA 3MT0A 3UHAA 1UCFA 2VDNB 2Y9MB 3VC2A 1B14A 3L3BA 4BBZA 3NHJA 4DCVA 5KOIA 4H3SA 2YVUA 2QIPA 3NRCA 2ZEJA 3I2HA 1O6ZA 2X9VA 1AKYA 2OHFA 4OP1A 2QN1A 3I09A 1NKTA 3DFIA 4JASB 1H9CA 3PDUA 4GOKA 4AJNA 4IIJA 1UWLA 3A9WA 3P0EA 4BNDB 4QTZA 2GS9A 4CMIA 2XTAA 4G25A 2QNIA 1RD4A 2PH1A 3CVOA 5CK4A 5E6RB 4C07A 1VBMA 4OMUA 1V95A 3PXGA 2NQ8A 2O14A 5FYDA 3UKDA 1EM8B 4Y7DA 1EDZA 2OZLB 4QJ4A 4TX1A 3K9HA 5LLDA 3DNMA 3KUCA 2ZT8A 5FUWA 4A5SA 4YRBA 5IK2D 1E60A 4CL8A 1GEGA 2X5NA 2XAAA 3V8PA 4PANA 4EO4A 1SULA 5EQDA 2QD4A 3MMPA 3AVWA 4IFEA 4JBNA 2LUOA 1E98A 4LJ5A 1N77A 3GZNB 4XGKA 2I6UA 1Z5UA 1K8YB 5BNFA 6CHYA 1E0DA 1T6ZA 4BMYA 4PC3A 5HGXA 1P3Y1 2QT0A 1OAKA 4KEAA 4MUKA 1KAQA 5JARA 5L53A 4L4RA 3UJCA 4NFHA 3KHUA 5C8VA 2QD5A 4W5JA 1ZHHA 4QASA 4G3XA 1FSGA 2JLBA 3FLEA 4YQEA 2EERA 4YRDA 4OYHA 4YAUA 2Q4EA 3K2IA 3ZJ4A 3RSCA 2XOXA 3DZKA 4MKXA 4UUOA 4LF5B 2JEYA 4FFLA 4MLDA 2PSHA 4ZDIA 2PUJA 4IKOA 4K86A 5A1TA 3ZTTA 2YHBA 3GLHA 4UM8B 3O3CA 4FHCA 4E08A 3KIPA 1JYFA 4RTMA 4NG5A 5IBPA 1U8ZA 2YC2C 3VO2A 1DWPA 1QE0A 1V0JA 4CV3A 4QG3A 3V7UA 2H1HA 2XNCA 4F5EA 4P3NA 3GEBA 3BF7A 3I8XA 5CM2Z 2I65A 2FXVA 4O5AA 4X9XA 4CHGA 5I7RA 1E4VA 4ZVTA 2H18A 5FADA 5HZKA 4AY6A 3IPRA 4QU5A 4WNCA 1RM3A 1I24A 5G1PA 1L4NA 3E23A 1ISPA 3C1TA 4FN5A 3D02A 2FOLA 4JN6B 2HR1A 3K53A 1GP2A 4Q7LA 3EYWA 3RSFA 5JY6A 1WX1A 4RANA 4X71A 3G5AA 5E95A 3H2HA 4CM5A 2FSVC 2UUOA 4DYVA 3O4GA 4FI3F 4NK4A 4CODB 1WUJS 5FV7A 3QBTA 2FW6A 5E2IA 4HEA6 1XRRA 1LUAA 3FYUB 3HFJA 2CVPA 1ACLA 1W49A 4P2BA 1GARA 1RMQA 3OUUA 4HOYA 4GLLA 3SBOA 2IS4A 1TEVA 4HQNA 1R0BA 1WUYA 3LUJA 4MUAA 9ATCA 1HT3A 2JGNA 5B7NA 3KALA 4IFTA 3KSUA 2XNJA 1EK0A 2FPXA 1N0VC 4GOLD 5K3EA 2Y27A 5BN3A 3R4CA 3KZXA 4I4TF 1OX4A 1D2RA 1K27A 1TC1A 2HKIA 1PIWA 2AXEA 1TIKA 3OVMA 5L45A 1EVIA 1PWHA 6PFKA 5HIAA 5L3VA 1BS9A 2J48A 3DEKA 3M6MD 2WM3A 3KYJB 2WD8A 3P0IA 5DTQA 5IXSA 1MXFA 2D4HA 1L4LA 4GOJA 4GWLA 1VXRA 4D42A 1TEXA 4BRWA 3ORRA 5ER6A 1QR2A 3V8VA 1ABBA 2YN0A 1C3JA 3N8GA 3U19A 1KKMA 3H8WA 2QSYA 5ALVA 1UMDA 3G0BA 5I8ZA 2GUGA 2FYTA 5BN3B 2IELA 4KACA 2X5KO 3IVCA 1THGA 2WG2A 5E1OA 4N39A 1JG4A 3VFDA 1YVPA 3OQPA 1QWOA 2WA2A 2GK4A 1FNBA 3NT5A 4ND1A 4EA8A 4YLGA 1G60A 1R0XA 4GR5A 4YPFA 4ILKA 1KI8A 1LA2A 4HXEB 4KYVA 4TXHA 8ATCA 4ROSA 1SURA 3EOBI 3SZMA 4E12A 2DBQA 5IAKA 5JCJD 3CIFA 1XTVA 1F8XA 3A2LA 1LDNA 4HN4B 3QU7A 1LTKA 2JNWA 3DGFC 4GI5A 5TQ2A 3WDSA 3EPKA 3RUIA 2L18A 3TIVA 3I3SR 3NTLA 2NW6A 2MINB 4GPAA 2EKLA 2VHCA 4RXUA 4IIFA 3ZNOA 4UAVA 1OLSA 1OTYA 1SQSA 2NPOA 4S1NA 3PNYA 1QVWA 4LX8A 4MINA 4OHBA 1YMUA 3T3PB 3W3AH 4BLSA 3U3ZA 4BNJA 4BVHA 4GP6A 2AFHE 1E0SA 2QP9X 5JATA 2BYTA 4CEIA 2Q8QA 4R68A 3TXYA 3JASB 4GT1A 1MMFB 2PT5A 4EMBA 4W5OA 3RBXA 2A88A 3SC4A 2HRQA 2UZ1A 4PXSA 4R51A 3HA3A 3L7YA 1R6AA 1L3CA 3COWA 5GJVC 2L42A 2HJRA 2MHCA 3PEUA 3S7TA 2EWWA 3EGVA 3PR1A 5IF9A 4PYIA 2XBUA 2DUJA 3AX6A 3VR2D 1Y6FA 2R86A 1TO1E 1IYZA 2I7DA 1OAAA 3LZCA 2P9GA 5ICEA 1RM5A 2WSIA 3I5AA 2RGGA 4RBNA 3EDOA 4OBWA 3RS8A 5CA1B 1NT4A 3NYIA 1CRPA 5FJJA 1ETUA 2AD1A 4GNKA 1Y3AA 3EARA 3TZHA 1IDOA 2PH5A 2WUFA 3G0OA 4I9NA 5F4BA 2R48A 3RADC 5AI6A 5EEHA 4EUFA 3H84A 4IIYA 3ICQB 4AO8A 4J0DA 5EP3A 4ZC8A 1PTKA 1CVIA 5KVQA 5EKUA 2ZSUA 3E18A 3DB2A 4GMGA 3D4IA 3Q15C 1WBDA 3E1KA 1TXGA 3ILYA 3O5AA 5H83A 3VSDA 5FLYA 5EZYB 3TLCA 2IYZA 2EF0A 3FLAA 3NU1A 4UEOA 3I6BA 5BXYA 4B6GA 3Q8KA 4ECEA 2BONA 4Z7QB 4CKZA 1LLQA 2C04A 2C1EA 1VM6A 1M7HA 4N8DA 1MOQA 4B73A 4C7XA 1HY3A 3LP8A 2YRXA 1V5GA 4DJTA 3UMYA 4RU1A 2P75A 3NGLA 1JXMA 2HM7A 5EE9A 2RI0A 1V26A 1WE2A 2QAJA 3PEVA 1FYDA 1G4UR 3F6EX 4FQ8A 5F33A 3ZY4A 4DUPA 3NOOA 3DMRA 4EMSA 2E21A 5EXXA 2FW0A 1XTIA 4R8MA 2FG6C 2PMKA 3KJNA 2MYTA 1SEVA 4PG7A 2ZUTA 5EZYA 1PVDA 4LDNA 1KERA 4U7FA 1JU9A 3NM5A 4TTIA 4CFYA 3R0XA 1OREA 4RGBA 4CJXA 3TO5A 2D5AA 2WJ3A 5L40A 1DEXA 2BGRA 3PC6A 3HHPA 3P9SA 4RTJA 3IEPA 3VISA 1QE5A 1KYTA 4QGBA 4ZO6A 5DYIA 5TV2A 3OKFA 3WLTA 1TM1E 1XRSB 4JVMA 4MV4A 4REQA 3GT7A 4DDUA 1BX3A 1H8ED 1TM4E 3UH1A 2ZTVA 1JDUA 1ZNXA 5B6JA 5EZ5A 4OLAA 2QT1A 1HA3A 3H1GA 2B6HA 1K4KA 3M70A 4MA0A 4RK7A 2YY7A 3X2EA 1Z2EA 2HFJA 4FFVA 2O0HA 1YK0A 1LDEA 1EBFA 2KPOA 1PGQA 3UB3A 4D8UA 5I3CA 1HRDA 1KWKA 2ICAA 2VT2A 2WB4A 3OP4A 1LCIA 3NHRA 4L5BA 3UJ9A 3SYMA 4WW0A 1E77A 1K7EB 2FFBA 5HKBA 5K8IA 4LGYA 5K6RA 3FAKA 3FNGA 1KJZA 3KZNA 3PEEA 4Q4LA 1KEZA 1JMVA 1W4RA 3C74A 4Q5IA 2ZQYA 2ZS7A 1ORHA 2VR1A 4AWXA 4M2LA 3ZHVA 5B30A 3N8KA 1T3ZA 4TZ0A 4CLDA 3OJEA 4LJ9A 1XDBA 1Y4DE 3LH5A 3UGTA 4L6AA 4K9MA 5T3UA 3T3MB 1ZU5A 4X92A 5EWJB 5GP1A 1KEKA 1PAUA 4DZRA 2JFZA 1IAQA 2OXCA 1Q3TA 1C9JA 3TSZA 3WK6A 2GQ0A 5BNWA 2F3TA 3DMDA 4GBED 3PRYA 5EI5A 2W0MA 2NACA 1NMXA 2AI2A 2HHAA 2WFLB 3LC0A 4KMRA 2X1HA 4EFKA 4O4JB 2YS6A 1IBMB 5KSPA 3WGQA 1YA4A 3PC8A 1B6GA 1N36B 3HXQA 3OQOA 2R7AA 2W43A 3T9BA 2CW5A 1V6CA 2B3DA 3DCYA 3ISVA 1M1NB 3EZ7A 4QOEA 4HDMA 1HQKA 1NP7A 2GBPA 2YVAA 3JQ9C 1W4CA 5AW9A 5FJIA 3TCNA 4OHCA 4F4IA 3D6TB 4YASA 1CJVC 3AVUA 3RT9A 3IAUA 4KV9A 4URWR 5IUNC 4QKQA 3K8YA 3L8FA 2P9FA 1II0A 2AFIB 5FYQA 3DZDA 1E89A 3PT5A 4EG4A 3CSDA 2C5SA 1XALA 2CDNA 2HF8A 4GX0A 4EFNA 1HNWB 4HDSB 8ADHA 5IKEA 1MOPA 5CUQA 3IJ5A 1EWVA 2NU6A 5MN4A 1CDDA 3RTEA 1PZNA 3DE7X 1Q15A 1Z37A 5FWYB 1PGOA 1E18A 1RXVA 3IC5A 4HDMB 4CNQA 1CZRA 2C54A 5TF4A 1QLJA 3C8HA 5EIWA 4Y6RA 1V9CA 2VQ3A 4P7KA 4WOKA 3ZDRA 1BJKA 3AXSA 3RIHA 3RGGA 5A6VA 1Y8RA 2C5EA 5IG2A 4G0VA 1TK9A 1PDVA 4NP6A 1DZIA 1V48A 4BNXA 1XAHA 1VHQA 1UMCB 1P5ZB 4HDSA 3RWMB 1QIGA 3QPBA 1R5OA 2C7VA 2Q3LA 5CB6A 2HHHB 3BWDD 3U4QA 3WKEA 1JJ7A 2NU7B 1HK7A 2G77B 4L15A 2Y2UA 5FPSA 4B32A 4DMHA 2V7VA 1QRUA 3O7MA 4E2ZA 4J0JA 1MDFA 4IZIA 1BDJA 1ZITA 4JI0B 1T4DA 3DDCA 1ZH4A 2DU8A 4UHJA 4I3FA 4UMFA 1AURA 1PWZA 2EJVA 4GRDA 5C4GB 3WLAA 3PEYA 4OM7A 2PLRA 2FA9A 3OETA 1YQGA 1HI9A 2P0YA 4H4CA 3DA8A 4BYGA 3DTVB 3A36A 2VDLB 1DC7A 1W19A 1HYEA 2YJ6A 3W7VA 5C9ZA 3GYBA 3F6YA 3P20A 3QJYA 3A1CA 2Z5FA 1W2HA 1XDSA 2XCOA 4IHJB 3F7NA 5IMBA 4CM4B 4HQ6A 1U9IA 2DQKA 2NTEA 4TVKA 1D2NA 3MGCA 4B8YA 2QZSA 4HZUB 5C5IA 4HX5A 1ONOA 1TKRA 1PEDA 2FU5C 2JW5A 3D2CA 1IM8A 3GT4A 4HB0A 4WEOA 3ZJYA 4CZ2A 4DMGA 3HU5A 4ERNA 2SBTA 3OMXA 4YEDA 2RGAA 3QI7A 1QZXA 3ETCA 2VRCA 1R50A 3KT6A 1VI6A 3KT0A 5DTIA 3E61A 3WLJA 4GG1A 2ZRGA 3HRHA 1MZPA 4EI8A 2QN2A 3MVEA 3QMWA 2ZAOA 4KLZA 1XP8A 4Y2VA 2H8KA 3NB0A 4KFUA 1CZNA 1EH5A 3D0KA 1JPNA 4U7JA 2WU0A 4HDNB 4J7CA 4LDAA 5BW4A 3AUUA 4GMKA 1VLLA 2Z6UA 1TCVA 2QN8A 4G85A 2CXNA 3D0OA 4KJZA 1QG0A 4UNIA 3GNSA 1RYNA 2ZPAA 1I2ZA 1OLUA 2R62A 5CRIA 2FH5B 2VK1A 1YZUA 2C82A 4Q9NA 5AI0A 1OPRA 1SHKA 4Y2SA 3M4ZA 1JXQA 5CA0B 2OAP1 3HNRA 1FMLA 1WM1A 3JQEA 1KR5A 3QEJA 2NUTA 4XD7D 5H4GA 1WXXA 4RLQA 1Q6ZA 4PVCA 4D4JA 4D9BA 4JB3A 1EVEA 2MYUA 1FCJA 4D26A 3A0UA 4CM9D 1EYZA 2C2HA 1NVTA 3QQ5A 4U6SA 3RARA 5JAUA 2CF5A 5K0BA 1BYIA 1UDRA 1ZWLA 4YMLA 1KI1A 1H3NA 2VJAA 4F3YA 2QORA 3G8BA 2NTYC 3Q8MA 821PA 1EVLA 2H4JA 3C3JA 1GPJA 4KU4A 1SBIA 2IYNA 3M9LA 3WSVA 4Q47A 4ESVA 1ODFA 1CQIA 1XCBA 4ND2A 5DHUA 2BZ1A 1QHXA 2PZ8A 4GP9A 4J03A 2VJQA 3DMGA 1KK2A 2ZIUB 1E63A 2QY9A 3NX4A 3TLXA 3Q3HA 2NUTB 1E1MA 3IP3A 3ZHCA 1ODLA 1XNHA 4PF1A 3EG9A 4ZA2A 3WRVA 4BO1A 1E62A 3U7JA 4E6EA 4MR9B 3PR3A 1JLLB 1O8CA 2C8KA 2GASA 4HEJA 3MIIA 4L0CA 5FPHA 5GMOA 3VI3B 3NHFA 3MUNA 5AI8A 3ZTWA 5FX2A 2M6RA 2SICE 4MRMB 3EVCA 4CNBA 2VYVA 1ZVKA 2VK2A 4POAA 3URKA 4MHTA 1SUIA 2RGUA 3BSWA 5KTTA 1L7PA 4ZT6A 1P9LA 3MMSA 3FLMA 3KJGA 2AJDA 3KKNA 1GV0A 2X2OA 1CQIB 2YHAA 3E8SA 3BB1A 4II2A 4PHGA 1L1QA 1ZMXA 4ZQFA 2RIPA 1JDPA 3WFIA 1H66A 3JZMA 4JB0A 1J5EB 1Z4PX 3IMCA 2WYOA 3ORFA 3PUWA 2DXIA 3H2ZA 4QYIA 1DKPA 1FOEB 5DSZA 2VZ0A 1EDDA 4FK8A 1RLTA 4FE7A 1ZN7A 3HXLA 2HIHA 5JO0A 3ASUA 4NZNA 4F06A 4QARA 2QUJA 2YVQA 4C3OB 5G0TA 2JBAA 2IYAA 2IHBA 3PLNA 4DM7A 1EJBA 3C3PA 4QXMA 3QE3A 4CKWA 2W2KB 1GPMA 3FCSB 3GUCA 3CTMA 3NYWA 4UAJA 1UWVA 2GVZC 2ZRQA 3K16A 1H0SA 2V6JA 3O73A 4BMPB 2QN7A 4QUJA 3RSQA 2Q0XA 5C18A 1ZO8A 3BXEA 4E31A 4EHJA 3VR2A 1Y4SA 2GSDA 5LP6F 2PVCA 2FRDA 2POCA 3Q7EA 2AUMA 2YZNA 4U7HA 3H8VA 5AOCA 1GRNA 3HDTA 3CPJB 1A7AA 1X80B 2CXUA 2R60A 4WECA 5DFAA 5IP5A 3V1MA 4BZXA 3IP1A 4EJFA 2VUTA 4ZCRA 2CE2X 3W34A 1IOZA 3TRIA 4EX7A 4F96A 4HPJB 3GLHE 3TLZA 1IY0A 1J20A 4O2RA 4RJLA 2EL9A 3FVVA 1NQOA 2Y76A 2YKGA 4DRYA 3OA0A 1HQDA 1KOJA 1M2NA 2FK7A 2JFNA 3FN4A 3OURA 1UWKA 4L8VA 1LNQA 4KPYA 5LQJA 3CLHA 2K2QB 1NRXA 4H7HA 2VHVA 3TOVA 2O8BA 1M8JA 4PG4A 2DT5A 1CERA 3DL4A 1KJQA 3SBXA 2FE4A 1QJ4A 1QHIA 1HE1C 3AR4A 4W4TA 1I94B 4A8JC 1GU7A 4CLOB 1CDOA 3VOTA 1CPYA 5ELXA 5FLEX 3C15C 2W58A 2X8LA 3QI2A 4NE2A 3CCCA 2F3SA 1QX3A 4KE7A 3IEIA 2W6ZA 1GO2A 1QV7A 2PRJA 2ZRNA 4RABA 1HE2A 4OL0A 3UJNA 3JYOA 1XMVA 1C9MA 4MIEA 4Q4AB 2O2IA 1D4ZA 1ELOA 1FLDA 1W5SA 3KYIB 1LVUA 2G5GX 3P5SA 5EKSA 2P4UA 1V1RA 2ZUBA 3S2ZA 4Q4HA 3MLEA 4G26A 2Q5LA 2ZRDA 4G4JA 2GH1A 2HHLA 3GOHA 5HS4A 1VRWA 5BSWA 1E58A 1Z4OA 4FLFA 4K88A 2ZE8A 2C0CA 2IHKA 1KMCA 3BQ9A 1M6YA 3H05A 3JWGA 4UZEA 4PV7A 3TVYA 2V8OA 5BOSA 3CUVA 1B2LA 2UVPA 1DT5A 3C6KA 3N0RA 4FLEA 5HF8A 3R7BA 3EASA 3RU9A 4ZYWA 2GJSA 5KU7A 4BCBA 2VQSA 3QOWA 4TMFA 2RH4A 2CL7X 1KI6A 3JAKB 4BEJA 3BPSA 1MQSA 3HWWA 4E4YA 4ZN6A 5BQOA 2BSXA 3MAJA 4N7RA 2K2WA 4D45A 1NC1A 1F7UA 1OWPA 1CS4C 2IV3A 1TLLA 3BORA 4BVEA 2ZSKA 3NDPA 3G0HA 3IVAA 4L73A 1J9GA 1RYFA 3TH5A 1ULZA 1TNDA 1Z22A 1T2FA 2NYRA 4FX5A 3U26A 1GA4A 3ZI7A 4DA4A 2YXLA 3NBAA 1KO4A 4PYMA 1GDHA 2NZXA 2RHDA 2VK4A 3EXG1 3I52A 4JL6A 4OK5A 2I76A 4RW0A 4P3YA 3EZGA 4L74A 2BBOA 4ZVLA 4EY6A 5C1PA 1EVJA 2G71A 1V9LA 1RYYA 4UJ3A 5FBZA 4ZYUA 1TM2A 2V9PA 3A3NA 1G4HA 1M66A 4DEVA 5KPDA 3LTNC 1NGSA 1Y5LA 1ICIA 3VI4B 2LE0A 1RXUA 2XSZD 4AP6A 3OJCA 4DWWA 2VQEB 4TYWA 3L6CA 2CHFA 4M1WA 3BT7A 4JJ4A 1G2QA 1SBZA 3ZE7A 1RZRD 1C0LA 4WRRA 1AUPA 3GLQA 3TKAA 4MB0A 1FFYA 1LGYA 3KSZO 3EC7A 1JIXA 3O3OB 2OK7A 5DN9A 4MB2A 3T5MA 1II8B 4NRDA 5EMNA 1WQ1R 1L5QA 1OXBB 2F4VB 3NIGB 2IY9A 3I28A 1OTXA 3PWZA 2WDPA 3R9WA 5JSKA 2A1UA 2ZTUA 1FNMA 3O2NA 2WBLC 4NCKA 5IHXA 4E15A 2C8LA 4XX1A 4EB6A 5LMNB 3IIKA 3PGA1 3T7DA 2KW5A 1LV8A 2PXHA 2ACEA 4QVGA 2ENUA 1RWMA 1NBEA 2RARA 3R3XA 5HCUA 4EWLA 5BURA 1FUYB 2JJMA 2YN4A 3PA6A 2G1UA 3DHEA 1AV6A 2IQIA 4LYFA 2WJAA 3EN0A 3NEPX 3T5DA 3GMTA 2XBLA 4GKVA 4MHOA 1EKXA 4HGPA 3U0BA 3UAXA 2PJZA 4ZRNA 2FFJA 1QG6A 4BNHA 3HCEA 4WZAE 5ENZA 1CCWA 4ETMA 2QPAA 3PGVA 5EJ2A 4BFWA 1ZK4A 3P9RA 3C3CA 5F21A 2NSJA 3W2IA 4XI9A 2XRMA 1CIJA 2WYIA 3P19A 5LDGA 2JZOA 3WMWA 4PGMA 4WPGA 1VIAA 3ITEA 3AM3A 3UFXB 2QTVA 2Z2ZA 5IKOA 3OU6A 1W36B 5AKKA 3GYGA 3ZHXA 2WIFA 1DNPA 4JODA 3OE4A 4W8GA 1SUSA 3TQIA 2GA9A 2W6CX 3DE3X 3NGMA 3FYUA 3P5BA 3TOCA 3HCWA 4JEMA 5TT1A 1L3BA 5T4FA 4CL3A 2PX5A 3GGCA 2DQYA 5I9NA 3PQEA 4LYJA 4MPJA 3EXIA 4Q24A 4W5RA 2ZKLA 5KTRA 4GDMA 1P7PA 4IV0A 1QO0A 3WWCA 4RD0A 2GF0A 3VH2A 1SK8A 4ZKDA 5DJ5A 2AEJA 5I4CA 1C7EA 1U9CA 5F23A 1WPXA 4RC9A 3LX4A 3Q6IA 4WLVA 4V3BA 3M5DA 1W85B 2HLDA 1YQXA 4QL3A 3FNQA 3RS3A 2J59A 4X8LA 2ZIZA 4DCTA 3W5DA 1DEAA 3JWPA 5AVXA 1Z6XA 1PSDA 1CB7A 1FLNA 5FEUA 1RRFA 5KYWA 4LUCA 2B7CA 4G36A 4PYOA 1R4NA 4FNOA 4P92A 2G06A 3VYTB 4KR2A 1RC1A 1JFVA 2HCTA 4U2FA 2E4UA 2E7ZA 5CDHA 4OQEA 4WESB 1GL7A 3DWEX 3I4FA 3JALA 2EFDB 3PC4A 3QLJA 1MQ9A 4TGLA 3TD9A 3B1ZA 3LY5A 4GOXA 4O08A 5D6NA 3M33A 4CTNA 2CFSA 5GQSA 1VFPA 4DVJA 2Q9CA 3GJ7A 3H9JA 3L8DA 3N8HA 4P38A 3G3EA 3N39C 3WGHA 4MGZR 2P9HA 2GEVA 4C03A 1V7CA 2XYPA 1CZLA 1Z68A 1RJDA 3LOUA 3JCZA 1ONSA 1SC1A 2XLCA 4IIJF 2YJNA 4YPVA 4KTVE 4MYCA 4XASA 1XLUA 1XQ9A 2VHZA 4TXMA 5KQMA 3UKOA 2R0QC 3SKXA 1NW4A 5B7PA 1YZGA 4Q9AA 3GX1A 2PE5A 4TT3D 1T5TA 2OB1A 2ZG6A 1C30B 2NN3C 5AJUA 4YT8A 3GQBA 3RG8A 3T8YA 2VTDA 4B8Z