3LIRA

Human mmp12 in complex with non-zinc chelating inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Insights from selective non-phosphinic inhibitors of MMP-12 tailored to fit with an S1' loop canonical conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lirA00
1CQRA 4H82A 1UTZA 2CKIA 2MLRA 4GR8A 1JANA 3LILA 3LUNA 1RMZA 1C3IA 1PWWA 1QICA 1JAPA 1FBLA 1OS2A 4GR0A 4GUYA 2HU6A 1AF0A 2AIGP 3EDGA 3ELMA 2OVZA 4FU4A 1K7GA 3EDZA 1KUKA 1IAAA 3AYUA 2MZHA 3Q2GA 2YIGA 3KRYA 1S4BP 1D5JA 2Z2DA 2FV9A 2X3CA 3LQ0A 3OHLA 1H71P 1OM8A 3EWJA 1CGEA 3DSLA 3B8ZA 4IJOA 3USNA 1K7IA 3NX7A 2ERQA 3VTGA 4FVLA 3TVCA 1O0TA 1SU3A 4JPAA 2OVXA 4GWNA 1IADA 2I47A 2MZIA 1USNA 1QUAA 5LABA 1XFXA 1ROSA 1MMQA 1QJIA 1YCMA 4H30A 1BKCI 4PKRA 3F15A 2EROA 3LJTA 4WKEA 5D1SA 4CTHA 1KUGA 1XFVA 1UEAA 2PJTA 3O64A 1JAQA 2OW1A 2OXUA 1G05A 4XM6A 1ATLA 3SHIA 2WO9A 1QIBA 3VI1A 4G9LA 3F17A 1ZXVA 3TT4A 4GWMA 5D1UA 4AYKA 1SLNA 3LJZA 3K7NA 5I43A 1QIAA 1KAPP 1ND1A 1J7NA 2DW2A 1B3DA 4WF6A 4XCTA 3KHIA 3LUMA 3EHXA 1I76A 2Y6CA 1BZSA 2W13A 1YP1A 1HV5A 1Y93A 4JIJA 3RTTA 3L0TA 966CA 1ZXCA 4PKUA 1I73A 1R54A 1IACA 1SMPA 1GO8P 3AYKA 3WV3A 1PWPA 5I4OA 1A86A 5I0LA 1JH1A 2YB9A 5L7FA 5CZMA 4GF1A 1KUIA 1C7KA 1JAOA 1A85A 2O3EA 1D7XA 2DDFA 5BOTA 1QJJA 1B8YA 3EHYA 3HDAP 4DF9A 4H3XA 3ZVSA 5JMYA 1OS9A 1GE6A 1GE7A 4H49A 3DPEA 3LEAA 1SATA 2KRJA 1RM8A 2E2DA 2OXWA 4ON1A 1I1IP 4FXQA 4EFSA 1FLSA 1Z3JA 3RTSA 5I12A 1CXVA 2OW2A 1O0QA 3WV2A 2WO8A 3B92A 2WOAA 3LE9A 3V96B 1G4KA 2DDYA 3Q2HA 3F1AA 1G9KA 2OY4A 2OW9A 1GKCA 4I03A 1BSWA 2K2GA 2MZEA 5CUHA 4DPEA 1UMTA 4WK7A 1CIZA 4H76A 1BQOA 2L0RA 3HYGA 2OXZA 1SRPA 2SRTA 2W0DA 4WKIA 1MNCA 2Y6DA 3P1VA 5H8XA 4A3WA 4AIGA 2J0TA 1BIWA 4HMAA 2AYKA 4IUWA 1OO9A 2X3AA 1GO7P 1XURA 1HY7A 2OZRA 2W14A 1Y0VA 4Q1LA 5D3CA 3LKAA 2K9CA 2V4BA 1EUBA 1UTTA 2JNPA 4H84A 1C8TA 3EDHA 1XUDA 1JIWP 3LIRA 4L63A 4WZVA 3ZXHA 4PKVA 1PWVA 2X3BA 4PKQA 3P24A 1IAEA 1K7QA 2OW0A 4PKSA 2JIHA 3I7IA 4G0DA 4JQGA 1KBCA 3HY7A 1D8FA 2ERPA 1JIZA 5B5PA 2MLSA 5L79A 4JP4A 4HX3A 4AUOA 1MMPA 1G12A 2JT5A 2JT6A 1L6JA 3ZUKA 3F19A 5I2ZA 2XS3A 1HOVA 2D1NA 4QKZA 2A8HA 3TS4A 3HDBA 3L0VA 4FXYP 3B2ZA 3KECA 1AKLA 1CK7A 1PWUA 4PKTA 1DTHA 1AYKA 1HFSA 1HFCA 3UVCA 4I35A 1IABA 1XUCA 1OM7A 2OY2A 1OM6A 2RJQA 1KUHA 3DPFA 4AXQA 1R55A 3WV1A 4GR3A 1D8MA 5CXAA 1SLMA 830CA 1MMBA 1CGLA 3HBVP 5D1TA 3KMEA 3O2XA 3TSKA 3MA2A 3GBOA 1XFYA 3AIGA 1EAKA 3F16A 1XFWA 3BA0A 1R1JA 1BUVM 1FM1A 1JJ9A 4GQLA 2USNA 1HTDA 1GXDA 2N8RA 1ASTA 3LJGA 1BUDA 5BOYA 3G42A 1CAQA 3F18A 2TCLA 1JKYA 1EB6A 4DV8A 2W15A 1GKDA 3OHOA 4ZR5A 1BQQM 3KWVC 5I3MA 1BKCA 2W12A 4R3VA 1R1HA 4J4MA 1MMRA 4H1QA 1XFUA 3U1RA 1R1IA 1CGFA 3DNGA 4L19A 3I7GA 2POJA 4XM7A 2J83A 3DL1A 2DW1A 3LK8A 2QPJA 4XM8A 4ILWD 1Q3AA 3KMCA 3KEJA 3HY9A 3N2VA 1BM6A 2CLTA 4H2EA 4PKWA 5D7WA 4IN9A 1OMJA 2E3XA 1YOUA 2DW0A 4DD8A 1BKCE 3E8RA 2O36A 2FV5A 4XBHA 1PWQA 3LMCA 1YQYA 5B5OA 3KEKA 3LQBA 1Y8JA 3CKIA 3LGPA 4JA1A 456CA 1ZP5A 2RJPA 2X7MA 3HB2P 2XS4A 1KUFA 2OI0A 2D1OA 5D2BA 3G5CA 1WNIA 1XFZA 3HBUP 3K7LA 1IAGA 1GE5A 5BPAA 3N2UA 1ZVXA 3DWBA 2JSDA 1JK3A 1DMTA 1UMSA 1G49A 4L6TA 1ZTQA 4A7BA 1ZS0A 3EDIA 3LIKA
chains in the Genus database with same CATH superfamily
1CQRA 4H82A 1UTZA 2CKIA 2MLRA 4GR8A 1JANA 3LILA 3LUNA 1RMZA 1C3IA 1PWWA 1QICA 1JAPA 1FBLA 1OS2A 4GR0A 4GUYA 2HU6A 1AF0A 2AIGP 3EDGA 3ELMA 2OVZA 4FU4A 3DTEA 1K7GA 3DTKA 3EDZA 1KUKA 1IAAA 3AYUA 2MZHA 3Q2GA 2YIGA 3KRYA 1S4BP 1D5JA 2Z2DA 2FV9A 2X3CA 3LQ0A 3OHLA 3DTIA 1H71P 1OM8A 3EWJA 1CGEA 3DSLA 3B8ZA 4IJOA 3USNA 1K7IA 3NX7A 2ERQA 3VTGA 4FVLA 1OZ9A 3TVCA 1O0TA 1SU3A 4JPAA 2OVXA 4GWNA 1IADA 2I47A 2MZIA 1USNA 1QUAA 5LABA 1XFXA 1ROSA 1MMQA 1QJIA 1YCMA 4H30A 1BKCI 4PKRA 3F15A 2EROA 3LJTA 4WKEA 5D1SA 4CTHA 1KUGA 1XFVA 1UEAA 2PJTA 3O64A 1JAQA 2OW1A 2OXUA 1G05A 4XM6A 1ATLA 3SHIA 2WO9A 1QIBA 3VI1A 4G9LA 3F17A 1ZXVA 3TT4A 4GWMA 5D1UA 4AYKA 1SLNA 3LJZA 3K7NA 5I43A 1QIAA 1KAPP 1ND1A 1J7NA 2DW2A 1B3DA 4WF6A 4XCTA 3KHIA 3LUMA 3EHXA 1XAXA 1I76A 2Y6CA 1BZSA 2W13A 1YP1A 1HV5A 1Y93A 4JIJA 3RTTA 3L0TA 966CA 1ZXCA 4PKUA 1I73A 1R54A 1IACA 1SMPA 1GO8P 3AYKA 3WV3A 1PWPA 5I4OA 1A86A 5I0LA 1JH1A 2YB9A 1TVIA 5L7FA 5CZMA 4GF1A 1KUIA 1C7KA 2YUFA 1JAOA 1A85A 2O3EA 1D7XA 2DDFA 5BOTA 1QJJA 1B8YA 3EHYA 3HDAP 4DF9A 4H3XA 3ZVSA 5JMYA 1OS9A 1GE6A 1GE7A 4H49A 3DPEA 3LEAA 1SATA 2KRJA 1RM8A 2E2DA 2OXWA 4ON1A 1I1IP 4FXQA 4EFSA 1FLSA 1Z3JA 3RTSA 5I12A 1CXVA 2OW2A 1O0QA 3WV2A 2WO8A 3B92A 2WOAA 3LE9A 3V96B 1G4KA 2DDYA 3Q2HA 3F1AA 1G9KA 2OY4A 2OW9A 1GKCA 4I03A 1BSWA 2K2GA 2MZEA 5CUHA 4DPEA 1UMTA 4WK7A 1CIZA 4H76A 1BQOA 2L0RA 3HYGA 2OXZA 1SRPA 2SRTA 2W0DA 4WKIA 1MNCA 2Y6DA 3P1VA 5H8XA 4A3WA 4AIGA 2J0TA 1BIWA 4HMAA 2AYKA 4IUWA 1OO9A 2X3AA 1GO7P 1XURA 1HY7A 2OZRA 2W14A 1Y0VA 4Q1LA 5D3CA 3LKAA 2K9CA 2V4BA 1EUBA 1UTTA 1XM5A 2JNPA 4H84A 1C8TA 3EDHA 1XUDA 1JIWP 3LIRA 4L63A 4WZVA 3ZXHA 4PKVA 1PWVA 2X3BA 4PKQA 3P24A 1IAEA 1K7QA 2OW0A 4PKSA 2JIHA 3I7IA 4G0DA 4JQGA 1KBCA 3HY7A 1D8FA 2ERPA 1JIZA 5B5PA 2MLSA 5L79A 4JP4A 4HX3A 4AUOA 1MMPA 1G12A 2JT5A 2JT6A 1L6JA 3ZUKA 3F19A 5I2ZA 2XS3A 1HOVA 2D1NA 4QKZA 2A8HA 3TS4A 3HDBA 3L0VA 4FXYP 3B2ZA 3KECA 1AKLA 1CK7A 1PWUA 4PKTA 1DTHA 1AYKA 1HFSA 1HFCA 3UVCA 4I35A 1IABA 1XUCA 1OM7A 2OY2A 1OM6A 2RJQA 1KUHA 3DPFA 4AXQA 1R55A 3WV1A 4GR3A 1D8MA 5CXAA 1SLMA 830CA 1MMBA 1CGLA 3HBVP 5D1TA 3KMEA 3O2XA 3TSKA 3MA2A 3GBOA 1XFYA 3AIGA 1EAKA 3F16A 1XFWA 3BA0A 1R1JA 1BUVM 1FM1A 1JJ9A 4GQLA 2USNA 1HTDA 1GXDA 2N8RA 1ASTA 3LJGA 4L7AA 1BUDA 5BOYA 3G42A 1CAQA 3F18A 2TCLA 1JKYA 1EB6A 4DV8A 2W15A 1GKDA 3OHOA 4ZR5A 1BQQM 3KWVC 5I3MA 1BKCA 2W12A 4R3VA 1R1HA 4J4MA 1MMRA 4H1QA 1XFUA 3U1RA 1R1IA 1CGFA 3DNGA 4L19A 3I7GA 2POJA 4XM7A 3DL1A 2J83A 2DW1A 3LK8A 2QPJA 4XM8A 4ILWD 1Q3AA 3KMCA 3KEJA 3HY9A 3N2VA 1BM6A 2CLTA 4H2EA 4PKWA 5D7WA 4IN9A 1OMJA 2E3XA 1YOUA 2DW0A 4DD8A 1BKCE 3E8RA 2O36A 2FV5A 4XBHA 1PWQA 3LMCA 1YQYA 5B5OA 3KEKA 3LQBA 1Y8JA 3CKIA 3LGPA 4JA1A 456CA 1ZP5A 2RJPA 2X7MA 3HB2P 2XS4A 1KUFA 2OI0A 2D1OA 5D2BA 3G5CA 1WNIA 1XFZA 3HBUP 3K7LA 1IAGA 1GE5A 5BPAA 3N2UA 1ZVXA 3DWBA 2JSDA 1JK3A 1DMTA 1UMSA 1G49A 4L6TA 1ZTQA 4A7BA 1ZS0A 3EDIA 3LIKA
chains in the Genus database with same CATH topology
1CQRA 4H82A 1UTZA 2CKIA 2MLRA 4GR8A 1JANA 3LILA 3LUNA 1RMZA 1C3IA 1PWWA 1QICA 1JAPA 1FBLA 1OS2A 4GR0A 4GUYA 2HU6A 1AF0A 2AIGP 3EDGA 3ELMA 2OVZA 4FU4A 3DTEA 1K7GA 3DTKA 3EDZA 1KUKA 1IAAA 3AYUA 2MZHA 3Q2GA 2YIGA 3KRYA 1S4BP 1D5JA 2Z2DA 2FV9A 2X3CA 3LQ0A 3OHLA 3DTIA 1H71P 1OM8A 3EWJA 1CGEA 3DSLA 3B8ZA 4IJOA 3USNA 1K7IA 3NX7A 2ERQA 3VTGA 4FVLA 3TVCA 1O0TA 1SU3A 4JPAA 2OVXA 4GWNA 1IADA 2I47A 2MZIA 1USNA 1QUAA 5LABA 1XFXA 1ROSA 1MMQA 1QJIA 1YCMA 4H30A 1BKCI 4PKRA 3F15A 2EROA 3LJTA 4WKEA 5D1SA 4CTHA 1KUGA 1XFVA 1UEAA 2PJTA 3O64A 1JAQA 2OW1A 2OXUA 1G05A 4XM6A 1ATLA 3SHIA 2WO9A 1QIBA 3VI1A 4G9LA 3F17A 1ZXVA 3TT4A 4GWMA 5D1UA 4AYKA 1SLNA 3LJZA 3K7NA 5I43A 1QIAA 1KAPP 1ND1A 1J7NA 2DW2A 1B3DA 4WF6A 4XCTA 3KHIA 3LUMA 3EHXA 1I76A 2Y6CA 1BZSA 2W13A 1YP1A 1HV5A 1Y93A 4JIJA 3RTTA 3L0TA 966CA 1ZXCA 4PKUA 1I73A 1R54A 1IACA 1SMPA 1GO8P 3AYKA 3WV3A 1PWPA 5I4OA 1A86A 5I0LA 1JH1A 2YB9A 5L7FA 5CZMA 4GF1A 1KUIA 1C7KA 2YUFA 1JAOA 1A85A 2O3EA 1D7XA 2DDFA 5BOTA 1QJJA 1B8YA 3EHYA 3HDAP 4DF9A 4H3XA 3ZVSA 5JMYA 1OS9A 1GE6A 1GE7A 4H49A 3DPEA 3LEAA 1SATA 2KRJA 1RM8A 2E2DA 2OXWA 4ON1A 1I1IP 4FXQA 4EFSA 1FLSA 1Z3JA 3RTSA 5I12A 1CXVA 2OW2A 1O0QA 3WV2A 2WO8A 3B92A 2WOAA 3LE9A 3V96B 1G4KA 2DDYA 3Q2HA 3F1AA 1G9KA 2OY4A 2OW9A 1GKCA 4I03A 1BSWA 2K2GA 2MZEA 5CUHA 4DPEA 1UMTA 4WK7A 1CIZA 4H76A 1BQOA 2L0RA 3HYGA 2OXZA 1SRPA 2SRTA 2W0DA 4WKIA 1MNCA 2Y6DA 3P1VA 5H8XA 4A3WA 4AIGA 2J0TA 1BIWA 4HMAA 2AYKA 4IUWA 1OO9A 2X3AA 1GO7P 1XURA 1HY7A 2OZRA 2W14A 1Y0VA 4Q1LA 5D3CA 3LKAA 2K9CA 2V4BA 1EUBA 1UTTA 2JNPA 4H84A 1C8TA 3EDHA 1XUDA 1JIWP 3LIRA 4L63A 4WZVA 3ZXHA 4PKVA 1PWVA 2X3BA 4PKQA 3P24A 1IAEA 1K7QA 2OW0A 4PKSA 2JIHA 3I7IA 4G0DA 4JQGA 1KBCA 3HY7A 1D8FA 2ERPA 1JIZA 5B5PA 2MLSA 5L79A 4JP4A 4HX3A 4AUOA 1MMPA 1G12A 2JT5A 2JT6A 1L6JA 3ZUKA 3F19A 5I2ZA 2XS3A 1HOVA 2D1NA 4QKZA 2A8HA 3TS4A 3HDBA 3L0VA 4FXYP 3B2ZA 3KECA 1AKLA 1CK7A 1PWUA 4PKTA 1DTHA 1AYKA 1HFSA 1HFCA 3UVCA 4I35A 1IABA 1XUCA 1OM7A 2OY2A 1OM6A 2RJQA 1KUHA 3DPFA 4AXQA 1R55A 3WV1A 4GR3A 1D8MA 5CXAA 1SLMA 830CA 1MMBA 1CGLA 3HBVP 5D1TA 3KMEA 3O2XA 3TSKA 3MA2A 3GBOA 1XFYA 3AIGA 1EAKA 3F16A 1XFWA 3BA0A 1R1JA 1BUVM 1FM1A 1JJ9A 4GQLA 2USNA 1HTDA 1GXDA 2N8RA 1ASTA 3LJGA 4L7AA 1BUDA 5BOYA 3G42A 1CAQA 3F18A 2TCLA 1JKYA 1EB6A 4DV8A 2W15A 1GKDA 3OHOA 4ZR5A 1BQQM 3KWVC 5I3MA 1BKCA 2W12A 4R3VA 1R1HA 4J4MA 1MMRA 4H1QA 1XFUA 3U1RA 1R1IA 1CGFA 3DNGA 4L19A 3I7GA 2POJA 4XM7A 2J83A 3DL1A 2DW1A 3LK8A 2QPJA 4XM8A 4ILWD 1Q3AA 3KMCA 3KEJA 3HY9A 3N2VA 1BM6A 2CLTA 4H2EA 4PKWA 5D7WA 4IN9A 1OMJA 2E3XA 1YOUA 2DW0A 4DD8A 1BKCE 3E8RA 2O36A 2FV5A 4XBHA 1PWQA 3LMCA 1YQYA 5B5OA 3KEKA 3LQBA 1Y8JA 3CKIA 3LGPA 4JA1A 456CA 1ZP5A 2RJPA 2X7MA 3HB2P 2XS4A 1KUFA 2OI0A 2D1OA 5D2BA 3G5CA 1WNIA 1XFZA 3HBUP 3K7LA 1IAGA 1GE5A 5BPAA 3N2UA 1ZVXA 3DWBA 2JSDA 1JK3A 1DMTA 1UMSA 1G49A 4L6TA 1ZTQA 4A7BA 1ZS0A 3EDIA 3LIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQR A;  4H82 A;  1UTZ A;  2CKI A;  2MLR A;  4GR8 A;  1JAN A;  3LIL A;  3LUN A;  1RMZ A;  1C3I A;  1PWW A;  1QIC A;  1JAP A;  1FBL A;  1OS2 A;  4GR0 A;  4GUY A;  2HU6 A;  1AF0 A;  2AIG P;  3EDG A;  3ELM A;  2OVZ A;  4FU4 A;  1K7G A;  3EDZ A;  1KUK A;  1IAA A;  3AYU A;  2MZH A;  3Q2G A;  2YIG A;  3KRY A;  1S4B P;  1D5J A;  2Z2D A;  2FV9 A;  2X3C A;  3LQ0 A;  3OHL A;  1H71 P;  1OM8 A;  3EWJ A;  1CGE A;  3DSL A;  3B8Z A;  4IJO A;  3USN A;  1K7I A;  3NX7 A;  2ERQ A;  3VTG A;  4FVL A;  3TVC A;  1O0T A;  1SU3 A;  4JPA A;  2OVX A;  4GWN A;  1IAD A;  2I47 A;  2MZI A;  1USN A;  1QUA A;  5LAB A;  1XFX A;  1ROS A;  1MMQ A;  1QJI A;  1YCM A;  4H30 A;  1BKC I;  4PKR A;  3F15 A;  2ERO A;  3LJT A;  4WKE A;  5D1S A;  4CTH A;  1KUG A;  1XFV A;  1UEA A;  2PJT A;  3O64 A;  1JAQ A;  2OW1 A;  2OXU A;  1G05 A;  4XM6 A;  1ATL A;  3SHI A;  2WO9 A;  1QIB A;  3VI1 A;  4G9L A;  3F17 A;  1ZXV A;  3TT4 A;  4GWM A;  5D1U A;  4AYK A;  1SLN A;  3LJZ A;  3K7N A;  5I43 A;  1QIA A;  1KAP P;  1ND1 A;  1J7N A;  2DW2 A;  1B3D A;  4WF6 A;  4XCT A;  3KHI A;  3LUM A;  3EHX A;  1I76 A;  2Y6C A;  1BZS A;  2W13 A;  1YP1 A;  1HV5 A;  1Y93 A;  4JIJ A;  3RTT A;  3L0T A;  966C A;  1ZXC A;  4PKU A;  1I73 A;  1R54 A;  1IAC A;  1SMP A;  1GO8 P;  3AYK A;  3WV3 A;  1PWP A;  5I4O A;  1A86 A;  5I0L A;  1JH1 A;  2YB9 A;  5L7F A;  5CZM A;  4GF1 A;  1KUI A;  1C7K A;  1JAO A;  1A85 A;  2O3E A;  1D7X A;  2DDF A;  5BOT A;  1QJJ A;  1B8Y A;  3EHY A;  3HDA P;  4DF9 A;  4H3X A;  3ZVS A;  5JMY A;  1OS9 A;  1GE6 A;  1GE7 A;  4H49 A;  3DPE A;  3LEA A;  1SAT A;  2KRJ A;  1RM8 A;  2E2D A;  2OXW A;  4ON1 A;  1I1I P;  4FXQ A;  4EFS A;  1FLS A;  1Z3J A;  3RTS A;  5I12 A;  1CXV A;  2OW2 A;  1O0Q A;  3WV2 A;  2WO8 A;  3B92 A;  2WOA A;  3LE9 A;  3V96 B;  1G4K A;  2DDY A;  3Q2H A;  3F1A A;  1G9K A;  2OY4 A;  2OW9 A;  1GKC A;  4I03 A;  1BSW A;  2K2G A;  2MZE A;  5CUH A;  4DPE A;  1UMT A;  4WK7 A;  1CIZ A;  4H76 A;  1BQO A;  2L0R A;  3HYG A;  2OXZ A;  1SRP A;  2SRT A;  2W0D A;  4WKI A;  1MNC A;  2Y6D A;  3P1V A;  5H8X A;  4A3W A;  4AIG A;  2J0T A;  1BIW A;  4HMA A;  2AYK A;  4IUW A;  1OO9 A;  2X3A A;  1GO7 P;  1XUR A;  1HY7 A;  2OZR A;  2W14 A;  1Y0V A;  4Q1L A;  5D3C A;  3LKA A;  2K9C A;  2V4B A;  1EUB A;  1UTT A;  2JNP A;  4H84 A;  1C8T A;  3EDH A;  1XUD A;  1JIW P;  3LIR A;  4L63 A;  4WZV A;  3ZXH A;  4PKV A;  1PWV A;  2X3B A;  4PKQ A;  3P24 A;  1IAE A;  1K7Q A;  2OW0 A;  4PKS A;  2JIH A;  3I7I A;  4G0D A;  4JQG A;  1KBC A;  3HY7 A;  1D8F A;  2ERP A;  1JIZ A;  5B5P A;  2MLS A;  5L79 A;  4JP4 A;  4HX3 A;  4AUO A;  1MMP A;  1G12 A;  2JT5 A;  2JT6 A;  1L6J A;  3ZUK A;  3F19 A;  5I2Z A;  2XS3 A;  1HOV A;  2D1N A;  4QKZ A;  2A8H A;  3TS4 A;  3HDB A;  3L0V A;  4FXY P;  3B2Z A;  3KEC A;  1AKL A;  1CK7 A;  1PWU A;  4PKT A;  1DTH A;  1AYK A;  1HFS A;  1HFC A;  3UVC A;  4I35 A;  1IAB A;  1XUC A;  1OM7 A;  2OY2 A;  1OM6 A;  2RJQ A;  1KUH A;  3DPF A;  4AXQ A;  1R55 A;  3WV1 A;  4GR3 A;  1D8M A;  5CXA A;  1SLM A;  830C A;  1MMB A;  1CGL A;  3HBV P;  5D1T A;  3KME A;  3O2X A;  3TSK A;  3MA2 A;  3GBO A;  1XFY A;  3AIG A;  1EAK A;  3F16 A;  1XFW A;  3BA0 A;  1R1J A;  1BUV M;  1FM1 A;  1JJ9 A;  4GQL A;  2USN A;  1HTD A;  1GXD A;  2N8R A;  1AST A;  3LJG A;  1BUD A;  5BOY A;  3G42 A;  1CAQ A;  3F18 A;  2TCL A;  1JKY A;  1EB6 A;  4DV8 A;  2W15 A;  1GKD A;  3OHO A;  4ZR5 A;  1BQQ M;  3KWV C;  5I3M A;  1BKC A;  2W12 A;  4R3V A;  1R1H A;  4J4M A;  1MMR A;  4H1Q A;  1XFU A;  3U1R A;  1R1I A;  1CGF A;  3DNG A;  4L19 A;  3I7G A;  2POJ A;  4XM7 A;  2J83 A;  3DL1 A;  2DW1 A;  3LK8 A;  2QPJ A;  4XM8 A;  4ILW D;  1Q3A A;  3KMC A;  3KEJ A;  3HY9 A;  3N2V A;  1BM6 A;  2CLT A;  4H2E A;  4PKW A;  5D7W A;  4IN9 A;  1OMJ A;  2E3X A;  1YOU A;  2DW0 A;  4DD8 A;  1BKC E;  3E8R A;  2O36 A;  2FV5 A;  4XBH A;  1PWQ A;  3LMC A;  1YQY A;  5B5O A;  3KEK A;  3LQB A;  1Y8J A;  3CKI A;  3LGP A;  4JA1 A;  456C A;  1ZP5 A;  2RJP A;  2X7M A;  3HB2 P;  2XS4 A;  1KUF A;  2OI0 A;  2D1O A;  5D2B A;  3G5C A;  1WNI A;  1XFZ A;  3HBU P;  3K7L A;  1IAG A;  1GE5 A;  5BPA A;  3N2U A;  1ZVX A;  3DWB A;  2JSD A;  1JK3 A;  1DMT A;  1UMS A;  1G49 A;  4L6T A;  1ZTQ A;  4A7B A;  1ZS0 A;  3EDI A;  3LIK A; 
#chains in the Genus database with same CATH topology
 1CQR A;  4H82 A;  1UTZ A;  2CKI A;  2MLR A;  4GR8 A;  1JAN A;  3LIL A;  3LUN A;  1RMZ A;  1C3I A;  1PWW A;  1QIC A;  1JAP A;  1FBL A;  1OS2 A;  4GR0 A;  4GUY A;  2HU6 A;  1AF0 A;  2AIG P;  3EDG A;  3ELM A;  2OVZ A;  4FU4 A;  3DTE A;  1K7G A;  3DTK A;  3EDZ A;  1KUK A;  1IAA A;  3AYU A;  2MZH A;  3Q2G A;  2YIG A;  3KRY A;  1S4B P;  1D5J A;  2Z2D A;  2FV9 A;  2X3C A;  3LQ0 A;  3OHL A;  3DTI A;  1H71 P;  1OM8 A;  3EWJ A;  1CGE A;  3DSL A;  3B8Z A;  4IJO A;  3USN A;  1K7I A;  3NX7 A;  2ERQ A;  3VTG A;  4FVL A;  1OZ9 A;  3TVC A;  1O0T A;  1SU3 A;  4JPA A;  2OVX A;  4GWN A;  1IAD A;  2I47 A;  2MZI A;  1USN A;  1QUA A;  5LAB A;  1XFX A;  1ROS A;  1MMQ A;  1QJI A;  1YCM A;  4H30 A;  1BKC I;  4PKR A;  3F15 A;  2ERO A;  3LJT A;  4WKE A;  5D1S A;  4CTH A;  1KUG A;  1XFV A;  1UEA A;  2PJT A;  3O64 A;  1JAQ A;  2OW1 A;  2OXU A;  1G05 A;  4XM6 A;  1ATL A;  3SHI A;  2WO9 A;  1QIB A;  3VI1 A;  4G9L A;  3F17 A;  1ZXV A;  3TT4 A;  4GWM A;  5D1U A;  4AYK A;  1SLN A;  3LJZ A;  3K7N A;  5I43 A;  1QIA A;  1KAP P;  1ND1 A;  1J7N A;  2DW2 A;  1B3D A;  4WF6 A;  4XCT A;  3KHI A;  3LUM A;  3EHX A;  1XAX A;  1I76 A;  2Y6C A;  1BZS A;  2W13 A;  1YP1 A;  1HV5 A;  1Y93 A;  4JIJ A;  3RTT A;  3L0T A;  966C A;  1ZXC A;  4PKU A;  1I73 A;  1R54 A;  1IAC A;  1SMP A;  1GO8 P;  3AYK A;  3WV3 A;  1PWP A;  5I4O A;  1A86 A;  5I0L A;  1JH1 A;  2YB9 A;  1TVI A;  5L7F A;  5CZM A;  4GF1 A;  1KUI A;  1C7K A;  2YUF A;  1JAO A;  1A85 A;  2O3E A;  1D7X A;  2DDF A;  5BOT A;  1QJJ A;  1B8Y A;  3EHY A;  3HDA P;  4DF9 A;  4H3X A;  3ZVS A;  5JMY A;  1OS9 A;  1GE6 A;  1GE7 A;  4H49 A;  3DPE A;  3LEA A;  1SAT A;  2KRJ A;  1RM8 A;  2E2D A;  2OXW A;  4ON1 A;  1I1I P;  4FXQ A;  4EFS A;  1FLS A;  1Z3J A;  3RTS A;  5I12 A;  1CXV A;  2OW2 A;  1O0Q A;  3WV2 A;  2WO8 A;  3B92 A;  2WOA A;  3LE9 A;  3V96 B;  1G4K A;  2DDY A;  3Q2H A;  3F1A A;  1G9K A;  2OY4 A;  2OW9 A;  1GKC A;  4I03 A;  1BSW A;  2K2G A;  2MZE A;  5CUH A;  4DPE A;  1UMT A;  4WK7 A;  1CIZ A;  4H76 A;  1BQO A;  2L0R A;  3HYG A;  2OXZ A;  1SRP A;  2SRT A;  2W0D A;  4WKI A;  1MNC A;  2Y6D A;  3P1V A;  5H8X A;  4A3W A;  4AIG A;  2J0T A;  1BIW A;  4HMA A;  2AYK A;  4IUW A;  1OO9 A;  2X3A A;  1GO7 P;  1XUR A;  1HY7 A;  2OZR A;  2W14 A;  1Y0V A;  4Q1L A;  5D3C A;  3LKA A;  2K9C A;  2V4B A;  1EUB A;  1UTT A;  1XM5 A;  2JNP A;  4H84 A;  1C8T A;  3EDH A;  1XUD A;  1JIW P;  3LIR A;  4L63 A;  4WZV A;  3ZXH A;  4PKV A;  1PWV A;  2X3B A;  4PKQ A;  3P24 A;  1IAE A;  1K7Q A;  2OW0 A;  4PKS A;  2JIH A;  3I7I A;  4G0D A;  4JQG A;  1KBC A;  3HY7 A;  1D8F A;  2ERP A;  1JIZ A;  5B5P A;  2MLS A;  5L79 A;  4JP4 A;  4HX3 A;  4AUO A;  1MMP A;  1G12 A;  2JT5 A;  2JT6 A;  1L6J A;  3ZUK A;  3F19 A;  5I2Z A;  2XS3 A;  1HOV A;  2D1N A;  4QKZ A;  2A8H A;  3TS4 A;  3HDB A;  3L0V A;  4FXY P;  3B2Z A;  3KEC A;  1AKL A;  1CK7 A;  1PWU A;  4PKT A;  1DTH A;  1AYK A;  1HFS A;  1HFC A;  3UVC A;  4I35 A;  1IAB A;  1XUC A;  1OM7 A;  2OY2 A;  1OM6 A;  2RJQ A;  1KUH A;  3DPF A;  4AXQ A;  1R55 A;  3WV1 A;  4GR3 A;  1D8M A;  5CXA A;  1SLM A;  830C A;  1MMB A;  1CGL A;  3HBV P;  5D1T A;  3KME A;  3O2X A;  3TSK A;  3MA2 A;  3GBO A;  1XFY A;  3AIG A;  1EAK A;  3F16 A;  1XFW A;  3BA0 A;  1R1J A;  1BUV M;  1FM1 A;  1JJ9 A;  4GQL A;  2USN A;  1HTD A;  1GXD A;  2N8R A;  1AST A;  3LJG A;  4L7A A;  1BUD A;  5BOY A;  3G42 A;  1CAQ A;  3F18 A;  2TCL A;  1JKY A;  1EB6 A;  4DV8 A;  2W15 A;  1GKD A;  3OHO A;  4ZR5 A;  1BQQ M;  3KWV C;  5I3M A;  1BKC A;  2W12 A;  4R3V A;  1R1H A;  4J4M A;  1MMR A;  4H1Q A;  1XFU A;  3U1R A;  1R1I A;  1CGF A;  3DNG A;  4L19 A;  3I7G A;  2POJ A;  4XM7 A;  3DL1 A;  2J83 A;  2DW1 A;  3LK8 A;  2QPJ A;  4XM8 A;  4ILW D;  1Q3A A;  3KMC A;  3KEJ A;  3HY9 A;  3N2V A;  1BM6 A;  2CLT A;  4H2E A;  4PKW A;  5D7W A;  4IN9 A;  1OMJ A;  2E3X A;  1YOU A;  2DW0 A;  4DD8 A;  1BKC E;  3E8R A;  2O36 A;  2FV5 A;  4XBH A;  1PWQ A;  3LMC A;  1YQY A;  5B5O A;  3KEK A;  3LQB A;  1Y8J A;  3CKI A;  3LGP A;  4JA1 A;  456C A;  1ZP5 A;  2RJP A;  2X7M A;  3HB2 P;  2XS4 A;  1KUF A;  2OI0 A;  2D1O A;  5D2B A;  3G5C A;  1WNI A;  1XFZ A;  3HBU P;  3K7L A;  1IAG A;  1GE5 A;  5BPA A;  3N2U A;  1ZVX A;  3DWB A;  2JSD A;  1JK3 A;  1DMT A;  1UMS A;  1G49 A;  4L6T A;  1ZTQ A;  4A7B A;  1ZS0 A;  3EDI A;  3LIK A; 
#chains in the Genus database with same CATH homology
 1CQR A;  4H82 A;  1UTZ A;  2CKI A;  2MLR A;  4GR8 A;  1JAN A;  3LIL A;  3LUN A;  1RMZ A;  1C3I A;  1PWW A;  1QIC A;  1JAP A;  1FBL A;  1OS2 A;  4GR0 A;  4GUY A;  2HU6 A;  1AF0 A;  2AIG P;  3EDG A;  3ELM A;  2OVZ A;  4FU4 A;  3DTE A;  1K7G A;  3DTK A;  3EDZ A;  1KUK A;  1IAA A;  3AYU A;  2MZH A;  3Q2G A;  2YIG A;  3KRY A;  1S4B P;  1D5J A;  2Z2D A;  2FV9 A;  2X3C A;  3LQ0 A;  3OHL A;  3DTI A;  1H71 P;  1OM8 A;  3EWJ A;  1CGE A;  3DSL A;  3B8Z A;  4IJO A;  3USN A;  1K7I A;  3NX7 A;  2ERQ A;  3VTG A;  4FVL A;  3TVC A;  1O0T A;  1SU3 A;  4JPA A;  2OVX A;  4GWN A;  1IAD A;  2I47 A;  2MZI A;  1USN A;  1QUA A;  5LAB A;  1XFX A;  1ROS A;  1MMQ A;  1QJI A;  1YCM A;  4H30 A;  1BKC I;  4PKR A;  3F15 A;  2ERO A;  3LJT A;  4WKE A;  5D1S A;  4CTH A;  1KUG A;  1XFV A;  1UEA A;  2PJT A;  3O64 A;  1JAQ A;  2OW1 A;  2OXU A;  1G05 A;  4XM6 A;  1ATL A;  3SHI A;  2WO9 A;  1QIB A;  3VI1 A;  4G9L A;  3F17 A;  1ZXV A;  3TT4 A;  4GWM A;  5D1U A;  4AYK A;  1SLN A;  3LJZ A;  3K7N A;  5I43 A;  1QIA A;  1KAP P;  1ND1 A;  1J7N A;  2DW2 A;  1B3D A;  4WF6 A;  4XCT A;  3KHI A;  3LUM A;  3EHX A;  1I76 A;  2Y6C A;  1BZS A;  2W13 A;  1YP1 A;  1HV5 A;  1Y93 A;  4JIJ A;  3RTT A;  3L0T A;  966C A;  1ZXC A;  4PKU A;  1I73 A;  1R54 A;  1IAC A;  1SMP A;  1GO8 P;  3AYK A;  3WV3 A;  1PWP A;  5I4O A;  1A86 A;  5I0L A;  1JH1 A;  2YB9 A;  5L7F A;  5CZM A;  4GF1 A;  1KUI A;  1C7K A;  2YUF A;  1JAO A;  1A85 A;  2O3E A;  1D7X A;  2DDF A;  5BOT A;  1QJJ A;  1B8Y A;  3EHY A;  3HDA P;  4DF9 A;  4H3X A;  3ZVS A;  5JMY A;  1OS9 A;  1GE6 A;  1GE7 A;  4H49 A;  3DPE A;  3LEA A;  1SAT A;  2KRJ A;  1RM8 A;  2E2D A;  2OXW A;  4ON1 A;  1I1I P;  4FXQ A;  4EFS A;  1FLS A;  1Z3J A;  3RTS A;  5I12 A;  1CXV A;  2OW2 A;  1O0Q A;  3WV2 A;  2WO8 A;  3B92 A;  2WOA A;  3LE9 A;  3V96 B;  1G4K A;  2DDY A;  3Q2H A;  3F1A A;  1G9K A;  2OY4 A;  2OW9 A;  1GKC A;  4I03 A;  1BSW A;  2K2G A;  2MZE A;  5CUH A;  4DPE A;  1UMT A;  4WK7 A;  1CIZ A;  4H76 A;  1BQO A;  2L0R A;  3HYG A;  2OXZ A;  1SRP A;  2SRT A;  2W0D A;  4WKI A;  1MNC A;  2Y6D A;  3P1V A;  5H8X A;  4A3W A;  4AIG A;  2J0T A;  1BIW A;  4HMA A;  2AYK A;  4IUW A;  1OO9 A;  2X3A A;  1GO7 P;  1XUR A;  1HY7 A;  2OZR A;  2W14 A;  1Y0V A;  4Q1L A;  5D3C A;  3LKA A;  2K9C A;  2V4B A;  1EUB A;  1UTT A;  2JNP A;  4H84 A;  1C8T A;  3EDH A;  1XUD A;  1JIW P;  3LIR A;  4L63 A;  4WZV A;  3ZXH A;  4PKV A;  1PWV A;  2X3B A;  4PKQ A;  3P24 A;  1IAE A;  1K7Q A;  2OW0 A;  4PKS A;  2JIH A;  3I7I A;  4G0D A;  4JQG A;  1KBC A;  3HY7 A;  1D8F A;  2ERP A;  1JIZ A;  5B5P A;  2MLS A;  5L79 A;  4JP4 A;  4HX3 A;  4AUO A;  1MMP A;  1G12 A;  2JT5 A;  2JT6 A;  1L6J A;  3ZUK A;  3F19 A;  5I2Z A;  2XS3 A;  1HOV A;  2D1N A;  4QKZ A;  2A8H A;  3TS4 A;  3HDB A;  3L0V A;  4FXY P;  3B2Z A;  3KEC A;  1AKL A;  1CK7 A;  1PWU A;  4PKT A;  1DTH A;  1AYK A;  1HFS A;  1HFC A;  3UVC A;  4I35 A;  1IAB A;  1XUC A;  1OM7 A;  2OY2 A;  1OM6 A;  2RJQ A;  1KUH A;  3DPF A;  4AXQ A;  1R55 A;  3WV1 A;  4GR3 A;  1D8M A;  5CXA A;  1SLM A;  830C A;  1MMB A;  1CGL A;  3HBV P;  5D1T A;  3KME A;  3O2X A;  3TSK A;  3MA2 A;  3GBO A;  1XFY A;  3AIG A;  1EAK A;  3F16 A;  1XFW A;  3BA0 A;  1R1J A;  1BUV M;  1FM1 A;  1JJ9 A;  4GQL A;  2USN A;  1HTD A;  1GXD A;  2N8R A;  1AST A;  3LJG A;  4L7A A;  1BUD A;  5BOY A;  3G42 A;  1CAQ A;  3F18 A;  2TCL A;  1JKY A;  1EB6 A;  4DV8 A;  2W15 A;  1GKD A;  3OHO A;  4ZR5 A;  1BQQ M;  3KWV C;  5I3M A;  1BKC A;  2W12 A;  4R3V A;  1R1H A;  4J4M A;  1MMR A;  4H1Q A;  1XFU A;  3U1R A;  1R1I A;  1CGF A;  3DNG A;  4L19 A;  3I7G A;  2POJ A;  4XM7 A;  2J83 A;  3DL1 A;  2DW1 A;  3LK8 A;  2QPJ A;  4XM8 A;  4ILW D;  1Q3A A;  3KMC A;  3KEJ A;  3HY9 A;  3N2V A;  1BM6 A;  2CLT A;  4H2E A;  4PKW A;  5D7W A;  4IN9 A;  1OMJ A;  2E3X A;  1YOU A;  2DW0 A;  4DD8 A;  1BKC E;  3E8R A;  2O36 A;  2FV5 A;  4XBH A;  1PWQ A;  3LMC A;  1YQY A;  5B5O A;  3KEK A;  3LQB A;  1Y8J A;  3CKI A;  3LGP A;  4JA1 A;  456C A;  1ZP5 A;  2RJP A;  2X7M A;  3HB2 P;  2XS4 A;  1KUF A;  2OI0 A;  2D1O A;  5D2B A;  3G5C A;  1WNI A;  1XFZ A;  3HBU P;  3K7L A;  1IAG A;  1GE5 A;  5BPA A;  3N2U A;  1ZVX A;  3DWB A;  2JSD A;  1JK3 A;  1DMT A;  1UMS A;  1G49 A;  4L6T A;  1ZTQ A;  4A7B A;  1ZS0 A;  3EDI A;  3LIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...