3LIRA

Human mmp12 in complex with non-zinc chelating inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
b'MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Insights from selective non-phosphinic inhibitors of MMP-12 tailored to fit with an S1' loop canonical conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lirA00
3DNGA 4I35A 3WV2A 2X3BA 2KRJA 4DF9A 1EB6A 5BOYA 3HY7A 1OMJA 1K7QA 4G9LA 4PKRA 5D2BA 5I3MA 4IUWA 3TSKA 3KRYA 3HBUP 1EAKA 2OW0A 2MLRA 2DDYA 1EUBA 4GR0A 1OS9A 2WO8A 1XFYA 4EFSA 3LJGA 1HY7A 3UVCA 1B8YA 1CGFA 2OVZA 1C8TA 3DPEA 3WV3A 1YQYA 1Z3JA 3HBVP 3Q2HA 1SRPA 4FXYP 1ZXVA 1BQQM 1DTHA 1MNCA 1JH1A 3B92A 4GWMA 2W15A 5LABA 4FU4A 4H82A 1RMZA 1UTTA 3P1VA 4WKIA 3DL1A 2A8HA 2N8RA 1QIAA 4PKSA 4DV8A 1HFCA 4J4MA 3SHIA 1K7IA 3EDHA 1BSWA 5BPAA 3G42A 3N2UA 2W0DA 3LK8A 3U1RA 2JIHA 1CIZA 3KECA 1OM8A 1ZTQA 2MZHA 3CKIA 3AYUA 2DW1A 1J7NA 1Y0VA 3E8RA 3EWJA 3LUMA 1XFXA 3HY9A 4I03A 2L0RA 3AYKA 4H2EA 2O3EA 2DDFA 3LIRA 2OY4A 3Q2GA 5D1UA 2HU6A 2OXWA 1G49A 4H3XA 1IAGA 4WF6A 2XS3A 3KWVC 4XM7A 3NX7A 3L0TA 2E2DA 1GO8P 3O2XA 3P24A 5D1SA 2JNPA 3RTSA 2Z2DA 1YCMA 1XFVA 4A7BA 1BUDA 1WNIA 3EDGA 1PWQA 1IACA 1AKLA 1SLMA 3F17A 1A86A 1FBLA 2XS4A 3KMCA 3KMEA 2YB9A 3F1AA 2FV9A 966CA 1UEAA 1ASTA 2K9CA 5H8XA 4PKUA 4PKVA 1ZVXA 1CXVA 3VTGA 3F18A 4GR3A 5D1TA 4L63A 3LILA 1KAPP 2V4BA 2YIGA 1I76A 4H76A 3LJTA 1BM6A 1QUAA 2I47A 3LIKA 3LQBA 3B8ZA 1A85A 3EDIA 3LUNA 3DSLA 2PJTA 1HTDA 2POJA 1L6JA 1BIWA 1AF0A 1ROSA 2K2GA 3EDZA 1PWUA 4GUYA 4PKTA 4ZR5A 2JT5A 5D7WA 3HYGA 2QPJA 2RJQA 1OM6A 4FVLA 1I1IP 1R55A 2EROA 1O0TA 1CK7A 4IJOA 3KEKA 1Q3AA 3G5CA 3LKAA 1YOUA 3LGPA 1PWVA 1BZSA 2JT6A 2O36A 1UMTA 3DPFA 1HOVA 2J83A 4ON1A 3L0VA 5CXAA 1OO9A 3OHLA 1CGLA 3VI1A 2ERPA 830CA 2OW2A 2MLSA 4CTHA 1D8FA 3LEAA 1GKCA 3TVCA 4XBHA 3LE9A 3N2VA 1DMTA 3LQ0A 1D7XA 1PWPA 1XUCA 1B3DA 1IAEA 1JKYA 1R1HA 2RJPA 4GF1A 1QJIA 1XURA 1PWWA 3F19A 4L6TA 3RTTA 1H71P 2OW1A 4IN9A 1JIZA 4ILWD 3LMCA 3HDBA 1S4BP 1BKCE 1BKCI 3OHOA 4AIGA 4H30A 4WKEA 4XM8A 2ERQA 4XCTA 5I4OA 2OXZA 1JK3A 1UTZA 3F16A 1ZS0A 1OS2A 5I0LA 1YP1A 3K7NA 1GO7P 2D1NA 4FXQA 1SLNA 1JIWP 1GXDA 1KUKA 3B2ZA 1MMRA 5JMYA 1GE6A 2AIGP 2Y6DA 1JAOA 1GE5A 2CKIA 3ZVSA 3I7GA 3TT4A 1ATLA 3F15A 2OXUA 1KBCA 4HX3A 2J0TA 5L7FA 1KUIA 3EHXA 1Y8JA 2DW2A 2JSDA 5L79A 456CA 1IAAA 2OZRA 4AXQA 1KUHA 3KEJA 1KUFA 4PKWA 1KUGA 1ND1A 1XUDA 1CGEA 3K7LA 3AIGA 4DD8A 5I43A 3ZUKA 4DPEA 5B5OA 3I7IA 5BOTA 1C7KA 5D3CA 2E3XA 3BA0A 1QJJA 1G4KA 1BQOA 4AYKA 3ZXHA 2X3CA 1XFZA 2Y6CA 1XFUA 4QKZA 3KHIA 3DWBA 5B5PA 3V96B 1XFWA 1O0QA 1Y93A 4XM6A 1JAPA 1FLSA 1D5JA 1ZXCA 2X3AA 3HDAP 2CLTA 4GQLA 3O64A 4WZVA 2FV5A 1G9KA 1MMPA 3LJZA 1G05A 1GKDA 3ELMA 1MMBA 2DW0A 4PKQA 1R54A 1R1JA 2TCLA 1K7GA 4JIJA 1C3IA 3GBOA 1MMQA 2OW9A 1JJ9A 5CUHA 1BKCA 1SATA 2MZIA 4Q1LA 4H84A 1HFSA 4JQGA 1GE7A 1HV5A 4GR8A 3TS4A 4HMAA 4JPAA 2W12A 1D8MA 2OY2A 4JA1A 3WV1A 2WOAA 1I73A 1QIBA 1OM7A 4H1QA 2W13A 4JP4A 3USNA 5I12A 5CZMA 4L19A 2OVXA 2MZEA 1CQRA 3EHYA 4AUOA 1G12A 1IADA 2X7MA 4H49A 4G0DA 2AYKA 1IABA 2USNA 3MA2A 1USNA 1JANA 1FM1A 1SU3A 1CAQA 3HB2P 1R1IA 4WK7A 4GWNA 1SMPA 4A3WA 2D1OA 4R3VA 2W14A 2OI0A 2SRTA 1UMSA 1QICA 1BUVM 1AYKA 2WO9A 5I2ZA 1ZP5A 1JAQA 1RM8A
chains in the Genus database with same CATH superfamily
3DNGA 4I35A 3WV2A 2X3BA 2KRJA 4DF9A 1EB6A 5BOYA 3HY7A 1OMJA 1K7QA 4G9LA 4PKRA 5D2BA 5I3MA 4IUWA 3TSKA 3KRYA 3HBUP 1EAKA 2OW0A 2MLRA 2DDYA 1EUBA 4GR0A 1OS9A 2WO8A 1XFYA 4EFSA 3LJGA 1HY7A 3UVCA 1B8YA 1CGFA 2OVZA 1C8TA 3DPEA 3WV3A 1YQYA 1Z3JA 3HBVP 3Q2HA 1SRPA 4FXYP 1ZXVA 1BQQM 1DTHA 1TVIA 1MNCA 1JH1A 3B92A 4GWMA 2W15A 5LABA 4FU4A 4H82A 1RMZA 1UTTA 3P1VA 4WKIA 3DL1A 2A8HA 2N8RA 1QIAA 4PKSA 4DV8A 1HFCA 4J4MA 3SHIA 1K7IA 3EDHA 1BSWA 5BPAA 3G42A 3N2UA 2W0DA 3LK8A 3U1RA 2JIHA 1CIZA 3KECA 1OM8A 1ZTQA 2MZHA 3CKIA 3AYUA 2DW1A 1J7NA 1Y0VA 3E8RA 3EWJA 3LUMA 1XFXA 3HY9A 4I03A 3DTEA 2L0RA 3AYKA 4H2EA 2O3EA 2DDFA 3LIRA 2OY4A 3Q2GA 5D1UA 2HU6A 2OXWA 1G49A 4H3XA 1IAGA 4WF6A 2XS3A 3KWVC 4XM7A 3NX7A 3L0TA 2E2DA 1GO8P 3O2XA 3P24A 5D1SA 2JNPA 3RTSA 2Z2DA 1YCMA 1XFVA 4A7BA 1BUDA 1WNIA 4L7AA 3EDGA 1PWQA 1IACA 1AKLA 1SLMA 3F17A 1A86A 1FBLA 2XS4A 3KMCA 3KMEA 2YB9A 3F1AA 2FV9A 966CA 1UEAA 1ASTA 2K9CA 5H8XA 4PKUA 4PKVA 1ZVXA 1CXVA 3VTGA 3F18A 4GR3A 5D1TA 4L63A 3LILA 1KAPP 2V4BA 2YIGA 1I76A 4H76A 3LJTA 1BM6A 1QUAA 2I47A 3LIKA 3LQBA 3B8ZA 1A85A 3EDIA 3LUNA 3DSLA 2PJTA 1HTDA 2POJA 1L6JA 1BIWA 1AF0A 1ROSA 2K2GA 3EDZA 1PWUA 4GUYA 4PKTA 4ZR5A 2JT5A 5D7WA 3HYGA 2QPJA 2RJQA 1OM6A 4FVLA 1I1IP 1R55A 2EROA 1O0TA 1CK7A 4IJOA 3KEKA 1Q3AA 3G5CA 3LKAA 1YOUA 3LGPA 1PWVA 1BZSA 2JT6A 2O36A 1UMTA 3DPFA 1HOVA 2J83A 4ON1A 3L0VA 5CXAA 1OO9A 3OHLA 1CGLA 3VI1A 2ERPA 830CA 2OW2A 2MLSA 4CTHA 1D8FA 3LEAA 1GKCA 3TVCA 4XBHA 3LE9A 3N2VA 1DMTA 3LQ0A 3DTIA 1D7XA 1PWPA 1XUCA 1B3DA 1IAEA 1JKYA 1R1HA 2RJPA 4GF1A 1QJIA 1XURA 1PWWA 3F19A 4L6TA 3RTTA 1OZ9A 1H71P 2OW1A 4IN9A 1JIZA 4ILWD 3LMCA 3HDBA 1S4BP 1BKCE 1BKCI 3OHOA 4AIGA 4H30A 4WKEA 4XM8A 2ERQA 4XCTA 5I4OA 2OXZA 1JK3A 1UTZA 3F16A 1ZS0A 1OS2A 5I0LA 1YP1A 3K7NA 1GO7P 2D1NA 4FXQA 1SLNA 1JIWP 1GXDA 1KUKA 3B2ZA 1MMRA 1XM5A 5JMYA 1GE6A 2AIGP 2Y6DA 1JAOA 1GE5A 2CKIA 3ZVSA 3I7GA 3TT4A 1ATLA 3F15A 2OXUA 1KBCA 4HX3A 2J0TA 5L7FA 1KUIA 3EHXA 1Y8JA 2DW2A 2JSDA 5L79A 456CA 1IAAA 2OZRA 4AXQA 1KUHA 3KEJA 1KUFA 3DTKA 4PKWA 1KUGA 1ND1A 1XUDA 2YUFA 1CGEA 3K7LA 3AIGA 4DD8A 5I43A 3ZUKA 4DPEA 5B5OA 3I7IA 5BOTA 1C7KA 5D3CA 2E3XA 3BA0A 1QJJA 1G4KA 1BQOA 4AYKA 3ZXHA 2X3CA 1XFZA 2Y6CA 1XFUA 4QKZA 3KHIA 3DWBA 5B5PA 3V96B 1XFWA 1O0QA 1Y93A 4XM6A 1JAPA 1FLSA 1D5JA 1ZXCA 2X3AA 3HDAP 2CLTA 4GQLA 3O64A 4WZVA 2FV5A 1G9KA 1XAXA 1MMPA 3LJZA 1G05A 1GKDA 3ELMA 1MMBA 2DW0A 4PKQA 1R54A 1R1JA 2TCLA 1K7GA 4JIJA 1C3IA 3GBOA 1MMQA 2OW9A 1JJ9A 5CUHA 1BKCA 1SATA 2MZIA 4Q1LA 4H84A 1HFSA 4JQGA 1GE7A 1HV5A 4GR8A 3TS4A 4HMAA 4JPAA 2W12A 1D8MA 2OY2A 4JA1A 3WV1A 2WOAA 1I73A 1QIBA 1OM7A 4H1QA 2W13A 4JP4A 3USNA 5I12A 5CZMA 4L19A 2OVXA 2MZEA 1CQRA 3EHYA 4AUOA 1G12A 1IADA 2X7MA 4H49A 4G0DA 2AYKA 1IABA 2USNA 3MA2A 1USNA 1JANA 1FM1A 1SU3A 1CAQA 3HB2P 1R1IA 4WK7A 4GWNA 1SMPA 4A3WA 2D1OA 4R3VA 2W14A 2OI0A 2SRTA 1UMSA 1QICA 1BUVM 1AYKA 2WO9A 5I2ZA 1ZP5A 1JAQA 1RM8A
chains in the Genus database with same CATH topology
3DNGA 4I35A 3WV2A 2X3BA 2KRJA 4DF9A 1EB6A 5BOYA 3HY7A 1OMJA 1K7QA 4G9LA 4PKRA 5D2BA 5I3MA 4IUWA 3TSKA 3KRYA 3HBUP 1EAKA 2OW0A 2MLRA 2DDYA 1EUBA 4GR0A 1OS9A 2WO8A 1XFYA 4EFSA 3LJGA 1HY7A 3UVCA 1B8YA 1CGFA 2OVZA 1C8TA 3DPEA 3WV3A 1YQYA 1Z3JA 3HBVP 3Q2HA 1SRPA 4FXYP 1ZXVA 1BQQM 1DTHA 1MNCA 1JH1A 3B92A 4GWMA 2W15A 5LABA 4FU4A 4H82A 1RMZA 1UTTA 3P1VA 4WKIA 3DL1A 2A8HA 2N8RA 1QIAA 4PKSA 4DV8A 1HFCA 4J4MA 3SHIA 1K7IA 3EDHA 1BSWA 5BPAA 3G42A 3N2UA 2W0DA 3LK8A 3U1RA 2JIHA 1CIZA 3KECA 1OM8A 1ZTQA 2MZHA 3CKIA 3AYUA 2DW1A 1J7NA 1Y0VA 3E8RA 3EWJA 3LUMA 1XFXA 3HY9A 4I03A 3DTEA 2L0RA 3AYKA 4H2EA 2O3EA 2DDFA 3LIRA 2OY4A 3Q2GA 5D1UA 2HU6A 2OXWA 1G49A 4H3XA 1IAGA 4WF6A 2XS3A 3KWVC 4XM7A 3NX7A 3L0TA 2E2DA 1GO8P 3O2XA 3P24A 5D1SA 2JNPA 3RTSA 2Z2DA 1YCMA 1XFVA 4A7BA 1BUDA 1WNIA 4L7AA 3EDGA 1PWQA 1IACA 1AKLA 1SLMA 3F17A 1A86A 1FBLA 2XS4A 3KMCA 3KMEA 2YB9A 3F1AA 2FV9A 966CA 1UEAA 1ASTA 2K9CA 5H8XA 4PKUA 4PKVA 1ZVXA 1CXVA 3VTGA 3F18A 4GR3A 5D1TA 4L63A 3LILA 1KAPP 2V4BA 2YIGA 1I76A 4H76A 3LJTA 1BM6A 1QUAA 2I47A 3LIKA 3LQBA 3B8ZA 1A85A 3EDIA 3LUNA 3DSLA 2PJTA 1HTDA 2POJA 1L6JA 1BIWA 1AF0A 1ROSA 2K2GA 3EDZA 1PWUA 4GUYA 4PKTA 4ZR5A 2JT5A 5D7WA 3HYGA 2QPJA 2RJQA 1OM6A 4FVLA 1I1IP 1R55A 2EROA 1O0TA 1CK7A 4IJOA 3KEKA 1Q3AA 3G5CA 3LKAA 1YOUA 3LGPA 1PWVA 1BZSA 2JT6A 2O36A 1UMTA 3DPFA 1HOVA 2J83A 4ON1A 3L0VA 5CXAA 1OO9A 3OHLA 1CGLA 3VI1A 2ERPA 830CA 2OW2A 2MLSA 4CTHA 1D8FA 3LEAA 1GKCA 3TVCA 4XBHA 3LE9A 3N2VA 1DMTA 3LQ0A 3DTIA 1D7XA 1PWPA 1XUCA 1B3DA 1IAEA 1JKYA 1R1HA 2RJPA 4GF1A 1QJIA 1XURA 1PWWA 3F19A 4L6TA 3RTTA 1H71P 2OW1A 4IN9A 1JIZA 4ILWD 3LMCA 3HDBA 1S4BP 1BKCE 1BKCI 3OHOA 4AIGA 4H30A 4WKEA 4XM8A 2ERQA 4XCTA 5I4OA 2OXZA 1JK3A 1UTZA 3F16A 1ZS0A 1OS2A 5I0LA 1YP1A 3K7NA 1GO7P 2D1NA 4FXQA 1SLNA 1JIWP 1GXDA 1KUKA 3B2ZA 1MMRA 5JMYA 1GE6A 2AIGP 2Y6DA 1JAOA 1GE5A 2CKIA 3ZVSA 3I7GA 3TT4A 1ATLA 3F15A 2OXUA 1KBCA 4HX3A 2J0TA 5L7FA 1KUIA 3EHXA 1Y8JA 2DW2A 2JSDA 5L79A 456CA 1IAAA 2OZRA 4AXQA 1KUHA 3KEJA 1KUFA 3DTKA 4PKWA 1KUGA 1ND1A 1XUDA 2YUFA 1CGEA 3K7LA 3AIGA 4DD8A 5I43A 3ZUKA 4DPEA 5B5OA 3I7IA 5BOTA 1C7KA 5D3CA 2E3XA 3BA0A 1QJJA 1G4KA 1BQOA 4AYKA 3ZXHA 2X3CA 1XFZA 2Y6CA 1XFUA 4QKZA 3KHIA 3DWBA 5B5PA 3V96B 1XFWA 1O0QA 1Y93A 4XM6A 1JAPA 1FLSA 1D5JA 1ZXCA 2X3AA 3HDAP 2CLTA 4GQLA 3O64A 4WZVA 2FV5A 1G9KA 1MMPA 3LJZA 1G05A 1GKDA 3ELMA 1MMBA 2DW0A 4PKQA 1R54A 1R1JA 2TCLA 1K7GA 4JIJA 1C3IA 3GBOA 1MMQA 2OW9A 1JJ9A 5CUHA 1BKCA 1SATA 2MZIA 4Q1LA 4H84A 1HFSA 4JQGA 1GE7A 1HV5A 4GR8A 3TS4A 4HMAA 4JPAA 2W12A 1D8MA 2OY2A 4JA1A 3WV1A 2WOAA 1I73A 1QIBA 1OM7A 4H1QA 2W13A 4JP4A 3USNA 5I12A 5CZMA 4L19A 2OVXA 2MZEA 1CQRA 3EHYA 4AUOA 1G12A 1IADA 2X7MA 4H49A 4G0DA 2AYKA 1IABA 2USNA 3MA2A 1USNA 1JANA 1FM1A 1SU3A 1CAQA 3HB2P 1R1IA 4WK7A 4GWNA 1SMPA 4A3WA 2D1OA 4R3VA 2W14A 2OI0A 2SRTA 1UMSA 1QICA 1BUVM 1AYKA 2WO9A 5I2ZA 1ZP5A 1JAQA 1RM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DNG A;  4I35 A;  3WV2 A;  2X3B A;  2KRJ A;  4DF9 A;  1EB6 A;  5BOY A;  3HY7 A;  1OMJ A;  1K7Q A;  4G9L A;  4PKR A;  5D2B A;  5I3M A;  4IUW A;  3TSK A;  3KRY A;  3HBU P;  1EAK A;  2OW0 A;  2MLR A;  2DDY A;  1EUB A;  4GR0 A;  1OS9 A;  2WO8 A;  1XFY A;  4EFS A;  3LJG A;  1HY7 A;  3UVC A;  1B8Y A;  1CGF A;  2OVZ A;  1C8T A;  3DPE A;  3WV3 A;  1YQY A;  1Z3J A;  3HBV P;  3Q2H A;  1SRP A;  4FXY P;  1ZXV A;  1BQQ M;  1DTH A;  1MNC A;  1JH1 A;  3B92 A;  4GWM A;  2W15 A;  5LAB A;  4FU4 A;  4H82 A;  1RMZ A;  1UTT A;  3P1V A;  4WKI A;  3DL1 A;  2A8H A;  2N8R A;  1QIA A;  4PKS A;  4DV8 A;  1HFC A;  4J4M A;  3SHI A;  1K7I A;  3EDH A;  1BSW A;  5BPA A;  3G42 A;  3N2U A;  2W0D A;  3LK8 A;  3U1R A;  2JIH A;  1CIZ A;  3KEC A;  1OM8 A;  1ZTQ A;  2MZH A;  3CKI A;  3AYU A;  2DW1 A;  1J7N A;  1Y0V A;  3E8R A;  3EWJ A;  3LUM A;  1XFX A;  3HY9 A;  4I03 A;  2L0R A;  3AYK A;  4H2E A;  2O3E A;  2DDF A;  3LIR A;  2OY4 A;  3Q2G A;  5D1U A;  2HU6 A;  2OXW A;  1G49 A;  4H3X A;  1IAG A;  4WF6 A;  2XS3 A;  3KWV C;  4XM7 A;  3NX7 A;  3L0T A;  2E2D A;  1GO8 P;  3O2X A;  3P24 A;  5D1S A;  2JNP A;  3RTS A;  2Z2D A;  1YCM A;  1XFV A;  4A7B A;  1BUD A;  1WNI A;  3EDG A;  1PWQ A;  1IAC A;  1AKL A;  1SLM A;  3F17 A;  1A86 A;  1FBL A;  2XS4 A;  3KMC A;  3KME A;  2YB9 A;  3F1A A;  2FV9 A;  966C A;  1UEA A;  1AST A;  2K9C A;  5H8X A;  4PKU A;  4PKV A;  1ZVX A;  1CXV A;  3VTG A;  3F18 A;  4GR3 A;  5D1T A;  4L63 A;  3LIL A;  1KAP P;  2V4B A;  2YIG A;  1I76 A;  4H76 A;  3LJT A;  1BM6 A;  1QUA A;  2I47 A;  3LIK A;  3LQB A;  3B8Z A;  1A85 A;  3EDI A;  3LUN A;  3DSL A;  2PJT A;  1HTD A;  2POJ A;  1L6J A;  1BIW A;  1AF0 A;  1ROS A;  2K2G A;  3EDZ A;  1PWU A;  4GUY A;  4PKT A;  4ZR5 A;  2JT5 A;  5D7W A;  3HYG A;  2QPJ A;  2RJQ A;  1OM6 A;  4FVL A;  1I1I P;  1R55 A;  2ERO A;  1O0T A;  1CK7 A;  4IJO A;  3KEK A;  1Q3A A;  3G5C A;  3LKA A;  1YOU A;  3LGP A;  1PWV A;  1BZS A;  2JT6 A;  2O36 A;  1UMT A;  3DPF A;  1HOV A;  2J83 A;  4ON1 A;  3L0V A;  5CXA A;  1OO9 A;  3OHL A;  1CGL A;  3VI1 A;  2ERP A;  830C A;  2OW2 A;  2MLS A;  4CTH A;  1D8F A;  3LEA A;  1GKC A;  3TVC A;  4XBH A;  3LE9 A;  3N2V A;  1DMT A;  3LQ0 A;  1D7X A;  1PWP A;  1XUC A;  1B3D A;  1IAE A;  1JKY A;  1R1H A;  2RJP A;  4GF1 A;  1QJI A;  1XUR A;  1PWW A;  3F19 A;  4L6T A;  3RTT A;  1H71 P;  2OW1 A;  4IN9 A;  1JIZ A;  4ILW D;  3LMC A;  3HDB A;  1S4B P;  1BKC E;  1BKC I;  3OHO A;  4AIG A;  4H30 A;  4WKE A;  4XM8 A;  2ERQ A;  4XCT A;  5I4O A;  2OXZ A;  1JK3 A;  1UTZ A;  3F16 A;  1ZS0 A;  1OS2 A;  5I0L A;  1YP1 A;  3K7N A;  1GO7 P;  2D1N A;  4FXQ A;  1SLN A;  1JIW P;  1GXD A;  1KUK A;  3B2Z A;  1MMR A;  5JMY A;  1GE6 A;  2AIG P;  2Y6D A;  1JAO A;  1GE5 A;  2CKI A;  3ZVS A;  3I7G A;  3TT4 A;  1ATL A;  3F15 A;  2OXU A;  1KBC A;  4HX3 A;  2J0T A;  5L7F A;  1KUI A;  3EHX A;  1Y8J A;  2DW2 A;  2JSD A;  5L79 A;  456C A;  1IAA A;  2OZR A;  4AXQ A;  1KUH A;  3KEJ A;  1KUF A;  4PKW A;  1KUG A;  1ND1 A;  1XUD A;  1CGE A;  3K7L A;  3AIG A;  4DD8 A;  5I43 A;  3ZUK A;  4DPE A;  5B5O A;  3I7I A;  5BOT A;  1C7K A;  5D3C A;  2E3X A;  3BA0 A;  1QJJ A;  1G4K A;  1BQO A;  4AYK A;  3ZXH A;  2X3C A;  1XFZ A;  2Y6C A;  1XFU A;  4QKZ A;  3KHI A;  3DWB A;  5B5P A;  3V96 B;  1XFW A;  1O0Q A;  1Y93 A;  4XM6 A;  1JAP A;  1FLS A;  1D5J A;  1ZXC A;  2X3A A;  3HDA P;  2CLT A;  4GQL A;  3O64 A;  4WZV A;  2FV5 A;  1G9K A;  1MMP A;  3LJZ A;  1G05 A;  1GKD A;  3ELM A;  1MMB A;  2DW0 A;  4PKQ A;  1R54 A;  1R1J A;  2TCL A;  1K7G A;  4JIJ A;  1C3I A;  3GBO A;  1MMQ A;  2OW9 A;  1JJ9 A;  5CUH A;  1BKC A;  1SAT A;  2MZI A;  4Q1L A;  4H84 A;  1HFS A;  4JQG A;  1GE7 A;  1HV5 A;  4GR8 A;  3TS4 A;  4HMA A;  4JPA A;  2W12 A;  1D8M A;  2OY2 A;  4JA1 A;  3WV1 A;  2WOA A;  1I73 A;  1QIB A;  1OM7 A;  4H1Q A;  2W13 A;  4JP4 A;  3USN A;  5I12 A;  5CZM A;  4L19 A;  2OVX A;  2MZE A;  1CQR A;  3EHY A;  4AUO A;  1G12 A;  1IAD A;  2X7M A;  4H49 A;  4G0D A;  2AYK A;  1IAB A;  2USN A;  3MA2 A;  1USN A;  1JAN A;  1FM1 A;  1SU3 A;  1CAQ A;  3HB2 P;  1R1I A;  4WK7 A;  4GWN A;  1SMP A;  4A3W A;  2D1O A;  4R3V A;  2W14 A;  2OI0 A;  2SRT A;  1UMS A;  1QIC A;  1BUV M;  1AYK A;  2WO9 A;  5I2Z A;  1ZP5 A;  1JAQ A;  1RM8 A; 
#chains in the Genus database with same CATH topology
 3DNG A;  4I35 A;  3WV2 A;  2X3B A;  2KRJ A;  4DF9 A;  1EB6 A;  5BOY A;  3HY7 A;  1OMJ A;  1K7Q A;  4G9L A;  4PKR A;  5D2B A;  5I3M A;  4IUW A;  3TSK A;  3KRY A;  3HBU P;  1EAK A;  2OW0 A;  2MLR A;  2DDY A;  1EUB A;  4GR0 A;  1OS9 A;  2WO8 A;  1XFY A;  4EFS A;  3LJG A;  1HY7 A;  3UVC A;  1B8Y A;  1CGF A;  2OVZ A;  1C8T A;  3DPE A;  3WV3 A;  1YQY A;  1Z3J A;  3HBV P;  3Q2H A;  1SRP A;  4FXY P;  1ZXV A;  1BQQ M;  1DTH A;  1TVI A;  1MNC A;  1JH1 A;  3B92 A;  4GWM A;  2W15 A;  5LAB A;  4FU4 A;  4H82 A;  1RMZ A;  1UTT A;  3P1V A;  4WKI A;  3DL1 A;  2A8H A;  2N8R A;  1QIA A;  4PKS A;  4DV8 A;  1HFC A;  4J4M A;  3SHI A;  1K7I A;  3EDH A;  1BSW A;  5BPA A;  3G42 A;  3N2U A;  2W0D A;  3LK8 A;  3U1R A;  2JIH A;  1CIZ A;  3KEC A;  1OM8 A;  1ZTQ A;  2MZH A;  3CKI A;  3AYU A;  2DW1 A;  1J7N A;  1Y0V A;  3E8R A;  3EWJ A;  3LUM A;  1XFX A;  3HY9 A;  4I03 A;  3DTE A;  2L0R A;  3AYK A;  4H2E A;  2O3E A;  2DDF A;  3LIR A;  2OY4 A;  3Q2G A;  5D1U A;  2HU6 A;  2OXW A;  1G49 A;  4H3X A;  1IAG A;  4WF6 A;  2XS3 A;  3KWV C;  4XM7 A;  3NX7 A;  3L0T A;  2E2D A;  1GO8 P;  3O2X A;  3P24 A;  5D1S A;  2JNP A;  3RTS A;  2Z2D A;  1YCM A;  1XFV A;  4A7B A;  1BUD A;  1WNI A;  4L7A A;  3EDG A;  1PWQ A;  1IAC A;  1AKL A;  1SLM A;  3F17 A;  1A86 A;  1FBL A;  2XS4 A;  3KMC A;  3KME A;  2YB9 A;  3F1A A;  2FV9 A;  966C A;  1UEA A;  1AST A;  2K9C A;  5H8X A;  4PKU A;  4PKV A;  1ZVX A;  1CXV A;  3VTG A;  3F18 A;  4GR3 A;  5D1T A;  4L63 A;  3LIL A;  1KAP P;  2V4B A;  2YIG A;  1I76 A;  4H76 A;  3LJT A;  1BM6 A;  1QUA A;  2I47 A;  3LIK A;  3LQB A;  3B8Z A;  1A85 A;  3EDI A;  3LUN A;  3DSL A;  2PJT A;  1HTD A;  2POJ A;  1L6J A;  1BIW A;  1AF0 A;  1ROS A;  2K2G A;  3EDZ A;  1PWU A;  4GUY A;  4PKT A;  4ZR5 A;  2JT5 A;  5D7W A;  3HYG A;  2QPJ A;  2RJQ A;  1OM6 A;  4FVL A;  1I1I P;  1R55 A;  2ERO A;  1O0T A;  1CK7 A;  4IJO A;  3KEK A;  1Q3A A;  3G5C A;  3LKA A;  1YOU A;  3LGP A;  1PWV A;  1BZS A;  2JT6 A;  2O36 A;  1UMT A;  3DPF A;  1HOV A;  2J83 A;  4ON1 A;  3L0V A;  5CXA A;  1OO9 A;  3OHL A;  1CGL A;  3VI1 A;  2ERP A;  830C A;  2OW2 A;  2MLS A;  4CTH A;  1D8F A;  3LEA A;  1GKC A;  3TVC A;  4XBH A;  3LE9 A;  3N2V A;  1DMT A;  3LQ0 A;  3DTI A;  1D7X A;  1PWP A;  1XUC A;  1B3D A;  1IAE A;  1JKY A;  1R1H A;  2RJP A;  4GF1 A;  1QJI A;  1XUR A;  1PWW A;  3F19 A;  4L6T A;  3RTT A;  1OZ9 A;  1H71 P;  2OW1 A;  4IN9 A;  1JIZ A;  4ILW D;  3LMC A;  3HDB A;  1S4B P;  1BKC E;  1BKC I;  3OHO A;  4AIG A;  4H30 A;  4WKE A;  4XM8 A;  2ERQ A;  4XCT A;  5I4O A;  2OXZ A;  1JK3 A;  1UTZ A;  3F16 A;  1ZS0 A;  1OS2 A;  5I0L A;  1YP1 A;  3K7N A;  1GO7 P;  2D1N A;  4FXQ A;  1SLN A;  1JIW P;  1GXD A;  1KUK A;  3B2Z A;  1MMR A;  1XM5 A;  5JMY A;  1GE6 A;  2AIG P;  2Y6D A;  1JAO A;  1GE5 A;  2CKI A;  3ZVS A;  3I7G A;  3TT4 A;  1ATL A;  3F15 A;  2OXU A;  1KBC A;  4HX3 A;  2J0T A;  5L7F A;  1KUI A;  3EHX A;  1Y8J A;  2DW2 A;  2JSD A;  5L79 A;  456C A;  1IAA A;  2OZR A;  4AXQ A;  1KUH A;  3KEJ A;  1KUF A;  3DTK A;  4PKW A;  1KUG A;  1ND1 A;  1XUD A;  2YUF A;  1CGE A;  3K7L A;  3AIG A;  4DD8 A;  5I43 A;  3ZUK A;  4DPE A;  5B5O A;  3I7I A;  5BOT A;  1C7K A;  5D3C A;  2E3X A;  3BA0 A;  1QJJ A;  1G4K A;  1BQO A;  4AYK A;  3ZXH A;  2X3C A;  1XFZ A;  2Y6C A;  1XFU A;  4QKZ A;  3KHI A;  3DWB A;  5B5P A;  3V96 B;  1XFW A;  1O0Q A;  1Y93 A;  4XM6 A;  1JAP A;  1FLS A;  1D5J A;  1ZXC A;  2X3A A;  3HDA P;  2CLT A;  4GQL A;  3O64 A;  4WZV A;  2FV5 A;  1G9K A;  1XAX A;  1MMP A;  3LJZ A;  1G05 A;  1GKD A;  3ELM A;  1MMB A;  2DW0 A;  4PKQ A;  1R54 A;  1R1J A;  2TCL A;  1K7G A;  4JIJ A;  1C3I A;  3GBO A;  1MMQ A;  2OW9 A;  1JJ9 A;  5CUH A;  1BKC A;  1SAT A;  2MZI A;  4Q1L A;  4H84 A;  1HFS A;  4JQG A;  1GE7 A;  1HV5 A;  4GR8 A;  3TS4 A;  4HMA A;  4JPA A;  2W12 A;  1D8M A;  2OY2 A;  4JA1 A;  3WV1 A;  2WOA A;  1I73 A;  1QIB A;  1OM7 A;  4H1Q A;  2W13 A;  4JP4 A;  3USN A;  5I12 A;  5CZM A;  4L19 A;  2OVX A;  2MZE A;  1CQR A;  3EHY A;  4AUO A;  1G12 A;  1IAD A;  2X7M A;  4H49 A;  4G0D A;  2AYK A;  1IAB A;  2USN A;  3MA2 A;  1USN A;  1JAN A;  1FM1 A;  1SU3 A;  1CAQ A;  3HB2 P;  1R1I A;  4WK7 A;  4GWN A;  1SMP A;  4A3W A;  2D1O A;  4R3V A;  2W14 A;  2OI0 A;  2SRT A;  1UMS A;  1QIC A;  1BUV M;  1AYK A;  2WO9 A;  5I2Z A;  1ZP5 A;  1JAQ A;  1RM8 A; 
#chains in the Genus database with same CATH homology
 3DNG A;  4I35 A;  3WV2 A;  2X3B A;  2KRJ A;  4DF9 A;  1EB6 A;  5BOY A;  3HY7 A;  1OMJ A;  1K7Q A;  4G9L A;  4PKR A;  5D2B A;  5I3M A;  4IUW A;  3TSK A;  3KRY A;  3HBU P;  1EAK A;  2OW0 A;  2MLR A;  2DDY A;  1EUB A;  4GR0 A;  1OS9 A;  2WO8 A;  1XFY A;  4EFS A;  3LJG A;  1HY7 A;  3UVC A;  1B8Y A;  1CGF A;  2OVZ A;  1C8T A;  3DPE A;  3WV3 A;  1YQY A;  1Z3J A;  3HBV P;  3Q2H A;  1SRP A;  4FXY P;  1ZXV A;  1BQQ M;  1DTH A;  1MNC A;  1JH1 A;  3B92 A;  4GWM A;  2W15 A;  5LAB A;  4FU4 A;  4H82 A;  1RMZ A;  1UTT A;  3P1V A;  4WKI A;  3DL1 A;  2A8H A;  2N8R A;  1QIA A;  4PKS A;  4DV8 A;  1HFC A;  4J4M A;  3SHI A;  1K7I A;  3EDH A;  1BSW A;  5BPA A;  3G42 A;  3N2U A;  2W0D A;  3LK8 A;  3U1R A;  2JIH A;  1CIZ A;  3KEC A;  1OM8 A;  1ZTQ A;  2MZH A;  3CKI A;  3AYU A;  2DW1 A;  1J7N A;  1Y0V A;  3E8R A;  3EWJ A;  3LUM A;  1XFX A;  3HY9 A;  4I03 A;  3DTE A;  2L0R A;  3AYK A;  4H2E A;  2O3E A;  2DDF A;  3LIR A;  2OY4 A;  3Q2G A;  5D1U A;  2HU6 A;  2OXW A;  1G49 A;  4H3X A;  1IAG A;  4WF6 A;  2XS3 A;  3KWV C;  4XM7 A;  3NX7 A;  3L0T A;  2E2D A;  1GO8 P;  3O2X A;  3P24 A;  5D1S A;  2JNP A;  3RTS A;  2Z2D A;  1YCM A;  1XFV A;  4A7B A;  1BUD A;  1WNI A;  4L7A A;  3EDG A;  1PWQ A;  1IAC A;  1AKL A;  1SLM A;  3F17 A;  1A86 A;  1FBL A;  2XS4 A;  3KMC A;  3KME A;  2YB9 A;  3F1A A;  2FV9 A;  966C A;  1UEA A;  1AST A;  2K9C A;  5H8X A;  4PKU A;  4PKV A;  1ZVX A;  1CXV A;  3VTG A;  3F18 A;  4GR3 A;  5D1T A;  4L63 A;  3LIL A;  1KAP P;  2V4B A;  2YIG A;  1I76 A;  4H76 A;  3LJT A;  1BM6 A;  1QUA A;  2I47 A;  3LIK A;  3LQB A;  3B8Z A;  1A85 A;  3EDI A;  3LUN A;  3DSL A;  2PJT A;  1HTD A;  2POJ A;  1L6J A;  1BIW A;  1AF0 A;  1ROS A;  2K2G A;  3EDZ A;  1PWU A;  4GUY A;  4PKT A;  4ZR5 A;  2JT5 A;  5D7W A;  3HYG A;  2QPJ A;  2RJQ A;  1OM6 A;  4FVL A;  1I1I P;  1R55 A;  2ERO A;  1O0T A;  1CK7 A;  4IJO A;  3KEK A;  1Q3A A;  3G5C A;  3LKA A;  1YOU A;  3LGP A;  1PWV A;  1BZS A;  2JT6 A;  2O36 A;  1UMT A;  3DPF A;  1HOV A;  2J83 A;  4ON1 A;  3L0V A;  5CXA A;  1OO9 A;  3OHL A;  1CGL A;  3VI1 A;  2ERP A;  830C A;  2OW2 A;  2MLS A;  4CTH A;  1D8F A;  3LEA A;  1GKC A;  3TVC A;  4XBH A;  3LE9 A;  3N2V A;  1DMT A;  3LQ0 A;  3DTI A;  1D7X A;  1PWP A;  1XUC A;  1B3D A;  1IAE A;  1JKY A;  1R1H A;  2RJP A;  4GF1 A;  1QJI A;  1XUR A;  1PWW A;  3F19 A;  4L6T A;  3RTT A;  1H71 P;  2OW1 A;  4IN9 A;  1JIZ A;  4ILW D;  3LMC A;  3HDB A;  1S4B P;  1BKC E;  1BKC I;  3OHO A;  4AIG A;  4H30 A;  4WKE A;  4XM8 A;  2ERQ A;  4XCT A;  5I4O A;  2OXZ A;  1JK3 A;  1UTZ A;  3F16 A;  1ZS0 A;  1OS2 A;  5I0L A;  1YP1 A;  3K7N A;  1GO7 P;  2D1N A;  4FXQ A;  1SLN A;  1JIW P;  1GXD A;  1KUK A;  3B2Z A;  1MMR A;  5JMY A;  1GE6 A;  2AIG P;  2Y6D A;  1JAO A;  1GE5 A;  2CKI A;  3ZVS A;  3I7G A;  3TT4 A;  1ATL A;  3F15 A;  2OXU A;  1KBC A;  4HX3 A;  2J0T A;  5L7F A;  1KUI A;  3EHX A;  1Y8J A;  2DW2 A;  2JSD A;  5L79 A;  456C A;  1IAA A;  2OZR A;  4AXQ A;  1KUH A;  3KEJ A;  1KUF A;  3DTK A;  4PKW A;  1KUG A;  1ND1 A;  1XUD A;  2YUF A;  1CGE A;  3K7L A;  3AIG A;  4DD8 A;  5I43 A;  3ZUK A;  4DPE A;  5B5O A;  3I7I A;  5BOT A;  1C7K A;  5D3C A;  2E3X A;  3BA0 A;  1QJJ A;  1G4K A;  1BQO A;  4AYK A;  3ZXH A;  2X3C A;  1XFZ A;  2Y6C A;  1XFU A;  4QKZ A;  3KHI A;  3DWB A;  5B5P A;  3V96 B;  1XFW A;  1O0Q A;  1Y93 A;  4XM6 A;  1JAP A;  1FLS A;  1D5J A;  1ZXC A;  2X3A A;  3HDA P;  2CLT A;  4GQL A;  3O64 A;  4WZV A;  2FV5 A;  1G9K A;  1MMP A;  3LJZ A;  1G05 A;  1GKD A;  3ELM A;  1MMB A;  2DW0 A;  4PKQ A;  1R54 A;  1R1J A;  2TCL A;  1K7G A;  4JIJ A;  1C3I A;  3GBO A;  1MMQ A;  2OW9 A;  1JJ9 A;  5CUH A;  1BKC A;  1SAT A;  2MZI A;  4Q1L A;  4H84 A;  1HFS A;  4JQG A;  1GE7 A;  1HV5 A;  4GR8 A;  3TS4 A;  4HMA A;  4JPA A;  2W12 A;  1D8M A;  2OY2 A;  4JA1 A;  3WV1 A;  2WOA A;  1I73 A;  1QIB A;  1OM7 A;  4H1Q A;  2W13 A;  4JP4 A;  3USN A;  5I12 A;  5CZM A;  4L19 A;  2OVX A;  2MZE A;  1CQR A;  3EHY A;  4AUO A;  1G12 A;  1IAD A;  2X7M A;  4H49 A;  4G0D A;  2AYK A;  1IAB A;  2USN A;  3MA2 A;  1USN A;  1JAN A;  1FM1 A;  1SU3 A;  1CAQ A;  3HB2 P;  1R1I A;  4WK7 A;  4GWN A;  1SMP A;  4A3W A;  2D1O A;  4R3V A;  2W14 A;  2OI0 A;  2SRT A;  1UMS A;  1QIC A;  1BUV M;  1AYK A;  2WO9 A;  5I2Z A;  1ZP5 A;  1JAQ A;  1RM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...