3LJ1A

Ire1 complexed with cdk1/2 inhibitor iii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
404
Chain Sequence
NFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQFRTSGWRAPELLEESNNLQTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Flavonol activation defines an unanticipated ligand-binding site in the kinase-RNase domain of IRE1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase
molecule keywords Serine/threonine-protein kinase/endoribonuclease IRE1
total genus 107
structure length 404
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06479 Ribonuc_2-5A Ribonuclease 2-5A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lj1A02
1.20.1440.180 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3lj1A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lj1A01
4ACDA 3DBQA 5HCXA 2UW7A 4MXZA 5HQ0A 2GSFA 2X0GA 4XV1A 5ITAA 1APME 4HYHA 4PDOA 2WEIA 5K5NA 1Z57A 2DS1A 3LFAA 1CMKE 1XH6A 2CGUA 3NW6A 4BHNA 4NW6A 4TL0A 2E9OA 3IGGA 4MAOA 2I1MA 1IRKA 3NAXA 4G3CA 2B9FA 4ZTMA 3PIYA 3PY1A 5JFWA 5CNOA 3PTGA 3UO5A 1FOTA 3GC7A 3ET7A 3ORZA 4K2RA 5IH5A 3ZSGA 3OD6X 5J7HA 4DYMA 1KE7A 5C8KA 4DEDA 2C6DA 4C02A 4W4VA 4AT4A 4FZAB 4R7IA 3DGKA 3KF4A 3GU7A 4NK9A 4MNEA 2BUJA 3OXTA 4J8MA 5ACBC 3SRVA 3BE9A 3LE6A 2PSQA 1PMNA 4Q9SA 4HZSA 4I0RA 3L8SA 5KHXA 4D2VA 5AA9A 3W55A 3AC4A 2NNWB 5E8XA 4EH2A 3FI4A 3WZJA 4EOPA 1WVYA 3DA6A 2WQEA 2XM8A 3KN5A 3NIZA 4G3DA 1OI9A 3DXQA 2C6IA 3Q53A 3F2RA 2O2UA 3F69A 2ITVA 4W9WA 4L53A 3C4ZA 4BWPA 4TYJA 3L9NA 4IFCA 3REPA 2JDTA 5CU3A 5HIEA 3ZS5A 5ICPA 4DFZE 2ZMDA 3QGYA 4CFXA 4YSMA 5D7VA 3SAYA 2OJ9A 1H1QA 3FSKA 2HZ0A 5HX8A 3O7LB 4EZ3A 3PSDA 4IX3A 1STCE 2CN5A 2QLUA 3R1QA 4IH8A 3SV0A 5IKWA 3C4WA 1MP8A 2XEYA 3QU0A 3HUBA 4YJRA 4DH3A 3MESA 2E9UA 2W96B 5KMOA 4YBJA 3CD8A 4IZYA 3FMDA 3A8WA 4FT3A 3FLQA 3FLYA 3MJ1A 5FTGA 2VRXA 1GZ8A 3OWKA 4LYNA 3F66A 3G9LX 2R3QA 5IISA 5D11A 5JMSA 1SM2A 3I4BA 4F6UA 3OOGA 4BDJA 2VTOA 4J1RA 4QMOA 4N4SA 3HMIA 4KIPA 4EKKA 2JBPA 1BL7A 3P86A 5HLNA 1AD5A 4N70A 4AW5A 4YZDA 3QKLA 3G90X 3I5ZA 2WQOA 1PXKA 3CTJA 4FKLA 3Q6WA 3QCXA 3TDWA 3GT8A 3UPXA 4RC2A 4XBUA 4NFNA 3WBLA 4I20A 4FIHA 2IZRA 3COKA 4QP1A 1F3MC 4DCEA 3V6RA 3HV5A 3GCQA 2B0QA 2EU9A 3RHXA 4X21A 5C8MA 3RPSA 3TCPA 2C3IB 3RAWA 2UW6A 2ZDUA 1R39A 3SKCA 4MKCA 4G1WA 2XBJA 1R78A 4UWYA 3GUBA 4TWCA 3BLHA 4AGUA 4JBPA 2AC3A 5DG5A 2Z8CA 2H9VA 3FZSA 4CMTA 3QXOA 4QP8A 4DINA 4F64A 3WILA 5DE2A 5HBHA 2BKZA 3NUNA 2YABA 3PIZA 3GFWA 2BROA 4FTJA 3LCOA 3EN5A 2JAVA 5KO1A 3U55A 4ZAUA 4FUXA 2CGWA 4JX3A 4FIJA 3UO4A 2UUEA 3KMWA 4XP2A 5HNGA 4DAWA 4IAIA 2WELA 5CT7A 4EOQA 2F57A 3ALOA 3WZEA 3SW7A 1PXMA 3IS5A 2EWAA 3RMFA 4D5HA 4BFMA 5KMLA 2VNWA 1IAHA 4CKIA 1G8SA 1YDRE 2UZLA 4CNHA 4AU8A 3VHEA 4KIKB 3ZBFA 3P78A 2BTRA 4BDDA 4JBQA 2J4ZA 1HCKA 4IMYA 1OL7A 5M4IA 3SHEA 4LRJA 4IVCA 3A99A 3P4KA 4O1PA 4O84A 1WCCA 3ULZA 2HENA 4BI1A 4FZFB 2OIDA 2Y8OA 4YHTA 1OIUA 3NCGA 2ITQA 3OT8A 1ZLTA 2VAGA 4OT6A 2WTJA 3ODYX 1KE8A 5HBEA 4ZK5A 5HTBA 4TYHA 4FNYA 5I9UA 1O6KA 4WA9A 4QTAA 4B0GA 2WO6A 4LRKA 4BDAA 3VUKA 4EYJA 1K9AA 4FIIA 2PULA 4EK6A 2RL5A 3LVPA 4O0WA 3EQRA 2YIRA 4IZ7A 2JFLA 5C1QB 2JFMA 4XG3A 5E8YA 1H24A 5TR6A 2CMWA 2X2KA 5F1ZA 2W4JA 3HRFA 3KXNA 5I9XA 4BGHA 1O9UA 2BCJA 5TF9A 4BCIA 3FZ1A 3FY0A 3BWFA 2UZTA 2CSNA 1QPCA 3MH3A 3TWJA 3UNKA 4GUBA 4K9YA 3CPBA 4F65A 4ZP5A 4F7NA 5E8TA 5EYCA 2GNHA 2JITA 5AP2A 2YCQA 3ZMMA 1QPEA 3E7OA 2QR8A 3HA8A 4YJPA 2RF9A 5A9UA 3O50A 3EFWA 3QKKA 4G3FA 2UZOA 3CS9A 3F5XA 1UWHA 1GIIA 3Q4TA 5C01A 3EYGA 3P0MA 4BDFA 4BYIA 4UMPA 5HO8A 4APPA 4ZTHA 4HYUA 1H8FA 2WMBA 4BDGA 2F4JA 4NIFB 4RBLA 2XYUA 2ZVAA 1IA9A 2XNMA 4RJ3A 1H1RA 4OT5A 3R7VA 3VW6A 1OPKA 2YM5A 4C2VA 4C3FA 5HIBA 3KMMA 2XJ2A 4RC3A 1H0VA 4WNPA 2XKEA 3QBNA 4BDIA 2HZ4A 5DR6A 5CQWA 4CD0A 2WU7A 4WT6A 4OBOA 3AMBA 4C57A 2R3IA 4M14A 5BPYA 5EW9A 3UE4A 3KCFA 1YOMA 2J0LA 2BALA 2QODA 3OEFX 4YHJA 5E8SA 3MYGA 3HECA 2JD5A 4J53A 2VWXA 4PPCA 3TT0A 4CMUA 2PU8A 4Y5QA 1RW8A 3U4UA 2ZAZA 4BWXA 4EQMA 3VQUA 3BV2A 3HMNA 3MDYA 3RAKA 3UVRA 3W8LA 4O7NA 4F4PA 2A2AA 2IVUA 4L42A 1WBWA 4BTMA 4WNOA 4NM0A 2GQRA 3IONA 2YZAA 3EN9A 3KCKA 4QP2A 4AA0A 4EONA 4DTAA 3QRJA 5J7BA 2X6EA 3ZOSA 4DC2A 3C5IA 3FI2A 3WF6A 5CI6A 5CSVA 4CGAA 4DCAA 3B8QA 3G9NA 4CQGA 1KE9A 3RKBA 4ZTLA 2C1AA 4FEQA 2UW0A 4FEUA 4QP9A 3QD0A 2JDOA 4PPBA 4RX8A 4PNKA 2R9SA 3FWQA 2FO0A 2C0TA 3KXHA 3R73A 5E8VA 4EH9A 4HNIA 3BYUA 3PJ8A 3HGKA 3ATSA 2PTKA 3SOAA 1HCLA 1XH5A 5LMBA 3WIKA 3Q2JA 5F95A 4O82A 2X9FA 3O51A 4TYIA 4YC6A 3TKIA 4M66A 4MYGA 5FDPA 1CKJA 2R7IA 5EDRA 4JLCA 1BYGA 3R8LA 4PL3A 4ALVA 3VO3A 4AFEA 2P4IA 5HKMA 5CALA 4ID7A 3E3BX 4Y46A 1CSNA 2PVRA 2ZMCA 3I0OA 4NWMA 3V5PA 3F5PA 2C6KA 5FWKK 4CMOA 1Y6AA 1Y91A 3BELA 2X2MA 3FMLA 4FKJA 4PX6A 4TKSA 4ENYA 4H05A 3DNEA 5CEIA 3NUXA 5AP7A 4KKHA 1XR1A 4EOMA 2EB3A 3RK7A 3IW5A 4BC6A 5A4TA 3CSVA 3L9MA 4FZ6A 4DGMA 3H30A 2E9NA 2Q0BA 3GU5A 4BI2A 4FVQA 3PJCA 5AP0A 4C2WA 4M0ZA 2C6LA 3C4FA 2R0IA 4FG7A 3TKUA 2GHMA 2PWLA 2QQ7A 3FMKA 1JSUA 2V5QA 4H1MA 5BYZA 3ZFYA 4DFNA 4IJPA 3SX9A 3ZRKA 1EH4A 4IZAA 4QP3A 3UTOA 2XJ1A 2G2HA 4A07A 3JPVA 2IG7A 4MVFA 4Y5HA 3COMA 3TIZA 4D5KA 3VRYA 3JVSA 1Z9XA 5L2QA 2PUNA 2W0JA 3UNZA 2CHLA 4D2TA 3R7EA 4D2RA 2X6DA 1Q8TA 2QNJA 2VV9A 2XJ0A 3C4XA 3GOKA 1OKZA 3I7BA 4I21A 4EH4A 3S00A 3DV3A 4E3CA 5A6NA 3GCVA 3ROCA 4E20A 1P4OA 1W8CA 1YRPA 3F3ZA 3EQCA 5IQCA 3ID6C 4AW0A 3QLGA 3F82A 2PZRA 4OAUC 4F7JA 4RZWA 2BAQA 3TN8A 4RFMA 4U6RA 1GJOA 3OG7A 4X2KA 3SD0A 3A7HA 4B7TA 5B2MA 3THBA 5HG8A 4TXCA 1YHVA 3KFAA 4L45A 1OL5A 5AUWA 5IG1A 4RX5A 4FZ7A 3IDBA 1J7LA 2XRWA 5B2LA 4KUJA 5LWMA 3C50A 1FMOE 2UW8A 2BFYA 2F9GA 4ZTRA 2QOKA 3QX4A 5KHWA 1H28A 2JIIA 3QZIA 3TV4A 3LFCA 4I6QA 3R7IA 4FEVA 4GKHA 4S30A 5FBNC 4AFJA 4FR4A 4ZOGA 2PUIA 1YHSA 1V0OA 2QG7A 2BZIB 3D14A 1H1WA 4BI0A 3MA3A 1UVRA 3W2CA 2QKRA 3PJ3A 3QC4A 2VTAA 3FUPA 4IQ6A 2A0CX 2EUFB 4F1MA 4O7SA 3A62A 4XH6A 2HELA 1YDSE 4IB0A 2F7ZE 4CVAA 1MQBA 3GU4A 4ANOA 4Y72A 4TN6A 2CJMA 5I9VA 4HGEA 5CXZA 1MRYA 3NAYA 4D1ZA 3QALE 2P2HA 2X4FA 3PE1A 5KE0A 3KF7A 2BDWA 1T46A 1P4FA 5M4FA 2JIVA 2CNUA 5E8ZA 3GP0A 3DDPA 3LJ0A 2W9FB 4TTHB 3OC1A 4YLKA 5IQDA 3FC1X 5E90A 1F0QA 4GT4A 3FLSA 5LVLA 3FYKX 3DQWA 4A9SA 3D4QA 4MNFA 4CFMA 2C69A 3D2KA 3F5UA 5LVNA 2BRMA 2UZEA 4E4LA 4RIYB 3BE2A 2O5KA 4FT9A 4FKSA 2ZJWA 3BQCA 4QPAA 5GJDA 1XH4A 3Q9WA 3PVWA 2BFXA 2VWYA 3WF8A 3NUUA 2BVAA 4AS0A 1VEBA 1QCFA 2XK9A 3BEAA 4RIWB 5IEXA 4E4MA 3RNYA 2I0EA 3QQUA 5H8EA 1QPDA 3O0GA 2XCKA 3R8UA 3NUPA 4R3CA 4EI4A 4DGOA 4FSUA 3TNQB 3DLZA 5CSWA 3MFRA 2YM4A 4HPTE 4X3FC 2C6OA 4PP9A 2YERA 5A4LA 3OW3A 2VX0A 2W4OA 2XA4A 3GXLA 3VS6A 4C36A 2CGVA 4DGGA 5FD2A 4LFIA 4WNKA 2WU6A 3LMHA 5AR7A 2HOGA 1ZYCA 5JQ8A 2R7BA 3FZOA 5CNNA 4F9YA 2I0VA 4L44A 4TT7A 5CVGA 3Q2MA 4FV2A 1L8TA 3LM0A 5HLPA 3QL8A 1MRUA 3DAKA 3ORKA 2YEXA 3UBDA 3V01A 2CN8A 4HZRA 2VX3A 1SNXA 3TUBA 4C37A 4HJOA 2SRCA 4LMUA 5L4QA 2IW6A 3BIZA 2QOBA 4HNFA 3UIBA 3NNXA 4FNWA 1JWHA 1M7NA 3C7QA 2OSCA 2I0YA 2V55A 1LEZA 2QG5A 2VWIA 4FC0A 4GV1A 5LMKA 4NL0A 4PDPA 4KNBA 5DT4A 5FXRA 4OTPA 3FC2A 4ERWA 2VX1A 2B9JA 3PDTA 2H96A 3MJ2A 3PY0A 4DG2E 4HOKA 4ZLZA 5KKRB 4U97A 5L2TA 3KQ7A 5C9CA 4QQCA 3AXWA 4UY9A 5CSHA 3FMNA 1JKKA 4X2GA 3M11A 3N4VA 4R3RA 2GS2A 2WD1A 5KZIA 3DFCB 3N4UA 4IX4A 3CLYA 4TWNA 4J96A 3R9OA 1Q41A 1YXVA 4OTGA 4S33A 3E88A 2BPMA 3FHRA 3M42A 4LV8A 4O0VA 4ZSLA 3VS2A 3R0TA 3UOJA 2NO3A 5LMKC 2HK5A 1Y8YA 4E6CA 4B99A 4BCJA 4ZSGA 3PWDA 5CVHA 3QA0A 4ZSAA 3DKFA 5L2IA 1FINA 2WEVA 2HZNA 5E4HA 4HVIA 3P7AA 1YI6A 3G5DA 3D7ZA 3NNUA 4MK0A 4UALA 4WO5A 4XV9A 4C62A 1E1XA 3R1NA 2I0HA 4YSJA 4MEDA 3ANRA 4YJNA 4D2SA 3NW7A 4D28A 3FQEA 4ARKA 1ZYLA 4RFYA 5AWMA 3H4JA 2OH4A 2OIBA 3TEIA 3SW4A 3LCKA 2EXCX 2GNGA 3ROYA 3NIEA 4QMXA 4UV0A 4OTDA 2B9HA 3U8WA 4EHEA 1H1PA 3CIKA 4BGGA 3E87A 2WMWA 3ORLA 3WZKA 3O8TA 4W9XA 3P1AA 3UJGA 2PL0A 4JVGA 3EFKA 4AGDA 3O7LD 4CV9A 3LFSA 4BICA 3VS1A 2C3LA 2IJMA 4FKGA 3DBFA 4O1OA 3OP5A 4E6DA 2UVYA 4CFFA 4L68A 4E6AA 4Z9LA 4A9UA 2WOUA 4E4XA 5D1JA 4ZJIA 1GY3A 4RJ4A 5AADA 4PP7A 5EM7A 4I23A 3UYTA 5LVPA 4Q2AA 4GS6A 4ERKA 5DFPA 4MF1A 1WVXA 3AG9A 5IDNA 4FE2A 3PP0A 3R9HA 2B54A 2R3NA 1LUFA 4ALWA 3V6SA 2AC5A 4KD1A 1U59A 3ZO3A 3LFEA 3DK6A 2NPQA 5IUHA 1UNHA 2BAKA 4MQ2A 5KBRA 5DRDA 4ZZNA 5DWRA 3G0FA 1YWVA 3OROA 3RK9A 1VZOA 4QTCA 4KKEA 2BIKB 2C68A 4MWHA 2X8EA 4OTIA 1R1WA 3QA8A 4M3QA 5EM6A 1FVRA 3P5KA 5B2KA 3QHWA 1Q62A 3PP1A 4PWNA 3KXZA 4IWQA 1V0PA 3CTQA 4P7EA 3NYVA 5JRQA 1KOAA 3COIA 2GNLA 3EQIA 4EH8A 2IO6A 2QC6A 4PTCA 5IUIA 1RQQA 4OTHA 5DVRA 3LQ3A 2X9EA 2WTCA 4EOLA 5CAQA 2DWBA 2WGJA 3MH0A 3QF9A 4Q5HA 3SXSA 4NKSA 4AWIA 4BY9E 4AZWA 1V0BA 3RPYA 4OTWA 5CF6A 3PVBA 3EH9A 3V8TA 5HNIX 4ZY4A 1QPJA 5BNJA 3BHHA 2NRYA 2WHBA 4JL9A 3QD3A 4D4RA 2WKMA 4C3PA 5IA1A 3CD3A 4DBNA 3ZZEA 4XRJA 3GNIB 4A9RA 4CYJA 2JC6A 1M2PA 3GQIA 4D1XA 4K11A 4BDKA 4MXXA 4AT5A 3KKVA 3NMUF 3LKMA 1OUKA 3S1HA 3BLQA 4OTRA 5M08A 4QTEA 4L00A 3PA3A 4F0GA 2UZVA 3DBCA 2X1NA 3WYYA 4BBEA 3FLNC 3OBJA 3PVGA 5CU4A 2W4KA 2C0IA 4WUNA 4CFVA 3LW0A 2ITYA 5J79A 3TV7A 5IMXA 3ODZX 4YZ9A 3ZYAA 5L8KA 3EOCA 4LQMA 3DOGA 1QMZA 2XS0A 4BTFA 4CFUA 5GZ8A 3H9OA 4J99A 1R3CA 3QRUA 3FDNA 4K33A 5DT0A 4R1VA 4E1ZA 4ITIA 3O8PA 5D41A 4NTSA 3PXQA 4NT4A 3FZTA 4AZSA 3MIYA 4ZTQA 4PMMA 3GB2A 4XG7A 3UIUA 4YO4A 4X0MA 3GCPA 3HUCA 2C0OA 1ZYDA 3LLAA 1E1VA 3VW8A 1DI9A 3FZRA 5BVEA 4C4JA 1WFCA 3VF9A 1ZYJA 4GIHA 3W2OA 3C51A 4FIGA 2PE0A 3AC3A 3R2YA 3OXZA 1R0EA 4FV6A 2RFDA 3VBVA 3MWUA 4A9YA 4CT2A 4EBVA 4YTIA 4DGLC 3S0OA 5BMSA 2W1GA 3C9WA 5IQEA 2YWVA 5AUYA 5K3YA 3VBQA 3H3CA 3KRWA 3F2AA 2HY0A 4G6OA 3V04A 4KSPA 4PRJA 3SDJA 4U81A 5BUJA 4I4EA 5GNKA 5AV3A 2WTKB 3W33A 3QZGA 2BKKA 2QONA 3PRFA 2P33A 1YQJA 5CY3A 4CZUA 5L8LA 1R0PA 2GMXA 3S95A 4GVJA 4TWOA 5KMIA 3DDQA 4O7ZA 3RAIA 2YCRA 4KAOA 3LQ5A 4UZDA 1YI3A 4L46A 1UV5A 2J6MA 3Q4CA 4RFZA 5T68A 3KC3A 4R3PA 4WOVA 4EC9A 1UU9A 4CZYB 1WBTA 4CRLA 4IAFA 3TG1A 3GCUA 1ZMWA 3K54A 4FG8A 4RJ5A 3T9IA 5C4KA 2OLCA 3B2TA 4RX7A 4MTAA 2J0MB 2XKDA 2XF0A 2VD5A 4YJOA 4CKRA 2XNOA 1YXSA 3QRKA 5JFXA 4AOIA 3I6UA 1G5SA 3JY0A 4XG2A 5KZ0A 1K3AA 3N4TA 4QP4A 5GJFA 3TI1A 1IA8A 2FSLX 3O17A 4JIAA 5EOLA 3R83A 4IFGA 3U9NA 4BDEA 2QCSA 4FSQA 4PL5A 3TACA 5DHJA 5F20A 2WZJA 3AC1A 4RWLA 3AD4A 4RQKA 4EHGA 5EH0A 1PKDA 2BZHB 1NXKA 3QFVA 4ZTNA 5EQYA 4M97A 3D2IA 4NJ3A 5B7VA 4N0SA 2PMIA 1ZMVA 4GK2A 1GZNA 4ZJVA 5L3AA 5M57A 2ITZA 1LEWA 1ZY4A 2VO7A 1U46A 3PZHA 2FYSA 3A2CA 3TZMA 4BN1A 4RA4A 3MB7A 4QYGA 3GC9A 4Y85A 2IW9A 4FK3A 1OIQA 5J1WA 3QZHA 5IZFA 3IECA 4O6LA 4FT7A 5IA0A 5M53A 4PUZA 2GNFA 2A4LA 2PZPA 4ZIMA 3BHYA 3AMYA 3R2BA 4LUDA 2Q0NA 4ANLA 2VTJA 1XKKA 5JGBA 1NW1A 1GIHA 5HG9A 3E63A 4N57A 4FSZA 4ZSJA 3JR1A 5I9WA 3LXNA 3KULB 4FYOA 5AR2A 1PF8A 2OFUA 3PSBA 5EHLA 1PRYA 2PE1A 3EL7A 3LCDA 3D15A 2A27A 3KB7A 4MBIA 4O96A 2EXEA 4DEBA 5HZNA 3FPMA 2GNIA 3EFJA 4IVAA 3R01A 4D2WA 5KX8A 3CJFA 5HORA 4R77A 4F09A 4UN0C 2BZKB 2QI8A 3V8WA 2GQSA 4O0SA 3DTWA 4H3BA 5KBQA 4AN9A 3AT3A 2BDFA 2Y0AA 4EWQA 4LMNA 4UMUA 4DEHA 3ANQA 2AYPA 4USDA 2YJSA 4O2ZA 5H8GA 2QOIA 2C6EA 4GYGA 5DA3A 4BR3A 4FV5A 4JQ7A 4AUAA 3ZTXA 3ERKA 4CFNA 4CKJA 5KMJA 4GK4A 4AA5A 1UNGA 4GUEA 4AGWA 3U6JA 5AUUA 1JNKA 2YM7A 3CGOA 3ATTA 4E5BA 4FK6A 5HNBA 3V5LA 1TVOA 4KIOA 1QL6A 2XIYA 3HL7A 2R64A 4GG5A 4JBVA 3UC4A 2XVDA 4TZRA 4DH1A 5CU6A 4QD6A 3VJNA 2R3LA 2WMSA 1H1SA 3QTZA 4FG9A 5HD7A 2BR1A 5J9LA 5EOBA 1ERKA 2QOLA 4WG5A 1NVQA 4YPDA 5EFQA 4FTAA 4U79A 5E7RA 4YGAA 5HI2A 4AF3A 2IPXA 3S3IA 2YZLA 4IWOA 3RHKA 1RE8A 2J7TA 4UZHA 3VS0A 2B52A 4CG9A 4W8DA 5BQ0A 2YA9A 5DOSA 2ACXA 2WAJA 1LR4A 4IEBA 4MX9A 1RJBA 3TUCA 1YXTA 4IM2A 4B8MA 4V0GA 2WMTA 5AM6A 4TYEA 5ANDA 4NKAA 1YWNA 3LCTA 4DHFA 4ANMA 4TY1A 4C34A 5FBOA 2VTPA 2RG5A 4R1YA 3PJ1A 1VR2A 3C0HA 4FKVA 5IQAA 2RIOA 3IDCA 4FV7A 1WMKA 4ASEA 5HD4A 4MD9E 5C8NA 3TNWA 3C0GA 4GEOA 2E9VA 3QRIA 1M14A 2PMLX 3QQLA 5BVWA 4G3GA 1VYZA 2C5NA 4BCKA 3MH1A 1CKIA 3TZ8A 4AN3A 2ZV2A 2W1FA 3D7TA 4FOBA 5EG3A 3IW6A 3ORIA 4IVBA 4IM3A 4U3YA 4EQUA 3RPRA 3NZ0A 2IVTA 4XOZA 4CG8A 3EKKA 3D5UA 4OBQA 2BZJA 4DF3A 2WMXA 2JEDA 5GHVA 4B8LA 4XNEA 2QOHA 4CCUA 3GC0A 4BVUA 5LVOA 4E8AA 5AAFA 4P5ZA 2VTLA 3LFNA 1ZZ2A 4OBPA 4JQ8A 5J5TA 1Y57A 3MSSA 4O7WA 4HVSA 4BCFA 4O0YA 4HPUE 1BI7A 4DN5A 4V05A 4WBOA 3UYSA 4JG8A 4EJNA 2C5XA 3KK8A 3BRBA 4HYIA 4NFMA 4EOOA 5K9IA 4YR8A 5AIKA 2VWZA 2XNPA 3FI3A 2F7EE 4I3ZA 2B53A 1YXUA 3OBGA 3ZM4A 1OKVA 4UBAA 5L6PA 3EN7A 5CZHA 4BKYA 1FBNA 2OI4X 4I92A 5BVDA 4KBAA 3KXMA 3PPKA 4PMPA 3RCJA 4IB5A 2OJJA 3F7ZA 5HESA 2UW4A 4IAKA 4QYHA 2W05A 3H10A 4R7BA 4FTUA 4EJ7A 3R02A 4EH6A 4QP7A 1FPUA 2OO8X 3JS2A 3OCGA 4GJ3A 4F0IA 2YIWA 4ACMA 2WMUA 2WQMA 4QMNA 3WF9A 1SVEA 4DH5A 2OG8A 3QYWA 4L3PA 4USEA 5DEWA 2OWBA 4NM3A 1XWSA 4FTCA 3FI8A 3NVKI 3BHTA 2YITA 4H3QA 1MQ4A 4FGRA 2QU5A 3OWPA 2PVNA 3V8SA 5J5SA 2ZM3A 4IB1A 2R3HA 2ETMA 5CASA 4NTTA 4AAAA 3DKGA 2PHKA 2Y4IC 3F9NA 4MWIA 4O22A 4MQ1A 3GENA 3MTFA 4C3RA 4E73A 2Y9QA 4YJVA 4Q5EA 4DFYA 1JQHA 3C0IA 3LPBA 2AUHA 4HGSA 2W5HA 5EW8A 3IOPA 4IB3A 3F88A 3MN3A 3UGCA 3OCSA 1OM1A 1O6LA 4QMZA 1H4LA 2RFEA 3R21A 4QOXA 4XG4A 5FP5A 1IAJA 3VS5A 3NRMA 1F5QA 4BL1A 4FKTA 5EW3A 2C30A 4KB8A 3U51A 4RPVA 2W06A 4QP6A 3IOKA 5CTPA 4ENXA 2UVZA 2YFXA 4F6SA 4P4CA 3I1AA 4ZTSA 2YIQA 3MPTA 4FSRA 4I4FA 5FXQA 3UO6A 3HP2A 5H3QA 4M68A 4WRSA 3EQGA 3R7OA 4DTBA 4ZS4A 4C58A 4HGTA 2GFSA 4GU9A 4YTHA 2F49A 3Q9XA 3ZCLA 2W17A 4TWPA 4U7ZA 2BRBA 4CT1A 3ZUUA 4E26A 5D9HA 3BCEA 1VYWA 4O7LA 3Q3BA 4U9AA 4L9IA 3FHIA 2LAVA 3HV4A 1SVHA 2VZ6A 4O0XA 4RVMA 3JXWA 1M2QA 5M51A 2XKCA 3QCQA 1J1BA 1ZYSA 4KIKA 4JJRA 1AGWA 4PL4A 4YMJA 2R0UA 4FUYA 5HOAA 4L43A 1ZAOA 3I0QA 4I5PA 4QYYA 4X3FA 5IEYA 3F61A 3VS3A 1JVPP 1BLXA 4EEVA 4ASXA 4ACCA 3IPHA 3IDPA 5CANA 4IX6A 2BRGA 2VTTA 3T9TA 1DAWA 5ETIA 4D9TA 4O7RA 2O0UA 1XH7A 3FY2A 2OGVA 4C4EA 3QTWA 3DBDA 2PMOX 4RIOA 4BZOA 4DGNA 1GAGA 4ZLOA 2WB8A 4BCGA 1Q8WA 4U8ZA 4D9UA 1SYKA 4X2JA 2C5YA 3BGZA 3MV5A 3NSZA 4M15A 4L3JA 3BGPA 1B39A 4FL1A 4HVHA 4ZY6A 4AOJA 2O64A 3EQDA 3D5XA 4IX5A 2JDSA 5H2UA 3K3JA 4BKJA 4BIDA 2G01A 2OIQA 5EHYA 2RKUA 4JDHA 5D12A 1PXNA 4LL5A 2Y4PA 4ZS0A 4RIWA 5BVFA 2PVHA 1X8BA 4EKLA 4K8AA 1W98A 3G33A 5A4CA 5AP3A 5L2SA 5IQGA 3I5NA 2ZB1A 5BVNA 4Z7HA 2Z7QA 4USFA 4TRLA 5AAEA 4XV2A 1XH9A 2XZSA 2QOFA 4OUCA 5FEQA 3ZU7A 1OIRA 3BQRA 2FH9A 2HCKA 4WKQA 3LXKA 4QYEA 4HCVA 5DR9A 4PTGA 2P0CA 4TNBA 5B0XA 4BYJA 2ITPA 4MBJA 5AR5A 3UP2A 5CXHA 4I93A 2XBAA 2ITTA 4I41A 1FGKA 4LGHA 2YWPA 3GFEA 1OUYA 2CNQA 3NCZA 2WIPA 4FVRA 2VTIA 1BUHA 5EM5A 4QT1A 3W18A 3OZ6A 5T6KA 4HVGA 4NIFA 5AFVA 2YAKA 3AGLA 5IDPA 4ITJA 4WUAA 3CXWA 3KGAA 4O6EA 5BVOA 4JNWA 3EFLA 5AP6A 3ULIA 4FV3A 5IH6A 2JKKA 2Z7LA 5JFSA 3E3PA 3DKOA 1FVTA 3OS3A 5HG7A 2BDJA 5M06A 4GL9A 5KNJA 3QXPA 4YC3A 3TV6A 1ATPE 1KOBA 4UXQA 4GW8A 3U54A 4ANQA 4CLIA 4V01A 4MF0A 4DEGA 3DU8A 4D0WA 2R3FA 2VWBA 2X81A 3A60A 3HMOA 5HIDA 3DBEA 3TZ9A 1TQMA 2C6MA 4F6WA 4L7FA 4UEUA 1PXJA 3FXZA 4RZVA 3OW4A 2O3PA 4FTLA 2FVDA 2HXQA 4M13A 2X7OA 3NNWA 4EH5A 4M8TA 4DITA 4A9TA 4YNEA 2ITUA 4BDBA 5HCYA 2HY81 4J97A 4Y8DA 4IW0A 4KBKA 3U9CA 3A7FA 3PA5A 2YJRA 4Z16A 3OHTA 3QTSA 1Q24A 3VVHA 1OZ1A 3BLRA 4HCTA 2Y7JA 2CLQA 1TKIA 5AP5A 2Q83A 5CYIA 3DZOA 4AE9A 5IA3A 5AUXA 4DLJA 2FSTX 5J9YA 5JZJA 4G5PA 1OBGA 3ZONA 5HE0A 3MGYA 1M7QA 4WIHA 3TTIA 3DB6A 2CPKE 3ZFMA 1UU3A 1WBOA 2W9ZB 3A4PA 4L52A 3VC4A 4LL0A 4EK8A 1PMVA 5HEZA 3EB0A 2HWPA 5LOHA 4KRDA 4F9CA 4JG7A 2C5OA 3CPCA 3I6WA 3LOKA 3ZLYA 1VJYA 3C4CA 5FP6A 4FEWA 2YLFA 4FZDB 4F63A 1M52A 4DH8A 2QLQA 3B2WA 4I6FA 2FGIA 3AD5A 1AQ1A 3CC6A 3BZ3A 3RINA 4M69B 3CY3A 4EOJA 4KSQA 4L01A 2Z02A 4FV1A 3FLZA 4MHAA 4MXAA 5AUVA 3K2LA 3UQFA 5DMZA 2J5FA 5AV0A 5ANJA 3VF8A 4AZEA 3POOA 5CU2A 5DBXA 5GZAA 3HDNA 4AP7A 3KL8A 5BYLA 2J51A 4FL2A 5J8IA 1H26A 2WTKC 3Q9YA 4L67A 3OUNB 1ZOHA 3R71A 5FGKA 4YP8A 1U5RA 5A3XA 4EZ5A 4QRCA 4FMQA 4Q9ZA 3IW8A 4U5JA 4G6NA 2CKQA 2XNNA 3F2NA 4IAZA 4XOYA 3D0EA 3UMXA 2B55A 4IC8A 3CKWA 4IDVA 4AOTA 4R6VA 4E93A 4FKPA 2CNVA 5IQFA 1XBAA 4GRBA 3WF7A 2YCSA 3FKLA 4FTIA 5ACKA 2PVMA 3D5WA 4WRGA 5I3RA 5ANOA 5HO7A 4WG3A 4TPTA 4JIKA 1CM8A 1UKHA 4FTQA 3CQEA 1W82A 3E64A 3CQUA 2IVSA 3MBLA 1PHKA 3PVUA 5HICA 4CXAA 3RK5A 4ALUA 1Q8ZA 2C3KA 2XIKA 4XYFA 2X7GA 5DLSA 5CF5A 5HGIA 4AX8A 3QWKA 5GJGA 4JT3A 5E91A 4X2FA 3D5VA 5FG8A 3QGWA 4ZMEA 3RBWA 4X2NA 5AV2A 3R30A 3OTUA 3DTCA 5ANEA 5H8BA 4RJ8A 4LOOA 4JR7A 3AGMA 4J52A 3W16A 4KA3A 4PMSA 4JDJA 4QMLA 1B38A 2NP8A 4XLVA 2Z60A 3HNGA 3GU8A 3L8PA 1ZRZA 4RWIA 4KINA 2XNGA 3OF0A 3HP5A 4QTDA 4HW7A 4FGBA 4I5HA 2PZIA 4BTKA 3TZ7A 3PSCA 2W99B 2WOTA 4NM7A 3NLBA 2OW3A 2H8HA 3DLSA 3P08A 2QU6A 5JQ5A 1H08A 3Q52A 4GU6A 3BV3A 4JDKA 4GSBA 4BBMA 3PRIA 1OBDA 3FL5A 4W4XA 2V0DA 2IW8A 4M0YA 4RX9A 4BHZA 4U80A 3R1YA 4M12A 5L6WL 1U4DA 5EDQA 3ZHPC 4D1SA 4LG4A 5J87A 1PJKA 2XM9A 3VBYA 4AN2A 2HZIA 4ZXTA 3GC8A 1JOWB 5EKOA 3QAME 3QQGA 3QC9A 3VS7A 3F6XA 2GS7A 3OCTA 3KVWA 4FKOA 4YZBA 2WQNA 3BYSA 5JRSA 2BRHA 2OF4A 4LUEA 4EORA 1XQZA 3SXFA 5M09A 4LOPA 2RFSA 4NEUA 3DJ6A 2R5TA 5AX9A 3UP7A 3MVHA 2WQBA 4W8EA 3UPZA 3Q6UA 3QCYA 5I4NA 3RTPA 3BYOA 4RJ6A 3HVCA 4KBCA 5GIPE 3DY7A 4EQCA 2R3PA 2IWIA 4GVAA 4JRNA 4BZDA 1Z5MA 2CKOA 4QYFA 3CQWA 5JN2A 3C13A 3UVQA 3W2RA 3MVMA 5TE0A 4A4OA 3H0ZA 1M2RA 3WI6A 2GHGA 1PKGA 2JDVA 3A7JA 3RZBA 3KRJA 2J2IB 1S9IA 2E9PA 4XG9A 4YLLA 3QTQA 2YM6A 3ZC6A 3BKBA 3Q4ZA 3VAPA 3E7VA 3R9DA 4QQTA 3ZDUA 4GJ2A 2CKEA 2ETKA 4ZEGA 3FKOA 4I6BA 3PZEA 4H3PA 4IWPA 4UXLA 4UYNA 5AP1A 3RI1A 5CF8A 3DFAA 2EXMA 2GHLA 1WAKA 3KULA 2UZUE 3FMHA 4AGCA 1REKA 4D58A 2ZYBA 3ACJA 4ZMFA 4ZY5A 4KS7A 4FSNA 3RPVA 3LFDA 2A19B 2C47A 3MPAA 5IMEA 5TOZA 4F08A 3Q5IA 2XYNA 1YXXA 1UNLA 4FODA 5EQPA 2R2PA 2VO3A 2WMQA 3EQHA 4UMTA 4ASDA 1ZOGA 3G15A 4PV0A 4AZVA 4BCNA 3CR0A 5CEOA 2DQ7X 3C1XA 3T8OA 3Q60A 4C4FA 1K2PA 3D94A 3TL8A 4ANNA 3AC5A 3HRBA 5DEYA 3FPQA 3OTVA 2W5BA 4L8MA 2VN9A 2W1HA 3GGFA 3RGFA 1OPJA 4QQJA 3HMMA 1W7HA 2G2FA 4ACGA 4CCBA 4I22A 3I81A 3ZEPA 4EK5A 4R5SA 2NRUA 5FTQA 3ZLWA 3NEWA 1OKYA 3O23A 2WMRA 1XBCA 4O38A 3AQVA 4U3ZA 5LJJA 5F94A 4BDCA 3UIXA 3CGFA 3MH2A 4FKIA 4RWJA 4F7LA 3K5UA 1JKLA 5IA4A 3NUSA 4C4HA 4FBXA 3SC1A 4IACA 3UG2A 4G17A 3QX2A 4O27B 5KMNA 3L1SA 3BWJA 3N9XA 4JXFA 5JEBA 2QO7A 3DKCA 3VUIA 3QUPA 3UOLA 2QR7A 3PLSA 5CF4A 1YKRA 4OAVB 1CTPE 3BU5A 3VBXA 2O8YA 3QQJA 5FUTA 5FDXA 5AR3A 3AC2A 3U4WA 2RSVA 4JBOA 5IA5A 2JGZA 5EYKA 5IQBA 2I6LA 3I60A 4RIXA 3R63A 3P7BA 2W1IA 4J71A 1Q8UA 1UU8A 5J1VA 5DPVA 2PVFA 2LGCA 4OR5A 2R3OA 3ORXA 4BWKA 2F7XE 2OZAA 4G31A 1J1CA 4YZCA 3G2FA 3R7YA 3QTRA 5DT3A 4QMWA 3QYZA 3NS9A 4I5MA 3CEKA 3TNIA 3TNPC 1UWJA 1J91A 4FSWA 4PF4A 4U43A 3D83A 5TO8A 1U5QA 3COHA 4WNMA 3W8QA 4NM5A 3DPKA 3A8XA 4C59A 5HU3A 4PDYA 5FM3A 1Q97A 2R3RA 5HX6A 2CCIA 2UZNA 4XEYA 4JQEA 4HCUA 2VWUA 5DNRA 4YJTA 3S2PA 1GZKA 3CP9A 4YZNA 5J95A 2O65A 5FM2A 4F99A 4YO6A 3S4QA 1IEPA 3CE3A 3PUPA 2PVLA 5EI8A 3SOCA 3SQQA 5JZNA 4GT3A 3SG9A 4R78A 5AJQA 1P14A 3PIXA 4C4GA 4O0RA 4RVLA 4RLKA 4O7TA 2X8IA 4RWKA 4AT3A 4K18A 2OBJA 5ETCA 3PXYA 1PXOA 3ZRMA 3JVRA 3KRXA 2XUUA 1OVEA 3CKXA 2GQGA 3FXXA 4JRVA 5GZ9A 5M55A 4EOSA 5IU2A 1L3RE 4FYNA 2V7OA 3Q4UA 3RCDA 5LARA 3V3VA 3BBWA 3ZC5A 5IF1A 1KSWA 5JK3A 4TNDA 4FTTA 5F9EA 4APCA 1Q5KA 3R00A 3OY1A 4NJDA 2PVJA 4BKZA 3HAMA 3I7CA 2WTVA 4KKGA 5HG5A 1NY3A 2OJFE 2WFYA 3JYAA 3FQHA 3BPRA 2PZ5A 2IN6A 2W1DA 3PE2A 3UDBA 5CEMA 3PLAE 5FEDA 3R8PA 2BHEA 2C5VA 3KY2A 3NW5A 2GNJA 3AT4A 4I94A 4QMUA 3UZPA 3VBWA 3VNTA 5EI2A 5BX0A 2YN8A 4ZZOA 4X3FB 5EHOA 2IZTA 3O2MA 4BBFA 2VO6A 5DIAA 3F3UA 4I24A 2ITWA 1GNGA 4QNAA 4XS2A 5CX9A 5J9ZA 3KN6A 3VUMA 1SNUA 2H6DA 4GT5A 4JAIA 4P5QA 4S2ZA 4XMOA 3VWAA 4CYIA 5LVMA 3EIDA 2B4SB 4KABA 3ZDIA 3NGAA 3L9PA 4KIQA 4S32A 3OT3A 2FB8A 1OL6A 3VQHA 3W2QA 3WOWA 3O71A 1H27A 3VUHA 5CZIA 1J7IA 2XIRA 2REIA 4WSQA 1JSVA 3II5A 2FA2A 5IQHA 3L8XA 1XH8A 4WSYA 4FT5A 4UMRA 1MUOA 5CAUA 4GG7A 2ONLA 3E5AA 4EOIA 3E92A 3H9FA 3KK9A 3PXKA 2XRUA 3MPMA 3VUTA 4DFUA 1Q3WA 3RJCA 3OFMA 3OCBA 5FQDC 1XBBA 2P2IA 3PA4A 4O0TA 1SMHA 2UW9A 3QD4A 2WTDA 2XK8A 3FXWA 2YLEA 4AZFA 5IQIA 2CCHA 3ZRLA 1HOWA 1GOLA 3E8DA 2VO0A 3ZSIA 3LCSA 3IW7A 3LMGA 3AMAA 3IK3A 3O8UA 4M7IA 3WZDA 4F7SA 2B1PA 2YM3A 3PPZA 4ACHA 4J8NA 3CBLA 3V5JA 5A14A 4QMYA 1E9HA 4CRSA 3IO7A 5A46A 4A7CA 3EYHA 3W2PA 3OOMA 5K4JA 3LIJA 5HHWA 2VTRA 3UOHA 2C1BA 3R9NA 3TUDA 3GU6A 4BCOA 3A61A 3M2WA 5IEVA 2KULA 3RM7A 4S34A 3VN9A 4RLLA 4QMMA 4KS8A 5EK7A 4I6HA 5AX3A 1FQ1B 4F1TA 5I5ZA 4O2PA 2JDRA 3LAUA 5CAOA 1O6YA 2F2CB 1KV1A 2VTQA 5HVKA 2YIYA 5AP4A 5EYDA 4BGQA 2HW7A 4NU1A 1NA7A 4N6ZA 2DYLA 5D7AA 5CVFA 4LGGA 5FXSA 4DT9A 2BRNA 3W1FA 4BCMA 2Y6OA 4XHKB 4YJUA 2GPHA 3N51A 4H36A 5EI6A 1XHAA 5HE1A 1TQIA 4K1BA 3FJQE 4EK3A 1UKIA 2XB7A 2CKPA 4O7VA 1WZYA 2IZSA 3DNDA 3MY1A 5HTCA 3NUAA 1J3HA 1NVSA 3OWJA 4LRMA 1KUTA 4EUUA 2YAAA 1SVGA 4RJ7A 2GFCA 1KE6A 3KEXA 4II5A 4O83A 4IANA 2ZM1A 1H00A 4C38A 3EQBA 5GINE 3BU3A 2Z2WA 4D4YA 3QHRA 2ITXA 2FUMA 1WBSA 2JKOA 2R3GA 4UWCA 5E8WA 5ANKA 1YDTE 4RSSA 1BMKA 3TJCA 2QHNA 1W83A 3ZLSA 4EOKA 1H01A 5JFVA 5JSMA 2EVAA 2A1AB 3FQSA 2XIXA 3G6HA 3OUKA 3QQHA 1P5EA 5LXMA 2G9XA 3Q96A 3PYYA 4G5JA 3PXFA 4M69A 5FRIA 4U44A 5BYYA 2X2LA 2XH5A 4F0FA 4D4VA 3QTIA 5AV1A 3NUYA 4JOAA 2CDZA 3P7CA 4BCQA 2OZOA 3LFQA 3HYHA 3ETAA 4CFWA 2XCHA 1YWRA 4YLJA 3WE4A 4C8BA 4V0GB 4C33A 3ORTA 2ZB0A 1JSTA 4FKUA 4XBRA 5KMKA 3MY0A 3RALA 3B8RA 5KKRC 1PXPA 5E8UA 1JLUE 2JIUA 4RT7A 1OPLA 3ZBXA 3ZZWA 4ONAA 3QUEA 4F70A 3CCNA 3KRLA 3ELJA 2DUVA 3TKHA 2OU7A 3V5WA 4LOQA 3KREA 1YOLA 2GS6A 3AC8A 4QMPA 2PVYA 3HA6A 5F4NA 1G8AA 2QO2A 3UZRA 5IA2A 2YISA 3EMGA 2J0IA 3HEGA 3UG1A 1PMUA 5EKNA 2OH0E 3P23A 3VUGA 5HU9A 1Q3DA 2QVSE 4N6YA 4NCTA 4NCTC 4FKWA 4NH1A 4O91A 3UIMA 4O81A 3NPCA 2GDOA 5LMAA 2HIWA 2I40A 4AQCA 3SG8A 4FL3A 4NYEA 3O96A 3ORMA 3HLLA 5CENA 3R1SA 4J95A 5ANGA 3V5TA 1I09A 2XP2A 4OLIA 4DT8A 3EJ1A 1JKSA 1Y8GA 3JUHA 3QQFA 3LJ2A 2WXVA 4IVDA 2B7AA 4QMVA 1H07A 4GYIA 3EQFA 2ITNA 2VWWA 4S31A 3DB8A 4IWDA 4JS8A 4FKQA 4YHFA 3ZSHA 1A06A 1U54B 3R28A 2YDKA 3OVVA 3M1SA 1RDQE 3QKMA 4NSTA 3SLSA 4ORKA 3FKNA 4OGRA 2WTIA 1OKWA 2YACA 3DXNA 1Q4LA 3F3WA 4DEIA 3F7WA 4LGDA 4EUTA 3IKAA 4Z3VA 4C4IA 4IAAA 1UA2A 3TDVA 1JPAA 3GQLA 4D2PA 4IIRA 4FICA 4AZTA 3MTLA 5AR8A 4QTBA 4BIEA 1Y6BA 1OMWA 4GFOA 4PTEA 4G6LA 3U87A 5A6OA 4FTRA 1WBNA 5A4QA 3NYNA 4PMTA 3PXZA 2GTMA 5JGDA 4C7TA 1LP4A 3W2SA 3MY5A 2RFNA 4F9WA 5I9ZA 1A48A 2CGXA 2HWOA 4FSMA 5CEPA 2PE2A 3ENMA 3VULA 5AIRA 2P55A 4B6LA 4E5AX 3LFBA 3K3IA 3KXGA 1W0XC 4DFBA 2YDIA 2XKFA 4QPMA 4R5YA 3AOXA 2ESMA 1DAYA 4I0SA 3WARA 3FZPA 2QO9A 5E92A 4YC8A 5A4EA 5FTOA 4E5WA 3VS4A 3Q9ZA 4FA2A 5JT2A 5M07A 2J90A 4I5CA 5K0XA 1OGUA 4GK3A 4DE4A 3T3UA 2QOQA 4U45A 2V62A 4XG6A 5EM8A 5DYJA 1OL2A 5LQFA 4PPAA 4IDTA 4IM0A 5BMMA 5HTIA 1FGIA 1Q8YA 3FYJX 2G2IA 2BIYA 5C03A 4O7YA 1CKPA 5L2WA 3GI3A 4IXPA 2ZDTA 5FEEA 1XJDA 4FT0A 5M4UA 3FMEA 4DTKA 4IBMA 4WHZA 3BYMA 1JAMA 4QO9A 3BHUA 4YTCA 3W10A 4UMQA 3WIGA 2HW6A 3FL4A 2HYYA 3PG1A 4RG0A 2GCDA 2P3GX 4UWBA 5BUEA 1IR3A 4HYSA 2VU3A 3D7TB 4EC8A 5TKDA 4MH7A 1BI8A 3NDMA 3GBZA 3Q32A 2QURA 3EL8A 1DI8A 5M56A 1DM2A 1WBPA 1A9UA 1CDKA 1IG1A 4K77A 2X7FA 4YBKA 3MW1A 4X3JA 4YJQA 2ZM4A 3V51A 2FSMX 5DN3A 4NW5A 4YZMA 3ZUTA 5JKGA 4GCJA 4CQEA 1YOJA 3A7IA 1GZOA 4JX7A 4KRCA 2VNYA 4YNOA 2WTWA 4GMYA 5CLPA 4LV5A 4H58A 3QLFA 3VBTA 4AXAA 3DJ5A 4P90A 4CTBA 3HV6A 5D10A 3RNIA 5C4LA 1URWA 3RPOA 3G6GA 3UQCA 4FIFA 2VTNA 4FTOA 3TTJA 4JAJA 5FLFA 4FTNA 4TYHB 3ACKA 4Y73A 5AV4A 4YUQA 2ZV7A 2XNBA 4Z55A 5IH4A 3QQKA 3DS6A 4EHVA 4XP3A 2PZYA 4O86A 1YHWA 4CTCA 2ONLC 5I0BA 2JAMA 5IPJA 5L8JA 2BHHA 4DG3E 2J0KA 3QUDA 1KE5A 2R4BA 3K5VA 3C5UA 4FOCA 4FX3A 4IHPA 4MBLA 5BVKA 4EBWA 3GCSA 2BILB 3W32A 4EH7A 2OXDA 3FE3A 3E8CA 2BMCA 3LZBA 4I0TA 3DK7A 5C26A 5K5XA 3R8ZA 2GU8A 2QOOA 4YJSA 2C3JA 5A54A 4ZJJA 1MRVA 3R7UA 3RZFA 1PW2A 5DGZA 3JY9A 4DFLA 4HVDA 2ZV9A 3I79A 2PK9A 1M17A 3EKNA 4D55A 2J0JA 4FIEA 2QD9A 3UODA 4RQVA 2PPQA 4IC7A 1OB3A 3QTXA 4YU2A 3NNVA 4G2FA 3G51A 4IE9A 3MB6A 1DS5A 4A4LA 3BX5A 3DT1A 3R22A 3L9LA 5DRBA 3VIDA 3LLTA 4IADA 4X6RA 2XK4A 3Q5ZA 3OEZA 2OJGA 3VRZA 4UYAA 1S9JA 2EB2A 3HV7A 3ZUVA 5M4CA 4OTFA 4PDSA 5EDPA 3KMUA 3WZUA 1IASA 5AMNA 4G9RA 4B9DA 2ERKA 3PFQA 4CSVA 3UNJA 4F9AA 4X6QC 4K6ZA 2B9IA 3E62A 4FKRA 3ZO4A 4EHZA 2XEZA 5T3QA 3LHJA 3POZA 3TNHA 4ANBA 1ZXEA 4U40A 5DH3A 4H1JA 4XCUA 3OMVA 3MS9A 4BIBA 4MXOA 2W7XA 3R7GA 3PPJA 2W1CA 3ZO1A 4BDHA 3BU6A 4O21A 1BX6A 4U41A 4FSYA 4BCHA 5LCJA 3E8EA 4RVKA 1BKXA 4D0XA 4K0YA 3DAEA 4L6QA 1ZARA 4FV8A 3NYXA 3GVUA 4GFMA 4RRVA 4TYGA 3T3VA 2OK1A 3LXLA 1G3NA 2OXXA 3D9VA 5CSPA 3E8NA 2RGPA 4MCVA 4ASZA 5ANIA 4MNEB 3BYVA 1I44A 3SRVB 3KA0A 2YCFA 2R3KA 3R6XA 4CZTA 5JGAA 5KCVA 3DXPA 1NT2A 1ZOEA 4FNXA 1PYXA 4L3LA 4DEEA 4GFGA 4E7WA 3FEGA 3FLWA 3ALNA 2G1TA 2YIXA 3F3TA 3PJ2A 5K4IA 3R9RA 4FV0A 3TIYA 4GH2A 4GIIA 4JDIA 5CQUA 3KRRA 4F1OA 2KTYA 1PXIA 2H34A 3MFTA 3R8MA 3FBVA 4EH3A 4E6QA 3H0YA 3IW4A 4BF2A 3ZEWA 1W84A 2GTNA 3EQPA 2PVKA 1YVJA 2XMYA 3HKOA 4IZ5A 4JI9A 3WE8A 3HV3A 4QMQA 2BTSA 1KWPA 3HZTA 4RGJA 4NZWB 4EZ7A 2WMVA 4ZSEA 1SZMA 2ETRA 3F3VA 3QWJA 5C27A 3UMWA 3GOPA 3VHKA 4CV8A 4EYMA 5CU0A 2XNEA 3VJOA 2F2UA 1JBPE 3F5GA 4FEXA 4MXCA 5I3OA 5HBJA 1FMKA 2E2BA 3CTHA 1OIYA 2IVVA 3DCVA 2ERZE 3HX4A 1PY5A 3LMIA 3E93A 2RG6A 3PY3A 4BZNA 2C6TA 2OKRA 3NYOA 5ETFA 1V1KA 2ZV8A 4FF8A 3KXXA 4BRXA 3MVJA 4RIXB 2X39A 1YW2A 3PWYA 2UW3A 4JG6A 2UVXA 4XX9A 3BI6A 4PQNA 4CLJA 3LM5A 4L7SA 5CEQA 4RIYA 4XRLA 4DH7A 2UZBA 4EWHA 2CLXA 3CY2A 3ORPA 2OZAB 2UZDA 2YHVA 4WD5A 2V22A 3MFSA 4C0TA 4G34A 2HXLA 2VTMA 3KVXA 3U6IA 2G15A 3UVPA 4PY1A 3UZTA 4QMTA 1NVRA 4KWPA 2O63A 2WMAA 2J9MA 3QZFA 1P2AA 5BUIA 3ZLXA 5CWZA 4TW9A 3P79A 4MD8E 4IAYA 4M84A 3EZVA 3V5QA 4FSTA 3TJDA 5LWNA 1OECA 3HRCA 1LPUA 4XV3A 5HVYA 1PXLA 5EYMA 4WG4A 5CSXA 5E1SA 3DK3A 2Z7SA 2XK6A 1UU7A 3HDMA 4XJ0A 5DI1A 1REJA 5AM7A 3ENHA 2PUUA 4U42A 3DAJA 2X8DA 4A06A 5JH6A 2PMNX 4B4LA 4BTJA 2BAJA 4QNYA 1J7UA 4F9BA 1U54A 1OL1A 2R3MA 2W1ZA 2JLDA 3A4OX 4DEAA 3PG3A 3QTUA 5G6VA 2WNTA 4R7HA 3C4EA 4CEGA 3FV8A 5AEPA 2ZOQA 4Y95A 3RVGA 2Z7RA 3EWHA 4UX9A 4FV9A 3DZQA 3R8VA 4DBXA 3TM0A 4XP0A 2VTSA 4QPSA 4Y83A 4DA5A 3QRTA 5HE2A 5HE3A 3ZXZA 2Y4IB 4FVPA 4M67A 4FNZA 4U0IA 4FTMA 3FMMA 4FI1A 4PNIA 5IUGA 2JBOA 1ZWSA 2C4GA 4AACA 4Z7GA 2JKQA 5AUZA 4JR3A 4AW2A 4BB4A 4FV4A 4C61A 4ZLYA 5HLWA 4AA4A 1GIJA 2OJIA 4RVTA 3MI9A 3TXOA 2X4ZA 2ITOA 1WBVA 4NUSA 2VGOA 2VTHA 3ORNA 4IJ9A 4WBBB 5CAPA 2J5EA 4P2KA 3RAHA 4ITHA 4OW8A 5GIOE 3U6HA 3UC3A 3G0EA 5G1XA 4AW1A 4MXYA 5HO6A 3QD2B 5I9YA 3IQ7A 2QOCA 2XK7A 3LQ8A 1ZMUA 1ZZLA 3MFUA 4RMZA 1H0WA 2YDJA 2XK3A 3RM6A 4ANSA 2W1EA 2YM8A 1WVWA 4I1ZA 4RC4A 2FSOX 3SVVA 2V7AA 3NWWA 3AT2A 3WF5A 3DJ7A 4XG8A 3MIAA 5K0KA 3HAVA 2UZWE 3CJGA 3MA6A 3R04A 2VGPA 4EK4A 5HCZA 3UQGA 1URCA 3A7GA 3DQXA 3Q04A 3NX8A 4MD7E 5CAVA 1Q99A 3IG7A 3IGOA 3ITZA 5TT7A 3LFFA 5H9BA 5LCKA 4FTKA 3BEGA 3OY3A 4AE6A 4ZZMA 3OWLA 2HAKA 5CS6A 1TQPA 5AAGA 2PUPA 3NVMB 3ZM9A 2IZUA 4QMSA 3BBTB 4YURA 3LJ1A 4OTQA 4YTFA 1B6CB 5AA8A 3SA0A 4HGLA 5ETAA 3ZXTA 3ZH8A 5E9EA 4A4XA 1FVVA 4QQ5A 1BL6A 1XO2B 3AD6A 3LXPA 4W4WA 3EN6A 3EZRA 2XIZA 4GKIA 2UW5A 4X7QA 5E1EA 3BGQA 2PYWA 1T45A 5AR4A 3OXIA 2W5AA 3WYXA 1YI4A 5KUPA 2J50A 5EQEA 3P9JA 5AUTA 1ND4A 3EHAA 5KMMA 1PMEA 2QKWB 2OICA 2WPAA 4RA5A 2JKMA 3QCSA 4J7BA 4DLIA 5CI7A 2OFVA 4H39A 4W4YA 4DG0E 4C35A 3RWPA 3ZO2A 4E4NA 4XUFA 1H25A 1PYEA 3RWQA 4G3EA 3FAAA 4EL9A 3VUDA 4DFXE 3FSFA 3L8VA 2WIHA 4G9CA 4LI5A 3BHVA 4AG8A 4YPSA 4BCPA 2PY3A 4V04A 1ZY5A 3UOKA 4O0UA 4UB7A 4D4SA 2QHMA 3PXRA 4XLIA 2I7QA 3H9RA 2OF2A 2OXYA 1KV2A 4LM5A 3ZFXA 3EN4A 5CEKA 5HVJA 4J98A 5DR2A 5CT0A 3SXRA 5L6OA 5M44A 3HMPA 2VWVA 2Y6MA 2VUWA 2R3JA 3MVLA 3GEQA 1JKTA 4R8QA 2UV2A 3RP9A 3FMJA 3NR9A 3KU2A 4G16A 3SGCA 1OITA 1Q61A
chains in the Genus database with same CATH superfamily
4ACDA 3DBQA 5HCXA 2UW7A 4MXZA 5HQ0A 2GSFA 2X0GA 4XV1A 5ITAA 1APME 4HYHA 4PDOA 2WEIA 5K5NA 1Z57A 2DS1A 3UDZA 3LFAA 1CMKE 1XH6A 2CGUA 3NW6A 4BHNA 4NW6A 4TL0A 2E9OA 3IGGA 4MAOA 2I1MA 1IRKA 3NAXA 4G3CA 2B9FA 4ZTMA 3PIYA 3PY1A 5JFWA 5CNOA 3PTGA 3UO5A 1FOTA 3GC7A 3ET7A 3ORZA 4K2RA 5IH5A 3ZSGA 3OD6X 5J7HA 4DYMA 1KE7A 4BJJA 5C8KA 4DEDA 3VA9A 2C6DA 4C02A 4W4VA 4AT4A 4FZAB 4R7IA 3DGKA 3KF4A 3GU7A 4NK9A 4MNEA 2BUJA 3OXTA 4J8MA 5ACBC 3SRVA 3BE9A 3LE6A 2PSQA 1PMNA 4Q9SA 4HZSA 4I0RA 3L8SA 5KHXA 4D2VA 5AA9A 3W55A 3AC4A 2NNWB 5E8XA 4EH2A 3FI4A 3WZJA 4EOPA 1WVYA 3DA6A 2WQEA 2XM8A 3KN5A 3NIZA 4G3DA 1OI9A 3DXQA 2C6IA 3Q53A 3F2RA 2O2UA 3F69A 2QSBA 2ITVA 4W9WA 4L53A 3C4ZA 4BWPA 4TYJA 4AXCA 3L9NA 4IFCA 3REPA 2JDTA 5CU3A 5HIEA 3ZS5A 5ICPA 4DFZE 2ZMDA 3QGYA 4CFXA 3DA3A 4YSMA 5D7VA 3SAYA 3FNBA 2OJ9A 1H1QA 3FSKA 2HZ0A 5HX8A 3O7LB 4EZ3A 3PSDA 4AXEA 4IX3A 1STCE 2CN5A 2QLUA 3R1QA 4IH8A 3SV0A 1SJ8A 4O4EA 5IKWA 3C4WA 1MP8A 2XEYA 3QU0A 3HUBA 4YJRA 4DH3A 3MESA 2E9UA 2W96B 5KMOA 4YBJA 3CD8A 4IZYA 3FMDA 3A8WA 4FT3A 3FLQA 3FLYA 3MJ1A 5FTGA 2VRXA 1GZ8A 3OWKA 4LYNA 3F66A 3G9LX 2R3QA 5IISA 5D11A 5JMSA 1SM2A 3I4BA 4F6UA 3OOGA 4BDJA 2VTOA 4J1RA 4QMOA 4N4SA 3HMIA 4KIPA 4EKKA 2JBPA 1BL7A 3P86A 5HLNA 1AD5A 4N70A 4AW5A 4YZDA 3QKLA 3G90X 3I5ZA 2WQOA 1PXKA 3CTJA 4FKLA 3Q6WA 3QCXA 3TDWA 3GT8A 3UPXA 4RC2A 4XBUA 4NFNA 3WBLA 4I20A 4FIHA 2IZRA 3COKA 4QP1A 1F3MC 4DCEA 3V6RA 3HV5A 3GCQA 2B0QA 2EU9A 3RHXA 2IP6A 4X21A 5C8MA 3RPSA 3TCPA 2C3IB 3RAWA 2UW6A 2ZDUA 1R39A 3SKCA 4MKCA 4G1WA 2XBJA 1R78A 4UWYA 3GUBA 4TWCA 3BLHA 4AGUA 4JBPA 2AC3A 5DG5A 2Z8CA 2H9VA 3FZSA 4CMTA 3QXOA 4QP8A 4DINA 4F64A 3WILA 5DE2A 5HBHA 2BKZA 3NUNA 2YABA 3PIZA 3GFWA 2BROA 4FTJA 3LCOA 3EN5A 2JAVA 5KO1A 4G75A 3U55A 4ZAUA 4FUXA 2CGWA 4JX3A 4FIJA 3UO4A 2UUEA 3KMWA 4XP2A 5HNGA 4DAWA 4IAIA 2WELA 5CT7A 4EOQA 2F57A 3ALOA 3WZEA 3SW7A 1PXMA 3IS5A 2EWAA 3RMFA 4D5HA 4BFMA 5KMLA 2VNWA 1IAHA 4CKIA 1G8SA 1YDRE 2UZLA 4CNHA 4AU8A 3VHEA 4KIKB 3ZBFA 3P78A 2BTRA 4BDDA 4JBQA 1TZDA 1HCKA 2J4ZA 4IMYA 1OL7A 5M4IA 3SHEA 4LRJA 4IVCA 3A99A 3P4KA 4O1PA 4O84A 1WCCA 3ULZA 2HENA 4BI1A 4FZFB 2OIDA 2Y8OA 4YHTA 1OIUA 3NCGA 2ITQA 3OT8A 1ZLTA 2VAGA 4OT6A 2WTJA 3ODYX 1KE8A 5HBEA 4ZK5A 5HTBA 4TYHA 4FNYA 5I9UA 1O6KA 4WA9A 4QTAA 4B0GA 2WO6A 4LRKA 4NV2A 4BDAA 3VUKA 4EYJA 1K9AA 4FIIA 3W0MA 2PULA 4EK6A 2RL5A 3LVPA 4O0WA 3EQRA 2YIRA 4IZ7A 2JFLA 5C1QB 2JFMA 4XG3A 5E8YA 1H24A 5TR6A 2CMWA 2X2KA 5F1ZA 2W4JA 3HRFA 3KXNA 5I9XA 4BGHA 1O9UA 2BCJA 5TF9A 4BCIA 3FZ1A 3FY0A 3BWFA 2UZTA 2CSNA 1QPCA 3MH3A 3TWJA 3UNKA 4GUBA 4K9YA 3CPBA 4F65A 4ZP5A 4F7NA 5E8TA 5EYCA 2GNHA 2JITA 5AP2A 2YCQA 3ZMMA 3UITA 1QPEA 3E7OA 2QR8A 3HA8A 4YJPA 2RF9A 5A9UA 3O50A 3IAM1 3EFWA 3QKKA 4G3FA 2UZOA 3CS9A 3F5XA 1UWHA 1GIIA 3Q4TA 5C01A 3EYGA 3P0MA 4BDFA 4BYIA 4UMPA 5HO8A 4APPA 4ZTHA 4HYUA 1H8FA 2WMBA 4BDGA 2F4JA 4NIFB 4RBLA 2XYUA 2ZVAA 1IA9A 2XNMA 4RJ3A 1H1RA 4OT5A 3R7VA 3VW6A 1OPKA 2YM5A 4C2VA 4C3FA 5HIBA 3KMMA 2XJ2A 4RC3A 1H0VA 4WNPA 2XKEA 3QBNA 4BDIA 2HZ4A 5DR6A 5CQWA 4CD0A 2WU7A 4WT6A 4OBOA 3AMBA 4C57A 2R3IA 4M14A 5BPYA 5EW9A 3UE4A 3KCFA 1YOMA 2J0LA 2BALA 2QODA 3OEFX 4YHJA 5E8SA 3MYGA 3HECA 2JD5A 4J53A 2VWXA 4PPCA 3TT0A 4CMUA 2PU8A 4AS2A 4Y5QA 1RW8A 3U4UA 2ZAZA 4BWXA 4EQMA 3VQUA 3BV2A 3HMNA 3MDYA 3RAKA 3UVRA 3W8LA 4O7NA 4F4PA 2A2AA 2IVUA 4L42A 1WBWA 4BTMA 4WNOA 4NM0A 2GQRA 3IONA 2YZAA 3EN9A 3KCKA 4QP2A 4AA0A 4EONA 4DTAA 3QRJA 5J7BA 2X6EA 3ZOSA 4DC2A 3C5IA 3FI2A 2YFAA 3WF6A 5CI6A 5CSVA 2RLDA 4CGAA 3B8QA 3G9NA 4CQGA 1KE9A 4DCAA 3RKBA 4ZTLA 2C1AA 4FEQA 2UW0A 4FEUA 4QP9A 3QD0A 2JDOA 4PPBA 4RX8A 4PNKA 2R9SA 3FWQA 2FO0A 2C0TA 3KXHA 3R73A 5E8VA 4EH9A 4HNIA 3BYUA 3PJ8A 3HGKA 3ATSA 2PTKA 3SOAA 1HCLA 1XH5A 5LMBA 3WIKA 3Q2JA 5F95A 4O82A 2X9FA 3O51A 4TYIA 4YC6A 3TKIA 2NYAA 4M66A 4MYGA 5FDPA 1CKJA 2R7IA 5EDRA 4JLCA 1BYGA 3R8LA 4PL3A 4ALVA 3VO3A 2BL8A 4AFEA 2P4IA 5HKMA 5CALA 4ID7A 3E3BX 4Y46A 1CSNA 2PVRA 2ZMCA 3I0OA 4NWMA 3V5PA 3F5PA 2C6KA 5FWKK 4CMOA 1Y6AA 1Y91A 3BELA 2X2MA 3FMLA 4FKJA 4PX6A 4TKSA 4ENYA 4H05A 3DNEA 5CEIA 3NUXA 5AP7A 4KKHA 1TFFA 1XR1A 4EOMA 2EB3A 3RK7A 3IW5A 3KP9A 4BC6A 5A4TA 3CSVA 3L9MA 4FZ6A 4DGMA 3H30A 2E9NA 2Q0BA 3GU5A 4BI2A 4FVQA 3PJCA 5AP0A 4C2WA 4M0ZA 2C6LA 3C4FA 2R0IA 4FG7A 3TKUA 2GHMA 2PWLA 2QQ7A 3FMKA 1JSUA 2V5QA 4H1MA 5BYZA 3ZFYA 4DFNA 4IJPA 3SX9A 3ZRKA 1EH4A 4IZAA 4QP3A 3UTOA 2XJ1A 2G2HA 4A07A 3JPVA 2IG7A 4MVFA 4Y5HA 3COMA 3TIZA 4D5KA 3VRYA 3JVSA 1Z9XA 5L2QA 2PUNA 3NFGB 2W0JA 3UNZA 2CHLA 4D2TA 3R7EA 4D2RA 2X6DA 1Q8TA 2QNJA 2VV9A 2XJ0A 3C4XA 3GOKA 1OKZA 3I7BA 4I21A 4EH4A 3S00A 4DHJA 3DV3A 4E3CA 5A6NA 3GCVA 3ROCA 4E20A 1P4OA 1W8CA 1YRPA 3F3ZA 3EQCA 5IQCA 3ID6C 4AW0A 3QLGA 3F82A 2PZRA 4OAUC 4F7JA 4RZWA 2BAQA 3TN8A 4RFMA 4U6RA 1GJOA 3OG7A 4X2KA 3SD0A 3A7HA 4B7TA 5B2MA 3THBA 5HG8A 4TXCA 1YHVA 3KFAA 4L45A 1OL5A 5AUWA 5IG1A 2XMXA 4RX5A 4FZ7A 3IDBA 1J7LA 4NV5A 2XRWA 5B2LA 4KUJA 5LWMA 3C50A 1FMOE 2UW8A 2BFYA 2F9GA 4ZTRA 2QOKA 3W0PA 3QX4A 5KHWA 1H28A 2JIIA 3QZIA 3TV4A 3LFCA 4I6QA 3R7IA 4FEVA 4GKHA 4S30A 5FBNC 4AFJA 2XTQA 4FR4A 4ZOGA 2PUIA 1YHSA 1V0OA 2QG7A 2BZIB 3D14A 1H1WA 4BI0A 3MA3A 1UVRA 3W2CA 2QKRA 3PJ3A 3QC4A 2VTAA 3FUPA 4IQ6A 2A0CX 2EUFB 4F1MA 4O7SA 3A62A 4XH6A 2HELA 1YDSE 4IB0A 2F7ZE 4CVAA 1MQBA 3GU4A 4ANOA 4Y72A 4TN6A 2CJMA 5I9VA 2XANA 4HGEA 5CXZA 1MRYA 3NAYA 4D1ZA 3QALE 2P2HA 2X4FA 3PE1A 5KE0A 3KF7A 2BDWA 1T46A 1P4FA 5M4FA 2JIVA 2CNUA 5E8ZA 3GP0A 3DDPA 3LJ0A 2W9FB 4TTHB 3OC1A 4YLKA 5IQDA 3FC1X 5E90A 1F0QA 4GT4A 3FLSA 5LVLA 3FYKX 3DQWA 4A9SA 3D4QA 4MNFA 4CFMA 2C69A 3D2KA 3F5UA 5LVNA 4DDGA 2BRMA 2UZEA 4E4LA 4RIYB 3BE2A 4AXDA 2O5KA 4FT9A 4FKSA 2ZJWA 3BQCA 4QPAA 5GJDA 1XH4A 3Q9WA 3PVWA 2BFXA 2VWYA 3WF8A 3NUUA 2BVAA 4AS0A 1VEBA 1QCFA 2XK9A 3BEAA 4RIWB 5IEXA 4E4MA 3RNYA 2I0EA 3QQUA 5H8EA 1QPDA 3O0GA 2XCKA 3R8UA 2XAMA 3NUPA 4R3CA 4EI4A 4DGOA 4FSUA 3TNQB 3DLZA 5CSWA 3MFRA 2YM4A 4HPTE 4X3FC 2C6OA 4PP9A 2YERA 5A4LA 3OW3A 2VX0A 2W4OA 2XA4A 3GXLA 3VS6A 4C36A 2CGVA 4DGGA 5FD2A 4LFIA 4WNKA 2WU6A 3LMHA 5AR7A 2HOGA 1ZYCA 5JQ8A 2R7BA 3FZOA 5CNNA 4F9YA 2I0VA 4L44A 4TT7A 5CVGA 3Q2MA 4FV2A 1L8TA 3LM0A 5HLPA 3QL8A 1MRUA 3DAKA 3ORKA 2YEXA 3UBDA 3V01A 2CN8A 4HZRA 2VX3A 1SNXA 3TUBA 4C37A 4HJOA 2SRCA 4LMUA 5L4QA 2IW6A 3BIZA 2QOBA 4HNFA 3UIBA 3NNXA 4FNWA 2AQXA 1JWHA 1M7NA 3C7QA 2OSCA 2I0YA 2V55A 1LEZA 2QG5A 2VWIA 4FC0A 4GV1A 5LMKA 4NL0A 4PDPA 4KNBA 5DT4A 5FXRA 4OTPA 3FC2A 4ERWA 2VX1A 2B9JA 3PDTA 2H96A 3MJ2A 3PY0A 4DG2E 4HOKA 4ZLZA 5KKRB 4U97A 5L2TA 3KQ7A 5C9CA 4QQCA 3AXWA 4UY9A 5CSHA 3FMNA 1JKKA 4X2GA 3M11A 3N4VA 4R3RA 2GS2A 3DA4A 2WD1A 5KZIA 3DFCB 3N4UA 2KKMA 4IX4A 2IEWA 3CLYA 4J96A 4TWNA 3R9OA 1Q41A 1YXVA 4OTGA 4S33A 3E88A 2BPMA 3FHRA 3M42A 4LV8A 4O0VA 4ZSLA 3VS2A 3R0TA 3UOJA 2NO3A 1TDPA 5LMKC 2HK5A 1Y8YA 4E6CA 4B99A 4BCJA 4ZSGA 3PWDA 5CVHA 3QA0A 4ZSAA 3DKFA 5L2IA 1FINA 2WEVA 2HZNA 5E4HA 4HVIA 3P7AA 1YI6A 3G5DA 3D7ZA 3NNUA 4MK0A 4UALA 4WO5A 4XV9A 4C62A 4DWLA 1E1XA 3R1NA 2I0HA 4YSJA 4MEDA 3ANRA 4YJNA 4D2SA 3NW7A 4D28A 3FQEA 4ARKA 1ZYLA 4RFYA 5AWMA 3H4JA 2OH4A 2OIBA 3TEIA 3SW4A 3LCKA 2EXCX 2GNGA 3ROYA 3NIEA 4QMXA 4UV0A 4OTDA 2B9HA 3U8WA 4EHEA 1H1PA 3CIKA 4BGGA 3E87A 2WMWA 3ORLA 3WZKA 3O8TA 4W9XA 3P1AA 3UJGA 2PL0A 4JVGA 3EFKA 4AGDA 3O7LD 4CV9A 3LFSA 4BICA 3VS1A 2C3LA 2IJMA 4FKGA 3DBFA 4O1OA 3OP5A 4E6DA 2UVYA 4CFFA 4L68A 4E6AA 4Z9LA 4A9UA 2WOUA 4E4XA 5D1JA 4ZJIA 1GY3A 4RJ4A 5AADA 4PP7A 5EM7A 4I23A 3UYTA 5LVPA 4Q2AA 4GS6A 4ERKA 5DFPA 4MF1A 1WVXA 3AG9A 5IDNA 4FE2A 3PP0A 3R9HA 2B54A 2R3NA 1LUFA 4ALWA 3V6SA 2AC5A 4KD1A 1U59A 3ZO3A 3LFEA 3DK6A 2NPQA 5IUHA 1UNHA 2BAKA 4MQ2A 5KBRA 5DRDA 4ZZNA 5DWRA 3G0FA 1YWVA 3OROA 3RK9A 1VZOA 4QTCA 4KKEA 2BIKB 2C68A 4MWHA 2X8EA 4OTIA 1R1WA 3QA8A 4M3QA 5EM6A 1FVRA 3P5KA 5B2KA 3QHWA 1Q62A 3PP1A 4PWNA 3KXZA 4IWQA 1V0PA 3CTQA 4P7EA 3NYVA 5JRQA 1KOAA 3COIA 2GNLA 3EQIA 4EH8A 2IO6A 2QC6A 4PTCA 5IUIA 1RQQA 4OTHA 5DVRA 3LQ3A 2X9EA 2WTCA 4EOLA 5CAQA 2DWBA 2WGJA 3MH0A 3QF9A 4Q5HA 3SXSA 4NKSA 4AWIA 4HEA1 4BY9E 4AZWA 1V0BA 3RPYA 4OTWA 5CF6A 3PVBA 3EH9A 3V8TA 5HNIX 4ZY4A 1QPJA 5BNJA 3BHHA 2NRYA 2WHBA 4JL9A 3QD3A 4D4RA 2WKMA 4C3PA 5IA1A 3CD3A 4DBNA 3ZZEA 4XRJA 3GNIB 4A9RA 4CYJA 2JC6A 1M2PA 3GQIA 4D1XA 4K11A 4BDKA 3W0RA 4MXXA 4AT5A 3KKVA 1G8KA 3NMUF 3LKMA 1OUKA 3S1HA 3BLQA 4OTRA 5M08A 4G76A 4QTEA 4L00A 3PA3A 4F0GA 2UZVA 3DBCA 2X1NA 3WYYA 4BBEA 3FLNC 2A2CA 3OBJA 3PVGA 5CU4A 2W4KA 2C0IA 4WUNA 4CFVA 3LW0A 2XARA 2ITYA 5J79A 3TV7A 5IMXA 3ODZX 4YZ9A 3ZYAA 5L8KA 3EOCA 4LQMA 3DOGA 1QMZA 2XS0A 4BTFA 4CFUA 5GZ8A 3H9OA 4J99A 1R3CA 3QRUA 3FDNA 4K33A 5DT0A 4R1VA 4E1ZA 4ITIA 3O8PA 5D41A 4NTSA 3PXQA 4NT4A 3FZTA 4AZSA 3MIYA 4ZTQA 4PMMA 3GB2A 4XG7A 3UIUA 4YO4A 4X0MA 3GCPA 4I6LA 3HUCA 2C0OA 1ZYDA 3LLAA 1E1VA 3VW8A 1DI9A 3FZRA 5BVEA 4C4JA 1WFCA 3VF9A 1ZYJA 4GIHA 3W2OA 4I1TA 3C51A 4FIGA 2PE0A 3AC3A 3R2YA 3OXZA 1R0EA 4FV6A 2RFDA 3VBVA 3MWUA 4A9YA 4CT2A 4EBVA 4YTIA 4DGLC 3S0OA 5BMSA 2W1GA 3C9WA 3TYKA 5IQEA 2YWVA 5AUYA 5K3YA 3VBQA 3H3CA 3KRWA 4JMQA 3F2AA 2HY0A 4G6OA 3V04A 4KSPA 4PRJA 3SDJA 4U81A 5BUJA 4I4EA 5GNKA 5AV3A 2WTKB 3W33A 3QZGA 2BKKA 2QONA 3PRFA 4LDTA 2P33A 1YQJA 5CY3A 4CZUA 5L8LA 1R0PA 2GMXA 3S95A 4GVJA 4TWOA 5KMIA 3DDQA 4O7ZA 3RAIA 2YCRA 2YFBA 4KAOA 3LQ5A 4UZDA 1YI3A 4L46A 1UV5A 2J6MA 3Q4CA 4RFZA 5T68A 3KC3A 4R3PA 4WOVA 4EC9A 1UU9A 4CZYB 1WBTA 4CRLA 4IAFA 3TG1A 3GCUA 1ZMWA 3K54A 4FG8A 4RJ5A 3T9IA 3W0NA 5C4KA 2OLCA 3B2TA 4RX7A 2JB2A 4MTAA 2J0MB 2XKDA 2XF0A 2VD5A 4YJOA 5LNK1 4CKRA 2XNOA 1YXSA 3QRKA 5JFXA 4AOIA 3I6UA 1G5SA 3JY0A 4XG2A 5KZ0A 1K3AA 3B55A 3N4TA 4QP4A 5GJFA 3TI1A 1IA8A 2FSLX 3O17A 4JIAA 5EOLA 3R83A 4IFGA 3U9NA 4BDEA 2QCSA 4FSQA 4PL5A 3TACA 5DHJA 5F20A 2V1CC 2WZJA 3AC1A 4RWLA 2K19A 3AD4A 4RQKA 4EHGA 2X0OA 5EH0A 1PKDA 2BZHB 1NXKA 3QFVA 4ZTNA 5EQYA 4M97A 3D2IA 4NJ3A 5B7VA 4N0SA 2PMIA 1ZMVA 4GK2A 1GZNA 4ZJVA 5L3AA 5M57A 2ITZA 1LEWA 1ZY4A 2VO7A 1U46A 3PZHA 2FYSA 3A2CA 3TZMA 4BN1A 4RA4A 3MB7A 4QYGA 3GC9A 4Y85A 2IW9A 4FK3A 1OIQA 5J1WA 3QZHA 5IZFA 3IECA 4O6LA 4FT7A 5IA0A 5M53A 4PUZA 2GNFA 2A4LA 2PZPA 4ZIMA 3BHYA 3AMYA 3R2BA 4LUDA 2Q0NA 4ANLA 2VTJA 1XKKA 5JGBA 1NW1A 1GIHA 5HG9A 3E63A 4N57A 4FSZA 4ZSJA 3JR1A 5I9WA 3LXNA 3KULB 2QGMA 4FYOA 5AR2A 1PF8A 2OFUA 3PSBA 5EHLA 1PRYA 2PE1A 3EL7A 3LCDA 3D15A 2A27A 3KB7A 4MBIA 4O96A 2EXEA 4DEBA 5HZNA 3FPMA 2GNIA 3EFJA 2CAZB 4IVAA 3R01A 4D2WA 5KX8A 3CJFA 5HORA 4R77A 4F09A 4UN0C 2BZKB 2QI8A 3V8WA 2GQSA 4O0SA 3DTWA 4H3BA 5KBQA 4AN9A 3AT3A 2BDFA 2Y0AA 4EWQA 4LMNA 4UMUA 4DEHA 3ANQA 2AYPA 4USDA 2YJSA 4O2ZA 5H8GA 2QOIA 2C6EA 4GYGA 5DA3A 4BR3A 4FV5A 4JQ7A 4AUAA 3ZTXA 3ERKA 4CFNA 4CKJA 5KMJA 4GK4A 4AA5A 1UNGA 4GUEA 4AGWA 3U6JA 5AUUA 1JNKA 2YM7A 3CGOA 3ATTA 4E5BA 4FK6A 5HNBA 3V5LA 1TVOA 4KIOA 1QL6A 2XIYA 3HL7A 2R64A 4GG5A 4JBVA 3UC4A 2XVDA 4TZRA 4DH1A 5CU6A 3I9V1 4QD6A 3VJNA 2R3LA 2WMSA 1H1SA 3QTZA 4FG9A 5HD7A 2BR1A 5J9LA 5EOBA 1ERKA 2QOLA 4WG5A 1NVQA 4YPDA 5EFQA 4FTAA 4U79A 5E7RA 4YGAA 5HI2A 4AF3A 3JSBA 2IPXA 3S3IA 2YZLA 4IWOA 3RHKA 1RE8A 4JCVE 2J7TA 4UZHA 3VS0A 2B52A 4CG9A 4W8DA 5BQ0A 2YA9A 5DOSA 2ACXA 2WAJA 1LR4A 4IEBA 4MX9A 1RJBA 3TUCA 1YXTA 4IM2A 4B8MA 4V0GA 2WMTA 5AM6A 4TYEA 5ANDA 4NKAA 1YWNA 3LCTA 4DHFA 4ANMA 4TY1A 4C34A 5FBOA 2VTPA 2RG5A 4R1YA 3PJ1A 1VR2A 3C0HA 4FKVA 5IQAA 2RIOA 3IDCA 4FV7A 1WMKA 4ASEA 5HD4A 4MD9E 5C8NA 3TNWA 3C0GA 4GEOA 2E9VA 3QRIA 1M14A 2PMLX 3QQLA 5BVWA 4G3GA 1VYZA 2C5NA 4BCKA 3MH1A 1CKIA 3TZ8A 4AN3A 2ZV2A 2W1FA 3D7TA 4FOBA 5EG3A 3IW6A 3ORIA 4IVBA 4IM3A 4U3YA 4EQUA 3RPRA 3NZ0A 2IVTA 4XOZA 4CG8A 3EKKA 3D5UA 4OBQA 2BZJA 1ST4A 4BJJB 4DF3A 2WMXA 2JEDA 5GHVA 4B8LA 4XNEA 2JBWA 2QOHA 4CCUA 3GC0A 4BVUA 5LVOA 4E8AA 5AAFA 4P5ZA 2VTLA 3LFNA 1ZZ2A 4OBPA 4JQ8A 5J5TA 1Y57A 3MSSA 4O7WA 4Q9VA 3W0QA 4HVSA 4BCFA 4O0YA 4HPUE 1BI7A 4DN5A 4V05A 4WBOA 3UYSA 4JG8A 4EJNA 2C5XA 3KK8A 3BRBA 4HYIA 4NFMA 4EOOA 5K9IA 4YR8A 5AIKA 2VWZA 2XNPA 3FI3A 2F7EE 4I3ZA 2B53A 1YXUA 3OBGA 3ZM4A 1OKVA 4UBAA 5L6PA 3EN7A 5CZHA 4BKYA 1FBNA 2OI4X 4I92A 5BVDA 4KBAA 3KXMA 3PPKA 4PMPA 3RCJA 4IB5A 2OJJA 3F7ZA 5HESA 2UW4A 4IAKA 4QYHA 2W05A 3H10A 4R7BA 4FTUA 4EJ7A 3R02A 4EH6A 4QP7A 1FPUA 2OO8X 3JS2A 3OCGA 4GJ3A 4F0IA 2YIWA 4ACMA 2WMUA 2WQMA 4QMNA 3WF9A 1SVEA 4DH5A 2OG8A 3QYWA 4L3PA 4USEA 2GSCA 5DEWA 2OWBA 4NM3A 1XWSA 4FTCA 3FI8A 3NVKI 3BHTA 2YITA 4H3QA 1MQ4A 4FGRA 2QU5A 3OWPA 2PVNA 3V8SA 5J5SA 2ZM3A 4IB1A 2R3HA 2ETMA 5CASA 4NTTA 2ZFYA 4AAAA 3DKGA 2PHKA 2Y4IC 3F9NA 4MWIA 3FVVA 4O22A 4MQ1A 2QZGA 3GENA 3MTFA 4C3RA 4E73A 2Y9QA 4YJVA 4Q5EA 4DFYA 1JQHA 3C0IA 3LPBA 2AUHA 4HGSA 2W5HA 5EW8A 2A2DA 3IOPA 4IB3A 3F88A 3MN3A 3UGCA 3OCSA 1OM1A 1O6LA 4QMZA 1H4LA 2RFEA 3R21A 4QOXA 4XG4A 5FP5A 1IAJA 3VS5A 3NRMA 1F5QA 4BL1A 4FKTA 5EW3A 2C30A 4KB8A 3U51A 4RPVA 3UDSA 2W06A 4QP6A 2L1LB 3IOKA 5CTPA 4ENXA 2UVZA 2YFXA 4F6SA 4P4CA 3I1AA 4ZTSA 2YIQA 3MPTA 4FSRA 4I4FA 5FXQA 3UO6A 3HP2A 5H3QA 4M68A 4WRSA 3EQGA 3R7OA 4DTBA 4ZS4A 4C58A 4HGTA 2GFSA 4GU9A 4YTHA 2F49A 3Q9XA 3ZCLA 2W17A 4TWPA 4U7ZA 2BRBA 4CT1A 3ZUUA 4E26A 5D9HA 3BCEA 1VYWA 4O7LA 3Q3BA 4U9AA 4L9IA 3FHIA 2XAOA 2LAVA 3HV4A 1SVHA 2VZ6A 4O0XA 4RVMA 3JXWA 1M2QA 5M51A 3DO9A 2XKCA 3QCQA 1J1BA 1ZYSA 4KIKA 4JJRA 1AGWA 4PL4A 4YMJA 2R0UA 4FUYA 5HOAA 4L43A 1ZAOA 3I0QA 4I5PA 4QYYA 4X3FA 5IEYA 3F61A 3VS3A 1JVPP 1BLXA 4EEVA 4ASXA 4ACCA 3IPHA 3IDPA 5CANA 1JQOA 4IX6A 4FJVA 2BRGA 2VTTA 3T9TA 1DAWA 5ETIA 4D9TA 4O7RA 2O0UA 1XH7A 3FY2A 2OGVA 4C4EA 3QTWA 3DBDA 2PMOX 4RIOA 4BZOA 4DGNA 1GAGA 4ZLOA 2WB8A 4BCGA 3AJFA 1Q8WA 4U8ZA 4D9UA 1SYKA 4X2JA 2C5YA 3BGZA 3MV5A 3NSZA 4M15A 4L3JA 3BGPA 1B39A 4FL1A 4HVHA 4ZY6A 4AOJA 2O64A 3EQDA 3D5XA 4IX5A 2JDSA 5H2UA 3K3JA 4BKJA 4BIDA 2G01A 2OIQA 3W0SA 5EHYA 2RKUA 4JDHA 5D12A 1PXNA 4LL5A 2Y4PA 4ZS0A 4RIWA 5BVFA 2PVHA 1X8BA 4EKLA 4K8AA 1W98A 3G33A 5A4CA 5AP3A 5L2SA 5IQGA 3I5NA 3UDTA 2ZB1A 5BVNA 4Z7HA 2Z7QA 4USFA 4TRLA 5AAEA 4XV2A 2F6MB 1XH9A 2XZSA 2QOFA 4OUCA 5FEQA 3ZU7A 1OIRA