3LJ1A

Ire1 complexed with cdk1/2 inhibitor iii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
404
Chain Sequence
b'NFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQFRTSGWRAPELLEESNNLQTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase/endoribonuclease IRE1
publication title Flavonol activation defines an unanticipated ligand-binding site in the kinase-RNase domain of IRE1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase
total genus 107
structure length 404
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06479 Ribonuc_2-5A Ribonuclease 2-5A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lj1A02
1.20.1440.180 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3lj1A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lj1A01
4AW2A 3TJDA 1H1RA 4FZ7A 4YZDA 4QMYA 3A99A 3HV5A 3GI3A 5HX6A 5JN2A 4XOZA 4DN5A 3A7HA 2OIBA 1BYGA 3F6XA 3OTVA 2OZAA 5BUJA 1V1KA 4IWQA 4F7LA 1XJDA 2WMBA 2XJ2A 4U7ZA 4EH9A 4F9AA 2ZB1A 1UNLA 4YO6A 5J87A 4C2VA 3R73A 2CGXA 4FTOA 4WNMA 3EN5A 4EYMA 3DU8A 4L9IA 2Z8CA 2NRUA 4NW6A 5EI6A 4GYGA 4I3ZA 4GU6A 4NWMA 5GHVA 4FNYA 2QKWB 1GNGA 2E9NA 1WBPA 2HYYA 3G0EA 3R22A 4L53A 4RLKA 4BZDA 4CNHA 4P7EA 4ENYA 4AS0A 5I5ZA 4L6QA 3BYSA 4O22A 3QTZA 3ZDIA 2JDTA 4O6LA 4IHPA 3OG7A 4PY1A 5ANIA 3AMBA 3Q4TA 2BDWA 2VTJA 3AGLA 4TNBA 4FTNA 1KUTA 3ZHPC 4ALVA 4CMTA 4ZTMA 5C03A 2XNNA 4K8AA 3E62A 4NK9A 4Q9ZA 2JFLA 1K2PA 3I79A 3MY5A 3H10A 4QP3A 4EYJA 3UMWA 4QOXA 4WO5A 2UW7A 3SXSA 4MXYA 5C8NA 3RNYA 3AC1A 2WTWA 3IG7A 4HCTA 4GEOA 1M2PA 5AV3A 3WE8A 5E1EA 3O2MA 5FG8A 5AP6A 2HW7A 3UQFA 2B9FA 5E9EA 4CFNA 3DAJA 3PJ2A 2W1CA 1PMEA 5HTIA 1YDRE 3DJ6A 5I9ZA 2GCDA 3FQHA 3ZLXA 5L2QA 5EDQA 5BX0A 3TIZA 2IZRA 4P5ZA 3Q6UA 5EW3A 4HYIA 3FBVA 2IZTA 3LJ0A 4AP7A 5BQ0A 2YZAA 5DMZA 3R8UA 1DM2A 4J8MA 4NKSA 5D9HA 3WF7A 4CQGA 2I0EA 2W9ZB 3CGFA 2UUEA 3ORLA 1XH8A 2V22A 2VTNA 3ELJA 4BICA 5K9IA 5HU3A 2ITQA 5CWZA 4DA5A 4YHFA 1YXXA 3JYAA 4FTRA 3F61A 2ONLA 2V62A 4EOOA 4R7BA 4F7SA 4IAIA 4I41A 4EWQA 3AD5A 1LP4A 5KMKA 2HCKA 4CEGA 4I0TA 4NSTA 4PRJA 2XBAA 4AUAA 2ZM4A 5HE1A 5IA3A 1KOAA 2YLEA 3ZRKA 5HKMA 1AQ1A 4KABA 1H28A 5KUPA 3BQRA 1GIIA 5CX9A 3LJ1A 5CXHA 1YW2A 2V55A 3HA8A 4F4PA 5DR2A 1ZMWA 4CLJA 5HD4A 2YABA 3TACA 2ACXA 3MFSA 4X0MA 2JFMA 2ITOA 1JPAA 2B1PA 5HE0A 3EQFA 4NIFA 3P5KA 4QP1A 2CN8A 5F4NA 5L6PA 4G9CA 5EK7A 4NYEA 3SXRA 1PF8A 4EOIA 3OBJA 2R3LA 3WF8A 3JY9A 3FJQE 5CF4A 3RJCA 5I9VA 3FL4A 1LEWA 1OI9A 5AMNA 2W1DA 4DH3A 1PXKA 2YM6A 2BMCA 3B8RA 3BHHA 3EQHA 4PX6A 4RFZA 4WBBB 3TNQB 1Y91A 4HYSA 2C3IB 4O91A 3PRFA 1SVHA 5JQ5A 5J1WA 4EOLA 3PWDA 5M57A 3RBWA 3KRWA 4I5CA 2FO0A 1J3HA 3POZA 3W18A 3KU2A 3TUBA 3CY2A 4RIOA 3CIKA 3UIMA 1J7IA 3IW4A 1LUFA 4QP2A 2UW0A 4HNIA 5AUTA 1PXIA 4IWOA 3OT8A 3FQSA 3P79A 4FTIA 3BBTB 2YDKA 2WIHA 4EK3A 4JDJA 1BMKA 3PE2A 3C0IA 2HZIA 3R8VA 3LOKA 4L52A 5JMSA 5M51A 3KKVA 5HD7A 2VRXA 4W8DA 5AP5A 3R8LA 2FYSA 2W06A 4PPBA 2ITZA 5DLSA 3P7AA 5IISA 1KE7A 4KIOA 3KRLA 4XG2A 5M55A 3Q5IA 2OFUA 4W4WA 2YZLA 1MP8A 2R3JA 4RWKA 5E8SA 3I7BA 5F95A 4JG7A 4YZNA 4A4OA 1YHSA 4O0UA 4YP8A 2PVLA 1E1XA 4KKHA 1P4FA 4NFMA 5IQDA 5HGIA 3AMYA 5CEMA 3HX4A 3Q9WA 1OVEA 3DGKA 2EXCX 5DE2A 4BI1A 3HGKA 4FUYA 5K3YA 3T3UA 3V04A 2XK3A 4X3FC 4EH4A 1H24A 4YR8A 2WELA 4FZDB 4BIEA 3FI2A 4FKTA 4B0GA 2F49A 3PZHA 5CNOA 3R1NA 3U4WA 1ZMVA 4QNYA 2BFXA 3D5UA 1XQZA 2A1AB 3MW1A 2CCIA 5DEYA 5EW8A 1JBPE 2X2KA 4E8AA 4DTAA 5IA5A 3ATTA 1Y6AA 4DBNA 2VGPA 4EI4A 4MD7E 5F20A 2VN9A 5GNKA 3OP5A 5GZ9A 5HE3A 3RCDA 1Q8ZA 3IOPA 3MYGA 2E9UA 2BROA 2VTOA 5HIDA 4FZAB 4II5A 4RVTA 5EDRA 4BDAA 5AV0A 4USDA 2ZM1A 5E4HA 1W83A 4E6QA 4LMUA 2X4ZA 2W1IA 4G1WA 3WE4A 3NAXA 2EB2A 3W8QA 3WARA 1WBOA 4ZSEA 4RC3A 2Z7LA 5IH4A 2WU7A 3I6UA 3O17A 3PXQA 2OZAB 2XM8A 1XH9A 3UG1A 4HW7A 3UZRA 2IJMA 4EOSA 4DEGA 3E7OA 4E5BA 2GQGA 3NPCA 3C0HA 3LXKA 4QQ5A 3TZMA 4DCEA 3NZ0A 4EC8A 4AGDA 2YIXA 4M0YA 4FC0A 1W7HA 3CS9A 4K2RA 3MGYA 4KBKA 4UMPA 3LMIA 3QWJA 5KKRB 3KRXA 1H01A 5IUIA 5AP7A 1OKWA 2EXEA 5C9CA 3VS7A 5IA4A 4I6FA 5DIAA 5FM3A 4E93A 3RK9A 1V0PA 1JKSA 3QTSA 4CFXA 3O8TA 1LR4A 3ENMA 4DG0E 4EH3A 3FLQA 4IC8A 4KB8A 5IA2A 1VYWA 4PF4A 3I4BA 3ZM9A 4FSTA 1EH4A 2OKRA 3R28A 2IW9A 4O7YA 2RFDA 2JBPA 3C5UA 2GDOA 4AA5A 3DBQA 3TUDA 1M7QA 5ANEA 4WG4A 2UZNA 5AUWA 3EYHA 4XG7A 3SG9A 4HGEA 3DBEA 3PA3A 4IX4A 2C3JA 3EL7A 2PYWA 4UWBA 2OJIA 2R3GA 1Q99A 3UGCA 1RJBA 3EYGA 4I22A 1NW1A 4NKAA 4RSSA 3R7VA 3A7JA 4F6SA 5HBEA 5CNNA 5HBJA 1OL7A 3OZ6A 5H3QA 3SQQA 2XNBA 1OL1A 4RVLA 4FEQA 1SM2A 3O7LD 3AC4A 3R7UA 3MV5A 3QRJA 2XA4A 2OJ9A 4D4RA 2YM4A 3A7IA 3O23A 3DOGA 4W9XA 1CKIA 5E8WA 2J0JA 3GC9A 2QONA 5JFWA 4RQKA 3KF7A 4C57A 2PMLX 4OLIA 3PG1A 2VTHA 1RE8A 4NM5A 3OROA 5HHWA 5L6WL 2H96A 4KAOA 3S4QA 3F7WA 3RINA 4L01A 4M0ZA 3R1YA 5HQ0A 2PWLA 1BL6A 2CGWA 2VZ6A 5C27A 4H3BA 2JAMA 4I20A 5LMKA 3K3IA 2X6DA 4FSYA 5HNBA 4DH8A 1WZYA 5AR5A 4O7SA 2QODA 3VUHA 4R1VA 5KMJA 1ND4A 4AE6A 1NVRA 4V0GA 5CS6A 3NUPA 1YOMA 2QI8A 4IACA 3RAIA 3CY3A 2OSCA 2PUPA 2UZDA 5ICPA 2GHMA 4DFZE 3DAEA 5LWMA 3POOA 5FBOA 3V8TA 2BUJA 1F3MC 4DHFA 4IADA 4RC2A 3AT2A 5JQ8A 3EOCA 3GC7A 5M53A 4F0FA 5LMBA 1JNKA 1FPUA 4IX3A 3RP9A 3TCPA 4NIFB 4ITHA 3H9FA 3LCSA 1SNXA 3W2CA 4BY9E 2Y9QA 4N4SA 4FIIA 2CKOA 1CDKA 3R63A 4AXAA 5IDNA 3FXWA 1WBNA 4QYYA 3BE9A 3DXQA 1YWNA 4FV4A 4G3FA 4QYGA 2FSLX 3C4FA 2VX0A 1ZOGA 3MPMA 3LAUA 4IQ6A 4IZAA 4O7WA 1UU7A 3HMOA 3NCZA 4CCBA 4JBVA 2OXYA 4RJ7A 1Z57A 1YXSA 2ZV9A 2W99B 1U5QA 3F5PA 3SA0A 4RFYA 1NVSA 3SGCA 4D0WA 4CKIA 2CPKE 4E7WA 4P2KA 3WZUA 2X2MA 4I93A 3EKNA 4RJ6A 4BIDA 1OIYA 4B9DA 1XR1A 4BI2A 2YISA 3IGOA 5EHLA 3L8XA 3RZBA 3D4QA 4Q5HA 3L8VA 3DY7A 3MTLA 3LMGA 4DFBA 3TNWA 1U5RA 4FSWA 5DGZA 3QYWA 4JDHA 5AP4A 1OKVA 4Z7GA 3DLSA 3UP7A 5EKNA 3THBA 4YJPA 2FA2A 2Q0NA 4L7SA 2W9FB 5BVFA 1Q4LA 3REPA 2YWVA 3U6JA 4ANMA 3VHEA 3QFVA 3ZZEA 2ZDUA 4N6ZA 4QP8A 4EOPA 4OTWA 4ENXA 3RAKA 2J51A 4K11A 4WIHA 3DJ7A 3L9LA 5G1XA 3P23A 3VF8A 3VRZA 4EK5A 3H30A 2XJ0A 2J0IA 4AFJA 2XNGA 3VQHA 2JITA 4L42A 4WRSA 4UX9A 2WQOA 2B9JA 1H26A 4RMZA 4L46A 1PKDA 4X6QC 5H8BA 2E9OA 3C4EA 1YHWA 3UBDA 3QUEA 4X6RA 3UO6A 5FDPA 2XRWA 3CP9A 4K9YA 3ROYA 4DT8A 4YJSA 4I6QA 3A2CA 2B54A 2B4SB 2IZUA 4C4JA 3U6IA 1QPCA 4FV6A 3HAVA 4OW8A 2W5BA 3TNPC 3MJ2A 4R3CA 1HCLA 3JR1A 3DB6A 3EIDA 4IAFA 4WUNA 3WYYA 4C4FA 4D2PA 3BQCA 4IM2A 3LFNA 4XLVA 4PMPA 1R0EA 4FIJA 3LFCA 4EH2A 3C51A 3NSZA 3UQCA 2HIWA 3LMHA 2E2BA 2VX3A 5FEEA 2BAJA 3E93A 3U4UA 4ZZOA 3DKFA 2UW8A 4B8MA 4RQVA 5J8IA 3R83A 1Z5MA 2PK9A 2REIA 3TKHA 4GK3A 2VU3A 3F5GA 3KVXA 4O21A 4F6WA 4PDYA 3BWFA 3R9OA 3A60A 4BCJA 1ERKA 1P5EA 2ITVA 4A4LA 4EKKA 5GJDA 1VJYA 3ETAA 3OMVA 4D4VA 4IZ5A 4L00A 1SNUA 1WVYA 2YACA 4YTHA 1HCKA 4NUSA 2F2CB 3Q96A 3GEQA 2XKEA 4B99A 5FXRA 2WMUA 4OTGA 2BZKB 2J6MA 3NIEA 4WRGA 4F64A 3PVWA 4DF3A 4GKIA 2JDOA 5C4KA 4LL0A 1UA2A 3ZEWA 4RVMA 5DPVA 4XP0A 4MEDA 2UZOA 3NNUA 4K0YA 4BDKA 4ZY5A 1M14A 3VS4A 3MS9A 2PZRA 4JR7A 4FV5A 3NW6A 4GK4A 2OGVA 2UW5A 3RK7A 3Q53A 3CD8A 3NAYA 5AV1A 4EORA 4DG3E 2CMWA 5IPJA 4O1PA 4PL3A 2UZWE 3R7GA 5L8JA 4R78A 2PU8A 3BGZA 3TDVA 4QTAA 2NP8A 2PVKA 2UW4A 2IW8A 4RX7A 2WMQA 5A4LA 1FINA 2PULA 1IR3A 1URWA 2QLQA 5ETAA 2WMRA 4IB3A 4UZDA 4ZOGA 4ZSJA 4BYIA 2JKKA 5E8TA 5AR2A 4IM3A 1J1BA 3QTRA 4E6CA 1BX6A 3FMHA 3H9RA 3I0OA 4USFA 4ERKA 2BVAA 2JDVA 3MIYA 3TV4A 4BDIA 2O8YA 4AGUA 3QLGA 2BTRA 2NNWB 2JIVA 3VJNA 3PVGA 4MYGA 4FKQA 5DVRA 5ANKA 3TTIA 3UDBA 2B0QA 4BCIA 3VS1A 4YJUA 1CM8A 4HYUA 3ORPA 1QL6A 4GIHA 4DEAA 3NCGA 4R5SA 3R7EA 4RC4A 2Y7JA 4S32A 3MFRA 4YHJA 4HVDA 5CVGA 4DCAA 5F9EA 1ZARA 1ZAOA 2CN5A 1ZY5A 4ONAA 4PPAA 4ZEGA 3HMMA 5HTBA 4D2SA 5LXMA 2O63A 3ROCA 2YIWA 4CZTA 5DYJA 3T8OA 4AGCA 5HG8A 5FP6A 3ZEPA 3QU0A 4AW0A 2H8HA 5BUIA 2FSOX 3IO7A 2C5VA 3EL8A 4HCVA 4BDHA 5A4TA 4FKPA 1YXUA 4V0GB 1Q97A 2ZV7A 2ZVAA 2GFCA 3QQKA 1CSNA 5AAFA 3PYYA 3BU3A 4MQ2A 2OXXA 3TN8A 4XBRA 4CT2A 4IAZA 3DTCA 3ZO4A 4EQMA 2C5OA 3PP0A 3U51A 4RBLA 2Q83A 1Y8YA 4W8EA 5M4CA 2FSTX 3I7CA 2VWIA 5AV4A 3QKMA 4YTFA 4FV3A 4DEEA 2W4JA 1B6CB 3QBNA 4FKGA 5K5XA 3Q60A 5IDPA 2GSFA 4X3FA 2CNVA 3EJ1A 3UO5A 5CTPA 4TKSA 5EM7A 4NM7A 5AP1A 4CFMA 3UJGA 4WD5A 3FI4A 3K2LA 3M2WA 2I0HA 4LQMA 5KNJA 1PMVA 3NYOA 4WG3A 3GFEA 1K9AA 4FK6A 4ZJJA 3LPBA 3WIKA 3KCFA 3W2OA 3SVVA 3EQCA 3ORZA 3KY2A 3OT3A 5HLPA 4F1OA 3GXLA 4A9SA 2WZJA 4FV1A 2ESMA 3VHKA 4RX8A 5CASA 2B9IA 3DQWA 1PMUA 4MTAA 3FLWA 5IQGA 5HIEA 5FUTA 4M97A 4B7TA 4TWCA 3PSDA 4M15A 4C59A 4DLIA 4NCTC 3F3WA 4U3ZA 1UV5A 4ZS0A 2ZDTA 4KD1A 4F0IA 3ZFYA 1KWPA 2RFSA 3GU8A 4QP4A 5KO1A 4YZBA 5IEXA 4LOOA 4O83A 2XIYA 4L3JA 3KXXA 5DHJA 4E6DA 4KSPA 4F70A 4QD6A 4QMZA 5JGDA 3RPSA 4L8MA 4FKVA 1Z9XA 2OZOA 1PJKA 3MJ1A 4IVBA 3LCKA 5LJJA 4FNWA 4CYIA 1ZMUA 3LFQA 4ZMFA 1W98A 2QCSA 2WFYA 3LFAA 3FI3A 3ZUTA 2XJ1A 1W84A 2Y4IC 3VUGA 3E8CA 2OWBA 3UYSA 4GG7A 4E5WA 5HU9A 5LVPA 3Q2MA 3BCEA 4FYNA 4YSMA 3I0QA 4ASDA 3FY0A 2WO6A 4EBWA 5KCVA 3LLAA 3FLZA 4RX9A 4CKJA 4HNFA 5AFVA 4XNEA 2QQ7A 2XZSA 3FXZA 5HLNA 3S0OA 4O81A 3QUPA 3V3VA 3F69A 3LVPA 2C47A 1BUHA 2VWWA 3DZOA 4G3GA 4YBKA 1YXTA 3F3ZA 5EHOA 3LCDA 4J96A 3SRVA 3TJCA 4W9WA 2UZTA 3WF6A 4RJ4A 3G51A 3WZDA 5DR9A 2V5QA 4QTCA 3TNHA 3E3PA 2H6DA 4XEYA 3SC1A 3QZHA 3VJOA 2P2HA 4NM3A 1TQPA 4CFUA 2HY81 5JZNA 3DBCA 2QR7A 4MNEA 4CT1A 3BI6A 4E4NA 4N0SA 4JX3A 4O0WA 1OKYA 3MY0A 4RVKA 4ZSLA 4BL1A 1OB3A 3ZO2A 4K6ZA 1R3CA 4MD9E 2XS0A 3UQGA 2QD9A 3VBXA 5A4CA 5IG1A 5KX8A 4E4XA 1VEBA 5CZHA 5A54A 3SG8A 4LV8A 3V8SA 5J9ZA 5J7BA 3KC3A 4EUTA 4AW5A 5AADA 1XBAA 1O9UA 3VS3A 2FVDA 3V6RA 4ZLYA 4TL0A 4A07A 3O96A 4O7TA 1ZY4A 5FWKK 2GNJA 3GGFA 4WSYA 3R71A 2UZEA 2YIRA 3OS3A 3NW7A 1H0WA 3TZ7A 3MB7A 1UU8A 3LFEA 5AUYA 2C6TA 2Z60A 4QPSA 4HPUE 3BLQA 2XK9A 3JUHA 3QD4A 4ANSA 2CJMA 4X7QA 4JG6A 3IONA 2DS1A 2BRHA 4DITA 4KSQA 3VVHA 3H4JA 2QOCA 3VW6A 2BRNA 3CPCA 5ETCA 3COHA 4BDGA 3QQGA 3KB7A 2BRMA 3BHVA 1BI7A 4F7JA 2XCHA 4D9UA 4B4LA 3FC1X 4C02A 4J1RA 3VBQA 3PVBA 4MHAA 4FMQA 5B2MA 2BKZA 1SYKA 3IDBA 2IN6A 3QALE 4GFMA 4I1ZA 4IB5A 4QPAA 3LHJA 2RF9A 5J79A 2F7EE 4XUFA 5HORA 2RIOA 5KE0A 4QMUA 2GQRA 3AMAA 4ASZA 2XCKA 5FBNC 3IOKA 3QCYA 5B2LA 5AR7A 4RJ8A 4LYNA 3FKLA 2P4IA 4BR3A 3EMGA 2WMXA 3Q4CA 4BDJA 4DBXA 4U9AA 3OWKA 4Y5HA 4D2TA 1FOTA 2RFNA 1E1VA 4I4FA 1H0VA 2QOLA 1CKPA 1Y57A 3FLYA 3HMNA 3VNTA 4AT4A 2XBJA 4YZMA 2F7XE 3F3VA 3ATSA 3VO3A 3QZIA 3UP2A 4QMXA 3BV2A 3KMWA 4WOVA 4JRVA 4M67A 3R8PA 2PPQA 3RPOA 2QOFA 1PXNA 3SD0A 1A9UA 4IWPA 3LQ8A 4IANA 3PXZA 3AGMA 3F2AA 5J5SA 4XLIA 1Q8UA 1QCFA 3TWJA 3HMIA 3ZRLA 1GZNA 2VWXA 4GUBA 5DOSA 4EOKA 1U54B 2VTRA 4ACDA 4K18A 5CU6A 4PMTA 5EQYA 4FYOA 2UVZA 1WBVA 3BU6A 4TWOA 3WZEA 2H34A 2ERKA 4KKGA 5AR4A 2HWPA 3IDPA 3OWLA 4ASEA 1FMKA 4QRCA 4CV9A 4HVSA 4E4MA 4XYFA 2OF2A 1FMOE 4LUEA 5JEBA 2GTNA 3NDMA 4J7BA 4N6YA 5ACBC 1YOJA 4ZY6A 2KTYA 5K4JA 3G33A 2WKMA 5IQEA 2HZ4A 3V01A 4R5YA 1O6YA 3AT3A 4ANOA 2O64A 4U81A 2OIDA 2PVFA 2RL5A 3AG9A 4DGOA 4U8ZA 3QHRA 3FMLA 5CQWA 4ZLOA 3W55A 4L43A 2NPQA 3OWJA 5A6OA 3VUMA 4IAAA 3DBFA 5CZIA 4BCQA 4IIRA 2UZUE 3VS0A 4X3FB 4XJ0A 4EZ7A 3VW8A 2YM5A 3R9DA 3QQFA 4XMOA 3EZRA 5HBHA 3RNIA 3RM7A 3WF5A 3RVGA 4R1YA 4EK4A 3MESA 2R3HA 4WNPA 3UG2A 2I7QA 5BVNA 4U44A 5G6VA 4LGDA 1PY5A 3EHAA 3EQBA 4X3JA 5E7RA 3ZM4A 2EVAA 4A7CA 4DFYA 5BVWA 4BGGA 4C35A 4O7RA 1UNHA 4TNDA 2RFEA 2G2HA 4X2GA 4RJ3A 3HLLA 4S2ZA 4XV1A 1UU9A 5DBXA 3FHRA 4QYHA 1NXKA 3PG3A 4LGHA 5AP3A 2BR1A 3W10A 4H58A 4TWNA 3GCUA 4FVQA 4F9BA 4FIFA 3GP0A 5CYIA 4AN3A 1LPUA 4RGJA 4FKSA 1Q8TA 2J5EA 4AACA 4DH7A 2X9FA 2YIQA 3HVCA 4IE9A 3F2RA 5JGAA 4FKLA 3O8UA 1CTPE 3WZKA 1IAHA 3IECA 2FB8A 3VS2A 1BL7A 4O6EA 4O7NA 3EQPA 3KF4A 3OXTA 5C26A 5IMXA 3NW5A 3BELA 2XIRA 3QRKA 2WTKC 4L3PA 2WEIA 2P3GX 4ZTQA 2H9VA 4TWPA 1ZOEA 3CTHA 4FEUA 3KXHA 4G31A 3KVWA 4M7IA 1Q3DA 2A19B 5JGBA 2YCSA 3K5VA 2R7BA 4F09A 1YWRA 4FEWA 5AUVA 3FPMA 3PY1A 2XNMA 2Z2WA 4EK8A 5DI1A 1P2AA 3IDCA 3PLSA 5F1ZA 4GJ2A 3LXLA 5CAQA 2BILB 4RWIA 4GKHA 3PY3A 4EOJA 1YI6A 3DLZA 1XKKA 3G9NA 3P4KA 5HCXA 2R64A 2GQSA 3LFBA 3B2TA 1JKKA 3ORNA 3SDJA 1YHVA 3SRVB 1JKLA 3TTJA 2X9EA 2YM3A 4GYIA 4MK0A 3IW5A 2VV9A 3G5DA 2QHMA 2QVSE 3ULZA 4CQEA 5M4UA 2QKRA 3BU5A 1FVVA 3KN6A 4PL4A 2PMIA 3RPYA 3ZYAA 1GIJA 5A14A 1M2RA 3C4CA 4FKJA 5IA1A 3U9NA 3ORMA 3ZBFA 4JBPA 4MNEB 5CEQA 2P55A 1Q62A 1MQBA 2WNTA 5HVJA 4AZSA 5CU0A 3MDYA 5CAUA 4IB0A 1YDSE 3HAMA 2AC5A 2PMOX 2CKEA 2XK4A 5HIBA 3S95A 2J50A 4FSZA 2J0MB 2WMVA 2CLQA 2EB3A 4YMJA 2C6EA 1MRUA 2WMSA 3ENHA 4BFMA 3OCTA 4CMUA 2W0JA 4BCOA 5JH6A 2C68A 4FIHA 4V01A 3KFAA 3EN6A 2ZV2A 1JOWB 5IQFA 3VUTA 4IM0A 2R9SA 1QPDA 4L68A 4MD8E 5E8YA 4FR4A 3OUKA 2JIIA 3F88A 4R6VA 3OCBA 2JDSA 3C0GA 4R7HA 3C5IA 4YJOA 4OTFA 2DUVA 4XV3A 2QO2A 4JAJA 1DI9A 4UALA 5IUGA 3S1HA 3EFLA 2BHHA 2R3RA 2UW6A 2W1FA 2Z02A 3C9WA 3PY0A 4DLJA 1PYXA 4IVAA 2LAVA 2OU7A 5CSXA 4OTHA 4ACCA 3QGWA 5DT4A 3TXOA 3KK9A 1GZOA 4FOCA 3TNIA 5BYZA 4E4LA 5CF6A 3KREA 5I9WA 2YDIA 4R7IA 2F7ZE 4DINA 3UIXA 3UOLA 3UPZA 2GNGA 3E92A 1H08A 4PQNA 1YQJA 3HP5A 3RI1A 3QA0A 2PZIA 2WGJA 3ALOA 3BLHA 3BYVA 4J8NA 4P4CA 4JBQA 3ZUVA 5IUHA 2WIPA 5M44A 4RFMA 3BIZA 3W2SA 3M11A 4A9YA 4DGNA 1GAGA 4PUZA 5E8UA 2R3QA 2OI4X 3PJ8A 5KBRA 1UWHA 5IF1A 5M4FA 1PXOA 2P33A 4A06A 4QQCA 2PZYA 4BF2A 1PHKA 5L2IA 2XRUA 4C8BA 5KHXA 4U41A 2XKDA 4NCTA 2P2IA 2PZPA 4O86A 1WBTA 4KRCA 4RLLA 1H1WA 5M09A 4JNWA 4AA0A 4HGSA 2R2PA 3D5XA 4FTMA 4MWIA 5D10A 1W8CA 5AP0A 1XWSA 3U8WA 2CGVA 4ZTRA 3FKOA 4BGHA 4D58A 2C6LA 2UW9A 1OKZA 2VUWA 1XH4A 5CXZA 2W17A 2EU9A 2GPHA 2QC6A 5AIRA 3KXMA 4ORKA 4FKRA 4WNOA 5KMLA 3QL8A 4BWXA 3ULIA 4APCA 2V7AA 2ZM3A 3DKOA 4FKOA 3OD6X 4HCUA 2WTVA 2UVXA 4J71A 3R9HA 2GMXA 3PXFA 2FH9A 3UZTA 2CKQA 2R0UA 4XP3A 5FEDA 2O65A 4EH6A 4HYHA 3MI9A 2Y6OA 1ZOHA 1AGWA 3HNGA 1BI8A 4JDIA 5AUXA 3KMMA 3NLBA 3KK8A 2WU6A 3IKAA 2QOOA 4FTLA 2O5KA 4M84A 3Q9XA 3HL7A 2HW6A 2GTMA 2PL0A 5HESA 5HNGA 4FEXA 5TKDA 3AD6A 1IRKA 3DXPA 2PVYA 2BCJA 3E8NA 3EB0A 3I1AA 2C0OA 2GU8A 2JEDA 1X8BA 3DPKA 3L8PA 3QQLA 3QCSA 4U79A 3F3TA 2W1EA 3NVMB 5HCZA 4DH1A 1OITA 5AR8A 4GFOA 4J99A 4MF0A 1WVXA 4AZEA 4BCMA 4Y46A 5LVNA 5DRDA 5A4QA 4YJNA 1WBSA 2VWUA 4BVUA 4U40A 5H9BA 2C30A 4G6NA 3KULA 4QPMA 3QC9A 5DH3A 3PIXA 1OMWA 3NVKI 4LFIA 5FRIA 4YSJA 5HICA 3QGYA 3D15A 4TPTA 3U55A 4RZWA 4KIQA 3OC1A 5I9XA 3PE1A 1H1SA 4ACGA 5HO8A 3PSBA 1NY3A 2YEXA 5JFXA 4GVAA 3I5ZA 1S9IA 2ITXA 3DDPA 1YKRA 2YERA 1UU3A 4G5PA 3O0GA 5ETIA 4NJDA 4BDEA 4EH8A 4IZ7A 4P5QA 1CMKE 2G2FA 2I0YA 3H0ZA 3Q3BA 1OUKA 3SOCA 4O0XA 4RIXA 3V5JA 4PTCA 5GIPE 3B2WA 1FGKA 2OO8X 1OIUA 5CSPA 3QQHA 4JAIA 3CQEA 1RQQA 4OR5A 2QOIA 1G8SA 1NA7A 3TL8A 2KULA 4MXZA 1J91A 2DQ7X 4FT9A 3FZTA 5JFSA 3KXGA 3BYUA 1Q8YA 3FC2A 4X2KA 3ZDUA 1OPLA 5L2WA 3C50A 1M7NA 4PWNA 5DG5A 2ITNA 3ZLWA 3MH2A 3DK3A 3ORXA 3HV7A 4QP7A 4DEDA 1GY3A 2YAAA 2WMAA 3IPHA 4OBQA 4GT3A 1FBNA 4O0VA 4H1JA 4NM0A 4BZNA 2IPXA 4PP9A 2W96B 4IJ9A 1ZYDA 4KS8A 3RM6A 2OIQA 3UOJA 2QR8A 3HEGA 4M8TA 3FLNC 2V0DA 4D0XA 4BTKA 4DE4A 3MB6A 4E1ZA 5FXSA 1SZMA 3UPXA 3GCQA 4JBOA 3OHTA 4M69A 3TI1A 3FAAA 2UZLA 4MAOA 2OICA 4WT6A 4EQUA 3E88A 3HV6A 4Z3VA 3F9NA 3R04A 4ZXTA 1UKIA 3W1FA 1GZ8A 2C3KA 2QOHA 4CLIA 1OZ1A 4RX5A 5D41A 2OG8A 4UXQA 4AOJA 3VC4A 3E3BX 2UVYA 3HRCA 1XHAA 4XX9A 4F0GA 2RG5A 2XP2A 4XBUA 3UYTA 2WXVA 1SVGA 4A9TA 4C36A 4WHZA 3W8LA 2BDJA 2HZ0A 5H2UA 3SAYA 4GVJA 3UMXA 1PXPA 3H0YA 4F9CA 3HKOA 4L44A 1YWVA 2ETMA 2PTKA 4FZFB 3VBVA 4Y73A 4HVHA 2A2AA 3V5QA 2EUFB 3AXWA 5CEOA 2A27A 5CQUA 4C0TA 4W4XA 3ZC5A 4FA2A 3OXIA 3NYXA 2X8EA 3P08A 5AM6A 2XM9A 1OM1A 2B9HA 4QMNA 4AE9A 3FHIA 5AEPA 2JBOA 2W5AA 5DN3A 5E8VA 1PXLA 2YIYA 3PZEA 4FL2A 3FY2A 4ACHA 5A4EA 3NNVA 3FMKA 4FTCA 4O38A 2FUMA 3SOAA 1YVJA 2AC3A 4IAYA 4YPSA 4GCJA 5FQDC 5CENA 3T3VA 4D1ZA 4FT3A 3ZC6A 2NRYA 4UB7A 3QTXA 4WKQA 3V5LA 4YC8A 4Y95A 4YNOA 4ZTSA 3LW0A 3QX2A 4MBIA 3Q52A 4XG9A 1FVRA 4QTDA 2OLCA 1U4DA 3ZO1A 1PW2A 3ACKA 4R8QA 4C4HA 5A46A 1Q41A 4B6LA 4OGRA 2DYLA 1JQHA 5B2KA 2R3MA 3VRYA 3VWAA 3AT4A 1KSWA 1Q5KA 3A61A 3II5A 4HJOA 3TUCA 2J90A 5HVKA 2PVRA 3QXPA 1MQ4A 3VAPA 4K33A 2QG7A 5CANA 4AWIA 5GINE 3LM5A 3ZUUA 2XUUA 1RW8A 4EC9A 2WPAA 4RA5A 3ERKA 2VO0A 4RWJA 2WQBA 3N9XA 3W33A 4BBEA 4EJNA 4J98A 4RZVA 5M07A 5AR3A 2BDFA 2ZYBA 2O0UA 1OL6A 3DKGA 3HECA 4IDVA 4USEA 5JSMA 5IQCA 4GT5A 5T3QA 5C8KA 4E3CA 4O7LA 3QRUA 4GSBA 2WOUA 3F82A 3GFWA 4LRMA 3S2PA 3MA3A 5LMAA 4QP9A 4MX9A 4V05A 2A4LA 3COKA 5HEZA 1T46A 2YHVA 3FMNA 4WG5A 3UVPA 3PA5A 3VIDA 1UNGA 4YURA 4ZMEA 5HG9A 4GV1A 2WHBA 4EQCA 5FD2A 3BGQA 2Y4IB 4I5MA 2ETKA 3CKXA 4GRBA 2PVMA 2XF0A 2G01A 4QMWA 5EQPA 2G1TA 2YM7A 4O7ZA 2Y6MA 1J7UA 2YA9A 3UNKA 3QRTA 3IW6A 3Q2JA 3OEZA 4EK6A 3HDNA 2C0TA 5ANJA 3WZJA 1O6LA 2WQEA 3HA6A 4OAUC 1KOBA 4M66A 2WEVA 3VBWA 2C1AA 3KRJA 4MQ1A 4PTEA 4E20A 2UV2A 2J9MA 3FSKA 3I60A 1JSTA 3DS6A 5D7AA 2HOGA 2VTQA 3ORKA 5E92A 3BEGA 3GU6A 5EOLA 5A3XA 5JFVA 1M2QA 3S00A 4QMTA 1H27A 4BI0A 4FE2A 2VWBA 3IQ7A 4LRJA 2YDJA 3G9LX 3IW7A 5HE2A 2QU6A 3ACJA 4H3PA 3MY1A 3OOGA 2XNPA 3A8WA 2X1NA 4FTQA 2RKUA 3WI6A 2OJGA 3KULB 2BPMA 5AUUA 3UE4A 2J2IB 4UMQA 4Z55A 3ZSGA 4ZZNA 4X2JA 3WYXA 4E26A 5AIKA 4H05A 3WOWA 2C6DA 2CHLA 1REJA 4O82A 4MNFA 3CXWA 1M17A 2BAQA 4O0RA 4ITJA 3QLFA 4LOPA 4IB1A 5IQIA 4C4EA 2VTPA 4RIXB 4I5PA 5HG5A 2BHEA 2PVHA 4TRLA 2OJJA 3BHTA 5JT2A 3C4XA 4YJTA 3QXOA 5DT3A 4AZFA 3ORIA 4PL5A 3TZ8A 4AOTA 4BZOA 2GHLA 2ITUA 4EH5A 3TM0A 1ZYLA 4IMYA 2Y4PA 5EFQA 3RWPA 4PP7A 2PUIA 4CGAA 4LI5A 3HV3A 4FOBA 3JPVA 2ZMDA 3DZQA 1B39A 3FLSA 3L8SA 2R3FA 3DQXA 3MH1A 4FKIA 4N70A 4D1XA 4DC2A 2VTAA 2CCHA 4NH1A 1YDTE 3AC8A 3FMJA 4C4IA 2XK6A 4FSMA 3FL5A 5FGKA 3TIYA 4RT7A 4Z16A 4CD0A 2IW6A 4CV8A 4WBOA 5IQBA 4QMLA 4C33A 4YLJA 1E9HA 4GL9A 3GCVA 3HDMA 4RIWA 3GU4A 2O2UA 4M69B 5TF9A 3D7TA 3ANQA 3UNJA 4I21A 4AN2A 1BLXA 5CT0A 4QMQA 5CSWA 3VS5A 3ZXTA 2Y8OA 1ZRZA 1PXJA 1H25A 1JWHA 1O6KA 2UW3A 4EHGA 2BFYA 4I0RA 5EH0A 5AAEA 5EDPA 1VR2A 2Q0BA 4AG8A 2XIKA 1RDQE 3D94A 2GS7A 4OT6A 4O1OA 3UODA 4JIAA 3CC6A 2WTDA 4FSUA 1WBWA 2R3NA 4I6BA 4ASXA 4G17A 1OUYA 2C4GA 3HUBA 3WILA 5FDXA 4TY1A 3O51A 5HO7A 5CVHA 5E8XA 3W2PA 2ZAZA 4G34A 3OY1A 4QMVA 1WCCA 1AD5A 3NGAA 1T45A 4E5AX 2ITTA 4G2FA 4C3PA 4DTBA 4KBCA 2QO9A 1DAWA 5HG7A 3KEXA 1FGIA 3CJFA 1TVOA 3ODZX 4A9RA 3E64A 3LKMA 3MIAA 4BHZA 2VNYA 4BYJA 4JS8A 3GCSA 4IJPA 3ZLSA 3FZ1A 4UN0C 3E7VA 2XYNA 2X8DA 2VO3A 5AAGA 3ZFMA 5CF8A 4AZVA 2GS2A 1MUOA 4C3RA 5A9UA 3CTQA 2C5YA 4RRVA 4TTHB 1OBGA 3LXNA 3ZMMA 4FZ6A 1DS5A 4HVGA 2JC6A 4U3YA 5H8EA 3VUDA 1B38A 2W1HA 4ZIMA 1F0QA 5BUEA 4UEUA 3QKKA 4LRKA 3VBYA 2ETRA 2JIUA 3MSSA 3MBLA 4FV2A 4CZYB 3MPTA 1V0BA 4F7NA 3F7ZA 4QQJA 5EM5A 2Z7QA 5AA9A 3GU5A 3MVJA 4FUXA 4I6HA 4ZTNA 4U6RA 5CU4A 4IZYA 4D5HA 1Y6BA 2GNHA 3MA6A 3VN9A 3AC3A 4Y8DA 4W4YA 4ZY4A 2CDZA 4BC6A 5ACKA 4BKYA 2LGCA 4X2NA 3CKWA 4RJ5A 1XBCA 4UWCA 3E8DA 5CT7A 3RHXA 2QG5A 4NT4A 4KWPA 3B8QA 3Q5ZA 3HRBA 5LQFA 2QHNA 4BDCA 4DAWA 3R0TA 3QF9A 4AQCA 4AZTA 3C1XA 2DWBA 4CTBA 3FSFA 4F08A 2WQNA 5E1SA 4FODA 2PE1A 1WVWA 4DGGA 1GIHA 2WTKB 2I6LA 4C7TA 3MVMA 3ZO3A 4IX5A 4EKLA 3O71A 4FT5A 3AQVA 5DA3A 4ARKA 5IH6A 5AJQA 2ZOQA 3H3CA 4B8LA 3FV8A 2IG7A 3GU7A 3CQUA 3PIYA 3QCXA 5CF5A 2ITPA 3IS5A 3CQWA 1CKJA 2ERZE 1ATPE 1JAMA 4FG7A 5D12A 3FE3A 2Z7RA 4NTSA 5GIOE 3WF9A 3OFMA 2IVTA 3EN9A 5EI8A 3MN3A 4R3RA 3I5NA 4BTMA 3ZU7A 2B53A 4BRXA 5CAOA 3COMA 1JSVA 3D9VA 3MWUA 2EWAA 3DB8A 3NYNA 5E91A 4C37A 3NUAA 3C13A 2YLFA 2Z7SA 5EYCA 4AF3A 4CMOA 2XK8A 5IZFA 5HLWA 4FVRA 5D11A 5LCKA 3FXXA 2X7FA 5GJFA 4I94A 4F1MA 2FGIA 3KN5A 3MFTA 5HCYA 2A0CX 1ZWSA 5FTGA 3R8ZA 4ALWA 4CKRA 4YZCA 3ZLYA 4JG8A 3TKIA 4AFEA 2BZIB 3FKNA 3QTIA 4BHNA 4XRJA 4O2PA 4MWHA 1MRYA 4FI1A 1KE6A 2PVJA 3PFQA 4NU1A 4CRSA 5IU2A 3KGAA 2OXDA 3OY3A 5I3OA 2VX1A 2W05A 3FMDA 3GENA 3CE3A 2PVNA 4AA4A 2XKFA 5J9YA 2BKKA 5CI7A 4XH6A 4KS7A 2OH0E 2PHKA 4UMTA 3EQIA 4DFLA 3CBLA 2UZBA 3T9IA 1APME 3OW4A 3SHEA 4EZ5A 5KBQA 2WMTA 2C6IA 4H3QA 3HV4A 3GNIB 3PPJA 5HTCA 2JGZA 4RG0A 3QKLA 2ZJWA 5DWRA 1OIQA 4MCVA 1ZYCA 5EKOA 3FPQA 3JY0A 2AUHA 4OTPA 4FGRA 2C5NA 5AUZA 3DJ5A 4TXCA 3RK5A 3PVUA 3IGGA 4QP6A 3UIBA 3UTOA 3PDTA 4ZP5A 3BE2A 3BBWA 3LZBA 3R9RA 4XG6A 3EFKA 4L45A 4UBAA 4LM5A 5TR6A 3Q9ZA 4FSRA 4AX8A 3BZ3A 3CEKA 3EN4A 2WTJA 3L9NA 1ZZLA 3PP1A 5IKWA 2QLUA 1IA8A 4IXPA 4JOAA 4RIWB 3TV7A 2WTIA 4G3CA 4M12A 4TT7A 4YO4A 3LFDA 5BYLA 1ZYSA 4O27B 5M56A 4G5JA 2WQMA 3Q04A 2WB8A 3D7TB 5CEIA 3DA6A 4FV0A 3W16A 4E73A 4CZUA 4CG9A 4JX7A 5L8LA 4QT1A 2PY3A 4D5KA 4Y85A 1JSUA 4AT3A 2XK7A 4S34A 4I5HA 3BLRA 4BCGA 2R0IA 3HYHA 3FWQA 4FV8A 5JZJA 2E9PA 3FZOA 4M68A 3ZZWA 5L2TA 5K0XA 1UKHA 3QD0A 4K77A 3F2NA 3QUDA 4OTIA 2YCQA 1SVEA 3ANRA 3CLYA 5BMMA 3LCOA 3TKUA 4DEBA 3QC4A 1IA9A 4ITIA 3E5AA 5CSHA 4G3EA 3HUCA 3OWPA 4IAKA 4EHVA 3E63A 4V04A 1YOLA 4D4SA 4HPTE 5HZNA 5CEPA 1P14A 3PPZA 3V5PA 2PE2A 2QO7A 2RG6A 3WIGA 3QYZA 4EH7A 1JKTA 4RA4A 1GOLA 3LCTA 4IFGA 3G6HA 3ID6C 5J7HA 4FF8A 4RIYA 4CTCA 1XH6A 4EHEA 1A06A 2VWVA 1ZYJA 3FMMA 3VULA 3K5UA 3KL8A 3BKBA 5DRBA 5LVOA 5M06A 1BKXA 2VTLA 4QTEA 1V0OA 3SW4A 3ZONA 2VO6A 2C69A 5BNJA 4YZ9A 3FYJX 4J52A 1REKA 4BBFA 2IVUA 4DEHA 3V8WA 2SRCA 1Q61A 3S3IA 2WAJA 3BYOA 3NNXA 3ZBXA 5DR6A 5AV2A 4G9RA 2VTIA 3MVLA 3UO4A 3D0EA 4KINA 4G3DA 3PSCA 4M3QA 4MKCA 3BX5A 3BWJA 4GH2A 1URCA 3AOXA 2VTMA 3HZTA 3MPAA 4LG4A 3K54A 4L67A 3W32A 3BEAA 3C4WA 3OW3A 4J53A 3U6HA 4NL0A 2W1ZA 2XNEA 5I0BA 3P78A 5JRSA 1JVPP 3QD2B 5KZ0A 1G8AA 3A4OX 4LGGA 3OCGA 1UVRA 4F9YA 1YI4A 5FTOA 3LFSA 3R7OA 4TYIA 5HNIX 4Y5QA 3BRBA 3KA0A 4NTTA 4DH5A 2PMNX 3QWKA 1XH5A 4IH8A 3OCSA 5J5TA 3RTPA 4BB4A 3SW7A 4L3LA 4YGAA 2QOKA 4YBJA 4KIPA 5D7VA 3CSVA 4ANNA 3LQ3A 2WMWA 4J97A 4YLLA 3V5TA 3O8PA 2VO7A 4ZJIA 2B7AA 3KXNA 3R00A 5L2SA 1ZXEA 2AYPA 2X4FA 4H39A 4ZS4A 4I4EA 4U97A 4BCKA 4MXAA 4JXFA 3RCJA 4PMSA 3F66A 3Q6WA 4KA3A 4C61A 4AN9A 2OFVA 4JLCA 1ZZ2A 4UMRA 4O7VA 2CLXA 2XNOA 4UWYA 3FYKX 3RPRA 1IAJA 2YITA 3K3JA 2XYUA 2F2UA 1W0XC 3KRRA 2BTSA 3Q9YA 1QPEA 3LE6A 2C6MA 3PXYA 4FIGA 4AU8A 5KMOA 2JD5A 4KRDA 3C7QA 1Q24A 4NEUA 5AX3A 3AC2A 2YFXA 5CU3A 3EZVA 3PA4A 4YC3A 5KZIA 4BN1A 2VTTA 5AP2A 4APPA 3VQUA 2XKCA 4FTKA 4HZRA 2BAKA 3I81A 4TYHA 4D2RA 5AA8A 4JL9A 3FUPA 4D28A 4DEIA 4ZTLA 5B0XA 4S30A 4BCNA 2G2IA 3G15A 3ZRMA 4O96A 4KUJA 3TV6A 3RAWA 4F6UA 4FT7A 4HVIA 2IVVA 4GS6A 1GJOA 4FTTA 4PNIA 3R2BA 4FG9A 3PXKA 3NUYA 3DK6A 3IK3A 2ZMCA 4CVAA 5EHYA 3Q4UA 2OF4A 5LOHA 3BPRA 3LJ2A 3OF0A 3NIZA 4XP2A 4D55A 3IW8A 4KKEA 2YJRA 5J1VA 5M08A 3GQIA 4WA9A 3PJ1A 4OT5A 3LIJA 2R3KA 5BPYA 5KMMA 1H07A 2VNWA 4FTAA 4QQTA 5IEVA 3R6XA 1QMZA 2ZB0A 3DBDA 4JI9A 3R9NA 3OBGA 4UXLA 4IW0A 1XO2B 4PV0A 4CFFA 5JRQA 4BKJA 3RPVA 5CLPA 3R2YA 1W82A 4JVGA 2C5XA 2XVDA 3U9CA 4FL3A 3FQEA 2OW3A 4JQEA 4FGBA 5CY3A 3N51A 4GG5A 2QNJA 2X0GA 5EYMA 5IEYA 5K4IA 2B55A 1OIRA 3PXRA 4DYMA 3TDWA 1P4OA 1YRPA 3D2IA 3NR9A 2JDRA 4KBAA 4FSQA 4YU2A 2C6OA 4A9UA 2BRBA 3UOKA 3QAME 3ALNA 3FZSA 3QD3A 4JIKA 4GJ3A 3NEWA 3ZXZA 3ET7A 4CG8A 5I4NA 3E8EA 1PMNA 4AZWA 3UVRA 4BDDA 2J7TA 3NNWA 3OOMA 2F9GA 3CD3A 4U43A 2F4JA 4U42A 3NYVA 3EQDA 4O0TA 5KMIA 2R4BA 3F5UA 3FI8A 3D14A 3GVUA 2OJFE 4OBPA 3R01A 1TQMA 4IC7A 3ZS5A 4FIEA 2V7OA 3NUSA 2YCFA 1A48A 3DCVA 4XG8A 1M52A 2CNQA 5DEWA 3HRFA 4UMUA 3NRMA 1I09A 3R8MA 2PZ5A 4RWLA 4Z9LA 2R3OA 1Q3WA 4ERWA 2X39A 4DT9A 1R1WA 3DFCB 3COIA 3FZPA 3BGPA 4MBJA 4O2ZA 4ZTHA 4CYJA 4AAAA 4EL9A 4JRNA 2ZV8A 4FT0A 2QOQA 1WFCA 3PJCA 4K1BA 4P90A 4EOQA 5E90A 2WTCA 4IVDA 5CAVA 1PKGA 3CCNA 3A7FA 3LM0A 1QPJA 4WNKA 4FKWA 1J7LA 3VF9A 1TQIA 5JK3A 2YCRA 1KV1A 5EYDA 2JLDA 3SX9A 5LVMA 4CXAA 2PUUA 4NZWB 1R39A 3PJ3A 5KKRC 3JVSA 4D2VA 4QNAA 4RIYB 5AX9A 2GS6A 2WOTA 3R21A 4W4VA 5EM8A 4F9WA 4PDOA 2NO3A 2VD5A 3ZFXA 4GFGA 3GB2A 2E9VA 3VUIA 2XMYA 1R78A 3NUNA 1VYZA 3G90X 1L3RE 2X7GA 3OTUA 4XOYA 3ZCLA 3W2QA 4E6AA 5TOZA 4DG2E 3GC8A 4XG4A 2BIKB 2JKOA 4BTFA 4XS2A 4MXOA 3VS6A 4ANLA 2W4KA 3ZOSA 4R3PA 3LQ5A 5HOAA 4XG3A 3SXFA 3R7YA 3QTQA 1H1QA 2C0IA 1XBBA 4FL1A 5CVFA 5ANOA 5BVKA 4XV2A 1H4LA 4IX6A 3GOKA 3AD4A 4GUEA 4XHKB 4Z7HA 4KIKA 1OECA 4EZ3A 3QRIA 4ZSAA 3CGOA 3O50A 2X6EA 4M13A 4RPVA 3GUBA 3RWQA 4BDFA 4MBLA 5EOBA 1NVQA 3JS2A 4Q9SA 4QMMA 3OEFX 2X8IA 5HO6A 5TO8A 3UC4A 2HZNA 4BCPA 3UIUA 1MRVA 4O84A 1F5QA 2HY0A 5GZ8A 4OTDA 3V51A 1G5SA 1PYEA 2QURA 1FVTA 3Q4ZA 4G6OA 3EWHA 3T9TA 5HVYA 4EWHA 4L7FA 3DFAA 4KNBA 2PUNA 5BMSA 4YC6A 4ZJVA 3I6WA 1I44A 3SLSA 2GHGA 3DAKA 4PDSA 4DGMA 1H1PA 4JDKA 2J5FA 4TN6A 2XH5A 2YJSA 2JAVA 2OH4A 3EFWA 4DGLC 5T6KA 4Q2AA 5FLFA 3U54A 3MFUA 2IZSA 3EH9A 3QX4A 4HOKA 2ITWA 2ONLC 3MH3A 5TE0A 1FQ1B 4IWDA 4BBMA 5GZAA 4Q5EA 4PNKA 4MXXA 5C8MA 1OPJA 4UYNA 3QZFA 5CU2A 4MXCA 3EKKA 5KMNA 4F1TA 1DAYA 3PWYA 2O3PA 3O7LB 5DT0A 1OGUA 3DV3A 5EYKA 4H1MA 3R1SA 5EQEA 5IQAA 3DNDA 4YLKA 4QYEA 3PUPA 4ZZMA 3L1SA 4LV5A 5T68A 2I1MA 5CI6A 5C1QB 4FICA 4IVCA 4A4XA 4F99A 4QTBA 2RSVA 4YNEA 3BYMA 3N4TA 2HK5A 2R3IA 3KXZA 4QMSA 3ZSHA 4BWKA 4MVFA 3NMUF 4YTCA 2XIZA 5BVDA 4NFNA 4TYHB 3D7ZA 2CNUA 4C38A 4LL5A 5EG3A 4OTRA 2G9XA 3TT0A 3CR0A 2BALA 3UZPA 3P7BA 2X7OA 5M4IA 5L3AA 1R0PA 2W1GA 2X2LA 3DK7A 4BIBA 1KE5A 4YPDA 3G0FA 1Y8GA 3P86A 2YAKA 2PSQA 4PMMA 1LEZA 3WBLA 4D2WA 2VWYA 5I9YA 5ITAA 3P7CA 4OBOA 2R3PA 3PPKA 4CSVA 3R1QA 4D1SA 4U5JA 4CCUA 3ITZA 4JQ8A 3EFJA 4NW5A 4QO9A 3QQUA 4ANBA 4BDBA 4UYAA 2CSNA 2QOBA 3DKCA 3OXZA 4FTUA 5FXQA 2HXQA 3MVHA 4J95A 1GZKA 3DTWA 3UOHA 2P0CA 1UWJA 2XEYA 4DFXE 5LCJA 4YJQA 3N4VA 3QTWA 4GIIA 1H8FA 4YUQA 3CJGA 2JKQA 2W5HA 4Y83A 5CAPA 5HX8A 2J0KA 4AGWA 4ALUA 4DFNA 4G6LA 4I0SA 4I23A 4JR3A 3FEGA 2CKPA 4LMNA 5BVOA 5J9LA 4FSNA 3NUXA 4I92A 5CALA 3HMPA 3JXWA 4FKUA 2GFSA 2JKMA 4GMYA 4C3FA 4OTQA 5B7VA 4ZAUA 3RALA 3D5WA 2B52A 3TEIA 5IA0A 2BIYA 5E8ZA 3F3UA 3UC3A 3QZGA 1HOWA 4CFWA 2PE0A 4FEVA 5DNRA 1U54A 3C4ZA 2OK1A 2R5TA 4FBXA 4FX3A 3VUKA 3ORTA 5C01A 4QMPA 4YHTA 3CPBA 2VGOA 3NWWA 3LXPA 5I3RA 3RAHA 5TT7A 2HELA 3VBTA 3NUUA 3TZ9A 4ACMA 1S9JA 2XIXA 4BWPA 2VAGA 1NT2A 3PIZA 2QU5A 4FTJA 5CEKA 3GC0A 5A6NA 2VTSA 3R7IA 5L4QA 1PXMA 4EBVA 4M14A 2Y0AA 2J0LA 1JLUE 4EOMA 3FDNA 3KQ7A 2XB7A 3MTFA 3SV0A 3HP2A 4WSQA 4JJRA 4ANQA 4I24A 4GU9A 4TYJA 2BRGA 4YJVA 3ZSIA 3A7GA 3FMEA 3QA8A 3KMUA 4UZHA 1U59A 5AM7A 5K0KA 1XH7A 3DT1A 3V5WA 4AT5A 1OBDA 3GT8A 4OUCA 3RMFA 4BKZA 3RGFA 5IH5A 4TW9A 4N57A 3D83A 4XRLA 4TZRA 3SKCA 2HXLA 2XEZA 5IMEA 5EW9A 5FEQA 4ID7A 3ZH8A 4ZLZA 4JQ7A 5H8GA 4FG8A 4BTJA 3UNZA 3M1SA 3U87A 4EJ7A 3QTUA 4C2WA 3D5VA 2OBJA 4YTIA 5BYYA 3DXNA 2BZJA 5LVLA 3M42A 4IBMA 5LWNA 4MF1A 4HZSA 3EQRA 3PLAE 4HGLA 4O0SA 2HAKA 4MH7A 4X21A 4F65A 4FNZA 2IO6A 3A4PA 4OAVB 4LUDA 4F63A 3RKBA 1SMHA 2W4OA 2WD1A 1IG1A 2I40A 3GCPA 4NJ3A 3G6GA 1OL2A 3KCKA 1L8TA 2GNLA 4TYEA 4H36A 5L8KA 5ANGA 1WAKA 3F5XA 4BCHA 4U45A 3JVRA 3ZTXA 3QQJA 4C62A 2J4ZA 5KHWA 5L6OA 3PRIA 1U46A 3NX8A 2BZHB 5EI2A 4XCUA 5FM2A 1OPKA 1H00A 3L9MA 3OVVA 4FNXA 4U0IA 1IEPA 1ZLTA 4LOQA 3RZFA 4KIKB 4FV7A 3DDQA 3R02A 4O0YA 4ZK5A 4D4YA 4XV9A 3L9PA 3E87A 3LFFA 1STCE 4GW8A 4AOIA 3QCQA 1KV2A 3TG1A 4C4GA 3OUNB 4CFVA 4R77A 4FK3A 4YJRA 2YN8A 4UY9A 4G16A 4U80A 4Y72A 1YI3A 3G2FA 2CGUA 1OL5A 5I9UA 4PDPA 3NS9A 4EHZA 2IVSA 3N4UA 1VZOA 1G3NA 3LLTA 4HGTA 4DTKA 2G15A 2I0VA 3UVQA 5FTQA 2R7IA 3P9JA 4C58A 2FSMX 5LMKC 5EM6A 1KE9A 4EEVA 2VWZA 3CTJA 3D2KA 2F57A 3Q32A 3A8XA 2C1BA 3QHWA 3V6SA 5IQHA 5K5NA 2GNFA 5DFPA 4GT4A 5HI2A 5AWMA 4IFCA 4EONA 1PRYA 3GOPA 5D1JA 2ITYA 4X2FA 4FV9A 5C4LA 1Q8WA 4QMOA 4UV0A 3DNEA 4IEBA 2HENA 3R30A 4BGQA 5FP5A 1TKIA 2C6KA 5ETFA 2GNIA 2YWPA 2EXMA 4IDTA 5CSVA 3RHKA 4PTGA 3EQGA 4DFUA 3BHYA 2YM8A 2UZVA 4BCFA 4PPCA 2HWOA 5GJGA 5BVEA 1YXVA 3ODYX 3P0MA 4AW1A 4TYGA 4C34A 3W2RA 3BHUA 5LARA 3A62A 4WUAA 4D9TA 2RGPA 3PTGA 3AC5A 4EUUA 4GK2A 3BV3A 4CRLA 1IASA 5F94A 1K3AA 2C3LA 3GBZA 1WMKA 1DI8A 3MH0A 4S31A 5ANDA 4JT3A 5J95A 2IWIA 5JKGA 4QYFA 4ZSGA 1KE8A 3H9OA 3P1AA 4FVPA 3EN7A 3GQLA 2X81A 4S33A 3FZRA 2W7XA 1J1CA
chains in the Genus database with same CATH superfamily
4AW2A 3TJDA 1H1RA 4FZ7A 4YZDA 4QMYA 3FVVA 3A99A 3HV5A 3GI3A 5HX6A 5JN2A 4XOZA 4DN5A 3A7HA 2OIBA 1BYGA 3F6XA 3OTVA 2OZAA 5BUJA 1V1KA 4IWQA 4F7LA 1XJDA 2WMBA 2XJ2A 4U7ZA 4EH9A 4F9AA 2ZB1A 1UNLA 4YO6A 5J87A 4C2VA 3R73A 2CGXA 4FTOA 4WNMA 3EN5A 4EYMA 3DU8A 4L9IA 2Z8CA 2NRUA 4NW6A 5EI6A 4GYGA 4I3ZA 4GU6A 4NWMA 5GHVA 4DDIA 4FNYA 2QKWB 1GNGA 2E9NA 1WBPA 2HYYA 3G0EA 3R22A 4L53A 4RLKA 4BZDA 4CNHA 4P7EA 4ENYA 4AS0A 5I5ZA 4L6QA 3BYSA 4O22A 3QTZA 3ZDIA 2JDTA 4O6LA 4IHPA 2P22B 3OG7A 4PY1A 5ANIA 3AMBA 3Q4TA 2BDWA 2VTJA 3AGLA 4TNBA 4FTNA 1KUTA 1YO7A 3ZHPC 4ALVA 4CMTA 4ZTMA 5C03A 2XNNA 2E8GA 4K8AA 3E62A 4NK9A 4Q9ZA 2JFLA 1K2PA 3I79A 3MY5A 3H10A 4QP3A 4EYJA 3UMWA 4QOXA 4WO5A 2UW7A 3SXSA 4MXYA 5C8NA 3RNYA 3AC1A 2WTWA 3IG7A 4HCTA 4GEOA 1M2PA 5AV3A 3WE8A 5E1EA 3O2MA 5FG8A 5AP6A 2HW7A 3UQFA 2B9FA 3AJFA 4CFNA 5E9EA 3DAJA 3PJ2A 2W1CA 1PMEA 5HTIA 1YDRE 3DJ6A 5I9ZA 2GCDA 3FQHA 3ZLXA 5L2QA 5EDQA 5BX0A 3TIZA 2IZRA 4P5ZA 3Q6UA 5EW3A 4HYIA 3FBVA 2IZTA 3LJ0A 4AP7A 5BQ0A 2YZAA 5DMZA 3R8UA 1DM2A 4J8MA 4NKSA 5D9HA 3WF7A 4CQGA 2I0EA 2W9ZB 3CGFA 2UUEA 3ORLA 1XH8A 2V22A 2VTNA 3ELJA 4BICA 5K9IA 5HU3A 2ITQA 5CWZA 4DA5A 4YHFA 1YXXA 3JYAA 4FTRA 3F61A 2ONLA 2V62A 4EOOA 4R7BA 4F7SA 4IAIA 4I41A 4EWQA 3AD5A 1LP4A 5KMKA 2HCKA 4CEGA 4DDGA 4I0TA 4NSTA 4PRJA 2XBAA 4AUAA 2ZM4A 5HE1A 5IA3A 1KOAA 2YLEA 3ZRKA 5HKMA 1AQ1A 4KABA 1H28A 1W3SA 5KUPA 3BQRA 1GIIA 5CX9A 3LJ1A 5CXHA 4DWLA 1YW2A 2V55A 3HA8A 4F4PA 5DR2A 1ZMWA 4CLJA 4G75A 5HD4A 2YABA 3TACA 2ACXA 3MFSA 4X0MA 2JFMA 2ITOA 1JPAA 2B1PA 5HE0A 3EQFA 4NIFA 3P5KA 4QP1A 2CN8A 5F4NA 5L6PA 4G9CA 5EK7A 2XMXA 4NYEA 3SXRA 1PF8A 4EOIA 3OBJA 2R3LA 3WF8A 3JY9A 3FJQE 5CF4A 3RJCA 5I9VA 3FL4A 1LEWA 1OI9A 5AMNA 2W1DA 4DH3A 1PXKA 2YM6A 2BMCA 3B8RA 3BHHA 3EQHA 4PX6A 4RFZA 4WBBB 3TNQB 1Y91A 4HYSA 2C3IB 4O91A 3PRFA 1SVHA 5JQ5A 5J1WA 4EOLA 3PWDA 5M57A 3RBWA 3KRWA 4I5CA 2FO0A 1J3HA 3POZA 3W18A 3KU2A 3TUBA 3CY2A 4RIOA 3CIKA 3UIMA 1J7IA 3IW4A 1LUFA 4QP2A 2UW0A 4HNIA 5AUTA 1PXIA 4IWOA 3OT8A 3FQSA 3P79A 4FTIA 3BBTB 2YDKA 2WIHA 4EK3A 4JDJA 1BMKA 3PE2A 3C0IA 3UITA 2HZIA 1U5KA 3R8VA 3LOKA 4L52A 5JMSA 5M51A 3KKVA 5HD7A 2V6EA 2VRXA 4W8DA 5AP5A 3R8LA 2FYSA 2W06A 2IEWA 4AQKA 4PPBA 2ITZA 5DLSA 3P7AA 5IISA 1KE7A 4KIOA 3KRLA 4XG2A 5M55A 3Q5IA 2OFUA 4W4WA 2YZLA 1MP8A 2R3JA 4RWKA 5E8SA 3I7BA 5F95A 4JG7A 4YZNA 4A4OA 1YHSA 4O0UA 4YP8A 2PVLA 2FUG1 1E1XA 3BLAA 4KKHA 1P4FA 4NFMA 5IQDA 5HGIA 3AMYA 2A98A 3HX4A 5CEMA 3Q9WA 1OVEA 3DGKA 2EXCX 5DE2A 4BI1A 3HGKA 4FUYA 5K3YA 3T3UA 3V04A 2XK3A 4X3FC 4EH4A 1H24A 4YR8A 2WELA 4FZDB 4BIEA 3FI2A 4FKTA 4B0GA 2F49A 3PZHA 5CNOA 3R1NA 3U4WA 1ZMVA 4QNYA 2BFXA 3D5UA 1XQZA 2A1AB 3MW1A 2CCIA 5DEYA 5EW8A 1JBPE 2X2KA 4E8AA 4DTAA 5IA5A 3ATTA 1Y6AA 4DBNA 2VGPA 4EI4A 4MD7E 5F20A 2VN9A 5GNKA 3OP5A 5GZ9A 5HE3A 3RCDA 1Q8ZA 3IOPA 3MYGA 2E9UA 2BROA 2VTOA 5HIDA 4FZAB 4II5A 4RVTA 5EDRA 4BDAA 2FEFA 5AV0A 4USDA 2ZM1A 5E4HA 1W83A 4E6QA 4LMUA 2X4ZA 2W1IA 4G1WA 3WE4A 3NAXA 2EB2A 3W8QA 3WARA 1WBOA 4ZSEA 4RC3A 3W0NA 2Z7LA 5IH4A 2WU7A 3I6UA 3O17A 3PXQA 2OZAB 2XM8A 1XH9A 3UG1A 4HW7A 3UZRA 2IJMA 4EOSA 4DEGA 3E7OA 4E5BA 2GQGA 3NPCA 3C0HA 3LXKA 4QQ5A 2F6MB 3TZMA 4DCEA 3NZ0A 4EC8A 4AGDA 2YIXA 4M0YA 4FC0A 1W7HA 3CS9A 4K2RA 3MGYA 4KBKA 4UMPA 3LMIA 3QWJA 5KKRB 3KRXA 1H01A 5IUIA 5AP7A 1OKWA 2EXEA 5C9CA 3VS7A 5IA4A 4I6FA 5DIAA 5FM3A 4E93A 3RK9A 1V0PA 1JKSA 3QTSA 4CFXA 3O8TA 1LR4A 3ENMA 4DG0E 4EH3A 3FLQA 4IC8A 4KB8A 5IA2A 1VYWA 4PF4A 3I4BA 3ZM9A 4FSTA 1EH4A 2OKRA 3R28A 2IW9A 4O7YA 2RFDA 2JBPA 3C5UA 2GDOA 4AA5A 3DBQA 3TUDA 1M7QA 5ANEA 4WG4A 2UZNA 5AUWA 3EYHA 4XG7A 3SG9A 4HGEA 3DBEA 3PA3A 4IX4A 2C3JA 3EL7A 2PYWA 4UWBA 2OJIA 2R3GA 1Q99A 3UGCA 1RJBA 3EYGA 4I22A 1NW1A 4NKAA 4RSSA 3R7VA 3A7JA 4F6SA 5HBEA 5CNNA 5HBJA 1OL7A 3OZ6A 5H3QA 3SQQA 2XNBA 1OL1A 4RVLA 4FEQA 1SM2A 3O7LD 3AC4A 3R7UA 3MV5A 3QRJA 2XA4A 2OJ9A 4D4RA 2YM4A 3A7IA 3O23A 3DOGA 4W9XA 1CKIA 3UDZA 5E8WA 2J0JA 3GC9A 2QONA 5JFWA 4RQKA 3KF7A 4C57A 2PMLX 4OLIA 3PG1A 3P5JC 2VTHA 1RE8A 4NM5A 3OROA 5HHWA 5L6WL 2H96A 4KAOA 3S4QA 3F7WA 3RINA 4L01A 4M0ZA 3R1YA 5HQ0A 2PWLA 1BL6A 2CGWA 2VZ6A 5C27A 4H3BA 2JAMA 4I20A 5LMKA 3K3IA 2X6DA 4FSYA 5HNBA 4DH8A 1WZYA 5AR5A 4O7SA 2QODA 3TMOA 3VUHA 4R1VA 5KMJA 1ND4A 4AE6A 1NVRA 4V0GA 5CS6A 3NUPA 1YOMA 2QI8A 4IACA 3RAIA 3CY3A 2OSCA 2PUPA 2UZDA 5ICPA 2GHMA 4DFZE 3DAEA 5LWMA 3POOA 5FBOA 3V8TA 2BUJA 1F3MC 4DHFA 4IADA 4RC2A 3AT2A 5JQ8A 3EOCA 3GC7A 5M53A 4F0FA 5LMBA 1JNKA 1FPUA 4IX3A 3RP9A 3TCPA 4NIFB 4ITHA 3H9FA 3LCSA 1SNXA 2X0PA 3W2CA 4BY9E 2Y9QA 4N4SA 4FIIA 2CKOA 1CDKA 3R63A 4AXAA 3AKJA 5IDNA 3FXWA 1WBNA 4QYYA 3BE9A 3DXQA 1YWNA 4FV4A 4G3FA 4QYGA 2FSLX 3C4FA 2VX0A 1ZOGA 3MPMA 3LAUA 4IQ6A 4IZAA 4O7WA 1UU7A 3HMOA 3NCZA 4CCBA 4JBVA 2OXYA 4RJ7A 1Z57A 1YXSA 2ZV9A 2W99B 1U5QA 3F5PA 3SA0A 4RFYA 1NVSA 3SGCA 4D0WA 4CKIA 2CPKE 4E7WA 4P2KA 3WZUA 2X2MA 4I93A 3EKNA 4RJ6A 4BIDA 1OIYA 4B9DA 1XR1A 4BI2A 2YISA 3IGOA 5EHLA 3L8XA 3RZBA 3D4QA 4Q5HA 1OGYA 3L8VA 3DY7A 3MTLA 3LMGA 4DFBA 3TNWA 1U5RA 4FSWA 5DGZA 3QYWA 4JDHA 5AP4A 1OKVA 4Z7GA 3DLSA 3UP7A 5EKNA 3THBA 4YJPA 2FA2A 2Q0NA 4AAYA 4L7SA 2W9FB 5BVFA 1Q4LA 3REPA 2YWVA 3U6JA 4ANMA 3VHEA 3QFVA 3ZZEA 2ZDUA 4N6ZA 4QP8A 4EOPA 4OTWA 4ENXA 3RAKA 2J51A 4K11A 4WIHA 3DJ7A 3L9LA 5G1XA 3P23A 3VF8A 3VRZA 4EK5A 4NV5A 3H30A 5BV3A 2XJ0A 2J0IA 4AFJA 2XNGA 3VQHA 2JITA 4L42A 4WRSA 4UX9A 2WQOA 2B9JA 1H26A 4RMZA 4L46A 1PKDA 4X6QC 5H8BA 2E9OA 3C4EA 1YHWA 3UBDA 3QUEA 4X6RA 3UO6A 5FDPA 2XRWA 3CP9A 4K9YA 3ROYA 4DT8A 4YJSA 4I6QA 3A2CA 2B54A 2B4SB 2IZUA 4C4JA 3U6IA 1QPCA 4FV6A 3HAVA 4OW8A 2W5BA 3TNPC 3MJ2A 4R3CA 1HCLA 3JR1A 3DB6A 3EIDA 4IAFA 4WUNA 3WYYA 4C4FA 4D2PA 3BQCA 4IM2A 3LFNA 4XLVA 4PMPA 2QZGA 1R0EA 4FIJA 3LFCA 4EH2A 3C51A 3NSZA 3UQCA 2HIWA 3LMHA 2E2BA 2VX3A 5FEEA 2BAJA 3E93A 3U4UA 4ZZOA 3DKFA 2UW8A 4B8MA 4RQVA 2IF8A 5J8IA 3R83A 1Z5MA 2PK9A 2REIA 3TKHA 4GK3A 2VU3A 3F5GA 3KVXA 4O21A 4F6WA 4PDYA 3BWFA 3R9OA 3A60A 4BCJA 1ERKA 1P5EA 2ITVA 4A4LA 4EKKA 5GJDA 1VJYA 2JB2A 3ETAA 3OMVA 4D4VA 4IZ5A 4L00A 1SNUA 1WVYA 2YACA 4YTHA 1HCKA 4NUSA 3VA9A 2F2CB 3Q96A 2XARA 3GEQA 2XKEA 4B99A 5FXRA 2WMUA 4OTGA 2BZKB 2J6MA 3NIEA 4WRGA 4F64A 3PVWA 4DF3A 4GKIA 2JDOA 5C4KA 4LL0A 1UA2A 3ZEWA 4RVMA 5DPVA 4XP0A 4MEDA 2UZOA 3NNUA 4K0YA 4BDKA 4ZY5A 1M14A 3VS4A 3MS9A 2PZRA 4JR7A 4FV5A 3NW6A 4GK4A 2OGVA 2UW5A 3RK7A 3Q53A 3CD8A 3NAYA 5AV1A 4EORA 4DG3E 2CMWA 5IPJA 4O1PA 4PL3A 3NFFB 2UZWE 3R7GA 5L8JA 4R78A 2PU8A 3BGZA 3TDVA 4QTAA 2NP8A 2PVKA 2UW4A 2IW8A 4RX7A 2WMQA 5A4LA 3W0RA 1FINA 2PULA 1IR3A 1URWA 2QLQA 5ETAA 2WMRA 4IB3A 4UZDA 4ZOGA 4ZSJA 4BYIA 2JKKA 5E8TA 5AR2A 4IM3A 1J1BA 3QTRA 4E6CA 1BX6A 3FMHA 3H9RA 3I0OA 4USFA 4ERKA 2BVAA 2JDVA 3MIYA 3TV4A 4BDIA 2O8YA 4AGUA 3QLGA 2BTRA 2NNWB 2JIVA 3VJNA 3PVGA 4MYGA 4FKQA 5DVRA 5ANKA 3TTIA 3UDBA 2B0QA 4BCIA 3VS1A 4YJUA 1CM8A 4HYUA 3ORPA 1QL6A 4GIHA 4DEAA 3NCGA 4R5SA 3R7EA 4RC4A 2Y7JA 4S32A 3MFRA 4YHJA 4HVDA 5CVGA 4DCAA 5F9EA 1ZARA 3L0IA 1ZAOA 2CN5A 1ZY5A 4ONAA 4PPAA 4ZEGA 3HMMA 5HTBA 4D2SA 5LXMA 2O63A 3ROCA 2YIWA 4CZTA 5DYJA 3T8OA 4AGCA 5HG8A 5FP6A 3ZEPA 3QU0A 4AW0A 2H8HA 5BUIA 2FSOX 3IO7A 2C5VA 3EL8A 4HCVA 4BDHA 5A4TA 4FKPA 1YXUA 4V0GB 1Q97A 2ZV7A 2ZVAA 2GFCA 3QQKA 1CSNA 5AAFA 3PYYA 3BU3A 4MQ2A 2OXXA 3TN8A 4XBRA 4CT2A 4IAZA 3DTCA 3ZO4A 4EQMA 2C5OA 3PP0A 3U51A 4RBLA 2Q83A 1Y8YA 4W8EA 5M4CA 2FSTX 3I7CA 2VWIA 5AV4A 3QKMA 4YTFA 4FV3A 4DEEA 2W4JA 1B6CB 3QBNA 4FKGA 5K5XA 3Q60A 5IDPA 2GSFA 4X3FA 2CNVA 3EJ1A 3UO5A 5CTPA 4TKSA 5EM7A 4NM7A 5AP1A 4CFMA 3UJGA 4WD5A 1ST4A 3FI4A 3K2LA 3M2WA 2I0HA 4LQMA 5KNJA 1PMVA 3NYOA 4WG3A 3GFEA 1K9AA 4FK6A 4ZJJA 3LPBA 3WIKA 3KCFA 3W2OA 3SVVA 3EQCA 3ORZA 3KY2A 3OT3A 5HLPA 4F1OA 3GXLA 4A9SA 2WZJA 4FV1A 2ESMA 3VHKA 4RX8A 5CASA 2B9IA 3DQWA 1PMUA 4MTAA 3FLWA 5IQGA 5HIEA 5FUTA 4M97A 4B7TA 4TWCA 3PSDA 4M15A 4C59A 4DLIA 4NCTC 3F3WA 4U3ZA 1UV5A 4ZS0A 2ZDTA 4KD1A 4F0IA 3ZFYA 1KWPA 2RFSA 3GU8A 4QP4A 5KO1A 4YZBA 5IEXA 4LOOA 4O83A 2XIYA 4L3JA 3KXXA 5DHJA 4E6DA 4KSPA 4F70A 4QD6A 4QMZA 5JGDA 3RPSA 4L8MA 4FKVA 1Z9XA 2OZOA 1PJKA 3MJ1A 4IVBA 3LCKA 5LJJA 4FNWA 4CYIA 3BL7A 1ZMUA 3LFQA 4ZMFA 1W98A 2QCSA 2WFYA 3LFAA 3FI3A 3ZUTA 2XJ1A 1W84A 2Y4IC 3VUGA 3E8CA 2OWBA 3UYSA 4GG7A 4E5WA 5HU9A 5LVPA 3Q2MA 3BCEA 4FYNA 4YSMA 3I0QA 4ASDA 3FY0A 2WO6A 4EBWA 5KCVA 3LLAA 3UDTA 3FLZA 4RX9A 4CKJA 4AS2A 4NV2A 4HNFA 5AFVA 4XNEA 2QQ7A 2XZSA 3FXZA 5HLNA 3S0OA 4O81A 1W2DA 3QUPA 3V3VA 3F69A 3LVPA 2C47A 1BUHA 1W2FA 2VWWA 3DZOA 4G3GA 1YXTA 3F3ZA 4YBKA 5EHOA 3LCDA 4J96A 3SRVA 3TJCA 4W9WA 2UZTA 3WF6A 4RJ4A 3G51A 3WZDA 5DR9A 2XTRA 2V5QA 4QTCA 3TNHA 3E3PA 1XMMA 2H6DA 4XEYA 3SC1A 3QZHA 3VJOA 2P2HA 4NM3A 1TQPA 4CFUA 2HY81 5JZNA 3DBCA 2QR7A 4MNEA 4CT1A 3BI6A 4E4NA 4N0SA 4JX3A 4O0WA 1OKYA 3MY0A 4RVKA 4ZSLA 4BL1A 1OB3A 3ZO2A 4K6ZA 1R3CA 4MD9E 2XS0A 3UQGA 2QD9A 3VBXA 5A4CA 5IG1A 5KX8A 4E4XA 1VEBA 5CZHA 5A54A 3SG8A 4LV8A 3V8SA 5J9ZA 5J7BA 3KC3A 4EUTA 4AW5A 5AADA 1XBAA 1O9UA 3VS3A 2FVDA 3V6RA 4ZLYA 4LV7A 4TL0A 4A07A 3O96A 4O7TA 3W0SA 1ZY4A 5FWKK 2GNJA 3GGFA 4WSYA 3R71A 2UZEA 2YIRA 3OS3A 3NW7A 1H0WA 3TZ7A 3MB7A 1UU8A 3LFEA 5AUYA 2C6TA 2Z60A 4QPSA 4HEA1 4HPUE 3BLQA 2XK9A 3JUHA 3QD4A 4O4CA 4ANSA 3TYKA 2CJMA 4X7QA 4JG6A 3IONA 2DS1A 2BRHA 4DITA 3W0MA 4KSQA 2KKMA 3VVHA 3H4JA 2QOCA 3VW6A 2BRNA 3CPCA 5ETCA 3COHA 4BDGA 3QQGA 3KB7A 2BRMA 3BHVA 1BI7A 4F7JA 2XCHA 4D9UA 4B4LA 3FC1X 4C02A 4J1RA 3VBQA 3PVBA 4MHAA 4FMQA 2XAMA 5B2MA 2BKZA 1SYKA 3IDBA 2IN6A 3QALE 4GFMA 4I1ZA 4IB5A 4QPAA 3LHJA 2RF9A 5J79A 2F7EE 4XUFA 5HORA 2RIOA 5KE0A 4QMUA 2GQRA 3AMAA 2K19A 4ASZA 2XCKA 5FBNC 3IOKA 3QCYA 5B2LA 5AR7A 4RJ8A 4AS3A 4LYNA 3FKLA 2P4IA 4BR3A 3EMGA 2WMXA 3Q4CA 4BDJA 2RLDA 4U9AA 3OWKA 4DBXA 4Y5HA 4D2TA 1FOTA 2RFNA 1E1VA 4I4FA 1H0VA 2QOLA 1CKPA 1Y57A 3FLYA 3HMNA 4LDTA 3VNTA 4AT4A 2XBJA 4YZMA 2F7XE 3F3VA 3ATSA 2ZW3A 3VO3A 3QZIA 3UP2A 4QMXA 3BV2A 3KMWA 4WOVA 4JRVA 4M67A 3R8PA 2PPQA 3RPOA 2QOFA 1PXNA 3SD0A 1A9UA 4IWPA 3LQ8A 4IANA 3PXZA 1TDPA 3AGMA 3F2AA 5J5SA 4XLIA 1Q8UA 1QCFA 3TWJA 3HMIA 3ZRLA 1GZNA 2VWXA 4GUBA 5DOSA 4EOKA 1U54B 2VTRA 4ACDA 4K18A 5CU6A 4PMTA 5EQYA 4FYOA 2UVZA 1WBVA 3BU6A 4TWOA 3WZEA 2H34A 2ERKA 4KKGA 5AR4A 2HWPA 3IDPA 3OWLA 4ASEA 1FMKA 4QRCA 4CV9A 4HVSA 4E4MA 4XYFA 2OF2A 1FMOE 4LUEA 5JEBA 2GTNA 3NDMA 4J7BA 4N6YA 5ACBC 1YOJA 4ZY6A 2KTYA 5K4JA 3G33A 2WKMA 5IQEA 2HZ4A 3V01A 4R5YA 1O6YA 3AT3A 4ANOA 2O64A 4U81A 2OIDA 2PVFA 2RL5A 3AG9A 4DGOA 4U8ZA 3QHRA 3FMLA 5CQWA 4ZLOA 3W55A 4L43A 2NPQA 3OWJA 5A6OA 3VUMA 4IAAA 3DBFA 5CZIA 4BCQA 4IIRA 2UZUE 3VS0A 4X3FB 4XJ0A 4EZ7A 3VW8A 2YM5A 3R9DA 2XTQA 3QQFA 4XMOA 3EZRA 5HBHA 3RNIA 4I6LA 3RM7A 3WF5A 3RVGA 4R1YA 4EK4A 3MESA 2R3HA 4WNPA 3UG2A 2I7QA 5BVNA 4U44A 5G6VA 4LGDA 1PY5A 3EHAA 3EQBA 4X3JA 5E7RA 3ZM4A 2EVAA 4A7CA 4DFYA 5BVWA 4BGGA 4C35A 4O7RA 1UNHA 4TNDA 2RFEA 2G2HA 4X2GA 4RJ3A 3IAS1 3HLLA 4S2ZA 4XV1A 1UU9A 5DBXA 3FHRA 4QYHA 1NXKA 3PG3A 4LGHA 5AP3A 2BR1A 3W10A 4H58A 4TWNA 3GCUA 4FVQA 4F9BA 4FIFA 3GP0A 5CYIA 4AN3A 1LPUA 4RGJA 4FKSA 1Q8TA 2J5EA 4AACA 4DH7A 2X9FA 2YIQA 3HVCA 4IE9A 3F2RA 5JGAA 4FKLA 3O8UA 1CTPE 3WZKA 1IAHA 3IECA 2FB8A 3VS2A 1BL7A 4O6EA 4O7NA 3EQPA 3KF4A 3OXTA 5C26A 5IMXA 3NW5A 3BELA 2XIRA 3QRKA 2WTKC 4L3PA 2WEIA 2P3GX 4ZTQA 1SJ8A 2H9VA 4TWPA 1ZOEA 3CTHA 4FEUA 3KXHA 4G31A 3KVWA 4M7IA 1Q3DA 2A19B 5JGBA 2YCSA 3K5VA 2R7BA 4F09A 1YWRA 4FEWA 1TZDA 5AUVA 3FPMA 3PY1A 2XNMA 2Z2WA 4EK8A 5DI1A 1P2AA 3IDCA 3PLSA 5F1ZA 4GJ2A 3LXLA 5CAQA 2BILB 4RWIA 4GKHA 3PY3A 4EOJA 1YI6A 3DLZA 1XKKA 3G9NA 3P4KA 5HCXA 2R64A 2GQSA 3LFBA 3B2TA 1JKKA 3ORNA 3SDJA 1YHVA 3SRVB 1JKLA 3TTJA 2X9EA 2YM3A 4GYIA 4MK0A 3IW5A 2VV9A 3G5DA 2QHMA 2QVSE 3ULZA 4CQEA 5M4UA 2QKRA 3BU5A 1FVVA 3KN6A 4PL4A 2PMIA 3RPYA 3ZYAA 1GIJA 5A14A 1M2RA 3C4CA 4FKJA 5IA1A 3U9NA 3ORMA 3ZBFA 4JBPA 4MNEB 5CEQA 2P55A 1Q62A 1MQBA 2WNTA 5HVJA 4AZSA 5CU0A 3MDYA 5CAUA 4IB0A 2CAZB 1YDSE 3HAMA 2AC5A 2PMOX 2CKEA 2XK4A 5HIBA 3S95A 2J50A 4FSZA 2J0MB 2WMVA 2CLQA 2EB3A 4YMJA 2C6EA 1MRUA 2WMSA 3ENHA 4BFMA 3OCTA 4CMUA 2W0JA 4BCOA 5JH6A 2C68A 4FIHA 4V01A 3KFAA 3EN6A 2ZV2A 1JOWB 5IQFA 3VUTA 4IM0A 2R9SA 1QPDA 4L68A 4MD8E 5E8YA 4FR4A 3OUKA 2JIIA 3F88A 4R6VA 3OCBA 2JDSA 3C0GA 4R7HA 3C5IA 4YJOA 4OTFA 2DUVA 4XV3A 2QO2A 4JAJA 1G8KA 1DI9A 2RADA 4UALA 5IUGA 3S1HA 3EFLA 2BHHA 2R3RA 2UW6A 2W1FA 2Z02A 3C9WA 3PY0A 4DLJA 1PYXA 4IVAA 2LAVA 2OU7A 5CSXA 4OTHA 4ACCA 3QGWA 5DT4A 3TXOA 3KK9A 1GZOA 4FOCA 3TNIA 5BYZA 4E4LA 5CF6A 3KREA 5I9WA 2YDIA 4R7IA 2F7ZE 4DINA 3UIXA 3UOLA 3UPZA 2GNGA 3E92A 1H08A 4PQNA 1YQJA 3HP5A 3FNBA 3RI1A 3QA0A 2PZIA 2WGJA 3ALOA 3BLHA 3BYVA 4J8NA 4P4CA 4JBQA 3ZUVA 5IUHA 2WIPA 5M44A 4RFMA 3BIZA 3W2SA 3M11A 4A9YA 4DGNA 1GAGA 2X0QA 4PUZA 5E8UA 2R3QA 2OI4X 3PJ8A 5KBRA 1UWHA 4GXTA 5IF1A 5M4FA 1PXOA 2P33A 4A06A 4QQCA 2PZYA 4BF2A 2JBWA 1PHKA 5L2IA 2XRUA 4C8BA 5KHXA 4U41A 2XKDA 4NCTA 2P2IA 2PZPA 4O86A 1WBTA 2ETDA 4KRCA 4RLLA 1H1WA 5M09A 4JNWA 4AA0A 4HGSA 2R2PA 3D5XA 4FTMA 4MWIA 5D10A 1W8CA 5AP0A 1XWSA 3U8WA 2CGVA 4ZTRA 3FKOA 4BGHA 4D58A 2C6LA 2UW9A 1OKZA 2VUWA 1XH4A 5CXZA 2W17A 2EU9A 2GPHA 2QC6A 5AIRA 3KXMA 4ORKA 4FKRA 4WNOA 5KMLA 3QL8A 4BWXA 3ULIA 4APCA 2V7AA 2ZM3A 3DKOA 4FKOA 3OD6X 4HCUA 2WTVA 2UVXA 4O4BB 4J71A 3R9HA 2GMXA 3PXFA 2FH9A 3UZTA 2CKQA 2R0UA 4XP3A 5FEDA 2O65A 4EH6A 4HYHA 3MI9A 2Y6OA 1ZOHA 1AGWA 3HNGA 1BI8A 4JDIA 5AUXA 3KMMA 3NLBA 3KK8A 3PFYA 2WU6A 3IKAA 4AXDA 2QOOA 4FTLA 2O5KA 4M84A 3Q9XA 3HL7A 2HW6A 2GTMA 2PL0A 5HESA 5HNGA 4FEXA 5TKDA 3AD6A 1IRKA 3DXPA 2PVYA 2BCJA 3E8NA 3EB0A 3I1AA 2C0OA 2GU8A 2JEDA 1X8BA 3DPKA 3L8PA 3QQLA 3QCSA 4U79A 3F3TA 2W1EA 3NVMB 5HCZA 4DH1A 1OITA 5AR8A 2V1CC 4GFOA 4J99A 4MF0A 1WVXA 4AZEA 4BCMA 4Y46A 5LVNA 3B55A 5DRDA 5A4QA 2XANA 4YJNA 1WBSA 2VWUA 4BVUA 4U40A 5H9BA 2C30A 4G6NA 3KULA 4QPMA 3QC9A 5DH3A 3PIXA 1OMWA 3NVKI 4LFIA 5FRIA 4YSJA 5HICA 3QGYA 3D15A 4TPTA 3U55A 4RZWA 4BJJA 4KIQA 2JB1A 3OC1A 5I9XA 3PE1A 1H1SA 4ACGA 5HO8A 3PSBA 1NY3A 2YEXA 5JFXA