3LJ1A

Ire1 complexed with cdk1/2 inhibitor iii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
404
Chain Sequence
NFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQFRTSGWRAPELLEESNNLQTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase/endoribonuclease IRE1
publication title Flavonol activation defines an unanticipated ligand-binding site in the kinase-RNase domain of IRE1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase
total genus 107
structure length 404
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06479 Ribonuc_2-5A Ribonuclease 2-5A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lj1A02
1.20.1440.180 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3lj1A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lj1A01
1IG1A 2CDZA 2F9GA 3TKHA 4CNHA 3HAVA 5HNGA 4R77A 3I0OA 3W10A 4AWIA 3OD6X 2R3OA 4ZY6A 4PNKA 2BIKB 3NNWA 4C3FA 4EHEA 2UZEA 3R02A 3R71A 4ASZA 5DMZA 1V0PA 3MA6A 4H1JA 2OBJA 5H8BA 3HX4A 3ZTXA 2YERA 4FTOA 4FEVA 3PY3A 1U54B 4CFFA 4R1YA 2BILB 4CMOA 4DGGA 3SG8A 4WNMA 2F2UA 1BKXA 4BWKA 4UZHA 4RIOA 3GBZA 3JS2A 1ZRZA 2QURA 3QQKA 5LMKA 5EFQA 3W8LA 1Q4LA 2JKOA 2J0MB 2Z60A 4X21A 4C59A 3QFVA 3T9IA 4ZMEA 4DEIA 5L2WA 2PULA 4EH9A 2OGVA 2H9VA 3SC1A 4FA2A 5CI7A 4HPUE 1IAJA 3HV4A 2J0LA 4K11A 3FI3A 1F5QA 1L8TA 5FD2A 1GIHA 2OF4A 5CQWA 2VO7A 3VAPA 5DVRA 2ZMDA 2UW9A 2WTKC 3D5WA 2O3PA 3M42A 4XOZA 1VYWA 2RFEA 4DCEA 4CFXA 1MQBA 1GZOA 2WMTA 3AG9A 4EBVA 4QD6A 4HCVA 2RL5A 4KKEA 4FTMA 4L46A 4ANSA 1Q3DA 3C9WA 3ET7A 5KKRC 5G6VA 2XNOA 3UP7A 4AOTA 5LQFA 4GL9A 3CKXA 5C8KA 3W55A 4QP7A 1VZOA 3QHWA 5CU4A 2WOTA 3FPQA 4F09A 3ZXZA 5HO6A 3M11A 2ZB1A 5L2IA 4M84A 5GZ8A 3DB8A 1Z5MA 3Q5ZA 4LGGA 5IPJA 3QQJA 5CS6A 1CTPE 3JVSA 4ZEGA 1Y91A 4RWJA 3UC3A 3FXWA 3ZBFA 3QX2A 3MB6A 3AD6A 4JG8A 2VTMA 2JD5A 4LOPA 3L1SA 3E8CA 3VHEA 3UNKA 4JVGA 2NO3A 2R9SA 5CSHA 1H0VA 4RT7A 3FE3A 5K0XA 2DS1A 2YM8A 1PXOA 4A9YA 4BTJA 1PKDA 3H10A 3ORMA 3UIBA 4BBEA 2R3QA 5DGZA 4BHNA 2ZAZA 4IACA 5J7BA 4OBQA 4MVFA 2J9MA 3UQFA 3OY3A 4TRLA 2O64A 4F6SA 2VWWA 3VS5A 2DQ7X 4GUEA 2IZSA 3HP5A 3DT1A 2PE2A 1YXTA 1YW2A 2YA9A 4YZMA 5LWMA 2I0HA 2BZIB 3O96A 2JBPA 4BR3A 4BRXA 2IZRA 4DGMA 2WMAA 2FSMX 5I4NA 4H05A 5IQBA 1URWA 5LWNA 3SQQA 3ZH8A 2XIRA 4F70A 5A46A 5ANGA 2C30A 3EYHA 3KF7A 5T68A 2XJ0A 3E8EA 3KGAA 3NEWA 4D5KA 4BIBA 4OUCA 3QTIA 4MD8E 5FM2A 4KIKB 3R9NA 2OI4X 3ZU7A 3LM0A 2XK6A 5JMSA 3RJCA 4AA0A 4D9TA 4EZ7A 4NW6A 4C02A 2PVMA 4QPSA 4P4CA 4ZZMA 4X2JA 4XG6A 2PMIA 2ITYA 1H1PA 4NTTA 1XH5A 1QPJA 2QLUA 4M12A 2VTLA 4QQCA 2CMWA 4FUYA 3C13A 5E92A 3COKA 3EB0A 4PL5A 3BEGA 4MNEA 2GNLA 3EN4A 3AXWA 4DH7A 3P86A 3EQGA 4FK6A 4Y73A 2V7OA 4LMNA 2O5KA 4IXPA 4LMUA 3HRBA 3F5UA 1T46A 3SW4A 5F9EA 1J7LA 4RVKA 2V5QA 5DR9A 4GFOA 5CU3A 4M0YA 1W0XC 3PIXA 4FTIA 4I23A 3DKFA 4XUFA 5HIDA 2GCDA 5AWMA 2QOFA 3DGKA 3RNIA 2PZRA 4S33A 5KBRA 1JAMA 2Z2WA 1K2PA 4G34A 2W06A 3BPRA 3I7CA 3A7IA 3LVPA 3CJFA 3PY1A 4A4OA 4I0TA 5CEMA 1QMZA 5K4IA 3EN9A 2C3JA 4PPBA 2CNUA 1U46A 2VTSA 1UU9A 4H1MA 3CPCA 5BVNA 4NFNA 5AP4A 5AR7A 5B2MA 4JQ7A 4RPVA 4M66A 3DJ5A 3E62A 5JN2A 3OTUA 3NUAA 5BVFA 2W1IA 2XIYA 3SGCA 5KNJA 4K2RA 1OITA 2C6OA 3E88A 3V8TA 1JOWB 5GJGA 2G2IA 4QTDA 3FMMA 2PVJA 4QMZA 2G15A 3NWWA 3SRVA 1CSNA 3U6JA 3Q04A 4RVTA 5AR2A 4FL2A 5CSVA 3RZFA 4QMSA 4J8MA 4UXQA 4QMMA 1PRYA 4GG5A 3UG1A 4FTKA 5E9EA 4JQEA 5EKNA 5EYMA 3H9FA 4HYIA 2YIYA 3D94A 3PSBA 3TZMA 2PZYA 2JAMA 4YLKA 5CAVA 2PE1A 4QMLA 5H9BA 1OVEA 2YDKA 4XV2A 2VWBA 5IISA 4G6LA 3COMA 3H30A 3A60A 4N0SA 2GQSA 5H8GA 1JSUA 4QMVA 4F7JA 5CEKA 4WG3A 2FGIA 5L6PA 3B8RA 1IA8A 3RCDA 3RAKA 5AP1A 5IQAA 5J9ZA 4QP3A 4FKQA 5BUEA 3S00A 3QRKA 5I9ZA 5C01A 4O86A 4ACMA 4XRJA 4FTJA 4IH8A 5GJDA 3O71A 4UWYA 4AF3A 5EKOA 3S1HA 3E5AA 2XYNA 4OLIA 3MJ2A 2BDFA 3ANQA 2OF2A 3GC0A 5IH5A 2C3LA 4QTAA 3CGFA 3PWYA 2RFNA 4I5MA 1VEBA 4E6AA 4L9IA 4WBBB 4DA5A 5E1SA 4MXAA 5EDPA 3BWFA 2VD5A 3EQDA 4JS8A 2XH5A 3R9OA 4M97A 3G5DA 3SVVA 3SXSA 3TTJA 2I1MA 4O96A 5E8WA 5FTOA 3Q4CA 3U4WA 4FICA 3IK3A 2FSTX 4TXCA 5CZHA 4XV1A 2XIZA 4QMQA 3W2QA 1BL7A 4IADA 5AUTA 4BGHA 2F57A 5JEBA 1JQHA 1Z9XA 4UB7A 3PLAE 5EW8A 4FTNA 3TACA 3UIMA 2OH0E 3JY0A 2WB8A 3ZC6A 5C03A 3FMDA 3TT0A 3TDVA 3S2PA 5LJJA 1H8FA 3TKUA 3FHRA 4FVQA 1GY3A 4JG7A 3DNDA 3V6RA 4BDDA 5HGIA 2JEDA 3HECA 2PTKA 4JQ8A 4APPA 5HVJA 3VO3A 4HOKA 3HYHA 3LFAA 4JRNA 4CVAA 4QQTA 2BVAA 1OL6A 5FXRA 1G3NA 1SVEA 3QTWA 5CZIA 3P7AA 5HD4A 4EJNA 4M15A 4F9YA 3NYVA 3UQCA 4ZZNA 3C4EA 3TNHA 3OCTA 2OW3A 2BZJA 5CWZA 5J1WA 2C69A 4OTRA 1WFCA 4XG9A 3VS6A 4EJ7A 4EOLA 2J0JA 4PTEA 2B53A 4RVLA 3QA0A 3BGQA 3DQWA 3QHRA 4OW8A 4QYYA 4F65A 1O6KA 1PMVA 3IGGA 5HBEA 3FQHA 3MVHA 3ORTA 3RPSA 3SV0A 4PX6A 3R1SA 5CAQA 3NYNA 4KIPA 3RP9A 4A06A 2ITZA 1APME 5HORA 2J6MA 1JWHA 3WBLA 4E8AA 4R1VA 3TZ8A 1U5QA 2YISA 2XEYA 3A8WA 5DT3A 2UW5A 4D4RA 5CEPA 3MPAA 2OJFE 2OIQA 4MF0A 4U6RA 3S3IA 1LP4A 2VZ6A 4C33A 5HCZA 4R5YA 3W2OA 4J8NA 3OUKA 4GIHA 3TV6A 4BCNA 3ZLSA 2OXXA 3LXKA 3VQHA 1ZXEA 2BALA 5F1ZA 3W1FA 3DAJA 4JX7A 1H26A 5DHJA 4GT5A 3C5UA 3NX8A 3E64A 1FMKA 3P5KA 3AGMA 3KXXA 1JVPP 2JAVA 3NR9A 5IA1A 2WELA 3RGFA 4IWPA 5J95A 5IEYA 4GFGA 3HMOA 4D1ZA 5CAUA 4NU1A 4BGQA 3U6IA 3N4TA 3EL8A 2CNVA 4O1OA 1YHSA 3Q60A 3ZUVA 4QTEA 1Q8WA 4DHFA 3L8PA 5J1VA 3TNQB 3UYSA 3LFBA 4TYJA 4AE6A 3D0EA 4GVAA 4XP2A 3ORLA 1XH7A 3HV5A 4HJOA 2CPKE 4EC8A 3FPMA 4O38A 3WIGA 2ZM1A 3UZRA 3AMBA 4D4VA 3VBTA 4F9CA 1O6LA 1OB3A 2O8YA 3KU2A 2WMVA 5JFSA 4F63A 4Z3VA 4KD1A 1O9UA 4LM5A 4GU9A 2W4OA 2WZJA 3BBTB 4K33A 3V6SA 3NYOA 4MTAA 4PDPA 4PUZA 3RM7A 3VBWA 5JQ8A 1OKVA 1JSTA 2PZIA 3LZBA 4K0YA 2BTRA 4EH5A 1B6CB 2Y0AA 3FC2A 4AT4A 3FUPA 4TL0A 1XO2B 3EWHA 4Z16A 4YZNA 4FF8A 4BB4A 1FQ1B 4BCIA 1W82A 2WMXA 1LR4A 4DFLA 1WBOA 3A2CA 1YVJA 1HCKA 3G0EA 2I7QA 3KRXA 4KAOA 1M7NA 2VX1A 5EW3A 4U3ZA 4FOBA 1Q62A 4F1MA 3BKBA 4C61A 4L52A 2C5VA 5CEOA 5M09A 4UMUA 1P5EA 4ZLYA 5AA9A 5IMXA 3CE3A 3KRWA 3ATTA 1GJOA 4LUDA 5KZ0A 1XBBA 5HE0A 4XBUA 3BYOA 3LJ1A 4BTMA 2QO2A 1OECA 3R0TA 4OBPA 4WT6A 3QKKA 4E4NA 3K3IA 5ANOA 4Q9SA 4G9RA 1OI9A 2OIBA 4YJRA 2QC6A 5AIKA 5EDQA 5CENA 1PMEA 4YPDA 3EMGA 3BU3A 2VTTA 4F7LA 3ATSA 2IJMA 3BGZA 2PPQA 3NAXA 5ANIA 3AC5A 1JLUE 4GKIA 3R7OA 4F99A 2ITWA 4QYGA 2B7AA 1H28A 2JBOA 2QR8A 4R8QA 3OXIA 4A9UA 3LLTA 3H3CA 4L42A 1OIYA 4O0SA 2AC3A 4BZDA 2WEIA 3DKGA 2GU8A 1ZMWA 3D4QA 5ITAA 5HIEA 5I5ZA 2FSOX 2XRWA 1WBSA 4IDTA 2QOKA 2PUUA 2HIWA 2YCRA 4RC3A 5EM8A 5HVKA 2CGVA 4F9BA 3BX5A 3RPOA 3MIYA 2R0UA 4ZP5A 2VGOA 3VNTA 4ZZOA 5CU0A 4G31A 4L43A 3V04A 4AFEA 5JZJA 2VTOA 3ZO2A 3QCQA 1R39A 4PDOA 5HIBA 4W9XA 2HWPA 4PMPA 1IR3A 2W4JA 2X6DA 3QZHA 3SD0A 3GCSA 1YWVA 1FVTA 2QU5A 4FEXA 3F2RA 3F9NA 3EQRA 3MSSA 1WZYA 2ONLA 4UWCA 4XG4A 3JYAA 2Y9QA 4Y83A 5I9VA 1IEPA 4ZTQA 3UPXA 2PMNX 5DWRA 1YHVA 2RIOA 3DCVA 5A6NA 5D10A 1ZY5A 5IUIA 3RAWA 2R3MA 4KINA 1M14A 1STCE 4OAUC 4UYNA 2JIUA 4WHZA 2QOIA 4IE9A 3P0MA 4RLKA 4I5HA 3DTCA 3G90X 5FLFA 4IAFA 2VTIA 4BDAA 2B0QA 5JK3A 4XP3A 2PVKA 1LEWA 1XJDA 3IQ7A 4ENYA 4DF3A 3JVRA 4S32A 4RIYA 3HUCA 3KRRA 4RA5A 3I0QA 3MH1A 4G17A 3SX9A 4MNEB 3ZC5A 4CTBA 4DG2E 3PA3A 4QMXA 3UJGA 2OIDA 3PXZA 1H08A 5DT0A 1J7IA 1E1VA 3GFEA 3VUGA 1KE7A 4BDEA 4C62A 2W05A 3NUUA 4TWCA 2CNQA 2YIXA 2QR7A 3ZFXA 1YDSE 4ONAA 4MXZA 3LIJA 3BLQA 4YU2A 5BQ0A 5KHWA 2YZAA 4AGWA 4FNWA 4O0XA 1JNKA 3ZDUA 3MESA 4AZTA 5TR6A 4NCTC 1ZMUA 3TUDA 1BI7A 3R30A 2WOUA 5GNKA 1XH4A 1FINA 3NPCA 4L3LA 5FEQA 2VV9A 4O2PA 3UIXA 1RQQA 4FT5A 4FNYA 2HCKA 4HNIA 5E8XA 4BBMA 3HRCA 4XMOA 5HNBA 3FXXA 3UGCA 4QMOA 4AXAA 3SLSA 1BL6A 3G6HA 1OUYA 2HY81 4AZEA 3FV8A 3N51A 3QZGA 4FG8A 2BDWA 3PSCA 4K1BA 3AC3A 4BYJA 4CSVA 5A14A 2WTDA 2E9VA 5HLWA 3FDNA 4FKTA 2GHLA 4G2FA 3SRVB 4QNAA 2EXMA 4I0SA 5ACBC 5AV3A 4AGCA 2ITPA 4FT3A 2FYSA 4NKSA 4D4YA 4WNKA 3QQGA 3EH9A 1WAKA 4JDKA 3QTZA 3I5ZA 4OTWA 3GP0A 1BX6A 1Q8UA 3PJ3A 5BVWA 1XBCA 2EUFB 4K9YA 3UZPA 4EKLA 4EOIA 2CJMA 4MXOA 4NKAA 4CD0A 1ZYCA 3BV3A 2JGZA 4NJDA 4D28A 4RRVA 3ALNA 4USDA 3EQPA 3H9RA 2BRHA 3RI1A 2W7XA 3SHEA 1W98A 4IFGA 4JR3A 4Q2AA 3CEKA 4FX3A 4X3JA 3T3UA 5DPVA 3Q2MA 3DTWA 4N6ZA 3G51A 1DAYA 4OR5A 3WOWA 3RNYA 3LLAA 3MH0A 2E9NA 4IWOA 3LKMA 4IAAA 4ENXA 3PIYA 4J1RA 2FB8A 1ZMVA 3OP5A 4BDHA 4XG8A 4CZYB 3EKNA 3PVWA 2LGCA 4LRJA 1BMKA 2YDIA 3PYYA 2JC6A 3DXNA 3QD0A 4I6QA 2HZ4A 3G33A 4O7YA 2JITA 3TIZA 2BDJA 2A4LA 4M67A 2JKMA 3GT8A 4HPTE 4YZCA 3UPZA 3Q4UA 4R5SA 3ZO3A 4MXYA 4MEDA 1YXSA 2NPQA 3NVKI 1XBAA 3Q4TA 1I44A 1Q8YA 1ZY4A 3AMAA 3MFUA 3QTUA 3QAME 1YI4A 3VS7A 4J95A 4DEEA 3U8WA 2WIPA 1GIIA 1OGUA 2R3IA 3ZRLA 3FMKA 5L2QA 4JIAA 4LUEA 4IAKA 4HVIA 4Y5HA 3ALOA 3PTGA 2BHEA 3WIKA 4KABA 5LOHA 3WF8A 5L6OA 1SVHA 5J5SA 4UBAA 3F66A 4UN0C 3W16A 2PMLX 2UW6A 1FGIA 2BCJA 2OJ9A 4G3FA 3ZFMA 4D0WA 4BWXA 3OC1A 5IA2A 1S9JA 2XF0A 3GC9A 4CT2A 4AZFA 5BYYA 3CS9A 1A9UA 3P9JA 3R7EA 3QYWA 4EQMA 4EKKA 3HKOA 4I5PA 3HL7A 4FV6A 2IVVA 2UZWE 4OTIA 4I0RA 4UMQA 4O0TA 5FWKK 2XM9A 4U9AA 4L3PA 2C6DA 5DBXA 3VULA 4O6LA 3ZO4A 1OUKA 3F2NA 3HVCA 5AR4A 4XV3A 3LFSA 4O7NA 3OXZA 4X2GA 2YFXA 2QI8A 2WMWA 3ORIA 4JAJA 4DGOA 4AW0A 4B8LA 4ANOA 4BDJA 2YIWA 4GU6A 4QP1A 5J9LA 4KBAA 2C5YA 4YC8A 4FEQA 4PMTA 5M53A 3EL7A 3MTFA 3CY2A 4XG3A 4F6WA 2OZOA 2X1NA 5IQDA 2NP8A 3OHTA 3UVPA 1EH4A 2OJGA 1HOWA 1R0EA 5HX8A 4RWIA 3C4ZA 4GS6A 4NEUA 4DFNA 1W7HA 3AGLA 3FAAA 4QTCA 3A7JA 4JDHA 4QMTA 2XBJA 4L45A 4E7WA 1JKTA 4GYGA 2XUUA 3GC7A 3HLLA 3I4BA 3NW5A 3LHJA 5CEQA 2XK7A 4TWNA 2JIVA 4U79A 2PK9A 3JUHA 4IC8A 4RWKA 3BHHA 5FXSA 2GPHA 1ZZ2A 4D5HA 3GOPA 4IB1A 3NUSA 4WO5A 5HHWA 3UOKA 3VUTA 3CP9A 4IM3A 5CYIA 4L3JA 3CY3A 3RBWA 3C51A 4CKJA 3KULA 4WIHA 5BVDA 3W2PA 3HV7A 3LJ0A 1JBPE 2F2CB 5CU2A 3Q52A 4I3ZA 3WE8A 3MVMA 4BL1A 2VTRA 3RHXA 1RE8A 3QCYA 2CN8A 3ZS5A 3NCGA 2FUMA 4KRDA 4G3GA 3U9NA 3ZEPA 2B9HA 3VS3A 4DH1A 5M44A 1UKHA 5K5NA 3S95A 5BNJA 5E7RA 3ACKA 2YWPA 2JFLA 3CBLA 2Z8CA 5J87A 2DUVA 5BUIA 4QYEA 5B0XA 3NMUF 2B1PA 4M8TA 2J2IB 5IA3A 4X7QA 4NYEA 4XRLA 4I22A 5EDRA 4FKWA 2ZMCA 3RPRA 1Y8GA 2PZ5A 3VF9A 5JFXA 3N9XA 4E6DA 4O6EA 1WMKA 2CN5A 4G9CA 2UZNA 2JDSA 2OO8X 3F3VA 2CGWA 4KBKA 5HU3A 4L00A 1OKWA 3BU6A 3I6WA 2NRYA 2OJIA 3BLHA 3F5GA 3QRUA 3ZONA 5BVOA 3MN3A 4FKSA 3FMLA 2QD9A 3Q96A 3QU0A 4LI5A 3OVVA 5LCJA 1XHAA 4FTCA 3O51A 3RMFA 3TWJA 3DNEA 1QL6A 4YJNA 5CSXA 3UVRA 4YJOA 5IUGA 2YIRA 4L53A 2V55A 3F5PA 4IMYA 5AIRA 5EYCA 4KNBA 1WVWA 2O65A 1E1XA 3EKKA 4ITIA 1XKKA 4MQ1A 4W4XA 2PYWA 4X6RA 1NW1A 4NM5A 4WBOA 3EN7A 4PDSA 5FTQA 3ZZWA 4B4LA 2YN8A 5IA5A 4F6UA 5JRSA 4DGNA 2WTWA 4FIFA 1PXIA 4O7VA 4UXLA 3V5WA 2PVHA 3C50A 3OEZA 5EYKA 3ENMA 2ZM3A 5AP5A 3VWAA 3H0ZA 4PWNA 4EOMA 5AAGA 4FKRA 5C4KA 4HCUA 3GGFA 4YC3A 3R7YA 3FL4A 4EONA 2C4GA 3V51A 3EFLA 4GV1A 2CCHA 4R7IA 4AQCA 1JKKA 2CSNA 2XNMA 4CKIA 5BYZA 3BELA 4K6ZA 4NK9A 4AGUA 3N4UA 5I9XA 1OMWA 2BFYA 2QOQA 4LV8A 4B9DA 4WKQA 3I5NA 1ZOHA 4A7CA 4D2TA 2YZLA 3IDPA 1PHKA 2E9OA 2H96A 3HGKA 2B9FA 3ZZEA 5JH6A 4CFWA 2RKUA 5IU2A 4GKHA 3EFKA 4FSNA 4OTQA 3DZQA 1H1RA 5EQEA 1FOTA 3OZ6A 1Q97A 4RIWA 4WSQA 4A4XA 2BRBA 4U97A 5EI6A 2VTPA 4DH3A 3IGOA 4AACA 1RJBA 3GCQA 3VJNA 4UEUA 4YGAA 5FBNC 4TNDA 2AYPA 4TYIA 1OPLA 3SOAA 4O7TA 5FDPA 4UMRA 5M07A 1UVRA 3QGYA 5DH3A 4AZVA 2BAQA 4C58A 5JT2A 5EM5A 2JDVA 1XH8A 3FLWA 3MYGA 2OLCA 4D2RA 4W4VA 5EQYA 4CFVA 4NIFA 1UWHA 3R2BA 4BDIA 3MH3A 4I20A 4R7HA 5M4IA 3F3ZA 2WTCA 3VBQA 5LXMA 5E4HA 2CKEA 2O0UA 1H25A 1KV2A 4IEBA 4OTHA 4L8MA 1DM2A 3R6XA 3QCXA 4F9AA 2UZDA 3PXQA 4FYOA 3EN5A 2W1GA 2R7IA 3MDYA 3P08A 4ZTSA 3DQXA 3P7CA 3Q9ZA 2ITXA 1ZOEA 3R8ZA 3Q6WA 3FJQE 5ANJA 1GZ8A 2R3FA 3Q32A 5HICA 3VBVA 4EZ3A 5IKWA 5M51A 5ETCA 3V01A 2EXCX 5CXZA 4QP8A 4E6CA 4RFMA 2OG8A 5HKMA 5B2KA 4N70A 2VO6A 1WBNA 4C4GA 4LV5A 3QF9A 3HZTA 2XNEA 3KF4A 3G6GA 3L9MA 4FV1A 3ZM4A 1OKZA 3DPKA 4Y85A 5AP0A 3ANRA 3KK8A 4P90A 2J90A 4C4EA 5CI6A 2OWBA 4E1ZA 3OT8A 3OWKA 4AOJA 3FL5A 5BUJA 4RIYB 2PVRA 3PVBA 2UW3A 4PPCA 4ZJIA 5BVKA 1H00A 4WD5A 4FC0A 5ETIA 4KB8A 3O7LB 2BROA 2HW7A 3MFRA 4QO9A 4V05A 3WZEA 5FUTA 4RJ3A 3C5IA 5AM6A 4CFUA 4L68A 3HMNA 2ZOQA 1KOBA 1M2RA 3C0HA 1PMUA 1WCCA 2X81A 3POOA 4FTTA 4BIDA 3WF5A 2GDOA 5I9WA 4FG7A 2PVYA 3TV7A 3DA6A 5BYLA 2QNJA 4NL0A 4O7ZA 2W96B 3T8OA 4JXFA 4O1PA 4QYFA 3SXRA 4J97A 4BDGA 4FI1A 4LGDA 2R4BA 3VBYA 3ZOSA 2XNPA 4L44A 2WQEA 3QD3A 3LFEA 4MBLA 5HO7A 5E8VA 5D41A 2PVFA 2XNGA 3A4PA 4FVPA 4EHGA 1BYGA 3ZMMA 4FL3A 2VTHA 5DRBA 3PJ1A 3ZXTA 2X9FA 5ANKA 5FP5A 4YZBA 3FQSA 4AS0A 2UW4A 5TKDA 4C4FA 3NUXA 4NH1A 4BI1A 2YHVA 5HESA 2BHHA 3FKLA 2QOLA 4GK3A 1KOAA 4FV7A 1YI3A 5AP6A 3QQHA 2XBAA 3O2MA 4BC6A 4DEDA 4BDKA 2WO6A 1G5SA 2P2HA 2WMSA 1WBVA 3HRFA 2VWIA 2J5FA 3BWJA 3F7ZA 3D2IA 5C8MA 4BDCA 4FT9A 4IVDA 3TEIA 2XKFA 4DG0E 5L8KA 1Q99A 4XNEA 3FMJA 3GCUA 4FR4A 5LARA 2ZM4A 5AM7A 4BIEA 4IZ7A 3K3JA 2C3IB 2RSVA 5F95A 4RMZA 5BMSA 2XJ1A 4E4XA 5DG5A 4EYJA 3FBVA 5DLSA 2A1AB 4BBFA 1UU7A 3O8UA 5HLNA 4S30A 4GMYA 5EM6A 5EHLA 2XMYA 4ZK5A 4WSYA 4L7FA 3TZ7A 4JRVA 3ITZA 3LW0A 3DK3A 3DKOA 1MRVA 4GYIA 3IOKA 4DFYA 4ASXA 5AUXA 4ZAUA 1UNGA 4GEOA 3QBNA 3V5TA 4DBXA 3MWUA 2BRNA 3NUNA 4Q5EA 2GS6A 3VBXA 4EI4A 3EFJA 2WQBA 2OJJA 4IX3A 4PP9A 4TTHB 5D7AA 3R9HA 4APCA 4BGGA 4BZOA 4C2WA 4CG8A 1W8CA 3BGPA 3CR0A 3CJGA 3LCKA 2LAVA 3P1AA 2OICA 4R7BA 1WBTA 4I94A 2UZUE 2VWVA 5ETAA 3GCPA 3D14A 3L9LA 2YM5A 5EK7A 5FEEA 1Y8YA 5HE2A 5M57A 1Y6AA 3AT2A 1ZYLA 1YKRA 3OOMA 3Q9WA 4PMSA 4U3YA 1Q61A 1ZYDA 1V0OA 2C3KA 4W9WA 5IUHA 5HX6A 3AC2A 3NNUA 4FIIA 5D1JA 5CVFA 4FEUA 1NVQA 2BMCA 2E9UA 3A62A 3EQCA 5M06A 3PRIA 5HG8A 4OTDA 2HELA 2IZUA 2X7OA 3CTQA 4H39A 4QMPA 4G6OA 5CLPA 5L3AA 2Z7QA 4UMTA 2RG5A 4M13A 4DTBA 4RJ7A 3DBFA 3FSKA 5IZFA 5E8UA 3B2WA 4YJQA 4RVMA 3A61A 3LPBA 4X0MA 4AG8A 3GENA 3R04A 4J99A 2XKCA 4D2PA 4TT7A 4FSYA 2G2HA 2QOHA 3VUMA 3VN9A 5CSWA 4GT4A 1ND4A 2KULA 1J1CA 5AP2A 1GZNA 3V8WA 4DFZE 3I79A 4DTKA 3QLFA 2OFVA 4DEGA 2RFDA 4W4WA 3R9DA 5TO8A 4ZY5A 5M4CA 2JDOA 4TY1A 3MH2A 4GK2A 3PPZA 5GZ9A 3R28A 1NXKA 2GS2A 2VO3A 4MCVA 2Z02A 4O83A 2QCSA 3RZBA 4F1OA 3BQRA 4QP6A 4FV5A 1WBWA 4O81A 3UVQA 5LVMA 4E5WA 1OPJA 2PWLA 3BCEA 3F6XA 3PE2A 3FQEA 5AV0A 1MRYA 5E1EA 5EI2A 4ZS0A 3ORPA 4FEWA 3I6UA 5FEDA 2X9EA 3NIEA 3W32A 2ITUA 3HMIA 4Q5HA 3L8VA 3TKIA 3AQVA 4USFA 4DFUA 2RF9A 2X7FA 3MS9A 4EQUA 4DEBA 1H24A 2B4SB 2ESMA 2HXQA 4U7ZA 5L8JA 4N4SA 5HQ0A 1LUFA 2R5TA 4D58A 2BR1A 4PV0A 5IG1A 5LMBA 4NUSA 4ZIMA 2KTYA 5DNRA 2WQMA 1ZLTA 2P0CA 5IEVA 3ULZA 4JLCA 4BCOA 1YWRA 2ETMA 2PVNA 2PUIA 4CZUA 5AV4A 2JDRA 1YOJA 3D5XA 5JRQA 4DITA 2BAJA 3EQFA 4AN3A 3KMMA 3KULB 3UYTA 3QUDA 5HI2A 1JSVA 5KMMA 4ZMFA 3ZLXA 4J71A 4RX5A 4KBCA 4TZRA 3FY2A 5GJFA 2XB7A 2W1DA 5CTPA 4DH5A 1RW8A 3E8DA 4KIQA 5AFVA 4YJSA 3MVJA 3LE6A 1YDRE 3R63A 5CNOA 2GSFA 3NYXA 4H3PA 4ASDA 2XK9A 2ZYBA 5H8EA 3QXOA 3F88A 5IH6A 2H8HA 2R3NA 3VQUA 3BU5A 1R1WA 3PVUA 4GVJA 4XLIA 5HE3A 4YJPA 2G1TA 3KXZA 4IM2A 2HWOA 4IDVA 3P23A 4X3FA 4K18A 5AUYA 2C0IA 4C4JA 3L8SA 3VJOA 1PW2A 1OIQA 2HZIA 2HZ0A 2JKQA 4EL9A 2QG7A 3FKNA 3IECA 4G3EA 3VS1A 2W1FA 5EQPA 4HCTA 2FO0A 2HENA 4MHAA 4WNOA 3RVGA 2WTIA 3BE2A 3HDMA 1U5RA 4FTUA 3T9TA 2XJ2A 4BCMA 5IA0A 2VNWA 3MFTA 3ETAA 5DE2A 5LMKC 3THBA 1YXXA 1H07A 4FZDB 2QOBA 2Y4IB 4O91A 3S4QA 2BKKA 2WHBA 3BQCA 4FV9A 3EYGA 2WMUA 5D12A 3WZKA 2XCHA 4F0FA 5HG9A 1NVRA 2C0OA 4BYIA 2YDJA 4O27B 4H3QA 1SYKA 1H01A 4ZSAA 3VIDA 4NM3A 1R0PA 4JIKA 4UV0A 3LQ3A 1ATPE 2BKZA 3UO5A 2W9FB 4ITHA 2PSQA 2YJRA 4PQNA 2IVUA 4I93A 4G5JA 3LAUA 1FVVA 3RTPA 1OM1A 4O82A 2BTSA 2ZV9A 4BDBA 3BE9A 3LQ5A 3SDJA 4CXAA 3CLYA 1Q41A 2JDTA 3KN6A 1PKGA 3CGOA 4WRSA 5D9HA 3TJCA 4FUXA 3UP2A 4DC2A 5K4JA 2WQOA 2GFCA 4DAWA 1DAWA 1KWPA 2GTNA 1OIRA 3A4OX 4I6HA 3PPJA 3IKAA 3F3WA 1CKPA 5CT7A 2XK8A 4TKSA 2C6IA 3GC8A 3KQ7A 4HGLA 4OTPA 3QX4A 5FG8A 4J96A 5JGAA 3LMGA 4QP4A 4FSUA 3RAHA 5IEXA 3FLYA 4YJUA 5L6WL 1VJYA 3ELJA 2YIQA 2EB2A 2WMBA 3QTSA 3UIUA 2E2BA 3BYUA 2X4FA 3OFMA 5I0BA 5M08A 4RIWB 4CV8A 2G2FA 3U55A 2OKRA 4I6FA 4C38A 5K9IA 2NNWB 5BMMA 3F2AA 5IA4A 4PPAA 3DBCA 5EOBA 4IVAA 2ERZE 3OT3A 3R1QA 4EH7A 2YJSA 4LRMA 5KMNA 4IVCA 5HD7A 3U51A 2VWYA 5CAOA 5KMKA 2HW6A 5AMNA 2JIIA 4E93A 4FYNA 3DJ7A 3DFCB 5AR8A 2XS0A 3O50A 3RCJA 3JR1A 3HMMA 4NIFB 1YOLA 4EOQA 1KV1A 4EC9A 4KA3A 3BHUA 3HMPA 3WF6A 2QKWB 3LM5A 3MY5A 2ZV8A 2W1CA 2CHLA 2VWZA 3UQGA 2X8DA 3LXLA 3FZPA 3BYSA 5D7VA 4GJ2A 2YAKA 2V22A 3OWPA 4AFJA 3MGYA 3SG9A 1ZYJA 3QGWA 3BRBA 4JDJA 1AQ1A 4WUAA 1YOMA 3GXLA 3KC3A 4EK4A 3DDQA 5CQUA 2GNFA 4G16A 3VUHA 2UZTA 3IPHA 4JOAA 5CASA 1KE9A 4JBVA 4ORKA 4OT6A 2XA4A 3ORXA 5AP3A 4YZDA 5EW9A 1NVSA 4FIEA 4PTGA 3Q3BA 4XH6A 1QPEA 4RX9A 4ZTRA 2YWVA 3OWLA 3O23A 3OBJA 3ZLYA 5DR6A 1IAHA 5IDPA 4RX8A 4EH2A 5AX9A 3F82A 2XM8A 2QQ7A 4ITJA 2Q0NA 3GU7A 5AV2A 1RDQE 4J53A 3E7OA 3FI2A 5JGDA 5JQ5A 2X2LA 3ZDIA 3LCSA 2XK4A 4I21A 1PXLA 3QWJA 3BZ3A 3FLZA 3OF0A 1UKIA 4YLLA 4R3RA 5E8SA 3C4FA 3D83A 3GFWA 3HNGA 3FMNA 4TN6A 2W5HA 3BYVA 4O7SA 4CG9A 4L7SA 5KX8A 3OCBA 2V7AA 1E9HA 1OL2A 1AGWA 4O0YA 2UUEA 4FSMA 2O2UA 4HGEA 2Z7LA 4CLIA 2AC5A 3R8VA 3NLBA 2V0DA 5GIOE 4II5A 2VX3A 3R7VA 4USEA 2IW8A 4DT8A 1PMNA 1A48A 2ZJWA 2WIHA 5CX9A 4AZSA 2W1ZA 4FZ6A 2R3PA 2GNGA 3R01A 4QQJA 3ZCLA 2Y7JA 2PL0A 3QTQA 1URCA 4RC2A 3RKBA 2X2KA 5DA3A 2ZDUA 4B7TA 3ENHA 5K5XA 4JAIA 2BZKB 3IW7A 2QHNA 4O0WA 5A4LA 3U6HA 5KCVA 4IAZA 2ITQA 3ERKA 3ZO1A 4C3RA 3LFDA 2R3KA 4FKOA 2CLXA 3PWDA 3D5UA 1ZWSA 3W33A 4BCFA 3HP2A 4CCUA 4X2FA 5AX3A 1TQPA 3KCKA 4AAAA 2A2AA 3DDPA 5FM3A 2B54A 1TVOA 3T3VA 3VC4A 2I0YA 5K3YA 4A9SA 4FT0A 2QONA 2ETKA 3PFQA 1YI6A 3ROYA 3ODYX 4E4LA 1OL7A 3D7TA 3FY0A 4WG4A 4YSJA 4P2KA 1ZZLA 3MI9A 5A54A 4KIOA 3K5VA 3LFNA 2RFSA 4I5CA 4YO6A 4L01A 5LVLA 2UW7A 4I4FA 3O8PA 4YSMA 4Y72A 2YACA 3Q53A 4HVGA 2BZHB 2BFXA 4ALUA 5LMAA 4PP7A 3KREA 2YM3A 3OS3A 3PE1A 2REIA 2WTKB 4G3DA 4F0IA 3F5XA 3QRIA 1IA9A 5IDNA 1JKLA 2IW6A 4FV8A 4TWPA 4QQ5A 5ICPA 4FV4A 1KE8A 2BPMA 3BIZA 4FVRA 1OPKA 3PLSA 5FP6A 3ZUTA 3DLSA 5CSPA 3TDWA 3IG7A 3QD4A 2C5OA 3QXPA 4U40A 2Q83A 3DB6A 3HDNA 4M68A 3VS0A 3BEAA 5JZNA 2X4ZA 3RK9A 4ANBA 2CGXA 4JJRA 2OXYA 2GHMA 1OBDA 3SW7A 2YLEA 3U9CA 4NM7A 1KSWA 2Z7SA 1TKIA 5CANA 3JY9A 4D55A 3DXQA 1KE5A 4GCJA 4AW1A 1K3AA 1ZOGA 3PDTA 2VN9A 3LFFA 3OEFX 4TW9A 2OSCA 2C6LA 3NGAA 2P55A 3UODA 1V1KA 2EVAA 3EFWA 3E93A 4UYAA 5DRDA 1CMKE 2I0VA 4DN5A 4QPMA 4HVHA 2CKQA 1CKJA 3OG7A 4AUAA 3SA0A 1H4LA 2WMQA 4ACGA 4DEAA 4G3CA 4MXCA 4YZ9A 4Y5QA 2W1HA 3FZ1A 2O63A 4CRSA 2F49A 3PXRA 2XZSA 3KXMA 3PY0A 4FBXA 4IVBA 2J50A 5CALA 1FMOE 4GH2A 4MBIA 3WZUA 3ZM9A 5I3RA 4TYGA 1M17A 3OCSA 3TJDA 4ALWA 2UZVA 4Z7GA 5JKGA 5EYDA 3QZIA 4EUUA 3H9OA 2E9PA 3R1NA 2QLQA 2W0JA 4QRCA 3RWQA 3V3VA 3DJ6A 1W84A 3V5PA 4JDIA 1XH9A 2PUPA 5HVYA 5EG3A 5K0KA 1Q8ZA 2IVSA 3NNXA 4FSRA 4PMMA 4EZ5A 4KWPA 2ITTA 3QLGA 3A7FA 3I60A 3MA3A 4BCPA 5HTCA 2ERKA 2WU7A 3R7UA 2WTVA 3PJCA 4BTFA 5AA8A 3G15A 4U45A 3G9NA 4PL3A 4E6QA 2R3LA 1TQIA 4S34A 3EIDA 3MBLA 5CF6A 3OUNB 5EOLA 4AN2A 4MXXA 4D2WA 3K54A 4HZSA 3HUBA 4EORA 2VNYA 3HEGA 4CYIA 4MAOA 3R8UA 2W99B 3COHA 3QUPA 3PJ2A 4RZVA 5HO8A 4ALVA 3RM6A 3OCGA 4QTBA 4JG6A 3FZRA 4XCUA 2ETRA 4FK3A 3E87A 3EQIA 2YM7A 2VU3A 2Q0BA 2WAJA 4I4EA 4LL5A 3MY0A 5HEZA 3VF8A 4JBQA 3V5QA 4CQGA 3K2LA 1YRPA 2A19B 3FSFA 4NCTA 3RAIA 1JPAA 4C3PA 2OZAA 2XYUA 3Q4ZA 1X8BA 3FC1X 5H3QA 4Z9LA 3WI6A 5KMJA 2EU9A 5AAFA 4LQMA 4QPAA 4HGSA 1SM2A 4RBLA 3UOJA 4UY9A 2R3RA 2AUHA 3BLRA 3FEGA 5AEPA 2P3GX 1M52A 2J5EA 5AJQA 4RJ6A 4PY1A 2GFSA 4JNWA 4U41A 4DFXE 4JBPA 4B0GA 3LCDA 3C4XA 5A4TA 4XV9A 5HOAA 3KRJA 4WRGA 5AADA 3QTXA 2GQRA 1GOLA 5FXQA 4ZOGA 3VS2A 5KBQA 4BDFA 4MF1A 3P79A 4I41A 3KN5A 3EJ1A 3IS5A 5KE0A 3DBEA 3RK5A 3ZBXA 4KKHA 4I24A 5DFPA 3TV4A 2QVSE 3UE4A 3AMYA 1UU8A 3GEQA 3NZ0A 4C7TA 3NAYA 1GAGA 3GVUA 3WF7A 3F7WA 3BV2A 4XS2A 4CYJA 1UV5A 2WKMA 4C36A 3BBWA 4TYEA 2B52A 2G01A 3EZRA 3NDMA 4X3FB 4MX9A 3C4CA 3PPKA 4OTFA 4AGDA 4EH8A 1UWJA 4YR8A 5TOZA 1G8AA 4FGRA 4YBJA 5IQHA 3HV6A 4CGAA 4C37A 2GHGA 5C4LA 4FSTA 4MNFA 5HCYA 4CQEA 5AAEA 3VW6A 4ERKA 2XEZA 5F94A 5FRIA 4EK3A 1A06A 4EQCA 5JFWA 4R3PA 5E90A 4M7IA 4E73A 3NW7A 3F69A 1ZAOA 5J5TA 5CVHA 2YM4A 3Q9YA 5AR5A 1WVXA 3BHVA 2HK5A 2QO7A 4FKLA 2YCSA 1R78A 3AD4A 3UO4A 3CPBA 3TUCA 5HG5A 2X39A 1LPUA 4FT7A 2QHMA 4ZY4A 2IZTA 5LVNA 2W9ZB 3Q5IA 4D1SA 3PZEA 1YWNA 4EK6A 3PG3A 3TNWA 3AT3A 2P2IA 4FZFB 4ZJJA 1AD5A 3C7QA 4ZSGA 1Q8TA 3NUPA 4IQ6A 1UU3A 3FLQA 4O7WA 5GHVA 4M69A 4IBMA 4ZTLA 4O84A 4B8MA 3TCPA 4CLJA 4P5ZA 2GQGA 2J0IA 5TT7A 2PHKA 3E8NA 3RPYA 5JSMA 3D7ZA 4BKYA 2YLFA 5HNIX 1BUHA 2WU6A 3GQLA 1OBGA 2X6EA 5G1XA 4CEGA 3EQHA 3R2YA 4ACHA 4ZSLA 1ZYSA 3GU5A 4C34A 4P7EA 2C0TA 3KFAA 4FKVA 4KUJA 2C1AA 2FSLX 4EOKA 3DY7A 1KUTA 1J7UA 2VAGA 1U4DA 4WNPA 4A4LA 4BHZA 1OKYA 2X8EA 2R2PA 2C47A 5HCXA 4RIXA 4NZWB 1MRUA 3IONA 4YNEA 4P5QA 3ORNA 4X6QC 3MV5A 4MWHA 4WUNA 5FQDC 2IPXA 3CXWA 5DEWA 3FKOA 5EHOA 4ANLA 3NS9A 2JKKA 3II5A 3HA6A 4KS7A 4YJTA 4JL9A 2HXLA 4QP2A 5KZIA 4PDYA 4FNZA 2UW0A 4I1ZA 1GZKA 1YQJA 5DOSA 4EH6A 4GG7A 4QNYA 4L6QA 4DEHA 2VTNA 4GT3A 4GW8A 3BYMA 4F4PA 1REJA 1WBPA 2X8IA 3CQEA 1Q24A 4QYHA 2ITVA 4IAIA 4LYNA 4OBOA 3W2RA 1XH6A 3K5UA 4MD7E 2W1EA 4GK4A 1Z57A 5CEIA 1I09A 1J91A 3L9NA 3WYYA 3RWPA 5BPYA 4HVSA 2WMRA 4JT3A 3GQIA 5T3QA 3RINA 5A4CA 4DE4A 1L3RE 4X3FC 3VRZA 2Y4PA 4D0XA 3DU8A 4YUQA 4ANNA 5A6OA 4HVDA 2UVZA 4IWDA 5F20A 5BVEA 4ZTMA 4IB3A 4OT5A 5GIPE 4IJ9A 3BHYA 3E92A 2F7ZE 3CD3A 3G2FA 4XP0A 3ROCA 4YO4A 3MB7A 4O2ZA 4S31A 4A07A 2QG5A 3QZFA 4RJ4A 2RG6A 3ZSIA 3PP1A 4EK5A 1Q5KA 2QOOA 4O21A 2J0KA 1U59A 1XR1A 3NCZA 1SZMA 3PUPA 2VTAA 3M2WA 4X2KA 4ARKA 5IQEA 2YEXA 4XOYA 2C6TA 3GU4A 1XWSA 4B99A 4PNIA 5CU6A 4W8EA 4YC6A 4HYSA 2GMXA 4AOIA 3IW4A 4JR7A 3ZUUA 4FSZA 4AA4A 3E3BX 2UZBA 4TPTA 5EHYA 4R78A 3KXNA 3MVLA 4FIJA 4F9WA 5LCKA 3ZHPC 4V0GA 5HTBA 2CKPA 4NJ3A 5KMOA 2IO6A 5DN3A 4H58A 1YXVA 2HYYA 4FKUA 4HGTA 3WARA 4DGLC 5B7VA 4QMWA 2X2MA 3UZTA 3B8QA 3O17A 5IF1A 3DKCA 5AV1A 5LVPA 2C6KA 2ONLC 5CXHA 5EM7A 3LFCA 4IAYA 5H2UA 2YCFA 1UNHA 4TYHA 3FI8A 4S2ZA 3A7HA 3ZEWA 1QPDA 4F7NA 1PXNA 5M55A 4OGRA 2CLQA 2FVDA 4CV9A 1HCLA 2GNHA 4QMYA 2CCIA 1MP8A 3FLNC 3D15A 4HZRA 4O0VA 4J7BA 4U42A 3V5JA 4Q9ZA 2ZDTA 4M14A 4EWHA 4Y46A 3NRMA 3N4VA 5AUWA 4JBOA 2ZV2A 4IX5A 2PE0A 4O7LA 4RJ8A 3NUYA 5L2TA 3PVGA 5AUZA 3V5LA 2YCQA 4LRKA 4ERWA 2DWBA 3MIAA 3D5VA 1MUOA 1YHWA 4PL4A 4BTKA 3UO6A 5DIAA 1JKSA 2P4IA 3QYZA 2WNTA 1Y57A 3E63A 3C0IA 1W83A 3B2TA 4ACDA 3R22A 2WPAA 4RQVA 3D7TB 4AW5A 5DEYA 2B9JA 4J98A 3SXFA 3DK7A 3QUEA 2OH4A 4ANMA 3CTJA 4BF2A 3GNIB 2R3HA 4MWIA 1P4FA 2IN6A 4RGJA 4AT3A 3HA8A 4XG7A 1F0QA 3DAKA 4FSQA 4KSQA 2B9IA 3MW1A 5AR3A 4FODA 5CY3A 3AC1A 4BCHA 3KVXA 4F0GA 4EOJA 4LL0A 4C4IA 1REKA 2PVLA 5HBJA 1CKIA 5A9UA 2UVXA 4FKJA 2Y6MA 5IQIA 1R3CA 4BCQA 3VS4A 4RSSA 4F08A 3PG1A 4FG9A 5D11A 5J8IA 1U54A 4UALA 3KMWA 4NFMA 4YBKA 3TN8A 3ORKA 3UG2A 1SNUA 3WYXA 4YMJA 2VTQA 3G9LX 5E8YA 5A4QA 1UA2A 3U54A 4AX8A 3OY1A 4EHZA 3L8XA 4BWPA 3POZA 2OU7A 3C4WA 3IW6A 4O22A 4RG0A 4XG2A 1F3MC 2XNBA 1FGKA 4ZXTA 5J7HA 3S0OA 3EN6A 4MBJA 2QKRA 3NW6A 4BFMA 1QPCA 3LCTA 3R00A 4RA4A 4W4YA 4YLJA 4E4MA 4EHVA 1GIJA 4Z7HA 3ZRKA 2QODA 2QOCA 3EZVA 4U81A 2XIXA 4NT4A 5E8TA 4RX7A 4ZTHA 4AP7A 4YTFA 3UOLA 1BLXA 4KS8A 5AUVA 1H0WA 1XQZA 1TQMA 4C35A 4U5JA 5HG7A 4FTQA 5FTGA 2VGPA 4GUBA 5KO1A 4EOOA 5KMLA 3FZSA 4PF4A 4ZLOA 2C5NA 3DAEA 5HBHA 2ITNA 5M56A 2YM6A 3TI1A 2W4KA 3TZ9A 4EEVA 4FZAB 4DFBA 1KE6A 3LCOA 3IDBA 1B39A 4V04A 3UMWA 5AUUA 3OOGA 4A9TA 3CSVA 3DK6A 4UZDA 4CT1A 1DS5A 5B2LA 3RHKA 3KA0A 3OW4A 1YXUA 4LGHA 4YHTA 4FTRA 3V8SA 4AZWA 4LG4A 2B55A 3LQ8A 4QMNA 3R9RA 3H4JA 4D2SA 4ZS4A 5C26A 4ZLZA 2UZLA 4OTGA 3SOCA 5CF4A 5JFVA 4L67A 3AC8A 2EB3A 3TXOA 2QU6A 4TNBA 4Z55A 2YAAA 1SMHA 4BKZA 2HZNA 4IZ5A 3TG1A 2OK1A 2R3JA 1P2AA 3BI6A 3U87A 2VX0A 4IJPA 2FH9A 2XVDA 4K8AA 2JFMA 3JXWA 4NM0A 4EOPA 3BHTA 2ZB0A 4EYMA 3D2KA 5L8LA 1NA7A 3KL8A 4XX9A 4EOSA 3FHIA 4BVUA 3REPA 4CMUA 5AP7A 4GIIA 1PYXA 3OBGA 2W5AA 5CAPA 2Y6OA 3R1YA 4H3BA 4IHPA 2XK3A 1S9IA 4RC4A 4YP8A 3VW8A 3KRLA 4TWOA 4E5AX 4RJ5A 2UV2A 2XIKA 2I0EA 3F61A 4UWBA 1PJKA 3R73A 3QTRA 3KK9A 2XRUA 4MD9E 4IC7A 3PIZA 4RZWA 5I3OA 5HTIA 3WZJA 4MYGA 4MK0A 2VWXA 5FGKA 5KUPA 1DI8A 4YTHA 3DBDA 1OIUA 1PF8A 2G9XA 4I92A 4EBWA 1PXMA 1P14A 1H1WA 2VUWA 3COIA 5F4NA 4DINA 3DFAA 3FWQA 4HYHA 4UX9A 4GSBA 1M2PA 3TL8A 3GB2A 5TE0A 2WXVA 2SRCA 3AC4A 4YHFA 2GNIA 4D1XA 3EQBA 5KHXA 1J1BA 2R3GA 3ZSHA 2H6DA 2OZAB 2PU8A 4MQ2A 5IQCA 1H27A 5J9YA 1O6YA 4E5BA 1FVRA 5M4UA 4AW2A 3O8TA 3NVMB 2IWIA 4KIKA 4LOOA 2XP2A 3QKMA 4XHKB 3WF9A 4AN9A 2H34A 2QO9A 3MFSA 5ANDA 3OMVA 5FBOA 4BZNA 4C4HA 3HAMA 3QA8A 2Y8OA 4YTCA 4FIHA 4YURA 3ZFYA 1LEZA 3DV3A 3R8PA 3P78A 4M0ZA 4RWLA 4ID7A 3KEXA 3Q6UA 3O7LD 4U43A 1VYZA 2R0IA 3RK7A 1CDKA 4FV3A 4DG3E 4KSPA 2ACXA 2X0GA 2CGUA 3IW5A 3IOPA 3IO7A 4HNFA 4U44A 4D9UA 3QQFA 2BIYA 4IFCA 4C57A 4CTCA 4E26A 3QD2B 3VUKA 3QWKA 5ACKA 4C2VA 3IDCA 2WFYA 5C1QB 3P4KA 3SAYA 2YITA 3F3UA 2W5BA 3MY1A 3VUIA 4BKJA 3CTHA 3PJ8A 3HV3A 5CNNA 4CCBA 4U80A 2P33A 2WD1A 3KXHA 4K77A 4BCKA 3PA5A 4IW0A 5TF9A 4R6VA 3PA4A 2XCKA 3FYKX 4NW5A 4WA9A 4IZYA 4ZJVA 2ZVAA 2GTMA 3EHAA 4LFIA 4E3CA 1H1SA 5HLPA 3QQUA 5DT4A 3UMXA 4QMUA 3NSZA 3GOKA 3OROA 2VWUA 3P7BA 5IQFA 3PXYA 2VRXA 5DYJA 1SVGA 2GS7A 5A3XA 2OXDA 3PXFA 3UC4A 3M1SA 3FMEA 3CIKA 3MJ1A 4HYUA 3UDBA 5CF8A 3LMIA 4FE2A 2EXEA 1ERKA 3DLZA 4FKGA 4G1WA 2UVYA 4NTSA 3W18A 3CC6A 2XKEA 2C5XA 2HY0A 3VHKA 5FDXA 4NWMA 4AA5A 3A99A 4B6LA 4XYFA 4FTLA 1M7QA 5LVOA 4YHJA 4BN1A 3ACJA 4PTCA 5DR2A 5L4QA 2IVTA 4FKIA 2PY3A 3I7BA 2IW9A 5T6KA 4FV0A 4Y95A 3WZDA 2XNNA 3MTLA 4WOVA 3LJ2A 4CMTA 2C1BA 1PXJA 4M69B 3TNPC 3C1XA 3U4UA 3Q9XA 4QOXA 4RQKA 3ZLWA 3WE4A 5GINE 3O0GA 4G6NA 4DBNA 1OZ1A 4MH7A 4JI9A 4FOCA 1J3HA 1P4OA 4ASEA 3JPVA 3W2CA 1PXKA 4J52A 4A9RA 4YPSA 1OL1A 1IRKA 1K9AA 4JX3A 3QRJA 4ACCA 4F7SA 4CRLA 1V0BA 1Y6BA 4AE9A 1M2QA 1MQ4A 3DXPA 3UOHA 5KMIA 5HU9A 3TNIA 2YABA 2XKDA 3R8MA 3GU6A 3VVHA 4CKRA 2Y4IC 3TTIA 3PXKA 5DI1A 5HE1A 4XLVA 3UTOA 2HAKA 2HOGA 4KKGA 4WG5A 3NIZA 4D2VA 3TM0A 3CKWA 3R21A 4XBRA 4EH4A 4O0UA 4D4SA 4RIXB 2DYLA 2V62A 4IB0A 4DYMA 2J7TA 3KCFA 4DT9A 2VTJA 3DZOA 2WGJA 3DS6A 3I81A 3KKVA 3ULIA 3TUBA 4X2NA 4ZTNA 4ZSJA 1PY5A 3D9VA 1GNGA 3FMHA 2R64A 4FGBA 4M3QA 4QP9A 2ITOA 5ETFA 4CZTA 4F1TA 3RALA 1WVYA 1H1QA 2C6EA 5CVGA 1NT2A 3GU8A 3VRYA 4UMPA 2W17A 4F64A 5E8ZA 4IIRA 3W2SA 4U8ZA 4N57A 4BI0A 4DTAA 3FZTA 1OL5A 3KMUA 1PYEA 4E20A 4EH3A 3KB7A 1CM8A 2C6MA 4IWQA 4ANQA 2A27A 2WEVA 3DBQA 4IB5A 2PMOX 3QQLA 3QKLA 3RPVA 5A4EA 3CQWA 4YNOA 4FTAA 2FA2A 3CCNA 3IW8A 3LXNA 3A7GA 5BX0A 4W8DA 3UBDA 4IX4A 3FI4A 3EOCA 2BRGA 1PXPA 2R7BA 4N6YA 1T45A 3UNJA 4XJ0A 4BCGA 5J79A 2UZOA 3KY2A 5L2SA 5C8NA 2X7GA 2BRMA 3FZOA 4IX6A 3R7IA 2IG7A 3OW3A 4PRJA 4CFMA 5I9YA 4DCAA 1NY3A 3QL8A 1DI9A 3PZHA 4O7RA 3PRFA 4MKCA 4BY9E 4Y8DA 4LOQA 3CD8A 1FPUA 3TIYA 5GZAA 3LOKA 2PUNA 3PSDA 3C0GA 3GUBA 4OAVB 1B38A 4RFYA 4DH8A 2OFUA 3QRTA 3R8LA 3UNZA 4IANA 3LFQA 4EK8A 2CKOA 4V0GB 2J51A 4AT5A 2C68A 5IH4A 3AD5A 3GCVA 4QT1A 3ZRMA 3L9PA 4FV2A 1IASA 3GI3A 5JGBA 1VR2A 3Q2JA 4H36A 3H0YA 4V01A 3R83A 2I6LA 3AT4A 3FYJX 3I1AA 5EI8A 3ZYAA 4C0TA 2A0CX 4YTIA 4HW7A 1FBNA 1ZARA 5CT0A 1UNLA 4EUTA 4TYHB 3G0FA 4FZ7A 4XEYA 1Q3WA 2UW8A 3ZSGA 3LMHA 3A8XA 3AOXA 1BI8A 3NNVA 4DLJA 5IMEA 4U0IA 5KKRB 3QALE 1G8SA 3QCSA 4KRCA 2BUJA 3SKCA 3F3TA 3R7GA 4BICA 2J4ZA 4FSWA 4R3CA 2F7XE 5M4FA 4AU8A 1YDTE 3FLSA 3OWJA 4NSTA 4DLIA 1QCFA 2F7EE 4RLLA 4GJ3A 5ANEA 2WQNA 3MPMA 2ZV7A 4CFNA 4G5PA 4RFZA 5C9CA 4I6BA 4EWQA 4GFMA 4IZAA 5IQGA 3KVWA 3ORZA 2BAKA 4FIGA 4FNXA 3W8QA 3DOGA 5CF5A 3ID6C 2JLDA 3LXPA 3FXZA 2I40A 2Z7RA 3E3PA 5C27A 2WTJA 2RGPA 3E7VA 1SNXA 4C8BA 4FL1A 4BI2A 5EH0A 4O0RA 3CQUA 2VO0A 3OXTA 3OTVA 5HZNA 3PP0A 2EWAA 5I9UA 4ZSEA 3ODZX 3QC9A 3VUDA 2NRUA 3WILA 2GNJA 4YJVA 4IM0A 5E91A 3KXGA 3QC4A 4FKPA 4GRBA 4BCJA 4FMQA 3MPTA 2PZPA 2F4JA
chains in the Genus database with same CATH superfamily
1IG1A 2CDZA 2F9GA 3TKHA 4CNHA 3HAVA 5HNGA 4R77A 3I0OA 3W10A 4AWIA 3OD6X 2R3OA 4ZY6A 4PNKA 2BIKB 3NNWA 4C3FA 4EHEA 2UZEA 3R02A 3R71A 4ASZA 5DMZA 1V0PA 3MA6A 4H1JA 2OBJA 5H8BA 3HX4A 3ZTXA 2YERA 4FTOA 4FEVA 3PY3A 1U54B 4CFFA 4R1YA 2BILB 4CMOA 4DGGA 3SG8A 4WNMA 2F2UA 2F66B 1BKXA 4BWKA 4UZHA 4RIOA 3GBZA 3JS2A 1ZRZA 2QURA 3QQKA 5LMKA 2FUG1 5EFQA 3W8LA 1Q4LA 2JKOA 2J0MB 2Z60A 4X21A 4C59A 3QFVA 3T9IA 4ZMEA 4DEIA 5L2WA 2PULA 4EH9A 2OGVA 2H9VA 4NV2A 3SC1A 4FA2A 5CI7A 4HPUE 1IAJA 4MUQA 3HV4A 2J0LA 4K11A 3FI3A 1F5QA 1L8TA 5FD2A 1GIHA 2OF4A 5CQWA 2VO7A 3VAPA 5DVRA 2ZMDA 2UW9A 3JSBA 2WTKC 3D5WA 2O3PA 3M42A 4XOZA 1VYWA 2RFEA 4DCEA 4CFXA 1MQBA 1GZOA 2WMTA 3AG9A 4EBVA 4QD6A 4HCVA 2RL5A 4KKEA 4FTMA 3AKJA 4L46A 4ANSA 1Q3DA 3C9WA 3ET7A 5KKRC 5G6VA 2XNOA 3UP7A 4AOTA 5LQFA 4GL9A 3CKXA 5C8KA 3W55A 4QP7A 1VZOA 3QHWA 5CU4A 2WOTA 3FPQA 4F09A 3ZXZA 5HO6A 3M11A 2ZB1A 5L2IA 4M84A 5GZ8A 3DB8A 1Z5MA 3Q5ZA 4LGGA 5IPJA 3QQJA 5CS6A 1CTPE 3JVSA 4ZEGA 1Y91A 4RWJA 3UC3A 3FXWA 3ZBFA 3TYKA 3QX2A 3MB6A 3AD6A 4JG8A 2VTMA 2JD5A 4LOPA 3L1SA 3E8CA 3VHEA 3UNKA 4JVGA 2NO3A 2R9SA 5CSHA 1H0VA 4RT7A 3FE3A 5K0XA 2DS1A 2YM8A 1PXOA 4A9YA 4BTJA 1PKDA 3H10A 3ORMA 3UIBA 4BBEA 2R3QA 5DGZA 4BHNA 2ZAZA 4IACA 5J7BA 4OBQA 4MVFA 2J9MA 3UQFA 3OY3A 4TRLA 2O64A 4F6SA 2VWWA 3VS5A 2DQ7X 4GUEA 2IZSA 3HP5A 3DT1A 2PE2A 1YXTA 1YW2A 2YA9A 4YZMA 5LWMA 2I0HA 2BZIB 3O96A 2JBPA 4BR3A 4BRXA 2IZRA 4DGMA 2WMAA 2FSMX 5I4NA 4H05A 5IQBA 1URWA 5LWNA 3SQQA 3ZH8A 2XIRA 4F70A 5A46A 5ANGA 2C30A 3EYHA 3KF7A 5T68A 4AS2A 2XJ0A 3E8EA 3KGAA 3NEWA 4D5KA 4BIBA 4OUCA 3QTIA 4MD8E 5FM2A 4KIKB 3R9NA 2OI4X 3ZU7A 3LM0A 2XK6A 5JMSA 3RJCA 4AA0A 4D9TA 4EZ7A 4NW6A 1XMLA 4C02A 2PVMA 4QPSA 4P4CA 4ZZMA 4X2JA 4XG6A 2PMIA 2ITYA 1H1PA 4NTTA 1XH5A 1QPJA 2QLUA 4M12A 2VTLA 4QQCA 2CMWA 4FUYA 3C13A 5E92A 3COKA 3EB0A 4PL5A 3BEGA 4MNEA 2GNLA 3EN4A 3AXWA 4DH7A 3P86A 3EQGA 4FK6A 4Y73A 2V7OA 4LMNA 2O5KA 4IXPA 4LMUA 3HRBA 3F5UA 1T46A 3SW4A 5F9EA 1J7LA 4RVKA 2V5QA 5DR9A 4GFOA 2A2DA 5CU3A 4M0YA 1W0XC 3PIXA 4FTIA 4I23A 3DKFA 4XUFA 5HIDA 2GCDA 5AWMA 2QOFA 3DGKA 3RNIA 2PZRA 4S33A 5KBRA 1JAMA 2Z2WA 1K2PA 4G34A 2W06A 3BPRA 3I7CA 3A7IA 3LVPA 3CJFA 3PY1A 4A4OA 4I0TA 5CEMA 1QMZA 5K4IA 3EN9A 1TDPA 2C3JA 4PPBA 2CNUA 1U46A 2VTSA 1UU9A 4H1MA 3CPCA 5BVNA 4NFNA 4O4FA 5AP4A 5AR7A 5B2MA 4JQ7A 4RPVA 4M66A 3DJ5A 3E62A 5JN2A 3OTUA 3NUAA 5BVFA 2W1IA 2XIYA 3SGCA 5KNJA 4K2RA 1OITA 2C6OA 3E88A 3V8TA 1JOWB 5GJGA 2G2IA 4QTDA 3FMMA 2PVJA 4QMZA 2G15A 3NWWA 3SRVA 1CSNA 3U6JA 4FJVA 3Q04A 4RVTA 5AR2A 4FL2A 5CSVA 3RZFA 4QMSA 2XTRA 4J8MA 4UXQA 4QMMA 1PRYA 4GG5A 3UG1A 4FTKA 5E9EA 4JQEA 5EKNA 5EYMA 3H9FA 4HYIA 2YIYA 3D94A 3PSBA 3TZMA 2PZYA 2JAMA 4YLKA 5CAVA 2PE1A 4QMLA 5H9BA 1OVEA 2YDKA 4XV2A 2VWBA 5IISA 4G6LA 3COMA 3H30A 3A60A 4N0SA 2GQSA 5H8GA 1JSUA 4QMVA 4F7JA 5CEKA 4WG3A 2FGIA 5L6PA 3B8RA 1IA8A 3RCDA 3RAKA 5AP1A 5IQAA 5J9ZA 4QP3A 4FKQA 5BUEA 3S00A 3QRKA 5I9ZA 5C01A 4O86A 4ACMA 4XRJA 4FTJA 4IH8A 5GJDA 3O71A 4UWYA 4AF3A 5EKOA 3S1HA 3E5AA 2XYNA 4OLIA 3MJ2A 2BDFA 3ANQA 2OF2A 3GC0A 5IH5A 2C3LA 4QTAA 3CGFA 3PWYA 2RFNA 4I5MA 1VEBA 4E6AA 4L9IA 3W0MA 4WBBB 4DA5A 4QDEA 5E1SA 4MXAA 5EDPA 3BWFA 2VD5A 3EQDA 4JS8A 2XH5A 3R9OA 4M97A 3G5DA 3SVVA 4O4BB 3SXSA 3TTJA 2I1MA 4O96A 5E8WA 5FTOA 3Q4CA 3U4WA 4FICA 3IK3A 2FSTX 4TXCA 5CZHA 4XV1A 2XIZA 4QMQA 3W2QA 1BL7A 4IADA 5AUTA 4BGHA 2F57A 5JEBA 1JQHA 1Z9XA 4UB7A 3PLAE 5EW8A 4FTNA 3TACA 3UIMA 2OH0E 3JY0A 2WB8A 3ZC6A 5C03A 3FMDA 3TT0A 3TDVA 3S2PA 5LJJA 1H8FA 3TKUA 3FHRA 4FVQA 1GY3A 4JG7A 3DNDA 3V6RA 4BDDA 5HGIA 2JEDA 3HECA 2PTKA 4JQ8A 4APPA 5HVJA 2V6EA 3VO3A 4HOKA 3HYHA 3LFAA 4JRNA 4CVAA 4QQTA 2BVAA 1OL6A 5FXRA 1G3NA 1SVEA 3QTWA 5CZIA 3P7AA 5HD4A 4EJNA 4M15A 4F9YA 3NYVA 3UQCA 4ZZNA 3C4EA 3TNHA 3OCTA 2OW3A 4BJJB 2BZJA 5CWZA 5J1WA 2C69A 4OTRA 1WFCA 4XG9A 3VS6A 4EJ7A 4EOLA 2J0JA 4PTEA 2B53A 4RVLA 3QA0A 3BGQA 3DQWA 3QHRA 4OW8A 4QYYA 4F65A 1O6KA 1PMVA 3IGGA 5HBEA 3FQHA 3MVHA 3ORTA 3RPSA 3IAM1 3SV0A 4PX6A 3R1SA 5CAQA 3NYNA 4KIPA 3RP9A 4A06A 2ITZA 1APME 5HORA 2J6MA 3KIOC 1JWHA 3WBLA 4E8AA 4R1VA 3TZ8A 1U5QA 2YISA 2XEYA 3A8WA 5DT3A 2UW5A 4D4RA 5CEPA 3MPAA 2OJFE 2OIQA 4MF0A 3VA9A 4U6RA 3S3IA 1LP4A 2VZ6A 4C33A 5HCZA 4R5YA 3W2OA 4J8NA 3OUKA 4GIHA 3TV6A 4BCNA 3ZLSA 2OXXA 3LXKA 3VQHA 1ZXEA 2BALA 5F1ZA 3W1FA 3DAJA 4JX7A 1H26A 5DHJA 4GT5A 2V1CC 3C5UA 3NX8A 3E64A 1FMKA 3P5KA 3AGMA 3KXXA 1JVPP 2JAVA 3NR9A 5IA1A 2WELA 3RGFA 4IWPA 5J95A 5IEYA 2AQXA 4GFGA 3HMOA 4D1ZA 5CAUA 4NU1A 4BGQA 3U6IA 3N4TA 3EL8A 2CNVA 4O1OA 1YHSA 3Q60A 3ZUVA 4QTEA 1Q8WA 4DHFA 3L8PA 5J1VA 3TNQB 3UYSA 3LFBA 4TYJA 4AE6A 3D0EA 4GVAA 4XP2A 3ORLA 1XH7A 3HV5A 4HJOA 2CPKE 4EC8A 3FPMA 4O38A 1W2FA 3WIGA 2ZM1A 3UZRA 3AMBA 4D4VA 3VBTA 4F9CA 1O6LA 1OB3A 2O8YA 3KU2A 1W3SA 2WMVA 5JFSA 4F63A 4Z3VA 4KD1A 1O9UA 4LM5A 4GU9A 2W4OA 2WZJA 3BBTB 4K33A 3V6SA 3NYOA 4MTAA 4PDPA 4PUZA 3RM7A 3VBWA 5JQ8A 1OKVA 3W0SA 1JSTA 2PZIA 3LZBA 4K0YA 2BTRA 4EH5A 1B6CB 2Y0AA 3FC2A 4AT4A 3FUPA 4TL0A 1XO2B 3EWHA 4Z16A 4YZNA 4FF8A 4BB4A 1FQ1B 4BCIA 1W82A 2WMXA 1LR4A 4DFLA 1WBOA 3A2CA 1YVJA 1HCKA 3G0EA 2I7QA 3KRXA 4KAOA 1M7NA 2VX1A 5EW3A 4U3ZA 4FOBA 1Q62A 4F1MA 3BKBA 4C61A 4L52A 2C5VA 5CEOA 5LNK1 5M09A 4UMUA 1P5EA 4ZLYA 5AA9A 5IMXA 3CE3A 3KRWA 3ATTA 1GJOA 2ZRRA 4LUDA 5KZ0A 1XBBA 5HE0A 4XBUA 3BYOA 3LJ1A 4BTMA 2QO2A 1OECA 3R0TA 4OBPA 4O4EA 3QKKA 4WT6A 4E4NA 3K3IA 5ANOA 4Q9SA 4G9RA 1OI9A 2OIBA 4YJRA 2QC6A 5AIKA 5EDQA 5CENA 1PMEA 4YPDA 3EMGA 3BU3A 2VTTA 4F7LA 3ATSA 2IJMA 3BGZA 2PPQA 3NAXA 5ANIA 3AC5A 1JLUE 4GKIA 3R7OA 4F99A 2ITWA 4QYGA 2B7AA 1H28A 2JBOA 2QR8A 4R8QA 3OXIA 4A9UA 3LLTA 1W2DA 3H3CA 4L42A 2QZGA 1OIYA 4O0SA 2AC3A 4BZDA 2WEIA 3DKGA 2GU8A 1ZMWA 3D4QA 5ITAA 5HIEA 5I5ZA 2FSOX 2XRWA 1WBSA 4IDTA 3F4MA 2QOKA 2PUUA 2HIWA 2YCRA 4RC3A 5EM8A 5HVKA 2CGVA 4F9BA 3BX5A 3RPOA 3MIYA 2R0UA 4ZP5A 2VGOA 3VNTA 4ZZOA 5CU0A 4G31A 4L43A 3V04A 4AFEA 5JZJA 2VTOA 3ZO2A 3QCQA 1R39A 4PDOA 5HIBA 4W9XA 2HWPA 4PMPA 1IR3A 2W4JA 2X6DA 3QZHA 3SD0A 3GCSA 1YWVA 1FVTA 2QU5A 4FEXA 3F2RA 3F9NA 3EQRA 3MSSA 1WZYA 2ONLA 4UWCA 4XG4A 3JYAA 2Y9QA 4Y83A 5I9VA 1IEPA 4ZTQA 3UPXA 2PMNX 2YFBA 5DWRA 1YHVA 2RIOA 3DCVA 5A6NA 5D10A 1ZY5A 2XAMA 5IUIA 3RAWA 2R3MA 4KINA 1M14A 1STCE 4OAUC 4UYNA 2JIUA 4WHZA 2QOIA 4IE9A 3P0MA 4RLKA 4I5HA 3DTCA 3G90X 2CAZB 5FLFA 4IAFA 2VTIA 4BDAA 2B0QA 5JK3A 4XP3A 2PVKA 1LEWA 1XJDA 3IQ7A 4ENYA 4DF3A 3JVRA 4S32A 4RIYA 3HUCA 3KRRA 4RA5A 3I0QA 3MH1A 4G76A 4G17A 3SX9A 4MNEB 3ZC5A 4CTBA 4DG2E 3PA3A 4QMXA 3UJGA 2OIDA 3PXZA 1H08A 5DT0A 1J7IA 1E1VA 3GFEA 3VUGA 1KE7A 4BDEA 4C62A 2W05A 3NUUA 4TWCA 2CNQA 2YIXA 2QR7A 3ZFXA 1YDSE 4ONAA 4MXZA 3LIJA 3BLQA 4YU2A 5BQ0A 5KHWA 2YZAA 4DDGA 4AGWA 4FNWA 4O0XA 1JNKA 3ZDUA 3MESA 3UDZA 4AZTA 5TR6A 4NCTC 1ZMUA 3TUDA 1BI7A 3R30A 2WOUA 5GNKA 1XH4A 1FINA 3NPCA 4L3LA 5FEQA 2VV9A 4O2PA 3UIXA 1RQQA 4FT5A 4FNYA 2HCKA 4HNIA 5E8XA 4BBMA 3HRCA 4XMOA 5HNBA 3FXXA 3UGCA 4QMOA 4AXAA 3SLSA 1BL6A 3G6HA 1OUYA 2HY81 4AZEA 3FV8A 3N51A 3BLAA 3QZGA 4FG8A 2BDWA 3PSCA 4K1BA 3AC3A 4BYJA 4CSVA 5A14A 2WTDA 4AXFA 2E9VA 5HLWA 3FDNA 4FKTA 2GHLA 4G2FA 3SRVB 4QNAA 2EXMA 4I0SA 5ACBC 5AV3A 4AGCA 2ITPA 4FT3A 2FYSA 4NKSA 4D4YA 4WNKA 3QQGA 3EH9A 1WAKA 4JDKA 3QTZA 3B55A 3I5ZA 4OTWA 3GP0A 1BX6A 1Q8UA 3PJ3A 5BVWA 1XBCA 2EUFB 4K9YA 3UZPA 4EKLA 4FRFA 4EOIA 2CJMA 4MXOA 4NKAA 4CD0A 1ZYCA 3BV3A 2JGZA 4NJDA 4D28A 4RRVA 3ALNA 4USDA 3EQPA 3H9RA 2BRHA 3RI1A 2W7XA 3SHEA 1W98A 4IFGA 4JR3A 4Q2AA 2X0OA 3CEKA 4FX3A 4X3JA 5DPVA 3T3UA 3Q2MA 3DTWA 4N6ZA 3G51A 1DAYA 4OR5A 3WOWA 3RNYA 3LLAA 3MH0A 3BL9A 2E9NA 4IWOA 3LKMA 4IAAA 4ENXA 3PIYA 4J1RA 2FB8A 1ZMVA 3OP5A 4BDHA 4XG8A 4CZYB 3EKNA 3PVWA 2LGCA 4LRJA 1BMKA 2YDIA 3PYYA 2JC6A 3DXNA 3QD0A 4I6QA 2HZ4A 3G33A 4O7YA 2JITA 3TIZA 2BDJA 2A4LA 4M67A 2JKMA 3GT8A 4HPTE 4YZCA 3UPZA 3Q4UA 4R5SA 3ZO3A 4MXYA 4MEDA 1YXSA 2NPQA 3NVKI 1XBAA 3Q4TA 1I44A 1Q8YA 1ZY4A 3AMAA 3MFUA 3QTUA 3QAME 1YI4A 3VS7A 4J95A 4DEEA 3U8WA 2WIPA 1GIIA 1OGUA 2R3IA 3ZRLA 3FMKA 5L2QA 4JIAA 4LUEA 4IAKA 4HVIA 4Y5HA 3ALOA 3PTGA 2BHEA 3WIKA 4KABA 5LOHA 3WF8A 5L6OA 1SVHA 5J5SA 4UBAA 3F66A 4UN0C 3W16A 2PMLX 2UW6A 1FGIA 2BCJA 2OJ9A 4G3FA 3ZFMA 4D0WA 4BWXA 3OC1A 5IA2A 1S9JA 2XF0A 3GC9A 4CT2A 4AZFA 5BYYA 3CS9A 1A9UA 3P9JA 3R7EA 3QYWA 4EQMA 4EKKA 3HKOA 4I5PA 3HL7A 4FV6A 2IVVA 2UZWE 4OTIA 4I0RA 4UMQA 4O0TA 5FWKK 2XM9A 4U9AA 4L3PA 2C6DA 5DBXA 3VULA 4O6LA 3ZO4A 1OUKA 3F2NA 3HVCA 5AR4A 4XV3A 3LFSA 4O7NA 3OXZA 4X2GA 2YFXA 2QI8A 2WMWA 3ORIA 4JAJA 4DGOA 4AW0A 4B8LA 4ANOA 4BDJA 2YIWA 4GU6A 4QP1A 5J9LA 4KBAA 2C5YA 4YC8A 4FEQA 4PMTA 5M53A 3EL7A 3MTFA 3CY2A 4XG3A 4F6WA 2OZOA 2X1NA 5IQDA 2NP8A 3OHTA 3UVPA 1EH4A 2OJGA 1HOWA 1R0EA 5HX8A 4RWIA 3C4ZA 4GS6A 4NEUA 4DFNA 1W7HA 3AGLA 3FAAA 4QTCA 3A7JA 4JDHA 4QMTA 2XBJA 4L45A 4E7WA 1JKTA 4GYGA 2XUUA 3GC7A 3HLLA 3I4BA 3NW5A 3LHJA 5CEQA 2XK7A 4TWNA 3Q8DA 2JIVA 4U79A 2PK9A 3JUHA 4IC8A 4RWKA 3BHHA 5FXSA 2GPHA 1ZZ2A 4D5HA 3GOPA 4IB1A 3NUSA 3KP9A 4WO5A 5HHWA 3UOKA 3VUTA 3CP9A 4IM3A 5CYIA 4L3JA 3CY3A 3RBWA 3C51A 4CKJA 3KULA 4WIHA 5BVDA 3W2PA 3HV7A 3LJ0A 1JBPE 2F2CB 5CU2A 3Q52A 4I3ZA 3WE8A 3MVMA 4BL1A 2VTRA 3RHXA 1RE8A 3QCYA 2CN8A 3ZS5A 4Q9VA 3NCGA 2FUMA 4KRDA 4G3GA 3U9NA 3ZEPA 2B9HA 3VS3A 4DH1A 5M44A 1UKHA 5K5NA 3S95A 5BNJA 5E7RA 3ACKA 2YWPA 2JFLA 3CBLA 2Z8CA 5J87A 2DUVA 5BUIA 4QYEA 5B0XA 3NMUF 2B1PA 4M8TA 2J2IB 5IA3A 4X7QA 4NYEA 1ST0A 4XRLA 4I22A 5EDRA 4FKWA 2ZMCA 3RPRA 1Y8GA 2PZ5A 3VF9A 5JFXA 3N9XA 4E6DA 4O6EA 1WMKA 2CN5A 4G9CA 2UZNA 2JDSA 2OO8X 3F3VA 2CGWA 4KBKA 5HU3A 4L00A 1OKWA 3BU6A 3I6WA 2NRYA 2OJIA 3BLHA 3F5GA 3QRUA 3ZONA 5BVOA 3MN3A 4FKSA 3FMLA 2QD9A 3Q96A 3QU0A 4LI5A 3OVVA 5LCJA 1XHAA 4FTCA 3O51A 3RMFA 3TWJA 3DNEA 1QL6A 4YJNA 5CSXA 3UVRA 4YJOA 5IUGA 2YIRA 4L53A 2V55A 3F5PA 4IMYA 5AIRA 5EYCA 4KNBA 1WVWA 2O65A 1E1XA 3EKKA 4ITIA 1XKKA 4MQ1A 4W4XA 2PYWA 4X6RA 1NW1A 4NM5A 4WBOA 3EN7A 4PDSA 5FTQA 3ZZWA 4B4LA 2YN8A 5IA5A 4F6UA 5JRSA 4DGNA 2WTWA 4FIFA 1PXIA 4O7VA 4UXLA 3V5WA 2PVHA 3C50A 3OEZA 5EYKA 3ENMA 2ZM3A 5AP5A 3VWAA 3H0ZA 4PWNA 4EOMA 5AAGA 4FKRA 5C4KA 4HCUA 3GGFA 4YC3A 3R7YA 3FL4A 4EONA 2C4GA 3V51A 3EFLA 4GV1A 2CCHA 4R7IA 4AQCA 1JKKA 2CSNA 2XNMA 4CKIA 5BYZA 3BELA 4K6ZA 4NK9A 4AGUA 3N4UA 5I9XA 1OMWA 2BFYA 2QOQA 4LV8A 4B9DA 4WKQA 3I5NA 1ZOHA 4A7CA 4D2TA 2YZLA 3IDPA 3BL7A 2IP6A 1PHKA 2E9OA 2H96A 3HGKA 2B9FA 3ZZEA 5JH6A 4CFWA 2RKUA 5IU2A 4GKHA 2F6MB 3EFKA 4FSNA 4OTQA 3DZQA 1H1RA 5EQEA 1FOTA 3OZ6A 1Q97A 1SJ8A 4RIWA 4WSQA 4A4XA 2BRBA 4U97A 5EI6A 2VTPA 4DH3A 3IGOA 4AACA 3W0PA 1RJBA 3GCQA 3VJNA 2NYAA 4UEUA 4YGAA 5FBNC 4TNDA 2AYPA 4TYIA 1OPLA 3SOAA 4O7TA 5FDPA 4UMRA 5M07A 1UVRA 3QGYA 5DH3A 4AZVA 2BAQA 4C58A 5JT2A 5EM5A 2JDVA 1XH8A 3FLWA 3MYGA 2OLCA 4D2RA 4W4VA 5EQYA 4CFVA 4NIFA 1UWHA 3R2BA 4BDIA 3MH3A 4I20A 4R7HA 5M4IA 3F3ZA 2WTCA 3VBQA 5LXMA 5E4HA 2CKEA 2O0UA 1H25A 1KV2A 4IEBA 4OTHA 4L8MA 3I9V1 1DM2A 3R6XA 3QCXA 4F9AA 4DHJA 2UZDA 3PXQA 4FYOA 3EN5A 2W1GA 2R7IA 3MDYA 3P08A 4ZTSA 3DQXA 3P7CA 3Q9ZA 2ITXA 1ZOEA 3R8ZA 2JB2A 3Q6WA 3FJQE 5ANJA 1GZ8A 2R3FA 3Q32A 5HICA 3VBVA 4EZ3A 5IKWA 5M51A 5ETCA 3V01A 2EXCX 5CXZA 4QP8A 4E6CA 4RFMA 2OG8A 5HKMA 5B2KA 4N70A 2VO6A 1WBNA 4C4GA 4LV5A 3QF9A 3HZTA 2XNEA 3KF4A 4O4CA 3G6GA 3L9MA 4FV1A 3ZM4A 1OKZA 3DPKA 4Y85A 5AP0A 3ANRA 3KK8A 4P90A 2J90A 4C4EA 5CI6A 2OWBA 4E1ZA 3OT8A 3OWKA 4AOJA 3FL5A 5BUJA 4RIYB 2PVRA 3PVBA 2UW3A 4PPCA 4ZJIA 5BVKA 1H00A 4WD5A 4FC0A 5ETIA 4KB8A 3O7LB 2BROA 2HW7A 3MFRA 4QO9A 4V05A 3WZEA 5FUTA 4RJ3A 3C5IA 5AM6A 4CFUA 4L68A 3HMNA 2ZOQA 1KOBA 1M2RA 3C0HA 1PMUA 1WCCA 2X81A 3POOA 4FTTA 4BIDA 3WF5A 2GDOA 2FEFA 2JBWA 5I9WA 4FG7A 2PVYA 3TV7A 3DA6A 5BYLA 2QNJA 4NL0A 4O7ZA 2W96B 3T8OA 4JXFA 4O1PA 4QYFA 1JQOA 3SXRA 4J97A 4BDGA 4FI1A 4LGDA 2R4BA 3VBYA 3ZOSA 2XNPA 4L44A 2WQEA 3QD3A 3LFEA 4MBLA 5HO7A 5E8VA 5D41A 2PVFA 2XNGA 3A4PA 4FVPA 4EHGA 1BYGA 3ZMMA 4FL3A 2VTHA 4O4DA 5DRBA 3PJ1A 2RADA 3ZXTA 2X9FA 5ANKA 5FP5A 4YZBA 3FQSA 4AS0A 2UW4A 5TKDA 4C4FA 3NUXA 4NH1A 4BI1A 2YHVA 5HESA 2BHHA 3FKLA 2QOLA 4GK3A 1KOAA 4FV7A 1YI3A 5AP6A 3QQHA 2XBAA 3O2MA 4BC6A 4DEDA 4GXTA 4BDKA 2WO6A 1G5SA 2P2HA 2WMSA 3W0OA 1WBVA 3HRFA 2VWIA 2J5FA 3BWJA 3F7ZA 3D2IA 5C8MA 4BDCA 4FT9A 4IVDA 3TEIA 2XKFA 4DHIB 4DG0E 3FNBA 5L8KA 1Q99A 4XNEA 3FMJA 3GCUA 4FR4A 5LARA 2ZM4A 5AM7A 4BIEA 4IZ7A 3K3JA 2C3IB 2RSVA 5F95A 4RMZA 5BMSA 2XJ1A 4E4XA 5DG5A 4EYJA 3FBVA 5DLSA 2A1AB 4BBFA 1UU7A 3O8UA 5HLNA 4S30A 4GMYA 5EM6A 5EHLA 2XMYA 4ZK5A 4WSYA 3TMOA 4L7FA 3TZ7A 4JRVA 3ITZA 3LW0A 3DK3A 3DKOA 1MRVA 4GYIA 3IOKA 3PFYA 4DFYA 4ASXA 5AUXA 4ZAUA 1UNGA 4GEOA 3QBNA 3V5TA 4DBXA 4JCVE 3MWUA 2BRNA 3NUNA 4Q5EA 2GS6A 3VBXA 4EI4A 3EFJA 2WQBA 2OJJA 4IX3A 4PP9A 4TTHB 5D7AA 3R9HA 4APCA 4BGGA 4BZOA 4C2WA 4CG8A 1W8CA 3BGPA 3CR0A 3CJGA 3LCKA 2LAVA 4NV5A 3P1AA 2OICA 4R7BA 1WBTA 4I94A 2UZUE 2VWVA 5ETAA 3GCPA 3D14A 3L9LA 2YM5A 5EK7A 5FEEA 1Y8YA 5HE2A 5M57A 1TFFA 1Y6AA 3AT2A 1ZYLA 1YKRA 3OOMA 3Q9WA 4PMSA 4U3YA 1Q61A 1ZYDA 1V0OA 2C3KA 4W9WA 5IUHA 3W0NA 5HX6A 3AC2A 3NNUA 4FIIA 5D1JA 5CVFA 4FEUA 1NVQA 2BMCA 2E9UA 3A62A 3EQCA 5M06A 3PRIA 5HG8A 4OTDA 2HELA 2IZUA 2X7OA 3CTQA 4H39A 4QMPA 4G6OA 5CLPA 5L3AA 2Z7QA 2ZFYA 4UMTA 2RG5A 4M13A 4DTBA 4RJ7A 3DBFA 3FSKA 5IZFA 5E8UA 3B2WA 4YJQA 4RVMA 4DDIA 3A61A 3LPBA 4X0MA 4AG8A 3GENA 3R04A 4J99A 2XKCA 4D2PA 4TT7A 4LV7A 4FSYA 2G2HA 2QOHA 3VUMA 3VN9A 5CSWA 4GT4A 1ND4A 2KULA 1XMMA 1J1CA 5AP2A 1GZNA 3V8WA 4DFZE 3I79A 4DTKA 3QLFA 2OFVA 4DEGA 2RFDA 4W4WA 3R9DA 5TO8A 4ZY5A 5M4CA 2JDOA 4TY1A 3MH2A 4GK2A 3PPZA 5GZ9A 3R28A 1NXKA 2GS2A 2VO3A 4MCVA 2Z02A 4O83A 2QCSA 3RZBA 4F1OA 3BQRA 4QP6A 4FV5A 1WBWA 4O81A 3UVQA 5LVMA 4E5WA 1OPJA 2PWLA 3BCEA 3F6XA 3PE2A 3FQEA 5AV0A 1MRYA 5E1EA 5EI2A 4ZS0A 3ORPA 4FEWA 3I6UA 5FEDA 2X9EA 3NIEA 3W32A 2ITUA 3HMIA 4Q5HA 3L8VA 1TZDA 3TKIA 3AQVA 4USFA 4DFUA 2RF9A 2X7FA 3MS9A 4EQUA 4DEBA 1H24A 2B4SB 2ESMA 2HXQA 4U7ZA 5L8JA 4N4SA 5HQ0A 1LUFA 2R5TA 4D58A 2BR1A 4PV0A 5IG1A 5LMBA 4NUSA 4ZIM