3LIPA

Open conformation of pseudomonas cepacia lipase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIACYL-GLYCEROL-HYDROLASE
publication title The open conformation of a Pseudomonas lipase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 122
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lipA00
2ZVDA 1CQZA 4W63A 4LXHA 3IUJA 2R8BA 2XMZA 2ROQA 4Y2PA 4LKOA 4ETWA 5IVKA 4Y2TA 4X6XA 2RHWA 3VDXA 1THTA 3LP5A 4UBIA 3GFFA 2OXEA 4P08A 4NS4A 1LZKA 1Q84A 2XDWA 4OYLA 5CT6A 4C4YA 1HBJA 4HXGA 3HRHA 3WKDA 4Y2RA 3IB3A 4WFJA 4ARAA 3FYUB 3GELA 4TVKA 5AJHA 1ZIYA 3RKSA 3WWCA 3G0GA 5EHNA 3O95A 1MT3A 5LZ8A 1T2NA 3QMWA 2JGMA 3DCNA 3I2KA 1N5RA 5EIAA 3PUIA 3H17A 3I2GA 1XZJA 4TPKA 4NZZA 1K4YA 1QJ4A 3SC2A 2C7BA 4GLBA 1QIEA 2WHPB 3PFBA 4OU5A 3DJYA 1N8SA 4TGLA 1X2BA 3DOIA 4BYMA 4OCZA 4FFVA 1IUPA 1QIKA 2DQYA 2ACEA 2PM8A 5ALFA 4WFIA 1YS2X 2UZ0A 3R3XA 5FOQA 3JYHA 5ALNA 1BN6A 3DQZA 3WIOA 2XI4A 2XUJA 4IQ4A 3RLIA 2XQGA 1ZI9A 1GXSA 2PVSA 4U2GA 3W04A 4UHDA 1VXOA 1H2WA 5HQ3B 5AM4A 4EHBA 4OSEA 2XUIA 5AM3A 1XQYA 4X97A 2CJPA 4BVKA 3DLTA 1Y7IA 4X94A 4N5IX 3S2ZA 2PU7A 1EK1A 1WOMA 3G9XA 2WUGA 3A2MA 1DWQA 4X85A 4BVLA 2ZSIA 1XZBA 4X3CA 4JYPA 4YX9A 4QA9A 1MX9A 2PUJA 2ZYHA 3IIIA 1XRNA 2WILA 4FTWA 5AICA 4BVJA 1IUOA 3ICVA 3ZLTA 4AMZA 1VLQA 3WLAA 3WWDA 1WB6A 1C7IA 6YASA 4UBMA 1Q0ZA 4YK7A 2WHRA 2CZQA 4OYYA 4H7JA 4JNCA 5FPQA 4G4JA 4PNZA 1X70A 1CUGA 5AOAA 3R3ZA 1CV2A 1QONA 2HA7A 5CW2A 3ZV7A 4Q05A 3U1TA 4BCDA 4B81A 4HRXA 2Y1KA 4DGQA 4E46A 2PL5A 4H7DA 1QO9A 3WWOA 1QZ3A 3CCCA 3W9BA 2WFZA 2PSFA 4BATA 1OCEA 5DYWA 3M3DA 4GXNA 2O2IA 2CUTA 4M0FA 3V48A 3AZOA 1EK2A 1MX1A 4FFWA 4DMKA 2QJWA 1XZKA 2W6CX 2EDAA 5HF9A 5SYNA 5JATA 3KWFA 4QWMA 3EF3A 2B20A 4B80A 3DL4A 2HDWA 2RGUA 3BDIA 5CBKA 3CCBA 5HKAA 5A2GA 4ZWNA 4Q3OA 1U4NA 4K6KA 5AI5A 3JWEA 3WL6A 1MAHA 2WM2A 5ALKA 2V9ZA 4G4IA 3BWXA 2AJ8A 4L0CA 4DM7A 5EHQA 4HS9A 4C6HA 2AJDA 1ACJA 2QUBA 1P0IA 1KEZA 1BS9A 5T4BA 1VE6A 5ALUA 5ALTA 1AZWA 1N1MA 3V1NA 3ED1A 1LLFA 1XRQA 5JAUA 1IUNA 3QH4A 1L7QA 4J0DA 3EBLA 5DTJA 2AJCA 2PSHA 4QLAA 1LGYA 4DLNA 1W6RA 3IURA 1JJBA 2JGFA 3AJAA 1QE3A 3BF7A 1E89A 1UOPA 4YPVA 4Z49A 2HA4A 4ZI5A 2BAGA 4Q82A 1CUIA 5AI0A 1CUCA 4G8BA 2HA0A 3A6ZA 3UUFA 1F0NA 3C8HA 4DSZA 5F4ZA 4U2FA 3VJKA 3V1MA 4NVRA 2W22A 1XZDA 1W52X 4H35A 5AKEA 5AKYA 5BOVA 1YSCA 4QDXA 3WK7A 5AH0A 2ZJFA 1T4MA 1E66A 1D07A 4U2CA 4FNGA 1DQYA 5FKJA 2OG1A 1WB4A 4C89A 1ZI6A 3LCRA 1R88A 3CXUA 1TCCA 3BIWA 3HXKA 3WIBA 3PF9A 5LZ2A 2OLEA 2GYVA 2WFLA 3VVMA 2HA5A 3LIIA 3D0KA 2OAEA 4AX4A 3IBTA 4N5HX 4LXGA 3RM3A 5JAHA 4D9JA 4GI1A 2ZYSA 2GBFA 2XMCA 5DWDA 4DNQA 1EB8A 5JD6A 3LIPA 4KAJA 3L1JA 4INZA 4H7KA 2Z5GA 1SFRA 3WWEA 4CG2A 1FFBA 1AGYA 5AOBA 4J0JA 3AUKA 1IZ7A 1CRLA 4OU4A 5JD4A 3WK5A 4G5XA 4OPMA 3H1AA 4J03A 1BRTA 3KSRA 5IKXA 2WG0A 2QVBA 4HZGA 3WL8A 1JJFA 3E1GA 5CT4A 1G66A 5FV4A 5FXMA 4FBLA 2R11A 1QIHA 1FSSA 3B5EA 3P2MA 2WUFA 3F97A 4FOLA 5KWJA 1XLUA 4FLMA 4FWBA 1ODSA 1UK6A 5AI8A 4H0CA 1H2ZA 3R41A 3WJ1A 1CPYA 1ETHA 3C70A 1EB9A 1W4LA 1E8DA 2WG1A 4Y2XA 5AOCA 3S8YA 1GPKA 2XT0A 4XJVA 1RWQA 3O4HA 3E0XA 3WYDA 2XQFA 4IH1A 1AMNA 3ILSA 1VKHA 5HFNA 4XX1A 3STTA 2XMDA 3AIKA 1DX4A 3IUNA 3UMJA 5I9IA 3N2ZB 4MQMA 3TRDA 1CR6A 1WB5A 2WIFA 3E3AA 3F67A 4FDMA 5ALYA 1BN7A 4B0PA 2QTBA 4DMHA 2EDCA 3AZPA 1BU8A 2XUDA 1TRHA 2IX9A 2WFMA 3DOHA 3IDAA 4X92A 3B3QA 4X00A 3H2IA 5K3DA 3QPCA 4DYHA 5AIAA 1CUEA 4KE9A 5DNUA 1ZD3A 2HFJA 4UPDA 3FYUA 4NMWA 2HU8A 3R3YA 2JGEA 4KE6A 2ZYIA 1R3DA 2WUEA 4EUSA 4Y7DA 2HA6A 2C5FA 3SWWA 1XQXA 5JIBA 1DTEA 1E5TA 2XUQA 5HF6A 1ZIXA 4OB7A 3IVMA 3D2AA 5AHXA 5CMLA 2DHEA 1XZCA 2WKWA 4RPCA 4ZRDA 2XLBA 1I6WA 5ALDA 2YH2A 2WHPA 5AKZA 5JASA 1GZ7A 1S8OA 5J3JA 2XMGA 1UFOA 1EVEA 3FLEA 3I1IA 3FOBA 3ICWA 1YAJA 3Q0TA 1J2EA 5CT8A 3QM1A 1YCDA 3AFIA 4H7FA 1MX5A 3O4IA 5H3HA 3G8YA 3PUHA 1K8QA 1QGED 5ALLA 3RK4A 2XE4A 2BGNA 2WIKA 2FJ0A 2NW6A 3L1IA 3DL7A 1EDBA 2GZRA 5IH7A 4XWGA 3NUZA 4UBJA 3D59A 5EHXA 3VJLA 4CFSA 1XRPA 4UBOA 1FFAA 5HQ3A 1WCYA 3STWA 2EEPA 5JAPA 2G5TA 2CKMA 3I28A 1GQRA 4KRYA 1CUZA 1GPNA 1A8UA 2VJAA 1DU4A 3WZMA 3AIOA 3TJMA 2I3DA 2OQIA 5CURA 1WPRA 1UOOA 1DQZA 1Q83A 3B12A 3FYTA 2AXEA 2LIPA 2QS9A 4EY8A 2ACKA 3FAKA 5D3ZA 5EI5A 5AKXA 1ACLA 5SYMA 4W9RA 4J0HA 4WJLA 1F8UA 3I2HA 4HRYA 1DT3A 4U2DA 4B82A 2VQ6A 2BUCA 1MJ5A 2HFKA 1XQVA 4UBKA 1EXWA 1C7JA 5FRDA 1SC9A 1YASA 1Z68A 4E14A 4KE7A 2B61A 4B7ZA 4KAAA 3C43A 4B85A 1HPLA 4BP8A 2G63A 3NGMA 4U2BA 1L7RA 2I3ZA 4ZREA 1GPLA 1LBSA 3HC7A 4PW0A 1H2YA 4UFNA 4MWTA 4FMPA 4H7EA 1ZGBA 1ORVA 1W1IA 5ALWA 2Y2UA 4QEKA 4HTAA 4P9NA 3STYA 3GZJA 1B41A 3QYJA 1GT6A 2CB9A 3R0VA 1AUOA 3VXKA 4BC0A 1VJ5A 1YR2A 1ZD2P 4CG1A 1XFDA 2RIPA 1QLWA 1EHYA 1K63A 1VOTA 4EB0A 1AQLA 5LZ4A 1UKBA 1LPBB 1ODTC 4DNOA 4BCBA 2XUKA 5AI9A 3R3UA 4M0EA 1XRMA 4X93A 4J0GA 4O08A 1AX9A 4ZXFA 1VA5A 3RARA 2V96A 2E3JA 4G8DA 1CUVA 2JEZA 1TKRA 5HF5A 3GUUA 2QRUA 3K2IA 1IMJA 5A62A 5A6VA 4W1PA 2CMFA 2BFNA 4N8EA 2ES4A 4W1SA 4BZWA 2PUHA 2O2HA 4RNCA 4BBZA 3BDVA 2VAXA 4FLFA 2DR0A 4JYMA 1XKLA 3C5WP 3PDCA 4BE9A 3FLBA 3K6KA 5ALSA 5FPPA 3F9CA 3EQ7A 2WIGA 2WIDA 3FBWA 4DTCA 3WQHA 2HADA 3PICA 1ISPA 3WK4A 5JZ9A 3M82A 5JAOA 4UHEA 5CT9A 5D6OA 3H0CA 2WTNA 1L7AA 3CN9A 5K3AA 3SK0A 1BROA 3LLCA 3FSGD 4G9GA 1XZEA 3H19A 1EX9A 1GGVA 2Y6VA 4H18A 3ZI7A 4BB0A 3DNMA 3I1YA 1VXRA 2I78A 1E8MA 3BXPA 2J3DA 4CCWA 1LZLA 1F0PA 4RE6A 2ZJ7A 3ESAA 2G5PA 1PV1A 4J7AA 2DFPA 4PF1A 4A16A 4GHWA 5JZBA 1GKLA 5FDFA 3O9MA 1CUFA 4CCYB 2VJBA 4EY5A 3MUNA 3G0DA 5E4YA 1XZIA 3R3VA 5HKBA 1YAHA 1LPMA 3H18A 4PQEA 3C6YA 2QKYA 3H2JA 2ZSHA 1ORWA 3C45A 4F21A 3IUQA 4F0JA 3I6ZA 1XLVA 5E4TA 3WZLA 4X71A 4LXIA 3WYNA 2BKLA 1ZD5A 3OPMA 2WQZA 5LZ9A 2P8SA 3QITA 4J0IA 2HRRA 3WKCA 1CVLA 2HRQA 1ZJ5A 3MGAA 3ANSA 4WY8A 2OGTA 3I2JA 4IHAA 5K3FB 1KU0A 4K6HA 4XIIA 1EINA 2QXUA 5ALXA 3IUMA 1TAHA 4K5QA 1CUYA 1KU6A 4B84A 2H1IA 1VZ2A 3I2FA 4HXEB 2GYWA 3KDAA 2Z8ZA 3D2CA 3OURA 3D7RA 1WPXA 4DNFA 1YS1X 1MNQA 1EDDA 1XRRA 2BJHA 2OCGA 5I8PA 1R9MA 1J07A 4ZGBA 3WA7A 4Q1VA 4K2AA 4OUKX 3N0TA 1LPOA 4WY5A 1K5PA 1RP1A 1LBTA 1EI9A 1CUUA 4BTVA 1O6FA 2DSNA 4W1RA 1GQSA 1N5MA 2RHTA 5A7GA 2ONCA 3D3NA 4UHHA 5DYYA 5C8XA 3HACA 5K3BA 2VA9A 5ALHA 1QTRA 2WSLA 4CI9A 5C8ZA 4JUIA 4Y2UA 5CT5A 4X91A 1P0MA 1U2EA 3FWHA 4L72A 5AKLA 3U0VA 2H7CA 3QPDA 4KYVA 1QIDA 2WU4A 3C8DA 3JW8A 4KR0A 5JZSA 3O9VA 3OG9A 4OB6A 3PE6A 1LPSA 1TIBA 4LYEA 4Y2YA 5AIBA 2Y6UA 4FBMA 2O7RA 2ZYRA 5ALIA 1TCAA 1WM1A 1W76A 2ZJ6A 2XMBA 3DYIA 4G4GA 5KWIA 3VKFA 7YASA 5I7UA 4EZIA 2BGRA 2QT9A 5JANA 1QIFA 3Q8WA 1AC5A 4P92A 2QXTA 1DWOA 1UXOA 3O0DA 5LZ5A 2XQJA 3WI7A 1YB7A 3M81A 5ALMA 2OGZA 1DWPA 3F98A 2WUDA 3STUA 4ZV7A 1R1DA 2OAGA 2B4KA 2VSQA 1AURA 2J4FA 4G8CA 4MEAA 2VT6A 5ALPA 1MU0A 1VA4A 2QM0A 1CQWA 3R40A 2QR5A 4PV7A 4X6YA 4UBNA 2X8BA 1CUHA 5FLKA 5AP9A 1WHTA 4S0XA 5HZGA 2RI6A 4FLEA 5ALEA 3CN7A 3WKBA 4B6GA 5CH3A 1CUJA 2VF2A 4GECA 3WKEA 2JIDA 4Q3KA 2WJ4A 1DX6A 2WJ3A 4I19A 5LLSA 4F60A 4GWLA 2GBGA 2PU5A 1G5FA 4QNNA 3NOXA 1VZ3A 3BE8A 1SCIA 1QIIA 3X3HA 1BCSA 2WJ6A 3PI6A 4AB1A 3HI4A 3TGLA 3STXA 5DTIA 5AK3A 2HIHA 3KD2A 2C5GA 3OTQA 1LPAB 3T52A 4CIBA 1B6GA 1XQWA 1R9NA 3C6ZA 4W1QA 4QDZA 3FLAA 4GBGA 1G4HA 5C7YA 4PSCA 1MPXA 4BTLA 1G42A 3HYSA 5T4EA 1OILA 3WKAA 5HFAA 1CUAA 3HABA 3QMVA 5KREA 3D5EA 2GYUA 3O4GA 1CUSA 1JT2A 3MVEA 3QPAA 4UUQA 3VISA 3PFCA 5DNWA 4M0MA 4X7BA 3GBSA 3T4UA 2HM7A 4P93A 3PF8A 4MJ3A 4C87A 1UWCA 3FCXA 3QVMA 4B0OA 2V98A 4V2IA 2DCMA 2WHQA 1XZHA 3BL8A 3I6MA 2PKYX 3R3WA 1H23A 4E15A 3EIOA 4GDMA 2VJCA 2PX6A 4I4CA 1EVQA 3WK8A 2GBCA 1JKMA 1UK7A 3A2NA 4UHBA 3LS2A 3AILA 2RONA 4UHFA 5DJ5A 3DYVA 2Z3WA 4UHCA 3QMMA 5LP1A 2JGIA 4Y2QA 1NU8A 5ALGA 1U8EA 2CBGA 5ALZA 1EDEA 1EH5A 2XUGA 4DMFA 4H7IA 5LZ7A 2RAUA 1JI3A 2JEYA 2Q0XA 2OPHA 4GEGA 4PSDA 5K5EA 1UK9A 4EY6A 4Y9SA 2J4CA 4OB8A 1JMKC 4C01A 2OCIA 1F6WA 2QOEA 2XMQA 5AKHA 4BZZA 4I3FA 1CFJA 1DINA 4ARBA 4C88A 5CXXA 4QDUA 4LIPD 1PFQA 2XUFA 5CXUA 1MTZA 5K3EA 3G0CA 2QZPA 1FFCA 4N8SA 1YB6A 2J3QA 1XLWA 5ALQA 2FJPA 2OCLA 2JF0A 1LNSA 3ESDA 3F96A 2DHCA 2HA3A 1XZGA 2DHDA 2JGKA 5EGNA 3W9UA 4A23A 4XVCA 3I2IA 3V1KA 1UZAA 3QZUA 2WTMA 2C58A 5HCUA 4BAUA 2BUAA 3IULA 3WK9A 2Z3ZA 1GKKA 3FCYA 2OQVA 4Q34A 3ESBA 5KBYA 1VE7A 4HXFB 4MEBA 4AZ0A 1UT6A 1JU3A 3QBJA 3VJMA 4AO6A 4BDTA 2XMSA 5AM1A 2C4HA 1HL7A 4EA6A 3DEAA 3FYUC 4WDRA 1MAAA 4BAZA 1XZAA 4U2EA 2XUOA 3FSGA 2ORYA 1RYYA 1HQDA 4BC1A 5AKJA 1P0QA 1EA5A 1HDEA 5C81A 5DLPA 5JD5A 1UOQA 5K3CA 3A2LA 3OOSA 1ODCA 1USWA 5T4FA 1M33A 5AK6A 2XUPA 4CCYA 3BF8A 5IVHA 4AO8A 3FVRA 4H7HA 3W05A 4MYSA 3WK6A 3C6XA 2GZSA 4A5SA 5AK5A 2VJDA 3DS8A 2D5LA 1JJIA 4KAFA 3ZWQA 1FJ2A 5JADA 4KEAA 2YASA 3G0IA 4L3WA 4IH4A 4L9AA 4OD0A 5E4JA 5IVIA 3ANTA 1SCKA 4X90A 4RGYA 5K3FA 2XMRA 4E11A 5LKRA 1QTIA 4B83A 3H1BA 1YA4A 1K6EA 4PO3X 5AM5A 3OC0A 5E2IA 4Y2VA 1THGA 4K6GA 5HF8A 3EQ9A 2YXPX 4WCVA 3HSSA 3GROA 1C4XA 1XZMA 3OM8A 1P0PA 2Z8XA 3KWJA 1XZLA 1HKHA 3W2TA 5AK4A 3E4DA 5EFZA 4QZVA 5YASA 2O7VA 4WFKA 1OXMA 5LYYA 3ESCA 1IZ8A 1CUBA 3WJ2A 2X76A 4WDQA 5A7HA 2B9VA 3H04A 4EY7A 4BDSA 5AM2A 2XB6A 2VEOA 4QWWA 5ALVA 3G9ZA 2WG2A 1YA8A 4QDOA 2PBLA 4KACA 2V97A 3G02A 2JBWA 5BWCA 5JARA 4FKBA 2VATA 3BJRA 3EQ8A 2PSJA 4Q3LA 5ALOA 4AMYA 1NX9A 2X5XA 3WA6A 5LIPA 5EHZA 2JGJA 4BRZA 5EIHA 1NU6A 2H7XA 4AN1A 4ITVA 5ESRA 4QDTA 2VTVA 4DSAA 2VT7A 5AKKA 4LYDA 4FHZA 3G0BA 5DNVA 2HHAA 2O2GA 4CG3A 4MWSA 1ZICA 2PPLA 4RE5A 3M83A 3A70A 3GA7A 5JYCA 4QLOA 3V9AA 1MO2A 3I6YA 5ISMA 1QIJA 3D4LA 2IIVA 1CLEA 2WU3A 4KE8A 4BE4A 2WLSA 4J3JA 1H22A 4UBLA 1FFEA 1E8NA 3AIMA 4IO0A 3G7NA 1ZI8A 5LKAA 1SOMA 1R50A 2WIJA 4EY4A 5FUMA 2G4LA 5T4HA 3V1LA 1ZOIA 5CTAA 3WMRA 1XZFA 2AJBA 4X95A 3KOOA 2I03A 4MYDA 3O4JA 3MUOA 5ALRA 4F5ZA 4C4XA 1UKCA 4AO7A 5D3KA 5IVDA 5CRIA 4MQLA 3WL7A 1A8SA 4B9EA 2PSEA 4JEIA 1A8QA 2AJLI 4DIUA 3ZPXA 4AN0A 2YYSA 1O6GA 4MXDA 1CIJA 5AKGA 4HVTA 1A88A 1QOZA 4Y2SA 4AZ3A 3HJUA 3SX4A 3VVLA 5BWBA 2JGLA 3H2GA 1BEZA 2QMQA 1BEEA 4J0KA 1IVYA 4BRSA 3FVTA 2ECFA 4ZV9A 4QE3A 5BV7A 1BCRA 3YASA 1TK3A 1LPPA 4EBBA 5A7FA 5AM0A 2IITA 5D7BA 4KJXA 2XLCA 2HL6A 1QIGA 1SCQA 1PJAA 5A71A 3TEJA 3STVA 1MNAA 2XQIA 5C8VA 4DNPA 3FNBA 4GW3A 2QUAA 4UFOA 1XRLA 1J1IA 2Y2VA 1Y37A 1UKAA 3HLKA 5HK9A 2H9YA 4ROTA 2FUKA 2FX5A 2HU5A 1QFSA 5HK8A 1H2XA 1CEXA 1DT5A 2WFLB 1QIMA 1JU4A 4X6UA 1TCBA 4Y2JA 4C4ZA 4G9EA 1XKTA 1QO7A 4AQDA 4BAGA 3ZLUA 2XQKA 3AINA 5JALA 2BCEA 1HLGA 1ZGCA 3BJMA 3H2KA 3IA2A 5AI4A 4IH9A 3HEAA 3WWPA 5EIEA 3HZOA 3UUEA 3W06A 3DDUA 5AKIA 3L1HA 5AI6A 1ZD4A 2PSDA 1J06A 3NWOA 2BUBA 3AZQA 1UK8A 1R4ZA 4KRXA 5CH5A 4N8DA 4H77A 2XUHA 4PSUA 1ZJ4A 3DKKA 1MN6A 3H2HA 3WL5A 3G9UA 4DMCA 3BIXA 1LPNA 2H7YA 2C0PA 4LHEA 5ALJA 4BCCA 2CEKA 2OGSA 1CUWA 2DQZA 1U65A 2C0QA 5AO9A 3ZLVA 4BP9A 1Q0RA 5DYTA 1WHSA 5CH8A 2XUAA 1QFMA 2HA2A 2OCKA 1A7UA 1W75A 3DKRA 1TQHA 2GBIA 2HU7A 4AXBA 3C6BA 3K9BA 1JFRA 5FP0A 3KXPA 1E3QA 1XROA 2QJRA 1Y7HA 4B9AA 4HAIA 1FFDA 4YASA 2K2QB 1CUXA 1JMYA 3C5VA 1X2EA 4JH0A 4FNMA 3F8SA 4J0CA 3C87A 4UFPA 4G1FA 2VAVA 1CUDA 4CIAA 3D2BA 3DD5A 1AKNA 3G9TA 1BE0A 2D0DA
chains in the Genus database with same CATH superfamily
2GX6A 2RGEA 3P0EA 5FBKA 4MKXA 1KYZA 1RPJA 1S7GA 5E2BA 4KQXA 5KYXA 3NHZA 4LXHA 1A98A 5FORA 1OLUB 2BM0A 4E2FA 4UU1A 1TRKA 5B6PA 3Q72A 1YDWA 2LDXA 5JDIC 1FIUA 1SXJB 1W85A 4GVLA 4OJMX 4RJIA 5KNCH 4RV9A 2AS0A 2KLHA 1KSGA 2WT8A 1W2HA 1FP4B 2ROQA 2Z83A 4AVYA 1WX1A 1JFTA 4LKOA 3H5IA 3WSTA 5IVKA 4JDPA 3AHEA 4MI9A 1M1UA 4L28A 5B2FA 1T4GA 3PITA 4EW6A 3VDXA 4DCPA 3UJNA 1UM9A 4CKWA 3ECSA 3SDBA 3A6PC 4NF2A 4J2OA 2ZJ4A 3GFFA 3TRJA 5JNTA 1WXEA 2IUTA 3NASA 4NS4A 2JZNA 5FUQA 4DSNA 3CF0A 1B0UA 1GAXA 1Q84A 3DVQX 3OZIA 5KYYA 1FX0B 1SELA 5CT6A 2J9FB 4UAJA 1KP3A 2J0EA 3IIJA 1MQ9A 3BGVA 4HXGA 5CX1A 5DX8A 3EA0A 3WKDA 2DETA 2XGGA 1NXSA 4D9NA 3NVMB 1JIXA 2AMLA 2FDXA 2Y1DA 3SVTA 3X1JA 1J9EA 2P7HA 4A1FA 3GELA 1NHGA 3LVQE 2IPMA 1XTPA 1RNLA 1MABA 2R6ZA 3IP7A 1GN8A 2YV5A 1KO8A 3ZKWB 2HMAA 2K4MA 1YULA 2IUFA 1EXVA 1X9HA 1MB2A 2APJA 3OJCA 2YXBA 1AY0A 1C29B 2FOXA 4XGRA 1NR7A 5H81A 1FNNA 1JEDA 2I4RA 2FFAA 3G0GA 3WWCA 2N1MA 3EVDA 3EZ2A 5EL0A 2KBFA 3ETGA 4FOOA 5LZ8A 4ZYLA 1E64A 1E96A 3NBFA 4WFQA 4KVGA 3QENA 1SIOA 1W0KA 2JGMA 2P4HX 3OETA 4HATA 1DBSA 4HN2A 3DCNA 5TS3A 2Y92A 4M88A 3ZEIA 2P2SA 2C03A 4I50B 4OSOA 3DLHA 3U5ZB 2CFIA 1EG2A 2NZWA 3KTFA 2ENWA 3OHSX 1Y5RA 4DWJA 4M9ZA 4KTVE 5AVSA 2DUWA 3U40A 3D7SA 3H17A 2YY6A 4V38A 1JKFA 3CONA 4DB2A 1QBGA 3M6XA 2Z2XA 5IHPA 1HYHA 4KJZA 3C3XA 2VJKA 4NZZA 4D4GA 3QFTA 1MG5A 2WJAA 1CZHA 1IQUA 1CJMA 3FN4A 5HBRA 9ABPA 1XA0A 1FVHA 5I9TA 1L4KA 5J2UA 3VX3A 4NCKA 3IAM6 1M1NB 4GLBA 1OYOA 1ND5A 2GWRA 4QAQA 3RFFA 2ISCA 1DJQA 4ZOEA 1O8CA 4Y0VA 5DXAA 4P0TA 4Q9AA 3PFBA 1CY0A 3PEWA 2OZLB 3HZHA 2IRWA 4OU5A 1EIZA 1TLLA 3FUCA 3DO8A 4GP7A 4I99A 4Q0MA 5HIKA 2RE8A 5JBNA 3QVTA 1ZMRA 3AVWA 2RJ3A 1P7PA 2VDRB 4EJSA 2CCGA 1YF3A 1G7RA 1I7QB 2VRBA 5HJ7A 4LYHA 5G41A 4B2YA 3W79A 2CWDA 2QP9X 1J56A 3QKSB 4M89A 4ND2A 2Q9BA 4KH0A 5C34B 1GITA 2ZI6A 5FUVA 1I3CA 2FRXA 5PNTA 2FEAA 1CDDA 2ACVA 1QFJA 2A78A 4FGSA 4D0NA 4DJDC 1XWIA 2XKKA 3VGPA 3GYBA 2ACEA 2AW5A 2WKPA 1XYYA 3TTWA 2PM8A 1T4CB 5I5GA 3TZLA 2QTZA 2NZXA 4JVMA 2B5WA 2ATEA 1C9MA 1WSAA 2FH5B 3CHYA 3FFBA 4O25A 4PBRA 5A3JA 4EEKA 3S81A 8MHTA 2JFWA 4M7RA 4Q7MB 5L3RA 3B53X 4KR2A 2DGDA 4AECA 4FSXA 2QX7A 4F2GA 1ZH8A 4JA2A 2ZRIA 4Q3AA 4EEXA 3TQSA 2XQGA 4HNGA 3VRHA 1GXSA 2PVSA 3WLRA 4D9BA 5BR4A 5JFGA 2MU1A 5LA6F 3AVXA 1OGIA 5JSYA 5HQ3B 4HTFA 1G7TA 3A1SA 4RF5A 4NEGA 3X43A 2QTCA 3M5WA 3M6WA 1CIVA 4LRWA 1PJTA 4PNPA 3UJ9A 1OAKA 1NPTO 5FOUA 3DF9A 5CLGA 2AF4C 3O2NA 5FB3A 1U02A 2CJXA 3AVTA 4DA4A 4C7KA 2I4LA 3WGJA 3AF6A 4YREA 2X9LA 4FCTA 1IQRA 3CX7A 3K5WA 4LGVA 4IF4A 2CJPA 2JIQA 3B70A 3PGVA 4YI3A 4ZEOA 3QI7A 1RMTA 3S2ZA 2C2GA 3VYRB 3EY9A 3IIKA 2DTXA 2P69A 4OQNA 3PP8A 2QTAA 3DDNA 1EK1A 2X1LA 3M6LA 4OHVA 4P7BA 3L5KA 5I4IA 3A9VA 4IM7A 2PV0A 3G9XA 2RH4A 2VK1A 2BH9A 2ZJYA 3Q8LA 1TFUA 1UFRA 1UP6A 4IVPA 5LL6P 4OKSA 1OFGA 2D74A 2FR0A 4EHIA 3ZWYA 2D1QA 5D3QA 3SVLA 1OI4A 1A95A 4YJ2B 2VLIA 1WXQA 4QA9A 5FFMA 2ZYHA 1QMPA 4JJEA 3GU3A 4I5IA 4URUR 5G02A 1JSLA 3P2OA 3ZHTA 3ICVA 1LI4A 2QAGB 3JATA 5KNBD 1YOVB 3GJXC 2NSHA 3WWDA 2XCRB 4MJXA 3PQ8A 4GZ3A 1C7IA 2NTVA 1PG2A 4GPTA 4UTNA 1RQXA 1E7RA 1F38A 4YK7A 4EWLA 2LDBA 1LB1B 5EOVA 3ZJTA 3ESRA 3L93A 2VDPB 5K09A 3W5HA 4CETA 4HWKA 3CW9A 3D7LA 3K5IA 3O0TA 4Y98A 1TIPA 3RHTA 5FPQA 3ZW9A 4G4JA 1KIAA 2QY6A 4F56A 1X70A 3ZE6A 2BFFB 2Y76A 1CJKC 3N0RA 4Z5XA 3CWCA 2ZYUX 1XDZA 3LOUA 1DFGA 3ORHA 1RXCA 1DKLA 4KGVA 3H8JA 2GB4A 3I09A 4MUHA 4ZT5A 4BNMA 2RARA 4HYEA 1RWMA 5CW2A 1CY8A 3ZV7A 3U1TA 2X13A 1VRCA 1V37A 5IBQA 5CNMA 1MRZA 2VHEA 3A6JA 1CNMA 4B81A 4P5DA 3Q9LA 3L6DA 4HSEA 4ZFNA 2W6NA 5G4KA 3PC8C 3M0EA 1NKTA 2IV2X 1WSBA 4PLGA 4E46A 4EA7A 4ENQA 2VF4X 2XRYA 3NC0C 4HLQB 3WWOA 4WXPA 4I5FA 2G36A 3LBIA 3UUGA 1V7CA 3W9BA 4BNZA 1FTWA 3KDPA 4JGGA 1DELA 1Y4AE 2IYAA 1WXIA 1QV7A 1IHUA 2Z1MA 2GM3A 3FFWA 3M89A 3M3DA 3L7BA 4HJRA 2W8ZA 2XNSA 3AZOA 4BV8A 1EK2A 4F6RA 1DMRA 4DMKA 2QJWA 1EGQA 1FMLA 1XZKA 2EBHX 2GILA 2QW1A 3DE1X 4IIEA 5SYNA 4EKIA 5JATA 1DP4A 2WWXA 1NN1A 1IUKA 1AKMA 1K66A 3CISA 3A8TA 4OBXA 4AS2A 4CQLA 2UUAB 1D4AA 4O02B 4ZOAA 2NAFA 4AJIA 3E2PA 3GOQA 4N9WA 3WQBA 5BXYA 1LQUA 2PHZA 2G82A 4GOJA 4YLEA 2HDWA 5K4GA 3W1WA 3RAGA 1FU4A 2OLKA 2Q1XA 3BDIA 1S1MA 3I0NA 4HDNA 4BU0A 3SFZA 4DM4A 3CCBA 2IW1A 1RI1A 2HLDD 3OQIB 4HZIA 4Q7LA 1YIDA 2G7MC 3IE1A 4BLQA 2RGYA 4PLHA 1A27A 4R01A 4R54A 4AK9A 3FTFA 1QFZA 1SB9A 5ENZA 2JCVA 4KLAA 1XNJA 4M7PA 5KQRA 1U3CA 2XVXA 3OEWA 3LU1A 5AI5A 3JWEA 5DULA 3SC3A 3BCRA 5D01A 2WU0A 1GIAA 3NNNA 1JJAA 2D2VA 3EVFA 4E94A 1MO4A 4G4IA 4XFKA 4YT2A 3UW3A 2X7HA 1TGYA 5TPZD 4QTXA 1E63A 2UZ1B 2JI6A 5EHQA 1G1AA 2F3UA 5ADWA 2QRZA 3NHAA 1KVTA 2NZUG 1L5OA 1SVWA 2F1JA 2QTHA 4C3VA 3N3BC 3AEQB 5DX0A 2EQBA 3ICOA 4NOMA 1YJQA 1Z36A 4OXYA 4Q47A 4J4HA 1U3FA 2ZKIA 4LC0A 4B3RB 3GFQA 4GP9A 4PZUA 3A4NA 2A35A 4Y6OA 1NVMB 3CM0A 3VR0A 3M6UA 1IWBB 2EF1A 2WLTA 4JV5B 1A77A 2WJGA 2IYNA 1JALA 1T2AA 4ALIA 5DK4A 1N1MA 2X23A 3ED1A 3CUWA 2F3SA 1LLFA 4HB4A 4I9GA 1Z0DA 5FWXA 2HF9A 1IUNA 1HO3A 2GVZC 1DHRA 3MK31 3S28A 3DEJA 1L7QA 3AF3A 4R5MA 5DTJA 4U8GA 4LXXA 3B20A 2AJCA 4F2DA 2JIZD 3CZ9A 2GM4A 4I1YA 4PHGA 1NXOA 3IA7A 3H6KA 2C94A 3MCAA 3S5JA 4DR6B 1HUQA 3K9LA 4BQQA 1Y8ZA 1U98A 3V3TA 9LDTA 2HKIA 3JALB 3AJAA 4N40A 5C0OE 3CRW1 1JXQA 2CE7A 4RQAA 1ZUD1 3VDMA 4Z49A 2P27A 2HA4A 4ZI5A 4ADSG 1TK2A 1EA7A 4Q82A 1N6RA 5KAPA 3KLNA 1C3LA 3CNBA 4DOMA 4YONB 1MDBA 3G1WA 3QXCA 3CG0A 4CKYA 1IPEA 2EKDA 5C51B 4HUQA 5F4ZA 1R66A 3VJKA 5HP4A 2GRAA 1TK9A 3ASYA 3V1MA 5IJ9A 1P5JA 2QRNA 3HVKA 3ZKWA 3VKWA 3TLYA 2UUPA 3WMWA 2ZR0A 1OZGA 1M34E 1YJAA 2BFAA 1ML4A 2IZOA 3I9KA 3N74A 5AKYA 2I6FA 5BOVA 3NEAA 4FN4A 3HKEB 3WK7A 3ABSB 5KMGA 2GNOA 4PGMA 5EZYB 4KIFA 3DYBA 4LISA 3OM1A 3DKVA 1H1LA 1VPEA 3OU7A 4W5OA 4W5NA 2OECA 5DWQA 4FNGA 1VPDA 4WVFA 2FQYA 1CK4A 1FS4A 4P2BA 5CM9C 5E95A 4G0VA 1G8HA 2I6UA 2QL7A 5FKJA 1BW9B 4BFSA 4N5MA 5BWLA 4WTOA 4XX0A 1WB4A 1NF9A 2J3JA 2SKEA 1T5IA 3AJEA 1QDEA 1JQKA 1TVCA 1D3AA 1M2OA 1O57A 3CB2A 1XI2A 5JG7A 5JS2A 4JVOA 2J41A 2FA9A 1NXTA 5DDIP 1BGVA 3UPUA 1N5KA 3WGQA 4EABA 2C7OA 2EFHB 3PF9A 1C7QA 1WU7A 4JLAA 4URVR 2OLEA 4TL6A 4MR7A 3UJBA 5U9CA 2QX4A 2HHJA 1YFKA 1YQQA 2W9XA 5DHUA 4EGJA 2BP7A 2WFLA 2X0EA 3N6VA 3VAZA 3DG9A 5BSFA 4RD6A 3D0KA 3NM4A 4N48A 1WB9A 3A1WA 4JLDA 2E1PA 2WYWA 1A96A 1T2UA 3OF3A 5GONF 3NHRA 3TQTA 4A6DA 4XWYA 3ZXSA 3TD6A 5HTOA 3BJIC 3KJEA 2D1TA 2HCFA 1J97A 2XZOA 3MRSA 2IZ0A 4IKOA 4LXGA 1E7WA 3M6VA 4BP3A 3SIXA 2Z6VA 1W9HA 1P5FA 3A4IA 3L05A 4MQEA 2Q2OA 2G9VA 2YHBA 3QPBA 1SOWA 3TOSA 4US2R 2DRIA 4G3XA 3NVAA 4HNUA 4I5DA 3WBFA 3ZBPA 2DPHA 3LV8A 3BGSA 4LVUA 3DV0A 3FJ1A 4PZ9A 2FFQA 3IAEA 3PDHA 3RS0A 3QX7A 3MSCA 1LSOA 2O8NA 4JIMA 3ZD8A 3MF4A 1FDWA 2XMCA 3KKZA 3PXXA 3SKVA 3ORYA 1Y8QB 1T3LA 2QYSA 3EIEA 1TMGE 5ECWA 1G5IA 2A58A 5CEFA 2FDRA 1MB0A 3ZW7A 4QYIA 3NZEA 4KXXA 1WQ4A 3QVOA 4RH1A 3L3BA 2Z5GA 2BH2A 4ITUA 4K26A 2FMTA 5DXFA 2NXCA 1SAYA 4OM7A 4MS1B 3G13A 3IT1A 3HYNA 3N6RA 5IEBA 1CRLA 5FWYA 3NYQA 3CRQA 4OU4A 5JD4A 5A9SB 3A28A 4F4IA 4G5XA 3M6IA 2WD9A 4MKGA 3TH5A 5BV2P 1V1RB 3H1AA 5MFZA 1UFVA 1THMA 2ORED 2ZKLA 2EFYA 1YFLA 4HFJA 3C97A 2DPGA 3KU4A 2QVBA 1ZMXA 1L4FA 1JJFA 1UXJA 3CLSD 3ESYA 2G04A 2Q4DA 3JQ7B 2M6KA 3S7TA 3IP5A 3DMGA 4JBYA 2WA2A 3I6IA 4H3SA 5D87A 3TNYA 3W1VA 1A8HA 3KQPA 4HDMA 3K94A 3PR2B 2J3LA 1ZVVA 5IF9A 1Z4IA 3A10A 2OCAA 5JSZB 3B5EA 3P2MA 1WDKA 1K4MA 3V4OA 4B46A 1TX4B 2E0IA 4RHYA 4OJKA 1YJBA 3LZCA 2C42A 1D4OA 2YQ4A 2D54A 1U5BB 4KUEA 3PC6A 3S68A 3DA8A 1DO0A 4FD2A 1ANKA 1ESEA 4UPVA 3RD5A 4C6SA 1V2GA 4WADA 3FW1A 1ODSA 4OF4A 2BY4A 3B1FA 1INLA 1A5TA 5DEIA 1IHOA 1F2UA 2TECE 1HDOA 3VR4A 4KWHA 5L45A 3EPKA 4PQGA 4LF7B 2A9RA 3H8VA 3T3HA 1VIAA 3R41A 2WW8A 4QTYA 3LF2A 2FETA 4HSGA 4YGYA 2W4IA 4I8DA 4RDIA 3WLNA 3SNKA 3C70A 4U7GA 2L2QA 1C9EA 4CL2A 1B42A 3CZPA 2PRKA 1RTKA 1SBIA 2YUIA 1I7DA 1PQUA 1ZCBA 3KQVA 1D9ZA 1NM5C 2Z5LA 4WBNB 1W4LA 2G25A 2B4AA 4RSMA 4K0KB 3CH4B 4RTJA 4D98A 3D1JA 5KWSA 4Q24A 1UJ4A 2VDWB 2WG1A 1V16B 2MSKA 2QW0X 3ORQA 4M1SA 1XVLA 3BAFA 5BW5A 5HXAA 1CVIA 2I54A 4Y2XA 4BEJA 3KJFA 1J39A 1L8XA 2QN6A 2GD0A 1Z28A 2N42A 3SZ3A 5HCNA 2QTGA 4WKBA 1IBLB 2VYVD 3ANXA 3JWHA 1BOFA 2ADMA 3E1KA 3TLJA 2PH1A 2QLJA 1MOQA 2XIQA 4MKFA 4Z86A 2JRLA 2UZIR 2HT6A 2LPMA 2ZTVA 3C7AA 1Y1PA 4HEA1 5AOCA 4BMVA 2W98A 4BUJA 3P9SA 1GPKA 4CV2A 1R4MB 4ALLA 3S8YA 1OBVA 4PYIA 1E77A 1MB9A 2FN7A 4PXAA 1M75A 3G5TA 4CN8A 2NU8B 1T9GR 4AJ2A 3DNFA 1NNLA 1T6ZA 2VYFA 3NTOA 2C96A 4UCFA 2XHZA 3NIFB 4BLTA 1I13A 4DSOA 2PEZA 3R5JA 1AMNA 4ARZB 3BZUA 2ECOA 1HDGO 4IZ6A 4HWTA 5EAIA 3VZPA 1Y8RA 2HF7A 3WBKA 4CNBA 1GLGA 2FW0A 1O5OA 3H9JA 2R1TB 3STTA 3HN6A 4J16A 5HKOA 1W5AA 1SG6A 2ATIA 1DX4A 5I9IA 3KQMA 3WOVA 1W36D 1OLUA 4P4UA 1BDMA 5CK5A 4MQMA 1J99A 4AKIA 5F23A 5I7SA 1SXJA 1C9DB 4Q15A 3N3AC 1V6SA 4IBOA 1CR6A 5BORA 4FZ5A 4FMCB 2H57A 3MJTA 4K2HA 4CYMA 1FP4A 1EGHA 1U9CA 1W1UA 2NNWB 3LQQA 5BURA 4B0PA 2EF0A 4DMHA 2GAJA 1Q14A 1AA9A 2E5FA 2PO5A 3O3NB 4BOYA 4IGIA 2BGWA 3AV0B 1U8UA 1TCVA 5EQFA 2IZ6A 2XUDA 3P9IA 1L5KA 3LP8A 4I4LA 4TL9A 1L5GB 4K1LA 4JFRA 2IX9A 4M1WA 2WVAA 3QLUA 4JLNA 4CMIB 4EFKA 1XB2A 2NTJA 3DOHA 3IDAA 5IFLA 3AC0A 3B3QA 4K1XA 1N2SA 4MLPA 4NZNA 5FQNA 2R6R1 3H2IA 1ZMTA 1ZC3A 4RH3A 1FX0A 2G72A 1DO8A 3QPCA 2EZUA 2J9FA 3CLSC 2EKQA 2PX0A 4KE9A 3D3QA 3P96A 4OTZA 3CEAA 4JP1A 5EEHA 4BFYA 5DNUA 4QC2A 3GPDG 3SYLA 1I3OA 1K4KA 3INYA 4UPDA 4Z8YA 5A3VA 3GGJA 4DLWA 2EKZA 4CL8A 5DWVA 2CJYA 1B14A 3EGOA 2HU8A 2IFTA 4DDTA 1YBVA 3R3YA 5C5IA 4ABYA 1I4EB 2WVJA 3TXAA 4KPYA 2IBMA 2NADA 5BOSB 2AD5A 5FWNA 4ZK6A 1X7XB 1HEIA 4D46A 4PTYA 3HDVA 5JV5A 3I04A 2WUEA 3B85A 1XL1A 3T7KA 2HA6A 3E23A 2QYHA 2EBWA 3H5RA 2GJSA 4MJ7A 3SWWA 1AGPA 4HL6A 2PWYA 3K8OE 1AF4A 3CR8A 4I50A 2QLBA 3VH1A 1GPMA 1DTEA 1E5TA 2AXNA 2C98A 3ZDYB 3RKRA 5JIBA 1IY8A 2AX3A 1V8PA 2FSVC 2B21A 2NUTB 1KMMA 3GCDA 5HF6A 2NU6B 3K1AB 3KXKA 3WLMA 4YUZA 4HYTA 3LL7A 3EMBA 3CO0S 3O8NA 3CNQS 5HX7A 5LQCA 2Z2ZA 5CMLA 1P2SA 1RQGA 1Z07A 2DHEA 2PYIA 1EVLA 4NATA 3FWZA 4JJGA 1OXXK 4PICA 2VUTA 2WKWA 5G4LA 2G1UA 2IOFK 3BSYA 3PFIA 2V0GA 1SG9A 2R60A 1M1NA 3QU2A 2EWMA 1I6WA 5ALDA 2IBTA 1N0IA 4N01A 4NTZA 4QGSA 5JASA 1NYLA 1W0CA 3R75A 4EKEA 4JZYA 1I2DA 1IB6A 2XKAA 3BFVA 4UAVA 4L02A 4KYTA 2H5EA 4QQFA 1BGXT 1S8OA 2CLHB 2OZLA 4WIAA 3AWDA 3TGWA 1EVEA 1G41A 2C2XA 3VR4H 2V6BA 4D8WA 3FOAA 1TPYA 3NOOA 4HD8A 4DXDA 2ZBUA 3ICWA 4JWKA 2O0HA 3T15A 4QYSA 3DO5A 2YJ5A 4OP1A 4G2NA 1EM6A 4UNIA 1VRVA 2XDQB 4XUGB 4DCOA 4WVLA 3QKSA 2ZIXB 1P2VA 3I39X 1TO2E 2O52A 1SC6A 3D31A 3GHHA 1FJGB 4IFBA 1OH8A 1MX5A 2WWFA 1NVUQ 3GPCA 3LSTA 4R9NA 2IXFA 4BX8A 3O4IA 3COVA 3LUAA 1BWQA 3PA6A 1W36C 1NJ2A 5ALLA 4DZRA 3BFKA 1T4CA 2WIKA 4IFEA 3CFYA 4EK9A 2JNWA 3MJVA 4EVRA 2FJ0A 1E3IA 2J0UB 4IEEA 3L1IA 3O6VA 1DC3A 3LBFA 4TS4A 2H7VA 3PUXA 1EDBA 2H1OA 1UJ2A 1Z5VA 1LXCA 2I2AA 4RF4A 3VMFA 5IH7A 2VYCA 1K92A 1KAHA 4XWGA 4KFTA 4UBJA 2ZSAA 4JFAA 2H4YA 2BI8A 3VJLA 3B8EA 4F84A 1ISHA 1P4JA 1UMBB 3PWSA 1RDFA 3OESA 5HQ3A 2ZM6B 3KBBA 3ADCA 1AQJA 5C4GB 3NTVA 2CKMA 4ZOBA 1GQRA 3E7WA 1SXHA 4KRYA 2WZQA 1U7TA 4M3NA 4FYVA 1CUZA 3H3XA 3WLOA 3DEKA 1DU4A 1Y7PA 4PYKA 3MOGA 4HNHA 4QARA 5K51A 3A1DA 3BK7A 5LWQA 3K6SB 1AHIA 4R7TA 3JVIA 4EELA 4ESOA 4RLHA 1Q83A 4REQB 2AEEA 1V47A 4EY8A 3PHLA 1TU3A 1ZGZA 3HXQA 4BHTA 4GVXA 2AE2A 5EIFA 1X1RA 3K2EA 4E4TA 2WQ6A 1VJRA 2UAGA 5D3ZA 1HFJA 4JXZA 2PKQP 3L18A 2DC1A 1BWRA 4OIFA 1YGYA 2OO5C 2HIGA 4Z9XA 4WKPA 1LU9A 3NV9A 1J5EB 1WUYA 1QRSA 3UJ8A 1HDIA 2O57A 4TS1A 4OFZA 3RVBA 4YJ2A 4J0HA 2H4WA 4DV5B 3W2EA 1BDBA 1G21E 3Q1LA 4TSKA 3FPJA 3QF4B 1R64A 3I2HA 3C5CA 4RY9A 1QQBA 5JBQA 3CNOA 1DT3A 4XQCA 5F5LA 2QAGA 4U2DA 4B82A 1YOVA 3DDSA 3BXOA 3F4LA 4OGLA 3PIIA 1MQSA 4MHSA 3FNHA 2HFKA 1XQVA 2P9CA 1EXWA 1C7JA 3PKIA 2QPLA 3VYSB 1TA9A 1Z68A 2I66A 3NQ41 2NP6A 3M6AA 1P29A 4U7TB 4IDCA 1X8XA 4KO1S 1JDBC 3I37X 3OA0A 1RHQA 5COQA 5DGXA 1SPBS 2BFFA 3HFJA 5LWHA 2B61A 5MHTA 4B7ZA 2HBRA 4M2LA 1YVPA 3PEYA 4LBYA 1PV2A 3KZVA 3PIRA 4KAAA 3SQWA 2GJKA 2CNBA 3PGKA 1HPLA 1GPYA 1LBIA 4BP8A 3B1XA 2I62A 4N41A 3OF2A 3K2QA 5AVJA 1L7RA 2JLCA 4JI3B 2JC3A 3U9TA 3UJ6A 1LBSA 1PKEA 4R3NA 1H94A 1P77A 4PFJA 4CT0A 5LOVB 3AKCA 3PDUA 4Y18A 1JB9A 2FX3A 4I5GA 4UFNA 2NMVA 3ZI4A 3QNMA 4MWTA 5LQNA 4ER5A 3T1TA 2P3QA 3U0BA 2CJFA 1ZGBA 1QX4A 4Q66C 1K75A 4NCXA 5LQSA 2RGGA 3PK0A 3JWGA 4N65A 4MQ5A 1II9A 2Q07A 2Y2UA 4QEKA 3TRHA 4N7MA 4DAOA 2ZCJA 2XEDA 5KEIA 4P9NA 2AJTA 3GZJA 1TECE 1UAAA 3KWLA 3QYJA 4MNTA 1GT6A 4N3NA 4P3NA 1NSFA 1WUKS 4RK1A 1W87A 3U4AA 1PT9A 1GG2A 2CB9A 3NEPX 4QUBA 2B2XA 1GUDA 3L0ZA 3LH5A 4RMHA 1G3MA 2B4RO 2CF5A 1NXWA 5DV9A 4JI1B 1AUOA 4ID3A 4QASA 3TI7A 1H5QA 4BC0A 3W5IA 5CA0F 1YR2A 4DLLA 1V25A 5ELXA 2ZANA 4MUAA 3HE3A 3KSUA 1P1JA 1T5BA 4PG5A 5EPEA 1OXKB 2MWMA 2HTFA 4DAEA 5KDOA 2I7XA 1KI2A 3SBXA 3LLVA 3OQIA 2ZI4A 2Y1XA 4RYDA 3FPKA 4HLNA 3A3OA 3Q8KA 2VBIA 2WTEA 5EVCA 3REOA 4MV7A 1S3IA 2GJ4A 1D2GA 2VOEA 3E7PA 1T5LA 1C1YA 4OK3A 1S3FA 1F2VA 1SQSA 2J3EA 3DSRA 3MCUA 3AL3A 3R6GA 2D2FA 4RBNA 1UKBA 3BSSA 4CLRB 4E4YA 4G5HA 1O9HA 2AEMA 1LPBB 2G1PA 1RJFA 1F48A 4E2WA 2GPAA 3QVGB 1GRQA 1Z45A 4QM6A 1PO7A 3X2EA 5AI9A 2UZ1A 2VVTA 1BTOA 3BK2A 1JZSA 2Z56A 3UF0A 1N7GA 1FTGA 2XT6A 4PVCA 5G1PA 1Z0ZA 4Z7NB 4FWIB 3AEQA 3O8BA 4RETA 2DVMA 3ZOZA 3PPWA 2JAUA 1VSTA 5LA6B 2V55B 3OFKA 3TDNA 1FX1A 2C59A 4RABA 4JCCA 2G40A 1AX9A 4ZXFA 4B3IA 4J0FA 1O95A 3QU7A 3Q2IA 5BVHB 3TW4A 3AUTA 3DL2A 3E1SA 2W6IA 3ZGNA 2OFFA 4QJBA 2QSUA 3OZSA 3KEFA 1P9WA 3LY5A 3TS1A 5JSUA 1QU3A 2LUOA 1FSPA 4II2A 1COWA 3F3MA 4YMVA 4OFXA 1EHIA 5HF5A 2PH7A 4MRVA 4NNPA 4D3FA 3GJ5A 5D85A 3UT5B 4LWQA 1DIGA 4BZQA 4YPFA 2GJ9A 3GUUA 5B36A 3K2IA 5CDSA 4GOMD 2NLOA 1IMJA 1PYGA 3SP1A 1A71A 5A62A 1WKBA 3V34A 3H99A 1ORHA 2CD9A 1U8TA 2B4QA 5A5VA 2CMFA 2FN8A 3M9WA 2BFNA 4CT5A 2A88A 4GYWA 3JALA 3HJCA 3ETNA 3OPYB 5IDYA 4NPAA 2J30A 4N8EA 2HV9A 1ZJWA 1EFUA 1P1HA 3VNAA 3KT0A 3EVTA 4HS4A 1TJYA 3SJAA 2G06A 5DNEA 1YDEA 2QG6A 3QXSA 4UNNA 2PUHA 4FK8A 5AUPB 1EZZA 4H3HB 3ZYCA 4BBZA 2MYUA 2I7VA 3OKAA 9ATCA 1LS1A 5K0SA 2ETXA 3OE7A 1M7BA 1N2OA 1VMAA 2CLEB 4R2IA 2DR0A 4RTPA 5A05A 3JVVA 3Q5DA 3FJOA 1NV9A 1IN5A 1JDSA 2JH8A 3LCUA 2PNFA 3C5WP 2QJOA 3OPXA 3NWBA 4MCHA 2GQ0A 4UARA 4IIVA 3V6MA 2BSAA 1K6JA 1LNZA 3UNXA 1HE1C 2WSIA 4O6VA 5CM2Z 5B7GA 4BVHA 3ICQB 1QGUB 1W5EA 2JAHA 1GPH1 2OKCA 3N76A 4GXTA 1HLDA 3HKEA 4FGKA 4UKDA 3RTBA 3K20A 2C83A 3KXLA 5EZYA 4IGKA 2E82A 3KC2A 1EE2A 1KMHB 4K0RA 3K6JA 3V3KA 2WIGA 2YCLA 3AV3A 3K0AB 3Q3GE 4E2ZA 5AJYA 1LBQA 5BRAA 3ZHZA 2HBYA 4NYJR 5EP1A 4DJTA 2GD1O 2IYRA 2C3MA 3IUPA 4R1TA 3FTDA 2SKCA 4ZVMA 5JZ9A 2A1UB 4JI0B 1BW9A 4O2LA 4IUYA 1U2RA 3BICA 2GFIA 2E87A 2PBRA 4WN9B 4CF3A 1B6RA 1WR8A 4LZPA 2GHRA 1SIBE 2P9EA 4RXUA 1M6NA 1ZN9A 1TM3E 1PDOA 1FK8A 4JJFA 1R4AA 1RYHA 2QORA 3KSMA 3Q9NA 1DAFA 2IZ5A 5DGCA 4BY9E 3CN9A 1S0UA 3CSDA 4HI0E 4MCIA 3UAZA 1E3DA 4DXAA 1JHXA 2DAPA 5DHQA 1RAFA 1FJXA 3R7SA 1JHQA 1IK6A 1CQJB 3HCFA 5KCMA 4B31A 1XZEA 4E3ZA 5BNWA 3V6LA 1EX9A 2IDKA 1YQTA 4OH1A 3ZI7A 3F5QA 2EARA 4B6FA 1Q19A 1ESDA 4H31A 2OZVA 3CBQA 1RPZA 1AS2A 3WV5A 1ZL2A 3G5LA 5JNRA 2VYNA 4RVFA 3O94A 4XYEA 4ASUD 2R7AA 1MUUA 4N3CA 2PLRA 1VXRA 1Q0UA 1E8MA 1P61B 2I78A 1Z16A 2H8GA 3BXPA 3EGIA 4R4JA 3WYGA 1O54A 4DDUA 1AKUA 1F0PA 4RE6A 4NK5A 4DIBA 1R0SA 1VG0B 3ESAA 2ZB3A 3GLSA 2VPTA 1JNYA 1TIKA 2W6ZA 3ZVNA 4KL8S 4ZD6A 2DFPA 4A16A 2WNSA 3CRVA 3A9UA 2CXHA 3NV7A 4GHWA 4BGIA 3PCXA 1K8ZB 1PL0A 1GKLA 3B1ZA 1ZXLA 1GFWA 2OZEA 3MN1A 4KWTA 3K70B 4R6XA 1NN0A 4QPDA 4IMJB 3AUSA 2O2XA 1Y8QA 1SA0B 5KSWB 1AOXA 2WFAA 2OHOA 3DFKA 5P21A 2GR9A 3QQPA 4IMPA 1OUMA 4FDVA 5HE8A 4F3KA 3I62A 3HJHA 4EY5A 3M6MD 2R62A 3RS3A 3EXG1 5E4YA 1U1GA 4MS1A 2XNDD 4YRQA 2DWOA 2FGKA 5T6BA 1KIMA 5DCUA 4QM7A 1GRCA 3EGDB 3KKQA 4P98A 1XVVA 1N8TA 1YAHA 5A9SA 3C74A 4J2HA 2C7QA 3H18A 5KKNB 1TW3A 1PNOA 1V1RA 4KXVA 2J7KA 4KCGA 2X7JA 2ZSHA 3IV7A 5DHSA 1GEGA 1F6DA 1N57A 3C45A 3FI0A 2CSUA 2GXUA 3IUQA 3QI2A 4LN1A 1XLVA 3JQ7A 2XJ9A 3WZLA 3WYNA 2CLSA 2QHXA 2ZE6A 1AV7A 2IWRA 3IT3A 2OP0A 2VUIB 3ZHCA 3S5UA 3BCUA 5JYEA 4D56A 5DASA 1G8FA 5JSZA 2P8SA 3B82A 1FYXA 2CJWB 2HRQA 2WK1A 3K0SA 1ZJ5A 3HS3A 3MGAA 4WY8A 3F5DA 3UENA 3C2QA 1SRRA 4TRRA 4WXMA 4IS2A 3UV7A 5ARDA 1W7AA 1UDRA 1OFUX 1U5BA 2OXFA 4KWIA 3SU8A 2PA0A 4LZLA 5A9RA 1U90A 1K3FA 2H1FA 2NQTA 5EZ5A 4AS1A 4JI8B 3FTEA 4EVSA 3OJXA 3NHJA 4PG6A 2BGTA 2XKBA 2RC6A 3W77A 3AIIA 5HIIA 1ABBA 4KMSA 4AIIA 2JLRA 3G2KA 3SF8B 3WGVA 1YRHA 3G17A 1OV6A 3LZDA 1QC5B 2P4EA 3N8KA 4HVLA 3OTHA 2A84A 3L6UA 1CUYA 1KU6A 3AP1A 4MRPA 1B0AA 4MIOA 4N54A 5FLEX 4YI5A 5ARBA 1WVGA 4OIMA 1FYWA 1OC4A 4MUBA 1DRWA 5CR9A 5BPHA 1IY9A 2EW8A 1WMAA 3JQQA 5LPNA 3ICEA 1KK3A 2PT6A 4AI6A 4AKGA 4YR9A 1BE6A 4IGFA 1OWOA 3MS4A 2JFBA 4BNLA 1SUPA 2FEXA 2VDWA 1V16A 3DV2A 1UM8A 4PBTA 3H5TA 4DLTA 1KK0A 1YS1X 4WCFB 5CCXA 1SO8A 4D7AA 4RL6A 1N1DA 1XRRA 4JENA 2X2PA 2PBFA 1ESZA 1NN5A 4PLVA 4Q1VA 1JLMA 4Q9JA 4AS3A 5D51S 1R4MA 2A14A 2QA5A 3N0TA 4GT1A 1WAMA 3OP1A 3OE4A 3QTTA 2NU8A 5F7ZA 1SUCA 1NJFA 3TW0A 1NVGA 3HCOA 4F1KA 1I2AA 1LBTA 2XX3A 4R9RA 1CUUA 4ARZA 5B30A 3EWSA 2H4ZA 1PVDA 2R1TA 3RNOA 3TZCA 1MQAA 5K0EA 4EB3A 3FVVA 1GQ2A 2AG0A 4AJEA 2G28A 3N5KA 4UHHA 4D9EA 2EIXA 4O59O 1O8BA 4UU0A 5KHAA 1C7FA 5I45A 5CHEA 3RFTA 1CRPA 3FB4A 4MVXA 4CI9A 2YXEA 5C8ZA 2FWJA 4DV6B 3DLIA 2C7RA 4JR0A 5DTQA 2GKOA 3L6RA 3ID6C 3RKUA 1HSOA 2IF2A 4C9BA 3VR6A 1NG9A 2QLFA 4G86A 4X91A 4C4TA 2ZUEA 4XW2A 4L72A 2UXDB 1PD1A 1OPRA 3ACBA 3T3GA 3BRQA 4DDVA 1KPGA 1CY1A 5B64A 5L4SA 1E1LA 4NONA 4MGIR 5AW5A 5TS2A 4CMIA 3VYWA 1ZEJA 3Q11A 4PXSA 4EFLA 1LVGA 1MV8A 1OQAA 1NIJA 1TA0A 3JW8A 3TL6A 5JZSA 5K8VA 4ZO8A 4OB6A 5H1YA 1Y3AA 1LPSA 2ZS9A 1PEYA 2BR5A 3HL0A 4AP9A 3UCXA 5AIBA 4ND5A 2PS9A 3A1CA 5I8ZA 4F4UA 3KYJB 2R5NA 4KQEA 1PD0A 4NZYA 1Z8FA 2WAXA 3NWEA 4FBMA 5LU8A 4A4DA 3HZRA 2O7RA 2ZYRA 5ALIA 4FZVA 1U0JA 2A4MA 1WM1A 2I6QA 2YJ3A 4OQYA 3LT2A 1NMSA 1NUQA 2FSFA 5BOSA 1VYHA 4JQZA 2PKRA 4TTJA 1X7XA 4C3ZA 1R0LA 5I4BA 2AG1A 3AUXA 1KQNA 3MT7A 3RS2A 2QT9A 4PY2A 3U3MA 1AQUA 2OHJA 5IJ0B 1FNCA 4PZ0A 2VXYA 1Y5MA 3MJDA 6Q21A 4NXMB 4JLKA 1LVHA 1QOQB 1UXOA 1X0VA 4MQBA 2XQJA 1RQRA 4RYLA 4DG8A 1YB7A 3ENZA 2PAFA 3ZJYA 4EHLA 3N0XA 2HQBA 3UJCA 2NXWA 5BV8A 5L4NA 4D4HA 1DWPA 1VI6A 2Q50A 3DBLB 2A92A 2NUTA 2WKRA 2NU6A 2WUDA 3K1AA 3THRA 4B3JA 3STUA 1O4VA 3IQZA 5MFPA 1R1DA 4ZVQA 3JAKB 3BZWA 5HG0A 1IZZA 1DQPA 1I33A 1WBJB 2FFRA 3N58A 1GHTA 4MI1A 3D0OA 4Y1RB 4DSTA 2J9XB 2X4DA 4FYXA 5FPKA 2DBZA 1AURA 2JAXA 3AY6A 4GM4A 5CYPA 3TL3A 3TGPA 4DABA 3CVWA 4FEGA 3PX7A 1YZKA 1Y81A 2VHQA 3F6EX 1OMOA 3R09A 1VSUA 3TWOA 1QCYA 2R6GA 2XYQA 1MU0A 1VA4A 1QRAA 2O5VA 4RX1A 5B7PA 4LTNA 4G56A 3VV2A 3BB1A 5LD2B 1RYZA 3EQ2A 3L1VA 5IBRA 4MUMA 1OXSC 4X6YA 2FR8C 5FOVA 3SIRA 5LMNB 3FCSB 5FBVB 5JJCA 3TECE 1KZ4A 1XXHB 3RHZA 5AP9A 5CFRA 3D43A 4ZVSA 3NWPA 2CBXA 4L0DA 4S0XA 2QN9A 4L9WA 1G6OA 4LRYA 3U26A 2XDQA 4G5YA 4DXHA 2RI6A 2I7TA 5LXTF 2ZIXA 4FLEA 4QO7A 1QS0B 1ZD9A 4UMEA 4B6GA 4BFLA 1CUJA 1H9BA 2VF2A 2EFGA 5LYJB 1H2BA 2GM9A 2JIDA 2PKCA 4GD3Q 1IHXA 4TKZA 1Z13A 1K0UA 1QE5A 3R8CA 4XTCS 2CMGA 1IJBA 2VR1A 4UMDA 1IDN1 1ZITA 4AWAA 1CE8B 4BQOA 2XKJE 4W7IA 1T0BA 1ICEA 1F2DA 1WL8A 1ZGGA 2GBGA 2J0UA 2VHUA 3AEKB 1ZUIA 1G5FA 3EZLA 4C2AA 3ITEA 1JWAB 2GN2A 3FKSA 4MWDA 2JJYA 3QNUA 4FYJA 2BKXA 2DBRA 1SCIA 4FCWA 1R8XA 4UDNA 1XCMA 4HYYA 5DSZA 3EWNA 3W9YA 2FYTA 2B1IA 2GDJA 3ORFA 5KKCA 1UMBA 4W9NC 3PQ4A 1UDAA 2G88A 4A0QA 2IOFA 2JD1A 2OCYC 1M5RA 1VMKA 3STXA 3DPUA 5AVVA 4ZALA 5DTIA 2GNPA 4K9NA 5A4AA 1BEUB 2JJ8A 2RBGA 2Z98A 2ZIWB 4G0ZA 4PIPA 4TWRA 2R79A 5FFFA 4IVRA 3CEMA 4D41A 4RK0A 1QP7A 4W99A 3UAVA 2WF6A 2HCTA 2ZAYA 1JTVA 4OGGA 3HDJA 3CVXA 4AIRA 3IAXA 1LPAB 4PS0A 3K6SA 3THSA 4TMKA 2ZW9A 5TGTA 3T52A 2WD8A 4FI3C 2IH5A 1B6GA 3AFGA 1XQWA 2ZBDA 1EWKA 2NZVG 4U7HA 3KQYA 4REQA 4W5JA 4Z4CA 4PAGA 3OEEA 5HS6A 2W4MA 4U9HS 3FLAA 1A1SA 3O7WA 4JASB 3JS5A 3NR2A 3O4FA 4YMTA 2BM9A 3B38A 3GEHA 2Z5FA 2H4FA 3DZCA 1RI2A 4CM9D 5M34A 3HNRA 4RO0A 2O4CA 4REOA 5C7YA 1FLAA 4DW8A 5KTTA 2HJGA 4LEIA 4XVHA 2WI8A 1NQWA 2HLPA 3LPMA 3HYSA 1XYVA 2H16A 2NSDA 2QT0A 3HDTA 3QF4A 4D6PA 3R24A 1MJGA 4LOIA 5K8JB 4B7XA 2P9ZA 3U48A 4AYWA 4ZPJA 3QUAA 1TEXA 4D3SA 1EP9A 1MGOA 3QMVA 3WQRA 4EYQA 2CNWD 1BNCA 3D5EA 3C8MA 3W7AA 5IAGA 3VDQA 2JFGA 1E2MA 1Z6XA 2CSXA 3R44A 3UB3A 1WBDA 2PPVA 3J81A 4FS3A 5E1OA 3IB6A 4LZAA 2DKFA 5JECA 2XPCA 2GBLA 3IELA 2E4XA 4OFWA 4EG8A 2PGAA 1M2VB 1ZUHA 3ZDQA 2PGIA 1A9SA 3CB4A 1G21B 1EUCB 1ACMA 1C50A 2BEVB 2OL4A 3IE2A 3T4UA 3N8IA 1V48A 2VHXA 1KWGA 3HG7A 5LUBA 2FPKA 1LDYA 4DY4A 1REQB 4NYIR 3TPFA 3ITNA 4RPJA 5GY7A 3VZRA 4YT8A 5JXIA 5DHPA 5KVCA 3QVMA 4TVBA 3WQQA 1LCIA 3TTVA 1MH9A 4OKIA 1G291 1XJWA 2BL4A 5LOVA 2ZRCA 1K7EB 2W6PA 1H8ED 1H0RA 4Z7OB 1YR9A 4NLLA 5K03A 1CVRA 1XZHA 4PG7A 3LPDA 1TE2A 3LPLA 3I6MA 5ITVA 4MAAA 2G8LA 1DRUA 3P9RA 1XQ1A 3R3WA 3CZ5A 1EFVB 1RAHA 2JFFA 1XK6A 3VDRA 1CIPA 3AKDA 5DB4A 2VRWA 3ZQJA 2YXNA 1XXLA 3GUVA 3UCFA 4B4DA 3CTPA 1U8FO 3B1JA 1T9BA 3OPVA 5EPUA 4IVNA 4M1EA 3WHPA 3VNRA 5MGNA 1BIFA 3I61A 5CM8B 1EVQA 5CPBA 5K9ZA 2Q27A 2IU4A 4GYYA 2Y0PA 4EA9A 5DSTA 4D9FA 1Q0TA 1JKMA 1OWPA 1BX1A 4XEUA 4BV3A 5G0UA 4ZVNA 4JVLA 1L3CA 2OV1A 2WM8A 2ZRPA 5E0OA 2XSZD 1H5UA 2H2AA 4L5AA 3KBOA 2OK7A 1GJRA 3KKNA 3DYVA 4UNPA 5DJ5A 3ZDZB 1UBHS 4LYJA 5BNFA 3JV7A 3T7TA 3QMMA 3EVCA 3QWHA 4P5EA 3RYHB 1GKUB 3EVNA 5KZMB 1GGNA 2DF8A 4S1PA 3P52A 1SVUA 4RY2A 3KHTA 4X45A 3ZV6A 4D4JA 5LQAA 3ENWA 4CLRA 1K06A 5JQGF 3VM6A 2CBGA 2QTVB 1JJVA 2ZCUA 4GWGA 4BB6A 3KZNA 1EDEA 2V7PA 3QVGA 5BUCA 4IDOA 3U3XA 5EJMA 4RFVA 1JSRA 1LFAA 1SVIA 4DMFA 4XYLA 3WGKA 2QRKA 4IGEA 3DCYA 2WR8A 5ER6A 4CKBA 1A4UA 4F9EA 1ZRMA 2GMWA 5LU9A 3HGMA 2JEYA 3UGJA 4URWR 5LA6A 5K5EA 4Z54A 4IDHA 1I24A 1L0BA 1Y7TA 3EEQA 4FQ8A 2EAUA 1UK9A 4G65A 4MINA 5CLHA 5BO5A 4EY6A 4A2WA 3D6AA 1IM5A 1PJBA 4PRLA 3FOZA 1NVTA 3QOWA 2PWAA 5BVHA 5ITSA 4RF2A 5KHLB 4KBGA 2ZYVX 4PQYA 4C01A 2IYZA 1F6WA 2R25B 3A9SA 2XMQA 1SKYE 5JAZA 2HSWA 5EFOA 4ZO6A 1K6MA 2C2ZA 3UT5A 3FDIA 2CDBA 1EZ4A 4BZZA 3DJFA 1APBA 4I3FA 1J7KA 4IIHA 4YO7A 2H85A 4RD2A 1Q1BA 4W4TA 2H3EA 4O8CA 2OK8A 2C5HA 3DUWA 1R0BA 2XHEA 3GRYA 2YUTA 1MVLA 4C88A 4OUDB 2I1QA 3UKDA 4QDUA 1EG7A 1XD8A 1ETUA 1X42A 4WGGA 4ZAWA 2WBLC 3O21A 3G0CA 3OHPA 1W2WB 1BVUA 3OPYA 2I1VB 2YZ7A 4G0QA 2GXSA 4NAUA 3SR3A 3WBJA 1FFCA 3ASUA 1HKUA 3K6RA 4N8SA 1QHEA 1P2FA 5BMVF 1XLWA 1NW4A 5A4KA 1WPGA 3EF1A 1YQGA 4XLTA 5ALQA 4Z2AA 4LE1A 3B9BA 5IWCA 1KJZA 2X0KA 5IJXA 2GN4A 2C88A 2PXHA 3ESDA 3LYAA 1JLRA 2RAVA 3MJEA 3RFUA 2DHCA 3N2YA 4Q9NA 2LCQA 2SECE 4G1VA 2CNKA 3TRKA 1HM5A 4XGNA 4A73A 3INNA 1QF6A 3KT8A 2AOXA 1NNI1 1XZGA 1H9AA 5EGNA 1FP2A 3FYDA 4PFQA 4EB6A 3HBJA 4FDTA 3B9QA 3ET5A 4YXWA 5BUQA 3DNPA 4C21A 2FHSA 4TMYA 1QGUA 3EDYA 4YTEA 3I5YA 3LY9A 1MF7A 1W46A 1YTLA 3G23A 1UZAA 2FW1A 3HU3A 3ICCA 4Y6GB 3BCHA 5C7LO 4DCGA 3V4LA 4EHAA 3TUJC 2C58A 4NE9A 4F12A 1KMHA 2Y0DA 3K0AA 3EJ6A 3AHCA 5IN4A 2Z3ZA 1D0SA 1YZUA 1SBCA 3BTSA 5BXQC 2OGWA 2B99A 2BYTA 3G2MA 4TT3A 2A1UA 4L76A 3RJTA 3G0HA 1WE2A 2J7PA 1NZJA 2WWTA 3EISA 2PEYA 1WDLA 3GUHA 5JNLA 3O8RA 4WN9A 4JOCA 1W4RA 1DPGA 4BNKA 3UMGA 1FBNA 2DCUA 1XELA 1C4WA 2IWHA 3ETLA 1JHOA 4UM5A 4TN5A 2PDAA 3FOCA 3GEGA 5ADHA 3SMVA 1A5AB 4JJ8A 1POWA 3ES9A 1JU3A 1M0SA 4WASA 1CQJA 2PMDA 2B3TA 3RANA 2KQUA 3MBOA 3V7YA 3B6JA 4GNKA 1O89A 2X6QA 2XGMA 1RVDA 3BHNA 1Z2PX 3IP9A 2B94A 2XMSA 1ZR2A 3BGDA 3ORRA 3VFDA 2DX7A 4KBYA 4UOQA 4DMRA 4I1IA 4UVGA 1E1RA 4F4CA 3SSAA 2IE0A 5DM4A 3TOVA 2X8JB 3L01A 1HF3A 1GU7A 3CLVA 5CIQA 2NYRA 4MV9A 5EYPB 4MKZA 1KNXA 1IXRC 1P19A 2WJVA 3U4QB 2PTGA 1NTRA 3GLHB 2OM6A 3OX3A 5CIWA 2YMLA 5CA0B 1XZAA 2DHQA 5AW1A 4MH0R 2DBQA 2CL5A 4QOIA 3UZUA 2CHEA 2XUOA 3FSGA 4PFSA 3UMSA 3O91A 4B3BA 3MHPA 3JD3A 1KI9A 1IY1A 4TWAA 4GPAA 2IZ7A 2XBLA 2PCJA 3PHGA 1AQNA 2XJ4A 3LUBA 4BC1A 2GASA 1I14A 1RCUA 2RGDA 2RKWA 4J07A 1EA5A 1P0CA 3QEJA 5AKJA 3WLSA 4N0QA 4RESA 3ZY5A 2ZETA 5K3CA 4QXAA 1W0KD 1CSEE 1PG0A 1V35A 3CH6A 3OOSA 1ODCA 3IJEB 4WKNA 4XGIA 5T4FA 1SA0A 1VL1A 3CJRA 1K8YB 3DZDA 3OQ6A 4PZCA 3TLKA 3CTMA 2AVNA 3ACCA 3PXBA 4ER7A 1T3ZA 5BT8A 3BL6A 2GO1A 4I6EA 4DILA 1JFSA 4YDRA 4A1OA 3IP1A 4MP3A 4MVJM 5CDFE 2WF5A 3TX2A 5I7FA 4TYNA 1IJFA 2RHJA 1KYTA 1WMDA 3EGDA 3GO4A 4ENVA 4FIZA 1E2HA 1WW2A 2A0WA 3IRVA 1B74A 2CXNA 3JX9A 2VJDA 3Q40A 5KKAA 4W7SA 4N3GA 3DS8A 4G25A 2A57A 3DMPA 3L4BC 1JJIA 5A4FS 1K1EA 2FWMX 4LNUA 4NEHB 3ZWXA 3HBMA 1GZ6A 1Z8DA 2OT3B 3G0IA 5CGZA 3V42A 2HJVA 4Z9YA 3RSHA 4L3WA 3WLFA 1KDVA 3ZCPA 4XJSA 3H5WA 5CGQB 3O7MA 3MTJA 4ZVOA 2J1LA 3FAZA 1YS9A 2JAWA 1SULA 2CJWA 2Q5CA 4K6MA 4NICA 1A8PA 1OX5A 5E4JA 5IVIA 4F72A 5JDCC 3ANTA 5IXJA 4LJYA 2FF7A 4ZICA 3TJRA 3V8BA 2IPXA 1AZLA 3UG6A 5GJBA 4IVQA 3U4CA 4DNQA 4JP5A 3O1HB 4QBTA 4D92A 2XMRA 3J7AC 4KQFA 1CKEA 5A4JA 3LCMA 2YJ4A 3D6MA 1RZ3A 1OXUA 4RA9B 4XH9B 4L8VA 3SF8A 5F2NA 1VHWA 3IEPA 4RD3A 1QC5A 4B83A 5I9MA 1FDRA 1YA4A 3BE6A 3H1BA 3RODA 2EW1A 4HLUA 3T99A 1QPBA 3FLMA 3T9EA 1KZ7B 5C8DA 1ZD1A 2O6HA 4IDDA 2ZT7A 1IRXA 3NG1A 4Z9FA 4ZT4A 2CXQA 5DM70 1FSGA 3N86A 4K6GA 3R7BA 4KYUA 2JI7A 4ED9A 2VHTA 2R8EA 3I0MA 3DOJA 4MEJA 5HF8A 5KOYA 1AU9A 2YXPX 3VKHA 2H6EA 3LMKA 2GK7A 5IAAA 5J5VA 1O08A 4COOA 5CNJA 2H5JA 2ZI9A 4WCVA 1IG3A 5K0JA 1YJ8A 3TRFA 1C4XA 3V5NA 4WCFA 2BMWA 3S99A 6ADHA 2C29D 2J48A 1EVZA 3KLOA 2FQWA 3I34X 1N2HA 1YKFA 1LEHA 4RCZA 2A0KA 2O0JA 5EPOA 1N6KA 4QZVA 4U9IS 5HM8A 5H82A 1U2GA 2ONZA 4WFKA 2ERXA 3DR3A 1W4AA 3PNKA 3DWGA 5C3MA 5F3WB 1F2TA 1OREA 1PG5A 2B78A 3ESCA 2Q5QA 1IN4A 3VGJA 1GSAA 4WDQA 4YECA 1T6BY 1E3WB 1Z2CA 2B8EA 3DMYA 4KC0A 4W5QA 4BJHB 4QG7A 2BCJQ 4BDSA 3FGPA 5AM2A 2OC4A 1LNQA 4MMYB 2EV9A 2N75A 1R6DA 2M6SA 1FFHA 3TFQA 5A04A 1X92A 2PIAA 4ND1A 3GG2A 3RIHA 2NPIA 2XYGA 1XIVA 2R7KA 1DADA 1DXHA 2H2DA 1IVSA 1YA8A 4K40A 2PBLA 2FPLA 2V97A 4TXMA 2JBWA 4PPNA 2VJOA 5JARA 5C8YF 2XA1A 4FKBA 1OLSB 3BWMA 3RREA 3E5HA 3W0LB 1H2RS 1SEVA 4RZQA 1NI4B 3SZOA 1YUBA 3WOHA 5JCXA 1PJRA 2UUCB 3DZBA 1M8FA 2ERCA 1PWXA 5H9VA 3TKAA 2RCYA 4QUEA 5AVRA 4P4GA 1NBMA 3W5SA 5E3HA 4L8YA 1NX9A 2FW7A 1KQPA 4U0KA 3TEMA 4AZVA 5EHZA 1V96A 1O97C 2JGJA 2ODNA 4JU9A 4GBED 4J1TA 3RUHA 3WSVA 4BRZA 5LNK6 3EODA 2QTTA 3OC6A 2HIMA 4UVEA 4Z2YA 1OBFO 5KDDA 2IYEA 3TAHA 1Z5ZA 4F8EA 4INAA 4ZYUA 1OB2A 2EU8A 3HQ4O 4LDJA 4LOLA 4URFA 1ZVQA 1RHKA 1IU9A 1U28A 3A3KA 1L5RA 1U0BB 3OA2A 4EJSC 3G0BA 2NZYA 1NVFA 3T4PA 1L5NA 4IHKA 4NU5A 4R40A 4IRUB 4UD2A 5JLJA 1SCUB 3GVIA 4Z51A 4WLFA 1ZSYA 1T4DA 2Z1NA 3I5AA 4ENTA 2M1XA 5CCBA 1YDGA 3NXKA 3ZWKA 4NFLA 1FF9A 2V59A 1ZX1A 2ENUA 3VH2A 5IJ0A 1U6JA 3V9AA 3LHFA 3EYAA 5K2MA 2IBSA 1P5ZB 3ZCSA 1AA6A 2IIVA 4LTDA 2MINB 5HMLA 2WU3A 1X1DA 2Q6IA 2AZXA 4L4XA 3DBLA 4X6LA 3LX4A 5K0CA 4R1QA 2XGJA 4U7PB 1RI3A 3JAKA 3HGQA 4UBLA 3KK0A 4Y1RA 1CF4A 3FBTA 2DJ5A 1QKKA 3I5MA 3PG5A 1J09A 2Y71A 1E8NA 1N0WA 2XCLA 5IULC 4IO0A 2BGKA 4B33A 4F11A 3L8CA 2O8BB 2XCIA 1JSZA 2ZJ0A 5DLEA 3VU8A 2YZMA 3HUEA 3PXEA 2P4UA 3H97A 2WIJA 4EHFA 4EY4A 3U3KA 5B6JA 1XXHA 4YXFA 3DZHA 2F8SA 1I5EA 2GETA 1MO6A 2CFTA 2G4VA 5JWHA 1PV4A 1Z17A 2A9OA 2ZZKA 3E9RA 2VAPA 3EXAA 2YW9A 2H1VA 3VMMA 4JB0A 5MGBA 1VPWA 3OIGA 2ZJAA 1QS0A 1AZSC 1V1MB 2R84A 1I80A 1TL7C 3LC0A 1T5HX 1SBYA 3NBXX 5LYJA 4ARUA 1X77A 3CURA 3GK3A 4L95C 3MUOA 5FO0A 4Y6LA 1JWLA 1U0OC 2B30A 3PEVA 2BBTA 2AR9A 1CE8A 4RA6B 2UYGA 3AEKA 3WL7A 2WABA 3HCWA 4B9EA 3LKBA 4MVYA 2AK3A 4N47A 2BFBB 4MHOA 5BQOA 3OTGA 4RJKA 4M0PA 4CM6A 2I55A 3MRTA 1E5VA 2WM9B 1JUDA 1JX6A 4MUKA 1A3CA 5AVKA 3DM9B 4H1TA 2FFBA 2YYSA 3R6WA 5DN6D 1O6GA 5M2QA 1JBQA 5CNIA 4RKFA 3J80A 3MWDB 4MW7A 1HV8A 2NZ2A 3FCCA 5J59A 1D8TA 1P2TA 3R7LA 4BO8A 4YMLA 1K7CA 1XAGA 5AKGA 1JIJA 4Q9IA 2QD5A 4QUIA 1QM5A 3H2SA 4JLOA 2ZTHA 2B1QA 2YY5A 4YVFA 3QWIA 3CSUA 1QOZA 4Y2SA 5EQTA 2D0OB 2GCGA 2QU7A 2Z3VA 4MB6A 4LSWA 1Z4QA 2JANA 2JGLA 4UW9A 1RRGA 2CL6X 2GCIA 1BEZA 4DZTA 1GQFA 2P9HA 3FGOA 1DHTA 1IXSB 2AZ4A 1OXBB 5FO1A 3ZD9A 4ND7A 5JMWA 4NHOA 1FQWA 2ZIAA 1BS2A 1PCXA 3CBGA 1G63A 3DQPA 4J0KA 4BRSA 4YCMA 3S2GA 3S0JA 2A5FA 2ECFA 1GZUA 2YRFA 5BV7A 3GG9A 1CHDA 3K2BA 2JRCA 3O1JC 2X86A 3UYKA 1UWLA 3DDOA 3NALA 2ZRQA 4I0WB 3VO9A 1LPPA 4AG3A 2C1XA 3LPCA 1NSYA 4L2IB 4LMAA 1HE3A 5K4HA 5DSXA 4FHEA 1CQXA 2YMPA 5FQOA 4CXMA 1C3XA 1PF7E 2VNJA 3GWGA 2K7ZA 5FWDA 4MUFA 3HH8A 4YH1A 5TEVA 4EPRA 5LN1A 4OY3A 2WWYA 3T54A 1JDVA 1WZCA 4KI7A 3RG2A 1IHDA 4TTQA 2ZT6A 4DCNA 4DV0B 2V1XA 3UFXB 2ZAOA 3FNFA 1E7QA 1N2IA 1Q0LA 2BEJA 2F3TA 3TEJA 2VH5R 1ESMA 2FMKA 1HTBA 2XQIA 4NC9A 1M2VA 3BEOA 2OXRA 5DO9A 4HC4A 4FFLA 1G21A 4GUDA 4MDYA 3ZNOA 1EUCA 2WHEA 3WRXC 2BEVA 2IP2A 3PQDA 4V0KA 3RHSA 5HSGA 2P5SA 4JB2A 3FTPA 4GVPA 4LQLA 4WE3A 1Y3BE 1DTWB 1GR1A 2FUNB 2IU3A 1REQA 2QVLA 2RK4A 3A4YA 4M46A 4BO7A 4EZEA 2GD2A 4CM3A 3HJNA 1J1IA 4ZVRA 5F9FA 3KS9A 2OENG 4LJRA 3HLKA 1EFTA 3R6DA 1JYFA 3W5VA 1M6EX 2F00A 4DCVA 3RRNA 3ZWBA 3DPIA 1OJLA 4OAQA 3USES 1PHRA 3NYIA 1C9NA 1FQJA 3SXPA 5BQPA 2FUKA 3Q41A 3FRHA 4CR8A 4YFVA 4YYEA 4NABA 2NP7A 3MQ2A 1EFVA 1RHRA 2EL7A 5HK8A 2Q4OA 3M6FA 4OOFA 2DPXA 1FSFA 1DT5A 1M1ZA 4H7PA 3ZZUA 4BFXA 3PXDA 1JU4A 2COKA 2XGSA 3OICA 5J4LA 3PZBA 1FTSA 3BA1A 2I29A 2QUZA 2I67A 1Y6QA 1WXFA 1H4QA 2B6HA 3EGXB 2QLNA 1N7HA 5G2OA 2X5OA 5G40A 4WLUA 3B3JA 4BZPA 2ZS8A 3IOMA 4C43A 7AT1A 2WVGA 2NQ8A 1G5RA 4D9IA 1J49A 4WXHA 3LQ2A 1IQPA 3P0IA 5HIJA 1HLGA 4Q12A 3C1OA 1UJ6A 1KI8A 3H2ZA 3D3JA 4A0FA 2A0UA 1EX7A 4B3TB 3IA2A 3EUEA 1NFFA 1YZTA 3RYHA 2SNIE 3SSMA 3P97A 1VSQA 2FN9A 2HK7A 3FF1A 3WWPA 4IJMA 1YZ3A 1I32A 4MRMB 1K7FB 1UZMA 2QTVA 3ONEA 4YJ3B 1STOA 4CPDA 4CUZA 6CHYA 3PD0A 4PGAA 4ECAA 3OKCA 4ZAVA 2PSDA 3CO5A 4RACA 5EZ6B 1NFRA 3FPCA 4JQYA 3BH7A 1J21A 3C4VA 1L1EA 4AL4A 3FHOA 3A9TA 3AZQA 4P86A 4XSHA 4K6FA 4YCSA 3PGJA 1N4DA 2NSLA 1RTTA 1L9XA 3DLPX 1PT7A 3N7TA 5JS7A 1S2GA 3MWYW 1ZJ4A 4PSUA 1YR3A 2PGNA 3TOCA 1VE1A 3FETA 2X0IA 1TYBE 3G5UA 3R0QA 4PEVA 3OU6A 1KO7A 4AWXA 2G08A 4IZHA 3H84A 2H7YA 2PN1A 4WOKA 5ALJA 2Q5LA 2H18A 3D8RA 4JGBA 4OA8A 4CCAA 3ADBA 4OHWA 1J5XA 2W2KB 1YKGA 4GPZA 2DQZA 1G60A 2NU9B 4DFDA 4ZAXA 4YP5A 1XMSA 2BMVA 3BVPA 2QUJA 3DWEX 3KAQA 2P9TA 1I9GA 4ID9A 2NPFA 2AD1A 2G9ZA 3EPPA 5EMMA 4YIHA 1MOZA 5IPFA 3L0IB 1J33A 1GNVA 3GT3A 4OUDA 2FZCA 2YDYA 1EUYA 1HFKA 1DO2A 1P8AA 1RM3A 5CH8A