3LJ1A

Ire1 complexed with cdk1/2 inhibitor iii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
404
Chain Sequence
b'NFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQFRTSGWRAPELLEESNNLQTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Flavonol activation defines an unanticipated ligand-binding site in the kinase-RNase domain of IRE1.
pubmed doi rcsb
molecule keywords Serine/threonine-protein kinase/endoribonuclease IRE1
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase
total genus 107
structure length 404
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06479 Ribonuc_2-5A Ribonuclease 2-5A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lj1A02
1.20.1440.180 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3lj1A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lj1A01
4PP7A 5C8NA 2FUMA 5IPJA 4C3RA 5IA3A 3HP2A 4Q9ZA 3OCTA 3WF9A 3ULIA 5AJQA 1HOWA 5J5SA 3DBDA 4Y5HA 3LFAA 4LGHA 4FKQA 1VYZA 4D4VA 3BEGA 4IX3A 2PE1A 4E1ZA 4GH2A 1OM1A 4CFWA 1W83A 5CALA 3F9NA 2XMYA 3HYHA 3BLHA 2VWUA 3F69A 4DBXA 1Q8YA 4DBNA 5E8UA 5AEPA 4Z16A 1MUOA 3IG7A 4AFEA 5JMSA 3BYUA 2YCQA 4IVCA 3NIEA 3MFSA 3NUSA 4RT7A 3RKBA 2WMBA 3I6UA 3PG3A 2I40A 2F49A 2UZUE 3P08A 3KVWA 3O7LB 2QOBA 4IADA 4R6VA 3FI8A 1M14A 1V0OA 2HZ0A 2ITVA 1YOJA 4HOKA 3ZOSA 4FV8A 4EH3A 4I4EA 2QOQA 2ZM1A 4JIAA 3UIUA 2B53A 3LXPA 4FT3A 3FL5A 5ETCA 2J4ZA 3DZQA 4WG3A 2W4JA 2WGJA 4HJOA 4P4CA 4ZTQA 3C50A 4ZY6A 3FKLA 2R3RA 4O0TA 3I60A 4NYEA 2VX3A 4YC8A 1A06A 3DJ5A 3L9MA 4FTUA 5BYZA 4G5JA 2X4ZA 4GJ2A 4FKLA 1Y6BA 2HXLA 2GS2A 3AC5A 4U80A 1BI8A 3MS9A 4QP9A 4O83A 4BHNA 4TWOA 2PU8A 5FLFA 3OP5A 2G01A 4NK9A 3DK3A 5CAPA 4EK4A 4DFZE 5E8VA 4ASZA 5FXRA 3LFSA 1H01A 3EN9A 4FSQA 3BYMA 2R3QA 4CZUA 1OI9A 4L42A 3DXQA 1NA7A 2B55A 3ZC5A 2C47A 5LCJA 3SKCA 2X2KA 3DXNA 3FZPA 5ANGA 3O96A 4AA4A 4BHZA 3UGCA 5HESA 3ZUVA 1P5EA 3R30A 4L44A 4ZP5A 3UOKA 3QC9A 3WZUA 3ZFYA 3GEQA 3QYZA 3NDMA 4JS8A 3R7UA 1F5QA 2V5QA 3U54A 4BIBA 3R2YA 2XKCA 4FK6A 1J1BA 2AC5A 2CKPA 3DU8A 5C27A 4IHPA 2YEXA 4PPAA 4FKUA 5AV2A 4AUAA 2XJ2A 4ZJVA 5AWMA 5GZ8A 5HE2A 2C6LA 4CQGA 1W82A 5E8YA 4ZK5A 2W1EA 2IZUA 2VO6A 3H0ZA 3II5A 2VTQA 2GFSA 4F9WA 4J96A 4M0YA 3A2CA 3PJ1A 2OKRA 4FBXA 2H96A 5E92A 1U54B 2YABA 4YURA 1E1VA 5EM5A 2I6LA 3FY2A 3BGQA 4OUCA 4CT1A 2EU9A 4YZNA 2WD1A 1B38A 2BALA 2X9FA 2YM3A 3EQIA 2VU3A 4RIWA 4RVLA 4AXAA 3W55A 3BBWA 3MPTA 4BTJA 1ZRZA 5IQFA 3MN3A 3QGYA 3QWKA 2PHKA 5EHOA 3F5PA 5LVLA 3FKNA 4DH1A 1OUKA 1JQHA 2JDRA 4QP8A 3KMMA 4RZWA 4AS0A 4QPAA 3R7OA 4FEXA 2IG7A 4ALUA 3ZRKA 1DI8A 4U45A 3PLAE 3ORNA 1XJDA 3U6IA 2XK7A 3EN6A 4II5A 2QLQA 4O22A 3KB7A 1GZOA 2QU5A 3FMJA 3ZTXA 2JIVA 2OGVA 4RFMA 3Q4UA 3W2QA 4FTMA 3BHYA 4A4XA 2ITXA 3C5UA 4G6OA 2PMIA 3EN4A 4FTNA 4M12A 1O6KA 2VWVA 5C8KA 3VVHA 4FE2A 3PA4A 4XG7A 2X8IA 4FIJA 3V8SA 2WMVA 2OI4X 3WF5A 4BCNA 4EC8A 4GG7A 4WBBB 3EFKA 5HO6A 2HXQA 2GHMA 3F5UA 3MA3A 2QOIA 2OXXA 1O6LA 3E8NA 4FZDB 5HTIA 5F9EA 1QMZA 3OT3A 5CVGA 4DITA 4BCFA 3G0EA 3ZONA 2Z7RA 5HX6A 2FSLX 3DBEA 3Q2MA 5HVYA 4X6RA 3JYAA 2WTWA 5AV3A 3FZRA 2JIUA 3O8PA 5IQDA 5HBHA 4X2JA 4HVSA 4BF2A 4YO4A 4JIKA 4MNFA 3HRBA 5HE0A 3OXZA 3CIKA 5KMIA 3I7BA 1XBCA 5JKGA 4G9CA 3BU3A 3G9LX 4PPBA 4AGCA 3BLQA 5KMLA 4BB4A 4IZYA 4JAJA 5D11A 3VS0A 2UZNA 1OL6A 3C1XA 1ZARA 2Z7QA 4RLKA 3ITZA 2XIYA 5HE1A 4EJNA 4FMQA 4AT3A 2PZYA 3CCNA 3SC1A 2PZ5A 3MIYA 1YWNA 4EK3A 3OS3A 2YAKA 2YWVA 2XNPA 2ITPA 3LFBA 3PY1A 5DPVA 5ANJA 5E8SA 4MAOA 4J52A 1OB3A 3FY0A 4ZSGA 3FC2A 2XBJA 5DT3A 2JDSA 3FWQA 3ZMMA 5A4QA 3JXWA 3MFRA 3C0GA 2DUVA 2ERZE 4PWNA 1DI9A 4TYHB 4XH6A 3DDPA 1H27A 1RW8A 5EH0A 4EQCA 4FNXA 4N57A 3P23A 2QVSE 1ZOGA 5AX9A 3TI1A 4QTCA 1YVJA 4GK2A 5AX3A 4QTAA 1S9JA 3KK8A 3P79A 2GNGA 3NPCA 3H30A 4FVPA 2G15A 2PZPA 3LQ3A 4EK5A 1OGUA 4WUNA 5DH3A 3QKMA 4OTWA 3ZSHA 1Q5KA 3PRFA 3U87A 2GNFA 5M09A 3LCDA 5DGZA 4EZ5A 2VWYA 4K77A 4UY9A 2A27A 4MXAA 2IN6A 3R7GA 3F66A 3A7HA 4X2GA 3E7OA 3A62A 3ZFMA 4CKRA 3FSKA 2SRCA 3LMIA 3T8OA 4IFGA 5M57A 2NPQA 4UMTA 4ZTSA 4O7LA 4L7FA 3F3TA 4QMWA 4QTBA 3LCOA 4IB5A 5DVRA 4CRLA 3FI4A 1R1WA 4AE9A 2HW7A 4PDOA 1ZAOA 1SNXA 3LFNA 5JFSA 5J7HA 4JNWA 4IB3A 3VIDA 3NW5A 3MESA 2HWPA 2EB2A 2JKKA 3VS3A 4RVTA 1DM2A 4EBVA 5D1JA 3D9VA 2ITNA 2VWXA 3ZZWA 2F2UA 5D41A 3UQFA 3EH9A 2JD5A 4HGSA 2W9ZB 4OW8A 4YUQA 4KS8A 3KREA 3DDQA 4C2WA 4O6LA 3LZBA 4FKRA 4KBAA 5BQ0A 3BLRA 3ZC6A 4MNEB 1WMKA 2BAKA 3BU6A 3QZGA 5HOAA 4USFA 2XJ0A 2VWWA 3V8WA 4HVDA 3HX4A 3IW7A 3PUPA 5C1QB 4XX9A 1ZXEA 4OBQA 4AGUA 5KO1A 2QURA 3PSDA 5JFWA 2GNHA 5AUVA 3EQFA 4IANA 1XBAA 4FOBA 4BICA 4XHKB 3IGOA 4FG7A 2QOLA 4BIDA 3D2IA 1IAJA 2ZOQA 3QUEA 4FTOA 3UO4A 3V01A 4MQ2A 3UMXA 5B2KA 3UIMA 4OLIA 2G2IA 3NLBA 3D15A 4EOIA 4AA5A 5M07A 4LL5A 2E9PA 4QMTA 4D9TA 3LXKA 5LWNA 5JGDA 3DKGA 5AAFA 4O27B 3TIZA 3QGWA 4YJTA 2XA4A 2ZDUA 1JKKA 4FL2A 4AQCA 3OY1A 1M7NA 1P4FA 3ET7A 1ZMVA 4QYEA 5J7BA 2QR7A 4U42A 2ZDTA 3R6XA 3LFFA 3COIA 3BGPA 2WU6A 4L01A 3R9OA 2DQ7X 4WIHA 3BV2A 4BDFA 3EN5A 4Z55A 2WTKB 3U8WA 2YLFA 2C0TA 3G0FA 4XBRA 5IA4A 1Y57A 2W05A 4K11A 3VUTA 4GYIA 3TL8A 3B8QA 4AW5A 4F0IA 2XYNA 2CLXA 1FOTA 4W9XA 1RQQA 2JKOA 5I3OA 4HW7A 4UN0C 2WFYA 5IH6A 4Z7GA 2ZV7A 4L46A 5I9VA 3S2PA 2ITWA 2CLQA 3ALOA 4FEUA 4O0VA 1MRUA 3NYOA 1UKIA 4EUTA 3MTLA 4O21A 3HAVA 4L53A 3ODZX 1CKPA 3QCSA 3OVVA 1PF8A 5EHLA 1GIHA 2BIYA 3LFQA 4FVQA 5AR2A 2UW9A 4L6QA 4KWPA 1W0XC 2X9EA 3FDNA 3BWJA 2F7XE 5CVHA 2BRGA 1Z5MA 3V8TA 5AAEA 4C4IA 3QX2A 2IW8A 5AV1A 4IX4A 4D2PA 1QCFA 2CN5A 4JQ8A 3DKCA 4Q5EA 4DEEA 2R3PA 3S0OA 3DAKA 3CLYA 2YWPA 4HNFA 3UYTA 4JI9A 5HCZA 3UYSA 3ORIA 2IVVA 3FMDA 1CDKA 2QG5A 2Y4IB 4IW0A 3OXTA 3BPRA 1NVQA 4IM3A 4DGGA 3R1NA 3GCQA 3QA8A 5KKRC 5KZ0A 4JX7A 3FQEA 1H0VA 4UEUA 1P4OA 2ZJWA 3NUXA 4ALWA 1WBWA 2V62A 3QFVA 4C3PA 1JSUA 3PG1A 4FT9A 4I0TA 5F20A 5K0KA 2J9MA 4EK8A 1YXVA 4DYMA 1M2RA 2VTAA 1PMVA 4YC6A 5BVKA 4W8DA 3A60A 4AOTA 3PP1A 3ZEPA 4EQMA 4NT4A 4BIEA 1UWJA 3FHIA 5A4CA 4QMVA 1KV1A 5L2TA 5EFQA 2O2UA 1E9HA 2FVDA 3RINA 4BWKA 2YIXA 3COHA 3OOMA 4OGRA 2BZJA 2FSOX 3A7JA 4FIGA 5KCVA 1YHSA 1ZYDA 3GGFA 4DFYA 3AD4A 3S00A 1KE9A 2GCDA 4M69B 5FTOA 3CGOA 5ETFA 3KXGA 3D83A 3Q9XA 1H00A 3LM5A 1KWPA 4BDBA 4G31A 3AD5A 1JKSA 3FZ1A 3ZLYA 4BCJA 3TEIA 4ZZOA 5GHVA 3RGFA 4WRGA 4OAUC 4CG9A 3KC3A 4EZ3A 4K9YA 4QMPA 4I1ZA 4QMOA 5HG8A 4RWIA 5HG5A 4DC2A 4ZY4A 5L8LA 3GP0A 4RZVA 4A9YA 3G2FA 1PYEA 3W10A 5M4UA 3TJDA 2UW4A 4IM0A 4XJ0A 2X81A 4TKSA 1APME 4TNDA 4B0GA 2XKFA 5CTPA 2RL5A 4HVGA 4K2RA 5CSXA 1H28A 1ZYCA 3Q5ZA 2CHLA 4MH7A 4J7BA 4P7EA 3GFWA 2BZIB 3OWJA 4PPCA 4LOQA 3ZLSA 1M2PA 3IW4A 3MIAA 3TDVA 5CZIA 4F70A 1FINA 2CPKE 2HELA 4C61A 4Y8DA 2E2BA 4K0YA 4ZSJA 2WTJA 4MCVA 4LV5A 1ZY4A 5LARA 3DT1A 3TACA 4S33A 1YI4A 4ZXTA 4C02A 3FQHA 4GL9A 5DT0A 3BIZA 4RA5A 5EHYA 4AW2A 5A4TA 2J5EA 5A14A 3CBLA 3POZA 4RIYB 4IXPA 4WG4A 3VUDA 2VGPA 5K4JA 4HYUA 4CZYB 3DB8A 5HTBA 5KBQA 5ACBC 4TY1A 5JZJA 2NRYA 2W1GA 2JGZA 4JQ7A 3JVSA 4EH8A 2PUIA 3ZO4A 5GINE 3DNEA 4F0GA 4BCKA 3HP5A 3REPA 3LE6A 4E93A 3FJQE 5DIAA 1AD5A 3NS9A 2NO3A 4FV5A 4QQCA 4UALA 3BHTA 2BDFA 2UZOA 3MVHA 1XR1A 3GXLA 4M66A 5J95A 4AACA 5L2IA 4MF1A 4BDJA 4IC7A 4EHVA 5JGAA 3TV7A 4RJ6A 5E9EA 4G3DA 1M52A 4RFZA 1OL5A 5HNGA 1Q3DA 2GS6A 4RGJA 2W4OA 2WPAA 5H9BA 3TTJA 2UZWE 4C4HA 2EXEA 5K4IA 3RM7A 2XRWA 1GZ8A 1PY5A 1SVGA 4E26A 4BRXA 1XH9A 4ID7A 4ZLYA 2C3JA 5AP6A 3WBLA 1PMEA 5HU3A 4G1WA 5LVNA 3C4EA 2C5OA 2W99B 1CKIA 5CU4A 2A2AA 4CV9A 4AOJA 3HNGA 3UZPA 5EDQA 2YM7A 1LR4A 1SVHA 1JLUE 3TUBA 3DK6A 4F08A 5BVNA 3G9NA 2R3IA 4O7TA 2ITUA 3GBZA 4DHFA 4DINA 5IQEA 2ESMA 3DY7A 4IWOA 4BZNA 2CDZA 1PHKA 2OWBA 4QQ5A 4RWKA 4EOQA 2BRBA 1PMNA 1K2PA 2XVDA 3L9LA 5LOHA 1OITA 2BRNA 3U4UA 5E91A 1J1CA 1YQJA 4FR4A 4DH8A 3IKAA 4HZSA 2VX1A 2PTKA 4MVFA 1ATPE 3PVWA 4S31A 4YJUA 3RPRA 3SOAA 4D4YA 3AG9A 3QRTA 5IQHA 1NW1A 5HCYA 1VYWA 4PDSA 4M69A 3E8CA 1OUYA 4RJ8A 3JR1A 4DFXE 5EK7A 2XK6A 3QC4A 2P2HA 2HZ4A 3DA6A 3E3PA 2A19B 3GCSA 4XG2A 4MD8E 4YJRA 5CLPA 5T6KA 4EH7A 3KXXA 2C6EA 4ANQA 3G90X 3QUDA 5FXSA 5CU3A 4CQEA 1XH6A 3RZFA 3QRKA 2WIPA 4IEBA 2VZ6A 1AQ1A 3BBTB 4E4MA 4D2TA 3VULA 3C0IA 1PJKA 1WAKA 3FPQA 2EWAA 4C57A 3PY0A 4MD7E 2PWLA 3R02A 2JLDA 3HUBA 3MPMA 2PVRA 4YSMA 5F95A 5FDXA 2JC6A 4CKJA 5A3XA 3AMAA 3RTPA 3ZEWA 4GMYA 4K1BA 5EW8A 4CFFA 1I09A 3QD0A 3V3VA 4GFOA 3F6XA 3P86A 5BVOA 4NU1A 3SVVA 3HV5A 4XOZA 5FD2A 4TPTA 5H2UA 4I0RA 1JBPE 5CF8A 2Q83A 3N4VA 4M0ZA 2C5XA 3NWWA 5CEIA 2XP2A 1A9UA 3EQHA 4O91A 4KIKB 3ULZA 4I24A 3FI2A 1XHAA 1WVWA 4FKTA 4O0XA 4DLJA 5IQBA 4QNAA 4E6QA 2F4JA 4KABA 1LEWA 3VBTA 4DTKA 2PZRA 4DE4A 2BZHB 1H08A 4HYIA 3ZYAA 3D2KA 2HZIA 2FSMX 4QOXA 2C6MA 3GT8A 5J9LA 4DFBA 3CTJA 4AZSA 1Q61A 4XV1A 3P1AA 3PJ8A 2YFXA 3UO6A 4HCUA 4PF4A 3UODA 3ORXA 4ZAUA 5HORA 4D5HA 2O63A 4YNEA 3CP9A 3ORLA 2I0EA 4ACMA 2QU6A 3QWJA 5A4LA 3A99A 4G2FA 3PY3A 4YU2A 3GU4A 4FUXA 1L8TA 3GU5A 4I41A 4A4LA 4JBQA 3FI3A 4KRCA 3VUGA 5J1VA 3T3VA 3RPYA 3AMYA 5CNNA 2PK9A 1SM2A 5C4LA 4FG9A 3ERKA 2BAJA 4P2KA 5ANOA 5FRIA 3DFCB 5EI6A 4FEVA 3R9HA 3F82A 1B6CB 3HECA 3LJ0A 3O8TA 4D28A 4WG5A 3QCYA 4OBOA 4OTQA 1XH7A 2I0YA 2WEVA 3OROA 1BX6A 4YZ9A 5KKRB 5GIPE 3TN8A 4R77A 3SW7A 2EXCX 5M56A 4BVUA 1MQ4A 3KCKA 3ZO1A 1B39A 3VJNA 1TVOA 3HUCA 2QONA 2C3IB 4FV1A 4X7QA 3P78A 2JFMA 2B4SB 5J9ZA 2R3NA 4XG6A 1GY3A 3ZSIA 5I4NA 4G6NA 3PPKA 4AW0A 5IMXA 2JEDA 3TZ7A 4AW1A 3PVGA 4BDGA 2YIRA 3BKBA 1F0QA 4IB1A 3MA6A 2C1BA 4LM5A 4E20A 4ARKA 3QQGA 3SX9A 2QKWB 4E5AX 5A9UA 4BWPA 3GCPA 4EYJA 3M11A 4XLIA 3VBXA 4AFJA 4YSJA 3LFCA 1UU9A 4YMJA 1K9AA 3EQDA 3O71A 5IMEA 4P5QA 5IISA 3KMUA 2Q0BA 4YHTA 4XYFA 4FUYA 3U4WA 2WZJA 3LQ5A 3UVQA 3IW8A 4YTFA 4IBMA 5BMMA 5IUGA 4I23A 4PTGA 1FGIA 3RI1A 4F6UA 2X6DA 5BPYA 4EOSA 3ZUUA 4BGGA 4WNOA 2O5KA 3PSBA 2X7FA 4H05A 5IF1A 1H07A 3KXMA 3KRXA 4DT8A 5K9IA 3EZVA 3VBYA 1FPUA 4FKJA 4B8MA 3E93A 1UV5A 1ZWSA 3E92A 3KF4A 3QYWA 5EM8A 2C5VA 3PXKA 4D55A 3LFDA 4ZIMA 4MBIA 4AP7A 5D9HA 3MY0A 5IQIA 3NEWA 3NAYA 5B7VA 4R5YA 5CZHA 3TV4A 4QPSA 3I4BA 3MGYA 4HPTE 4ERWA 4C7TA 5M44A 4QMUA 3S95A 1QPDA 1Z57A 5IKWA 4RIOA 2OJGA 4MKCA 5ANDA 2WQBA 3FYKX 3Q96A 4IZ7A 4FT5A 3FZTA 4KIKA 2R3OA 4FZ7A 2J90A 5JQ5A 5IH4A 4S34A 2YCRA 2XJ1A 4FKIA 4RG0A 4YZDA 5AIRA 4ANSA 1RE8A 3CR0A 4MF0A 1GZKA 2X7GA 3ZZEA 3QTRA 1GAGA 2W06A 3QU0A 1SYKA 5DBXA 4I21A 4DEHA 3FZSA 2C3KA 4YHJA 1VEBA 4HZRA 2WNTA 3LJ2A 2HWOA 4GUEA 4UYAA 4D4RA 3EHAA 4BDAA 4I6FA 4WOVA 3EB0A 3QALE 2W17A 4CLJA 3T9IA 3FXXA 4AGDA 2R2PA 3VF8A 3EQBA 3EQCA 2B0QA 4BDDA 2ETKA 3COKA 1S9IA 3MI9A 5CEKA 4O0UA 3RM6A 3PE2A 5JT2A 4CMUA 1PXIA 2JITA 2BKZA 3D94A 3KL8A 2W1IA 1CTPE 3W33A 1VJYA 2B9HA 2QODA 1REKA 3Q5IA 5KMMA 1M7QA 1FGKA 2NRUA 3CEKA 1GIJA 4BDHA 3EYGA 4JJRA 2H34A 3RK9A 5HZNA 4CFXA 2WB8A 3IDPA 4E5BA 3FEGA 4USEA 3F3ZA 3ZRLA 2WQEA 4NUSA 4O1OA 4QMYA 3V6SA 2CGXA 4DH7A 3FXZA 3TNHA 2YLEA 2WAJA 4FV4A 4NIFA 3VBVA 3RPSA 2V7OA 1OIYA 1VZOA 3FLYA 2VTMA 3QRUA 5JZNA 4PDYA 3NYXA 4TWNA 1PXJA 2WMSA 2OZAA 3EFWA 3OWLA 4M68A 5EYCA 4CEGA 5EI2A 3KY2A 4AZWA 4ACHA 3CKWA 4O7ZA 1QPEA 5EOLA 4CFNA 5IDNA 1Q8UA 4FV9A 4JR7A 4ZS4A 1YWVA 3MBLA 3O50A 3MVMA 5CANA 5HLWA 2IVUA 2P0CA 3MB7A 4G17A 2CKEA 3R71A 4QP1A 3WIGA 4BKZA 4L52A 4DGMA 1FBNA 2GNJA 2RFDA 3DNDA 5GZ9A 1URCA 5HBJA 4GUBA 4QYFA 4C4EA 3MJ1A 4EH6A 2A4LA 2O0UA 4NFNA 3E64A 4QMQA 5M55A 2VO0A 5KHWA 4FSYA 3N51A 3ID6C 4CGAA 4ACCA 3HA8A 3MH3A 3L8VA 5CU6A 5DHJA 2XNOA 3HL7A 3VHEA 3E8DA 5HBEA 2WIHA 3IDBA 5CEPA 2FB8A 2UW6A 1UVRA 1WFCA 3W2OA 5D12A 2O65A 2BUJA 4HVIA 3LJ1A 1GZNA 3K3JA 5LXMA 1V0PA 4E73A 4PL5A 4C2VA 5CAUA 4A07A 4XG8A 3FE3A 5CXHA 4QNYA 1JWHA 1R78A 3EYHA 1OL1A 2VTNA 1WBNA 2XK4A 3RK7A 2OFVA 4O2ZA 4RC2A 2BHEA 3C5IA 4D2RA 1Y8GA 5FGKA 2RSVA 4UXLA 3QX4A 3U6HA 3P9JA 3VS1A 3UIBA 3QD2B 4CTBA 4NW6A 3NYNA 3DQXA 4C33A 4ACDA 4FI1A 2VTJA 3R8VA 3E7VA 4KKHA 4RQVA 3UNZA 4GJ3A 4TYEA 4Y73A 4BCMA 2GTNA 1MP8A 3RALA 4EKLA 3RHKA 5KMOA 4MYGA 4K6ZA 4I5MA 4I20A 4NM0A 5CSVA 4F65A 1MQBA 3R7IA 1KV2A 3LIJA 1BI7A 2O3PA 3ZFXA 3PTGA 1DAWA 3WF6A 1UKHA 2BFYA 2E9UA 2W1HA 3JS2A 3NRMA 4F7NA 3UJGA 4G3GA 1G5SA 2QO7A 4JVGA 3WE4A 5BYLA 4CT2A 1UU8A 4DFLA 2J7TA 4GSBA 4TZRA 3Q04A 3BZ3A 2WTCA 3G51A 4WNKA 2H8HA 3BE9A 5AM6A 5LMAA 4CYJA 3U6JA 3HAMA 1U59A 3AC2A 5AM7A 2VNYA 4IAIA 4KKGA 3LPBA 3OZ6A 2GNIA 3Q3BA 4DEBA 1QPJA 4R8QA 1YKRA 5I0BA 4I3ZA 5HIDA 5HVKA 4O6EA 4GKIA 1UU3A 3BYSA 1XH5A 3CPCA 4FVRA 5CI6A 3CS9A 3ZM4A 3GCVA 4IVBA 4ENXA 2W0JA 5I9XA 3CD8A 3DKOA 5FWKK 3IS5A 2OF4A 4QD6A 4WUAA 5HIBA 4KKEA 2PUPA 5H8GA 2X8EA 2WMWA 2PMOX 2Y9QA 4IWDA 2I1MA 5DFPA 5LCKA 1JOWB 2VWBA 2OJJA 2UZVA 4F9CA 2W9FB 3QKLA 4MX9A 4H3QA 3KQ7A 1FVRA 1OVEA 2YA9A 4N70A 4EC9A 4JBPA 4IFCA 3WYYA 4Q2AA 2ITZA 2AUHA 4FV2A 3NYVA 3DTCA 2WTVA 5CT7A 5HE3A 5IZFA 5JRQA 2GDOA 3QD3A 2BILB 3THBA 4Y83A 5M4FA 4W8EA 4ACGA 5A6OA 4QYGA 1W8CA 5F94A 5BVDA 5EKNA 3PPZA 3QBNA 2PE0A 3COMA 5AA9A 4ZTNA 1Q8TA 3AC4A 5AR8A 2V55A 5AFVA 3ZHPC 4ZY5A 2OIBA 4RJ7A 1IR3A 3ZSGA 4IWPA 3NW7A 4OTHA 4BI1A 1J7UA 5IEYA 3TZ8A 2OLCA 4UMRA 3QQJA 1YRPA 5I9UA 4FTRA 3V5LA 2B9FA 3AT3A 4K8AA 5BUJA 4GCJA 4L68A 3C4CA 5EM7A 4Z7HA 5I9YA 5IUHA 4HPUE 2B9IA 4RRVA 4G3EA 2VO3A 3BI6A 3OFMA 3V51A 3H3CA 2W1FA 1O9UA 1Y91A 4OTPA 4F1OA 4R7BA 4I5CA 4H58A 4FKVA 4BCIA 4C62A 4O7VA 4WA9A 4AX8A 3EFJA 3KK9A 2OICA 5CY3A 4ZSLA 4NH1A 4ORKA 5EW9A 4JR3A 5GJGA 3Q4CA 4L9IA 4IIRA 4EHZA 2YIYA 4UMUA 1DS5A 2VGOA 4U3ZA 2XNEA 2YAAA 4S2ZA 5E8XA 2GQSA 2HENA 4ANNA 4E6DA 3O17A 4U8ZA 3NW6A 3HGKA 3NIZA 3F5GA 3TTIA 1K3AA 4N6ZA 3TNIA 4A4OA 2OSCA 5EQPA 2C6IA 3Q9YA 5DT4A 5AUZA 3VS7A 5CEQA 3D7TA 4FV7A 1KE5A 5M4IA 4IMYA 4RIXB 5FBNC 4PQNA 3MJ2A 4MXZA 3KCFA 5FDPA 3TDWA 4RMZA 5HEZA 4Y95A 1GOLA 3Q6UA 2ONLC 3R1SA 3UNJA 5AAGA 2X39A 3HVCA 4R5SA 2V22A 4U43A 4XG3A 3LCSA 4U79A 4LRKA 3CC6A 2A0CX 3AC3A 4D2VA 3I5ZA 1YHVA 3OBGA 3DCVA 3FMLA 4MXOA 4E5WA 2YERA 2YIQA 4EHEA 4YTHA 2Z02A 3GC8A 2BRHA 3KN5A 2ZMCA 4FKOA 4HCVA 3DBQA 3S4QA 2XIZA 3BCEA 4JDIA 4MXCA 5DI1A 1CM8A 1UNLA 1TQMA 4ERKA 4KIQA 1PXNA 3CQWA 1ZMWA 4IZAA 4NJ3A 3VS4A 2OH0E 1FMKA 1OIRA 3F3UA 3FLWA 3K2LA 4JDHA 3R22A 4TT7A 5JQ8A 3M42A 3QQKA 3EIDA 3R1QA 4A9SA 4U40A 2FSTX 4WD5A 2Y6MA 3OCGA 5KZIA 5KX8A 5LMKA 2C68A 3ZBXA 4HYHA 4BC6A 4CFMA 5DE2A 4GT3A 3IGGA 4M84A 5KUPA 1U4DA 2WO6A 3Q52A 5J5TA 2R7IA 4JRNA 1PXOA 3KF7A 3OEFX 2VTRA 3VBQA 5HLNA 4IJ9A 4H3BA 4GU9A 1G3NA 4C37A 3QL8A 2JDTA 3OD6X 2OU7A 3DBCA 5ANEA 4PX6A 3FSFA 4CFVA 3QZFA 5CQUA 3PWDA 5EW3A 4IDTA 3VWAA 1V1KA 1QL6A 5CASA 4GVAA 4G5PA 4MWHA 5E8TA 4C3FA 5KMNA 3Q9ZA 3ATTA 1O6YA 4OTDA 4PMSA 4PUZA 1YI6A 2VTSA 5AP5A 4RBLA 4QMMA 5CAVA 3VO3A 4KSQA 3TM0A 3PXFA 4UXQA 2WU7A 3R63A 2OO8X 2XNBA 3I1AA 4R3CA 4F0FA 4ZS0A 2VRXA 4IVDA 4AZVA 3I7CA 4I6QA 4OTIA 4EWQA 5HTCA 4RFYA 4FNYA 4JDKA 1Q8WA 3ZCLA 1ZZLA 4AN2A 3PIYA 2C6OA 5AP2A 2Z8CA 5CT0A 1Q8ZA 4RX7A 4HYSA 2XK8A 1YXUA 3TJCA 3D7ZA 1AGWA 3RBWA 4OT6A 3R0TA 4EOMA 3V5WA 4JQEA 5EDRA 3OW3A 4ZLOA 2Y8OA 3T3UA 3R8ZA 4FT0A 3L1SA 5E8ZA 4N0SA 3AD6A 3C4XA 3D5XA 4UWYA 3GU7A 2J0MB 4Y46A 3PWYA 3Q9WA 2F7ZE 3KRJA 3MV5A 3MB6A 5HNIX 3UZTA 3ALNA 3FPMA 4E8AA 3G33A 3DAJA 1BYGA 2AC3A 4BI2A 5AUTA 4IX5A 1NVSA 1BKXA 3EZRA 1YDTE 4LGGA 4EOLA 3FLNC 3BX5A 3QTIA 3UQGA 5FUTA 3WOWA 1Q24A 4FNWA 3C9WA 3VHKA 5M4CA 2C69A 4RX8A 4JG6A 2XKEA 4G3CA 4YBJA 5AV4A 4RIXA 2GTMA 4ZSAA 4FT7A 1I44A 4LV8A 2WQMA 4D1XA 3V6RA 3ANRA 3VUIA 1GJOA 1Q99A 2CCHA 2WMUA 3QZHA 1LP4A 4V05A 3IONA 3LLTA 4EH9A 4BBEA 1H26A 3FMHA 3GQIA 5CYIA 1Q97A 4YZMA 3TNQB 5J8IA 4QP7A 4DFNA 5IQCA 4FA2A 3NAXA 4QTEA 4ASEA 2YJRA 2QO9A 3UZRA 4JBOA 5HX8A 3IQ7A 3D5UA 3NZ0A 3R8LA 3IO7A 3UPXA 2P3GX 3PIXA 4E4XA 3OCBA 5HD7A 3CQUA 3E3BX 3FXWA 2BIKB 4HCTA 2JIIA 2R3MA 2WTDA 4IZ5A 4FZFB 4ZOGA 5CEMA 3I5NA 4F7LA 4A9TA 4G6LA 2UW5A 3S1HA 4OAVB 2YDKA 4IJPA 4PL4A 3WF8A 1P14A 1OKYA 3WIKA 2PSQA 1YXSA 3SXFA 4JXFA 1OKWA 3QQFA 3QTZA 5FXQA 4PMPA 1KOBA 4QT1A 3O7LD 3ZXTA 4FODA 5L3AA 5C4KA 4QMZA 2QR8A 3PFQA 1BUHA 4NM3A 4QRCA 2EB3A 5CF5A 4QPMA 2RFNA 4EJ7A 4B99A 1OKZA 5BYYA 3DS6A 1J7IA 4DA5A 4FSUA 2YHVA 4HGEA 5CU0A 2UZTA 5EOBA 2JBPA 3MH2A 2RF9A 4C34A 1GNGA 2W1ZA 3NNXA 5CAQA 5J87A 5EYDA 3HV6A 4H39A 4WO5A 2GMXA 5ETAA 3QLFA 2Z7LA 2V0DA 3LAUA 5DEWA 3ETAA 2IZSA 5CS6A 3ATSA 1T45A 4TL0A 3K54A 5M53A 2BRMA 2C5YA 4O1PA 4YZBA 4X6QC 2C5NA 4I22A 2R0UA 4R3PA 3ACJA 5H8BA 2BMCA 3PE1A 2UZDA 5HIEA 4XP0A 3OBJA 1IA8A 3PYYA 4U9AA 4GRBA 5A54A 3Q2JA 5L8JA 4L3JA 4QMNA 5DR2A 2XRUA 4ZEGA 1H1PA 2PVYA 3CJGA 3MPAA 1RJBA 4ZMEA 2OW3A 5KHXA 3E8EA 3RVGA 3BYVA 3FMEA 3QKKA 4ANLA 4APPA 2XKDA 3KEXA 4X3FA 4N4SA 2DWBA 1DAYA 2W1DA 4FSTA 4LUDA 2FO0A 4MHAA 2C0OA 1L3RE 2UW0A 2VTTA 4TW9A 3U9NA 4XV2A 4F6SA 4JG7A 2CCIA 3VBWA 3BHVA 3VS5A 4YJPA 1H1SA 4I94A 5E8WA 2CNUA 3CTHA 4TN6A 2BKKA 3LW0A 4LQMA 2Q0NA 2XIXA 4CTCA 3E63A 4LI5A 4AWIA 4XBUA 2WOTA 2FYSA 3ZH8A 5AADA 4FIFA 3SLSA 3HMIA 2UZLA 3DBFA 5AMNA 1OL7A 2R3LA 3WZEA 4RSSA 3NNWA 5LWMA 4FTQA 4PTEA 3AC8A 3NSZA 3M1SA 3I81A 3QRJA 2P4IA 4ZTMA 3KRWA 3RAHA 4DEDA 3SXRA 5A4EA 3P4KA 2E9NA 4IAFA 5ANIA 3UE4A 4EWHA 4EZ7A 5DMZA 4O7SA 3HRCA 4H1MA 5FTQA 3RPOA 5CF6A 4BCOA 4ZSEA 4R78A 2A1AB 3VC4A 4DCAA 4DG0E 4PP9A 2HAKA 4J95A 4TYIA 3W2CA 4NZWB 2C6KA 2KULA 4R3RA 4YLKA 3FC1X 5BVWA 3BWFA 3F5XA 5DR6A 3R8MA 1M2QA 3GFEA 3RAWA 4EK6A 4YTCA 4XEYA 4F99A 3OUKA 3B2WA 2CGWA 3KMWA 2QOOA 2HK5A 3QA0A 4YTIA 3LMGA 2ITOA 2UZBA 3O0GA 4KUJA 1Q41A 5HQ0A 2WMRA 4KD1A 3PXYA 2C30A 4BCQA 5TKDA 3NUYA 5J9YA 3D5WA 3NVKI 4JBVA 1YW2A 2ITYA 4QYHA 5HG9A 5C01A 3LXNA 1A48A 4J8NA 3IOKA 4CLIA 3KRRA 2B52A 3NCZA 4QMXA 1ZLTA 2J0JA 3FV8A 4DFUA 4FK3A 2XH5A 5LVMA 1LEZA 4UWCA 4YJVA 3PJ3A 2GHGA 4J99A 4W9WA 3CGFA 3H9RA 4UBAA 1H0WA 3VS2A 4R7IA 2X7OA 4JOAA 3R9NA 2UVZA 3ROYA 1FVVA 2ACXA 4Y85A 1U46A 4LG4A 1Q3WA 4FKSA 2GNLA 1IA9A 4AZTA 5IQAA 4X21A 4HNIA 4FGBA 3EFLA 4BDCA 2BDWA 3PXRA 2B1PA 3NCGA 3QQHA 2GHLA 3DAEA 3BHHA 4D2SA 3H0YA 2YCFA 1OPJA 3RCJA 4RVMA 4ZJJA 1UA2A 4OTFA 1ZOHA 5B2MA 4GFMA 4G9RA 1R3CA 4PMTA 2FA2A 5K5NA 2JDOA 2YACA 4CV8A 1PMUA 3LM0A 3I0QA 5TR6A 5LMKC 3FAAA 4BFMA 4XOYA 3BE2A 1JKTA 1WVXA 4J53A 3TG1A 4TRLA 3ELJA 3PXQA 5IA0A 4LFIA 4YJOA 4J98A 4TXCA 4ITIA 3M2WA 4P90A 4ENYA 5JN2A 2WELA 4NIFB 5E7RA 3BELA 4BBFA 5EYMA 4TYJA 4IWQA 2PVKA 2OZAB 4QMLA 1PXPA 4KA3A 5IQGA 3UOJA 2OJFE 5I9ZA 2ETRA 4XV3A 4O96A 5JRSA 4RWJA 2QKRA 5L6PA 4BDKA 5A6NA 2WQNA 3H4JA 3K5VA 4F7JA 2C1AA 2X6EA 1OPLA 4X2FA 2VWIA 3F2AA 1W7HA 2Z7SA 3MDYA 3ORPA 4WRSA 2WXVA 4FYNA 5FM3A 4A06A 4QQTA 5L6OA 3UC3A 3DJ7A 3SA0A 4S30A 3RJCA 4UX9A 1G8AA 4XUFA 3ZXZA 3MYGA 3QF9A 4TYGA 5HVJA 2J0IA 3CPBA 4ZTHA 4RQKA 3KGAA 4F1TA 4FIEA 1Q4LA 1ND4A 3N4UA 5E4HA 3OXIA 4J71A 4YP8A 5EQYA 2UW7A 4ANMA 2E9VA 2RIOA 3HMPA 3LVPA 5LVPA 1OL2A 5G6VA 2PVFA 4FSZA 1M17A 2QNJA 3P5KA 1UU7A 2ONLA 5DA3A 4CYIA 5EI8A 4BN1A 5DLSA 4XCUA 1PXLA 1OMWA 5FM2A 2YZLA 3ORZA 2ITTA 2ZMDA 5HGIA 3ZS5A 2YJSA 4YPDA 4R1YA 2XYUA 4BCPA 4GU6A 2XCHA 2CJMA 4CD0A 2OF2A 1URWA 3DJ6A 1CKJA 3I79A 4M15A 3W1FA 5DYJA 4NEUA 4ZLZA 4GT5A 4W4WA 3W2PA 4FV3A 4DCEA 3PA3A 4YBKA 3UP7A 2JKMA 2UV2A 3DB6A 4GK4A 4JAIA 4AOIA 5BUIA 4CVAA 4NFMA 3LFEA 2QI8A 4V0GA 3PZEA 3LKMA 3SGCA 4YC3A 4GT4A 4LYNA 4J97A 4J8MA 3TIYA 4KBCA 3QUPA 4CKIA 4E7WA 4RC4A 2XEYA 3QCQA 2PUNA 3DV3A 3R00A 1U5RA 3POOA 4MBLA 4BYJA 3H9OA 4EOPA 1BL6A 3UG2A 1EH4A 4LMNA 2Z2WA 5HO7A 1YOLA 4FSRA 3ORTA 4IC8A 3T9TA 5BX0A 2IWIA 3HV4A 4ZZMA 2HZNA 4YGAA 4F09A 2ETMA 2IVTA 4DEGA 4GKHA 3WARA 3CQEA 4AN9A 5DNRA 4KINA 4Y72A 5ITAA 4B9DA 2VTHA 3HDNA 4PDPA 3OTUA 5HKMA 3R7VA 3KXZA 4L3LA 4YLJA 4UZHA 4ZJIA 5C8MA 4AZFA 4WBOA 2PL0A 1LUFA 4EQUA 3KN6A 3G6GA 1UNGA 4QP3A 3F2RA 1SNUA 3BRBA 3ORMA 4QO9A 3OC1A 4IAYA 4NM5A 2VTLA 2X2MA 2HCKA 3FMKA 1R0EA 4X2KA 1ERKA 4BBMA 3P7BA 3R2BA 3TNWA 2XCKA 1OIQA 2R9SA 3V5JA 3BV3A 5L2SA 2FH9A 5IU2A 3FUPA 3RNYA 3WF7A 1HCLA 2J5FA 2Y4PA 2YM4A 4FIIA 4M13A 1YOMA 1YDSE 4JLCA 3S3IA 5ETIA 4NL0A 4RX9A 5TT7A 1H1WA 3E88A 4KB8A 5KE0A 2HIWA 3HLLA 5KMJA 3R21A 4BGHA 5DR9A 5IA5A 4GS6A 2GQGA 3SV0A 3SQQA 4E6AA 3EJ1A 4I5PA 2YDJA 3W32A 4FOCA 5JK3A 2WTKC 4U44A 4FTLA 4DEIA 4X2NA 1PXMA 2QD9A 3NUUA 5DOSA 3TNPC 3OOGA 4JX3A 3ENHA 3QAME 3CTQA 4GV1A 4MBJA 4O7RA 3NGAA 4AA0A 1Y6AA 3N4TA 4L8MA 4APCA 4F64A 4U6RA 3D0EA 2CMWA 2QC6A 3A8XA 4MQ1A 2XIRA 2YIWA 3TCPA 4FTAA 1H4LA 2BPMA 2VAGA 2FGIA 3CSVA 1OKVA 3U9CA 2ZB0A 2RG6A 2UVYA 2R3FA 5EQEA 2XM8A 4ITHA 4XG9A 3VNTA 4YJSA 3MSSA 2Y6OA 3NR9A 3TT0A 3UG1A 3ZU7A 2ZAZA 4MK0A 3MY5A 1WVYA 2HOGA 5HG7A 2H9VA 1WBVA 2EUFB 5TO8A 4BDIA 3LXLA 1YXTA 3B2TA 3RAIA 5HLPA 2VNWA 3ORKA 4L3PA 3QTUA 4S32A 2BTRA 4LMUA 2IPXA 4X3FC 2C4GA 2OIQA 3I6WA 1WBOA 3GC0A 3GB2A 2B54A 1R39A 3RWPA 3ROCA 2ZVAA 3QXOA 3RMFA 1YXXA 3OWPA 3MH0A 1OPKA 5DRDA 2OJIA 3ENMA 2XEZA 1SVEA 5FTGA 4AG8A 2BFXA 2CNQA 3AQVA 3VRYA 2J0LA 3V04A 4AT4A 3GC7A 1UWHA 3TKUA 3BGZA 3EQGA 3GQLA 4RVKA 4QYYA 4O7NA 3Q60A 2Y4IC 4F7SA 2JKQA 5DN3A 2J50A 4E4LA 1PKDA 4YHFA 4V01A 3WZDA 3GUBA 2R3JA 4TWPA 2P2IA 2J6MA 4C58A 3A7FA 5KNJA 3D7TB 3JUHA 5HU9A 2VX0A 2YM6A 4LGDA 1JVPP 4BTMA 4I92A 4E3CA 2BR1A 2PMLX 4BTFA 3C4ZA 1F3MC 3JVRA 3Q32A 5GNKA 4M67A 4AU8A 5CSPA 4MEDA 2RFSA 3W16A 2CN8A 4HGTA 3NX8A 2YCSA 4JT3A 5CSWA 4LOOA 4HGLA 4L7SA 4DH5A 3DFAA 2YDIA 5AUWA 1R0PA 3MTFA 2GS7A 4FV0A 4PNKA 3W18A 2XF0A 3FMNA 4FV6A 4FGRA 3OW4A 3HZTA 2PYWA 5E90A 5D10A 4YNOA 1H8FA 2ERKA 2F2CB 3JY9A 4C38A 4B7TA 4M14A 4ANOA 3KU2A 4EBWA 3A4PA 1WZYA 4IQ6A 2E9OA 4OT5A 4I0SA 5CI7A 3R7YA 2W4KA 2XUUA 4UWBA 2G2FA 1UNHA 4XS2A 4BCGA 4DH3A 2VTOA 3PIZA 5J1WA 4DF3A 3QTXA 4KIPA 4U5JA 5J79A 2BZKB 3SG9A 5JGBA 5JSMA 2BHHA 2DYLA 3DQWA 2X8DA 3R1YA 2ZV9A 4FKGA 4X3JA 3UO5A 4O0YA 3TWJA 3FQSA 4M8TA 3PXZA 4U0IA 4FTTA 4NKSA 5L8KA 1JPAA 3O8UA 4UZDA 5GIOE 3HMOA 4AT5A 5L2QA 1J7LA 3OG7A 4JL9A 3VUKA 4H36A 4O84A 4FL3A 2PVLA 4XG4A 1Q62A 4IX6A 4Q9SA 2WMQA 4D2WA 5M08A 2JDVA 4XMOA 4N6YA 2RGPA 3DTWA 3ZLXA 2BDJA 3ACKA 3C7QA 1T46A 3CXWA 3R8UA 4W4YA 3V5QA 4D4SA 3SOCA 4A9UA 2WKMA 4BZOA 3MFUA 4CCBA 1H24A 3EWHA 4Z9LA 4ITJA 3A8WA 3F3WA 5DWRA 3OY3A 4I4FA 3HDMA 1JSVA 3L8PA 4Z3VA 5GJDA 1J3HA 4BDEA 5BNJA 4RJ4A 4U3YA 2VN9A 1OZ1A 3RPVA 3WZKA 3QTSA 4AAAA 3LCKA 4O0SA 3UOHA 4C36A 5FP6A 5EKOA 2HYYA 2JBOA 4CMTA 5CU2A 5IG1A 2ZV8A 3V5TA 1LPUA 4G16A 2LGCA 2PE2A 1KE7A 4FSMA 3IW6A 4JDJA 3GC9A 3HV7A 4D5KA 4F6WA 2R3HA 2F7EE 2GU8A 5H3QA 4QP4A 3RHXA 4AE6A 5L2WA 3B8RA 1MRYA 3Q4TA 4B6LA 5IEVA 1U54A 1IAHA 3DPKA 3ZBFA 3W8LA 4C8BA 2IJMA 2JAVA 2R5TA 4NCTC 5AA8A 3G6HA 3GU8A 2W1CA 3TZMA 5I5ZA 4D1ZA 3G15A 4BZDA 2PVMA 3OHTA 1V0BA 4RWLA 4CXAA 5IEXA 5KBRA 2H6DA 3NNUA 3QTQA 4RJ3A 5M06A 2G9XA 4FSWA 5DEYA 5KMKA 4LOPA 4IVAA 5HD4A 3NUNA 2R4BA 3AC1A 3UNKA 2ZYBA 5ACKA 2RKUA 4MTAA 1OECA 3FLZA 4XRLA 4DGNA 3N9XA 3PDTA 4DTBA 1YI3A 3NUAA 5FEDA 1JKLA 3MVJA 1WBPA 1REJA 4KS7A 4B8LA 4DGOA 2YISA 3PLSA 4PNIA 3QLGA 3SG8A 2AYPA 3EKNA 2Y7JA 3BYOA 1H25A 2IW6A 3BU5A 2QO2A 4WSQA 4YJQA 1ZZ2A 3BQRA 4C4FA 4MXXA 3CY2A 4FEQA 3ZDUA 1XKKA 3CY3A 3EL8A 1WCCA 2DS1A 2ZV2A 4CCUA 3AT2A 4BGQA 3AT4A 1XH4A 4RA4A 4BI0A 1VR2A 3MY1A 4PMMA 4AF3A 2PULA 4BY9E 1OIUA 3PZHA 3SXSA 5I3RA 3AOXA 4OTRA 2OK1A 2CGVA 2CNVA 4NTTA 5JFVA 2PMNX 4DEAA 1PKGA 4FC0A 3RAKA 1HCKA 4OTGA 3ZDIA 1NY3A 4IDVA 3HEGA 4U81A 4O81A 2J0KA 4D1SA 3EL7A 3A61A 4FX3A 4F1MA 2QLUA 1RDQE 3RCDA 4XV9A 4BKYA 1IASA 4OR5A 2UUEA 1KUTA 2PUUA 3CKXA 3JY0A 3NNVA 2HY81 3Q53A 4FSNA 4GG5A 3R04A 4FNZA 5D7VA 5GZAA 4O0WA 4V04A 5AUXA 4BWXA 3UDBA 4O7WA 3HV3A 2W7XA 1QPCA 3GVUA 1MRVA 4RPVA 5FEQA 2WMXA 4EH2A 4DG3E 3VQHA 3DOGA 3EQRA 4C59A 4UV0A 4EKKA 3KA0A 4NM7A 4ZZNA 2QOKA 5IUIA 2VD5A 3SRVB 4EHGA 1SMHA 2UVXA 5CF4A 3QCXA 5GJFA 2KTYA 3PSCA 4UMPA 2XNMA 3A7IA 3P0MA 4IACA 3O23A 4TYHA 3HA6A 3F7WA 3PRIA 1Z9XA 3U51A 1ZYSA 1J91A 3MVLA 4DGLC 3C13A 3PP0A 2O8YA 1E1XA 4DN5A 3PJCA 3IPHA 4KBKA 3QZIA 4YO6A 3UQCA 1W84A 3MH1A 1XBBA 5A46A 3UBDA 2I7QA 2LAVA 4R7HA 4BR3A 4LL0A 4NW5A 5EYKA 2WMTA 4WNPA 2QHNA 5LMBA 2P55A 3L9PA 4FF8A 5K5XA 4HVHA 4X3FB 5HCXA 3OUNB 3SHEA 4GVJA 4GYGA 4XRJA 5TOZA 3FHRA 3TUDA 2BAQA 2IZTA 3E87A 4FL1A 3ZO2A 4QP2A 4IM2A 2OXDA 3TKIA 2GQRA 2OZOA 1IEPA 4W4XA 3F2NA 3UC4A 4UYNA 2X2LA 2OIDA 1ZYLA 2WQOA 3OT8A 4NWMA 2W5AA 4H1JA 5HO8A 2YZAA 4TTHB 3TKHA 1XQZA 3DZOA 2PY3A 2C6DA 4I6HA 3F61A 4X0MA 1NXKA 4FZAB 4BTKA 5EDPA 3TXOA 5IA1A 2XM9A 2B9JA 1FMOE 3FLSA 4FIHA 1XO2B 2G2HA 5ANKA 2NNWB 4E6CA 3AGMA 4GW8A 1WBSA 5DRBA 2WOUA 3Q6WA 4NKAA 2YN8A 2OXYA 4EONA 3F88A 4YJNA 3HRFA 2WHBA 3FKOA 5BUEA 5K0XA 4PRJA 5L6WL 2IZRA 1G8SA 2VV9A 5AUUA 3VS6A 4PY1A 5F1ZA 3QHWA 3GOPA 2CKOA 2B7AA 2PVNA 4MNEA 4NTSA 4QQJA 5AP0A 4CRSA 3SW4A 3DGKA 3HMMA 2C6TA 3R7EA 5FP5A 4MD9E 5AP7A 3R9RA 2IVSA 4GIIA 3KRLA 4XNEA 3QTWA 3ZRMA 3ZM9A 3P7AA 4P5ZA 3BHUA 3GOKA 4YPSA 5E1SA 4D0XA 3KVXA 5C03A 2QCSA 2VO7A 2EVAA 2RFEA 4F9AA 4XP3A 2XZSA 1NT2A 1FQ1B 4GEOA 5EM6A 4Q5HA 3D14A 4WNMA 4YLLA 5IA2A 3VF9A 5L4QA 3KKVA 2XB7A 3W8QA 4RC3A 2VWZA 4ALVA 1NVRA 3OMVA 3MWUA 3OWKA 3O51A 4J1RA 5E1EA 4M3QA 4W4VA 4K33A 5AP3A 3OCSA 3RWQA 4EORA 4CG8A 4TNBA 4O38A 5JEBA 3R01A 5F4NA 2W96B 4EOJA 4L43A 2EXMA 3LMHA 3MW1A 2X4FA 1P2AA 1PW2A 4USDA 3R83A 1H1RA 3QRIA 5B2LA 1KOAA 2OJ9A 3OTVA 3UVPA 2R7BA 2VTIA 1KSWA 4ANBA 1X8BA 4LRJA 4CZTA 3NUPA 3HKOA 3TV6A 2W5BA 2R64A 1TQPA 4FKWA 1H1QA 2W5HA 3LCTA 4GFGA 4L00A 4D0WA 3ODYX 4KSPA 3WI6A 3TZ9A 3SRVA 4ASXA 2VTPA 2F57A 4WKQA 5CNOA 4B4LA 5HNBA 5TF9A 4F9BA 3VUMA 3FBVA 4PV0A 4BYIA 5CEOA 2BCJA 4G3FA 2J51A 4PTCA 2O64A 2YM8A 3KULB 3R28A 5M51A 4ZTRA 4GK3A 5H8EA 2QOCA 4FYOA 5AIKA 3WYXA 4AN3A 4DG2E 5ICPA 2CSNA 2CKQA 4D9UA 2WMAA 2YITA 1OBDA 1JSTA 3GENA 1JAMA 3O2MA 5AR4A 5HHWA 5C9CA 4U7ZA 2HY0A 2C3LA 4WHZA 4NSTA 2ZB1A 4FICA 4C0TA 2R0IA 2RG5A 3WE8A 2OFUA 2ZM4A 5AR7A 5CWZA 3QXPA 4CMOA 4DAWA 2OH4A 4EYMA 4LUEA 3PVBA 3C4WA 4ZTLA 2IW9A 3QD4A 4MXYA 4D58A 4IAZA 4UB7A 3AGLA 4KRDA 3SAYA 5BVEA 5B0XA 3KFAA 4XP2A 5DG5A 2IO6A 1W98A 3QHRA 4CFUA 4FG8A 1XWSA 1FVTA 2XIKA 3NMUF 2XBAA 1STCE 2ZM3A 3IECA 3OEZA 2XS0A 2Y0AA 4U97A 3EQPA 2ITQA 5AUYA 3RNIA 1BLXA 4JG8A 3FLQA 3P7CA 4UMQA 4L67A 4EL9A 3L8XA 3OF0A 3BEAA 2OBJA 4K18A 3FMMA 1YDRE 3RP9A 4YR8A 4DTAA 1TKIA 2F9GA 3DKFA 5T68A 4CNHA 3UPZA 4F9YA 3L9NA 3QQUA 1PYXA 2R3KA 3UMWA 2PVHA 5D7AA 1YHWA 3D4QA 3CD3A 4IE9A 5CENA 3SD0A 2QOFA 3Q4ZA 4QTDA 3W2SA 1IG1A 3GCUA 4EH5A 2QQ7A 3ZO3A 5CQWA 4FZ6A 1ZOEA 5AP1A 3PJ2A 4O7YA 3WILA 5AR3A 2PZIA 5FG8A 4E4NA 3UP2A 4C35A 4V0GB 5HI2A 3R73A 1U5QA 2BROA 3I0OA 4QMSA 3EMGA 3V5PA 3FYJX 4L45A 3C4FA 3DLZA 4Y5QA 3DXPA 3VN9A 4DT9A 2PVJA 3IDCA 5CX9A 5LQFA 2GSFA 1Y8YA 4FKPA 5FEEA 3PA5A 3GI3A 3IW5A 2UZEA 4I93A 4WSYA 5CVFA 1ZY5A 4BL1A 4PL3A 4A9RA 3KXNA 2BVAA 1ZYJA 3IK3A 3R8PA 1KE6A 2C0IA 3A4OX 4IH8A 1TQIA 2JAMA 3GU6A 4WT6A 1JNKA 1WBTA 5C26A 2G1TA 2NP8A 2GPHA 4FTJA 4YZCA 3PPJA 5LJJA 4ZMFA 3UVRA 4G34A 4MWIA 1OBGA 3A7GA 3E62A 1PRYA 2GFCA 3JPVA 3L8SA 3SDJA 3VW6A 3EOCA 3HMNA 1IRKA 5CSHA 3H10A 4GIHA 4O82A 4IB0A 5G1XA 2UW3A 2I0HA 4EEVA 3DLSA 4U41A 5AV0A 4KAOA 2REIA 3IOPA 1YWRA 5FBOA 4M97A 3W2RA 4ASDA 5HICA 2VUWA 4JRVA 3UTOA 2YM5A 2CGUA 2XK3A 5LVOA 2WTIA 3C51A 4O0RA 4R1VA 2P33A 4AGWA 4BCHA 4M7IA 4RIYA 4EH4A 5I9WA 3ANQA 5FQDC 3RZBA 3ZLWA 4EOKA 1PXKA 3E5AA 3FL4A 3WZJA 2JFLA 3KULA 4TWCA 4H3PA 4C4GA 3NVMB 3RK5A 4I5HA 2X1NA 4NJDA 3U55A 1BL7A 3G5DA 4FTCA 5T3QA 3F7ZA 2X0GA 3TUCA 2QOHA 4O2PA 3VQUA 4ONAA 3QQLA 1SZMA 4RLLA 3D5VA 3VUHA 2Z60A 3LLAA 2QG7A 2J2IB 3PVUA 3R9DA 2XNGA 4F63A 4IAAA 3LOKA 5JH6A 4FEWA 4NCTA 2QHMA 5EG3A 3DK7A 4AZEA 1ZMUA 3ZUTA 4FTIA 4FTKA 5AP4A 4EI4A 4I6BA 4DLIA 5BVFA 2PPQA 4EUUA 3VAPA 4IAKA 5K3YA 3BQCA 1CMKE 2XK9A 1KE8A 2BTSA 2I0VA 3KXHA 3VRZA 4EOOA 4RX5A 5CAOA 3GNIB 3AMBA 4CSVA 1GIIA 3UIXA 5IDPA 5IH5A 4OBPA 5AR5A 3AXWA 4KIOA 2WEIA 5TE0A 3EN7A 3MFTA 4RJ5A 4BKJA 1BMKA 4A7CA 3LHJA 3CE3A 3H9FA 3FZOA 4KNBA 5BMSA 4O86A 2UW8A 3EKKA 3F3VA 3K3IA 4LRMA 4QP6A 2HW6A 4RIWB 3C0HA 4C4JA 3LQ8A 3UOLA 3CJFA 4F4PA 1CSNA 2OG8A 1XH8A 2V7AA 3VJOA 3VW8A 5CXZA 2XNNA 4XLVA 5JFXA 2R3GA 3K5UA
chains in the Genus database with same CATH superfamily
4PP7A 2IP6A 5C8NA 2FUMA 5IPJA 4C3RA 5IA3A 3HP2A 4Q9ZA 3OCTA 3WF9A 3ULIA 5AJQA 1HOWA 5J5SA 3DBDA 4Y5HA 3LFAA 4LGHA 4FKQA 1VYZA 4D4VA 3BEGA 4IX3A 2PE1A 4E1ZA 1G8KA 4GH2A 1OM1A 4CFWA 1W83A 5CALA 3F9NA 2XMYA 3HYHA 3BLHA 2VWUA 3F69A 4DBXA 1Q8YA 4DBNA 5E8UA 5AEPA 4Z16A 1MUOA 3IG7A 4AFEA 5JMSA 3BYUA 2YCQA 4QDVA 4IVCA 3NIEA 4AQKA 3MFSA 3NUSA 4RT7A 3RKBA 2WMBA 3I6UA 3PG3A 2I40A 2F49A 2UZUE 3P08A 3KVWA 3O7LB 3W0PA 2QOBA 4IADA 4R6VA 3FI8A 1M14A 1V0OA 2HZ0A 2ITVA 1YOJA 4HOKA 3ZOSA 4FV8A 4EH3A 4I4EA 2QOQA 2ZM1A 4JIAA 3UIUA 2B53A 3LXPA 4FT3A 3FL5A 5ETCA 2J4ZA 3DZQA 4WG3A 2W4JA 2WGJA 4HJOA 4P4CA 4ZTQA 3C50A 4ZY6A 3FKLA 2R3RA 4O0TA 3I60A 4NYEA 2VX3A 4YC8A 1A06A 3DJ5A 3L9MA 4FTUA 5BYZA 4G5JA 2X4ZA 4GJ2A 4FKLA 1Y6BA 2HXLA 2GS2A 3AC5A 4U80A 1BI8A 3MS9A 4QP9A 4O83A 4BHNA 4TWOA 2PU8A 5FLFA 3OP5A 2G01A 4NK9A 3DK3A 5CAPA 4EK4A 4DFZE 5E8VA 4ASZA 4AXEA 5FXRA 3LFSA 1H01A 3EN9A 4FSQA 3BYMA 2R3QA 4CZUA 1OI9A 4L42A 3DXQA 1NA7A 2B55A 3ZC5A 2C47A 5LCJA 3SKCA 2X2KA 3DXNA 3FZPA 5ANGA 3O96A 4AA4A 4BHZA 3UGCA 5HESA 3ZUVA 1P5EA 3IAS1 3R30A 4L44A 4ZP5A 3UOKA 3QC9A 3WZUA 3ZFYA 2ETDA 3GEQA 3QYZA 3NDMA 4JS8A 3R7UA 1F5QA 2V5QA 3U54A 4BIBA 3R2YA 2XKCA 4FK6A 1J1BA 2AC5A 2CKPA 3DU8A 5C27A 4IHPA 2YEXA 4PPAA 4FKUA 5AV2A 4AUAA 2XJ2A 4ZJVA 5AWMA 5GZ8A 5HE2A 2C6LA 4CQGA 3TMOA 1W82A 5E8YA 4ZK5A 2W1EA 2IZUA 2VO6A 3H0ZA 3II5A 2VTQA 2GFSA 4F9WA 4J96A 4M0YA 3A2CA 3PJ1A 2OKRA 4FBXA 2H96A 5E92A 1U54B 2YABA 4YURA 4JMQA 1E1VA 5EM5A 2I6LA 3FY2A 3BGQA 4OUCA 4CT1A 2EU9A 4YZNA 2WD1A 1B38A 2BALA 2X9FA 2YM3A 3EQIA 2VU3A 4O4BB 4RIWA 4RVLA 3W55A 3BBWA 3MPTA 4AXAA 1ZRZA 4BTJA 5IQFA 3MN3A 3QGYA 3QWKA 2PHKA 5EHOA 3F5PA 5LVLA 3FKNA 4DH1A 1OUKA 1JQHA 2JDRA 4QP8A 3KMMA 4RZWA 4AS0A 4QPAA 3R7OA 4FEXA 2IG7A 4ALUA 3ZRKA 1DI8A 4U45A 3PLAE 3ORNA 1XJDA 3U6IA 2XK7A 3EN6A 4II5A 2QLQA 4O22A 3KB7A 1GZOA 2QU5A 3FMJA 3ZTXA 2JIVA 2OGVA 4RFMA 3Q4UA 3W2QA 4FTMA 3BHYA 4A4XA 2ITXA 3C5UA 4G6OA 2PMIA 3EN4A 4FTNA 4M12A 1O6KA 2VWVA 5C8KA 3VVHA 4FE2A 3PA4A 4XG7A 2YFBA 2X8IA 4FIJA 3V8SA 2WMVA 2OI4X 3WF5A 4BCNA 3PFYA 4EC8A 4GG7A 4WBBB 3EFKA 5HO6A 2HXQA 4FRFA 2GHMA 3F5UA 3MA3A 2QOIA 2OXXA 1O6LA 3E8NA 4FZDB 5HTIA 5F9EA 1QMZA 3OT3A 5CVGA 4DITA 4BCFA 3G0EA 3ZONA 2Z7RA 5HX6A 2FSLX 3DBEA 3Q2MA 5HVYA 4X6RA 3JYAA 2WTWA 5AV3A 3FZRA 2JIUA 3O8PA 5IQDA 5HBHA 4X2JA 4HVSA 4BF2A 4YO4A 4JIKA 4MNFA 3HRBA 5HE0A 3OXZA 3CIKA 5KMIA 3I7BA 1XBCA 5JKGA 4G9CA 3BU3A 3G9LX 4PPBA 4AGCA 3BLQA 5KMLA 4BB4A 4IZYA 4JAJA 5D11A 3VS0A 2UZNA 1OL6A 3C1XA 1ZARA 2Z7QA 4RLKA 3ITZA 2XIYA 5HE1A 4EJNA 4FMQA 4AT3A 2PZYA 3CCNA 3SC1A 2PZ5A 3MIYA 1YWNA 4EK3A 3OS3A 2YAKA 2YWVA 2XNPA 2ITPA 3LFBA 3PY1A 5DPVA 5ANJA 5E8SA 4MAOA 4J52A 1OB3A 3FY0A 4ZSGA 3FC2A 2XBJA 5DT3A 2JDSA 3FWQA 3ZMMA 5A4QA 3JXWA 3MFRA 3C0GA 2DUVA 2ERZE 4PWNA 1DI9A 4TYHB 4XH6A 3DDPA 1H27A 1RW8A 5EH0A 4EQCA 4FNXA 4N57A 3P23A 2QVSE 1ZOGA 5AX9A 3TI1A 4QTCA 1YVJA 4GK2A 5AX3A 4QTAA 1S9JA 3KK8A 3P79A 2GNGA 3NPCA 3H30A 2XALA 4FVPA 2G15A 2PZPA 3LQ3A 4EK5A 1OGUA 4WUNA 5DH3A 3QKMA 4OTWA 3ZSHA 1Q5KA 3PRFA 3U87A 2GNFA 5M09A 3LCDA 5DGZA 4EZ5A 2VWYA 4K77A 4UY9A 2A27A 4MXAA 2IN6A 3R7GA 3F66A 3A7HA 4X2GA 3E7OA 3A62A 3ZFMA 4CKRA 3FSKA 2SRCA 3LMIA 3T8OA 4IFGA 5M57A 2NPQA 4UMTA 4ZTSA 4O7LA 4L7FA 3F3TA 4QMWA 4QTBA 3LCOA 4IB5A 5DVRA 4CRLA 3FI4A 1R1WA 4AE9A 2HW7A 4PDOA 1ZAOA 1SNXA 3LFNA 5JFSA 5J7HA 4JNWA 4IB3A 3VIDA 3NW5A 3MESA 2HWPA 2EB2A 2JKKA 3VS3A 4RVTA 1DM2A 4EBVA 5D1JA 3D9VA 2ITNA 4AS2A 2VWXA 2ZFYA 3ZZWA 2F2UA 5D41A 3UQFA 3EH9A 2JD5A 4HGSA 2W9ZB 4OW8A 4YUQA 4KS8A 3KREA 3DDQA 4C2WA 4O6LA 3LZBA 4FKRA 4KBAA 5BQ0A 2YFAA 2IF8A 3BLRA 3ZC6A 4MNEB 1WMKA 2BAKA 3BU6A 3QZGA 5HOAA 4USFA 3NFFB 2XJ0A 2VWWA 3V8WA 4HVDA 3HX4A 3IW7A 3PUPA 5C1QB 4XX9A 1ZXEA 4OBQA 4AGUA 5KO1A 2QURA 3PSDA 5JFWA 2GNHA 5AUVA 3EQFA 4IANA 1XBAA 4FOBA 4BICA 4XHKB 3IGOA 4FG7A 2QOLA 4BIDA 2XMXA 3D2IA 1IAJA 2ZOQA 3QUEA 4FTOA 3UO4A 3V01A 4MQ2A 3UMXA 5B2KA 3UIMA 4OLIA 2G2IA 3NLBA 3D15A 4EOIA 4AA5A 5M07A 4LL5A 2E9PA 4QMTA 4D9TA 3LXKA 5LWNA 5JGDA 3DKGA 5AAFA 4O27B 3TIZA 3QGWA 4YJTA 2XA4A 2ZDUA 1JKKA 4FL2A 4AQCA 3OY1A 1M7NA 1P4FA 3ET7A 1ZMVA 4QYEA 1XMLA 5J7BA 2QR7A 4U42A 2ZDTA 3W0RA 3R6XA 3LFFA 3COIA 3BGPA 2WU6A 4L01A 3R9OA 2DQ7X 4WIHA 3BV2A 4BDFA 3EN5A 4Z55A 2WTKB 3U8WA 2YLFA 2C0TA 3G0FA 4XBRA 5IA4A 1Y57A 2W05A 4K11A 3VUTA 4GYIA 3TL8A 3B8QA 4AW5A 4F0IA 2XYNA 2CLXA 1FOTA 4W9XA 1RQQA 2JKOA 5I3OA 4HW7A 4UN0C 2WFYA 5IH6A 4Z7GA 2ZV7A 4L46A 5I9VA 3S2PA 2GSCA 2ITWA 2CLQA 3ALOA 4FEUA 4O0VA 1MRUA 3NYOA 1UKIA 3UDTA 4EUTA 3MTLA 4O21A 3HAVA 4L53A 3ODZX 2JB2A 1CKPA 3QCSA 3OVVA 1PF8A 5EHLA 1GIHA 2BIYA 3LFQA 4FVQA 5AR2A 2UW9A 4L6QA 4KWPA 1W0XC 4BJJA 2X9EA 3FDNA 3BWJA 2F7XE 5CVHA 2BRGA 1Z5MA 3V8TA 5AAEA 4C4IA 3QX2A 2IW8A 5AV1A 4IX4A 4D2PA 1QCFA 2CN5A 4JQ8A 3DKCA 4Q5EA 4DEEA 2R3PA 3S0OA 3DAKA 3CLYA 2YWPA 4HNFA 3UYTA 4JI9A 4NV2A 5HCZA 3UYSA 3ORIA 2IVVA 3FMDA 1CDKA 2QG5A 2Y4IB 4IW0A 3OXTA 3BPRA 1NVQA 4IM3A 4DGGA 4G76A 3R1NA 3GCQA 3QA8A 5KKRC 5KZ0A 4JX7A 3FQEA 1H0VA 4UEUA 1P4OA 2ZJWA 3NUXA 4ALWA 1WBWA 2V62A 3QFVA 4C3PA 1JSUA 3PG1A 4FT9A 4I0TA 5F20A 5K0KA 2J9MA 4EK8A 1YXVA 4DYMA 1M2RA 2VTAA 1PMVA 4YC6A 5BVKA 4W8DA 3A60A 4AOTA 3PP1A 3ZEPA 4EQMA 4NT4A 4BIEA 1UWJA 3FHIA 5A4CA 4QMVA 1KV1A 5L2TA 5EFQA 2O2UA 1E9HA 2FVDA 3RINA 4BWKA 2YIXA 3COHA 3OOMA 4OGRA 2BZJA 2FSOX 3A7JA 4FIGA 5KCVA 1YHSA 1ZYDA 3GGFA 4DFYA 2HGKA 3AD4A 3S00A 1KE9A 2GCDA 4M69B 5FTOA 3CGOA 5ETFA 3KXGA 4HFVA 3D83A 3Q9XA 4JCVE 1H00A 3LM5A 1KWPA 4BDBA 4G31A 3AKJA 3AD5A 3UDZA 1JKSA 3FZ1A 3ZLYA 4BCJA 3TEIA 4ZZOA 5GHVA 3RGFA 4WRGA 4OAUC 4CG9A 3KC3A 4EZ3A 4K9YA 4QMPA 4I1ZA 4QMOA 5HG8A 4RWIA 5HG5A 4DC2A 4ZY4A 5L8LA 3GP0A 4RZVA 4A9YA 3G2FA 1PYEA 3W10A 5M4UA 3TJDA 2UW4A 4IM0A 4XJ0A 2X81A 4TKSA 1APME 4TNDA 4B0GA 2XKFA 5CTPA 2RL5A 4HVGA 4K2RA 5CSXA 2BL7A 1H28A 4DHIB 1ZYCA 3Q5ZA 2X0QA 2CHLA 4MH7A 4J7BA 4P7EA 3GFWA 2BZIB 3OWJA 4PPCA 4LOQA 3ZLSA 1M2PA 3IW4A 3MIAA 3TDVA 5CZIA 4F70A 1FINA 2CPKE 2HELA 4C61A 4Y8DA 2E2BA 4K0YA 4ZSJA 2WTJA 4MCVA 4LV5A 1ZY4A 5LARA 3DT1A 3TACA 4S33A 1YI4A 4ZXTA 4C02A 3FQHA 4GL9A 5DT0A 3BIZA 4RA5A 5EHYA 4AW2A 5A4TA 2J5EA 5A14A 3CBLA 3POZA 4RIYB 4IXPA 4WG4A 3VUDA 2VGPA 5K4JA 4HYUA 4CZYB 3DB8A 5HTBA 5KBQA 5ACBC 4TY1A 5JZJA 2NRYA 2W1GA 2JGZA 4JQ7A 3JVSA 4EH8A 2PUIA 3ZO4A 5GINE 3DNEA 4F0GA 4BCKA 3HP5A 3REPA 3LE6A 4E93A 3FJQE 5DIAA 1AD5A 3B55A 3NS9A 2NO3A 4FV5A 4QQCA 4UALA 3BHTA 2BDFA 2UZOA 3MVHA 1XR1A 3GXLA 4M66A 5J95A 4AACA 5L2IA 4MF1A 4BDJA 4IC7A 4EHVA 5JGAA 3TV7A 4RJ6A 5E9EA 4G3DA 1M52A 4RFZA 1OL5A 5HNGA 1Q3DA 2GS6A 4RGJA 2W4OA 2WPAA 5H9BA 3TTJA 2UZWE 4C4HA 2EXEA 5K4IA 3RM7A 2XRWA 2A98A 1GZ8A 1PY5A 1SVGA 4E26A 4BRXA 4I1TA 1XH9A 4ID7A 4ZLYA 2C3JA 5AP6A 3WBLA 1PMEA 5HU3A 4G1WA 5LVNA 3C4EA 2C5OA 2W99B 1CKIA 5CU4A 2A2AA 4CV9A 4AOJA 3HNGA 2V6EA 3UZPA 5EDQA 2YM7A 1LR4A 1SVHA 1JLUE 3TUBA 3DK6A 4F08A 5BVNA 3G9NA 2R3IA 4O7TA 2ITUA 3GBZA 4DHFA 4DINA 5IQEA 2ESMA 3DY7A 4IWOA 4BZNA 2CDZA 1PHKA 2OWBA 4QQ5A 4RWKA 4EOQA 2BRBA 1PMNA 1K2PA 2XVDA 3L9LA 5LOHA 1OITA 2BRNA 3U4UA 5E91A 1J1CA 1YQJA 4FR4A 4DH8A 3IKAA 4HZSA 2VX1A 2PTKA 4MVFA 1ATPE 3PVWA 4S31A 4YJUA 3RPRA 3SOAA 4D4YA 3AG9A 3QRTA 5IQHA 1NW1A 5HCYA 1VYWA 4PDSA 4M69A 3E8CA 1OUYA 4RJ8A 3JR1A 4DFXE 5EK7A 2XK6A 3QC4A 2P2HA 2HZ4A 3DA6A 3E3PA 2A19B 3GCSA 4XG2A 4MD8E 4YJRA 5CLPA 5T6KA 4EH7A 3KXXA 2C6EA 4ANQA 3G90X 3QUDA 5FXSA 5CU3A 4CQEA 1XH6A 3RZFA 3QRKA 2WIPA 4IEBA 2VZ6A 1AQ1A 3BBTB 4E4MA 4D2TA 3VULA 3C0IA 1PJKA 1WAKA 3FPQA 2EWAA 4C57A 3PY0A 4MD7E 2PWLA 3R02A 2JLDA 3HUBA 3MPMA 2PVRA 4YSMA 5F95A 5FDXA 2JC6A 4CKJA 5A3XA 3AMAA 3RTPA 3ZEWA 4GMYA 4K1BA 5EW8A 4CFFA 1I09A 3QD0A 3V3VA 4GFOA 3F6XA 3P86A 5BVOA 4NU1A 4F78A 3SVVA 3HV5A 4XOZA 5FD2A 4TPTA 5H2UA 4I0RA 1JBPE 5CF8A 2Q83A 3N4VA 4M0ZA 2C5XA 3NWWA 5CEIA 2XP2A 1A9UA 3EQHA 4O91A 4KIKB 3ULZA 1YO7A 4I24A 3FI2A 1XHAA 1WVWA 4FKTA 4O0XA 4DLJA 5IQBA 4QNAA 4E6QA 2F4JA 4KABA 1LEWA 3VBTA 4DTKA 4FJVA 2PZRA 4DE4A 2BZHB 1H08A 4HYIA 3ZYAA 3D2KA 2HZIA 2FSMX 4QOXA 2C6MA 3GT8A 5J9LA 4DFBA 3CTJA 4AZSA 1Q61A 4XV1A 3P1AA 3PJ8A 2YFXA 3UO6A 4HCUA 3W0QA 4PF4A 3UODA 3ORXA 4ZAUA 5HORA 4D5HA 2O63A 4YNEA 3CP9A 3ORLA 2I0EA 4ACMA 2QU6A 3QWJA 5A4LA 3A99A 4G2FA 3PY3A 4YU2A 3GU4A 4FUXA 1L8TA 3GU5A 4I41A 4A4LA 4JBQA 3FI3A 4KRCA 4O4DA 3VUGA 5J1VA 3T3VA 3RPYA 3AMYA 5CNNA 2PK9A 1SM2A 5C4LA 2ZRRA 4FG9A 3ERKA 2BAJA 4P2KA 5ANOA 5FRIA 3DFCB 5EI6A 4FEVA 3R9HA 3F82A 1B6CB 3HECA 3LJ0A 3O8TA 4D28A 4WG5A 3QCYA 4OBOA 4OTQA 1XH7A 2I0YA 2WEVA 3OROA 1BX6A 4YZ9A 5KKRB 5GIPE 3TN8A 4R77A 3SW7A 2EXCX 5M56A 4BVUA 1MQ4A 3KCKA 3ZO1A 1B39A 3VJNA 1TVOA 3HUCA 2QONA 2C3IB 4FV1A 4X7QA 3P78A 2JFMA 2B4SB 5J9ZA 2R3NA 4XG6A 1GY3A 3ZSIA 5I4NA 4G6NA 3PPKA 4AW0A 5IMXA 2JEDA 3TZ7A 4AW1A 3PVGA 4BDGA 2YIRA 3BKBA 1F0QA 4IB1A 3MA6A 2C1BA 4LM5A 4E20A 4ARKA 3QQGA 3SX9A 2QKWB 4E5AX 5A9UA 4BWPA 3GCPA 4EYJA 3M11A 4XLIA 3VBXA 4AFJA 4YSJA 3LFCA 1UU9A 4YMJA 1K9AA 3EQDA 3O71A 5IMEA 4P5QA 5IISA 3KMUA 2Q0BA 4YHTA 4XYFA 4FUYA 3U4WA 2WZJA 3LQ5A 3UVQA 3IW8A 4YTFA 4IBMA 5BMMA 5IUGA 4I23A 4PTGA 1FGIA 3RI1A 4F6UA 2X6DA 5BPYA 4EOSA 3ZUUA 4BGGA 4WNOA 2O5KA 3PSBA 2X7FA 4H05A 5IF1A 4AXFA 1H07A 3KXMA 3KRXA 1TDPA 4DT8A 5K9IA 3EZVA 3VBYA 1FPUA 4FKJA 4B8MA 3L0IA 3E93A 1UV5A 1ZWSA 3E92A 3KF4A 3QYWA 5EM8A 2C5VA 3PXKA 4D55A 3LFDA 4ZIMA 4MBIA 4AP7A 5D9HA 3MY0A 5IQIA 3NEWA 3NAYA 5B7VA 4R5YA 5CZHA 3TV4A 2FU2A 2NYAA 4QPSA 3I4BA 3MGYA 4HPTE 4ERWA 4C7TA 5M44A 4QMUA 3S95A 1QPDA 1Z57A 5IKWA 4RIOA 2OJGA 4MKCA 5ANDA 2WQBA 3FYKX 3Q96A 4IZ7A 4FT5A 3FZTA 4KIKA 2R3OA 4FZ7A 2J90A 4QEBA 5JQ5A 5IH4A 4S34A 2YCRA 2XJ1A 4FKIA 4RG0A 4YZDA 5AIRA 4ANSA 1RE8A 3CR0A 4MF0A 3TYKA 1GZKA 2X7GA 3ZZEA 3QTRA 1GAGA 2W06A 3QU0A 1SYKA 5DBXA 4I21A 4DEHA 3FZSA 2C3KA 4YHJA 1VEBA 4HZRA 2WNTA 3LJ2A 2HWOA 4GUEA 4UYAA 4D4RA 3EHAA 4BDAA 4I6FA 1G8JA 4WOVA 3FVVA 3EB0A 3QALE 2W17A 4CLJA 3T9IA 3FXXA 4AGDA 2R2PA 3DA3A 3VF8A 3EQBA 3EQCA 2B0QA 4BDDA 2ETKA 3COKA 1S9IA 3MI9A 5CEKA 4O0UA 3RM6A 3PE2A 5JT2A 4CMUA 1PXIA 2JITA 2BKZA 3D94A 3KL8A 2W1IA 1CTPE 3W33A 1VJYA 2B9HA 2QODA 4QDEA 1REKA 3Q5IA 5KMMA 1M7QA 1FGKA 2NRUA 3CEKA 1GIJA 4BDHA 3EYGA 4JJRA 2H34A 3RK9A 5HZNA 4CFXA 2WB8A 3IDPA 4E5BA 3FEGA 4USEA 3F3ZA 3ZRLA 2WQEA 4NUSA 4O1OA 4QMYA 3V6SA 2CGXA 4DH7A 3FXZA 3TNHA 2YLEA 2WAJA 4FV4A 4NIFA 3VBVA 3RPSA 2V7OA 1OIYA 1VZOA 3FLYA 2VTMA 3QRUA 5JZNA 4PDYA 3NYXA 4TWNA 1PXJA 2WMSA 2OZAA 3EFWA 3OWLA 4M68A 5EYCA 4CEGA 5EI2A 3KY2A 4AZWA 4ACHA 3CKWA 4O7ZA 1QPEA 5EOLA 4CFNA 5IDNA 1Q8UA 4FV9A 4JR7A 4ZS4A 1YWVA 3MBLA 3O50A 3MVMA 5CANA 5HLWA 2IVUA 2P0CA 3MB7A 4G17A 2CKEA 3R71A 4QP1A 3WIGA 4BKZA 4L52A 4DGMA 1FBNA 2GNJA 2RFDA 3DNDA 5GZ9A 1URCA 5HBJA 4GUBA 4QYFA 4C4EA 3MJ1A 4EH6A 2A4LA 2O0UA 4NFNA 3E64A 4QMQA 5M55A 2VO0A 5KHWA 4FSYA 3N51A 3ID6C 4CGAA 4ACCA 3HA8A 3MH3A 3L8VA 3P5JC 5CU6A 5DHJA 2XNOA 3HL7A 3VHEA 3E8DA 5HBEA 2WIHA 3IDBA 2JB1A 1VLRA 5CEPA 2FB8A 2UW6A 1UVRA 1WFCA 3W2OA 5D12A 2O65A 2BUJA 4HVIA 3LJ1A 1GZNA 3K3JA 5LXMA 1V0PA 4E73A 4PL5A 4C2VA 5CAUA 4A07A 4XG8A 3FE3A 5CXHA 4QNYA 1JWHA 1R78A 3EYHA 1OL1A 2VTNA 1WBNA 2XK4A 3RK7A 2OFVA 4O2ZA 4RC2A 2BHEA 3C5IA 4D2RA 1Y8GA 5FGKA 2RSVA 4UXLA 3QX4A 3U6HA 3P9JA 3VS1A 3UIBA 3AKLA 3QD2B 4CTBA 4NW6A 3NYNA 3DQXA 4C33A 4ACDA 4DDGA 4FI1A 2VTJA 3R8VA 3E7VA 4KKHA 4RQVA 3UNZA 4GJ3A 4TYEA 4Y73A 4BCMA 2GTNA 1MP8A 3RALA 4EKLA 3RHKA 5KMOA 4MYGA 4K6ZA 4I5MA 4I20A 4NM0A 5CSVA 3W0MA 4F65A 1MQBA 3R7IA 1KV2A 3LIJA 1BI7A 2O3PA 3ZFXA 3KP9A 3PTGA 4NV5A 1DAWA 3WF6A 1UKHA 2BFYA 2E9UA 2W1HA 3JS2A 3NRMA 4F7NA 3UJGA 4G3GA 1G5SA 2QO7A 4JVGA 3WE4A 5BYLA 4CT2A 1UU8A 4DFLA 2J7TA 4GSBA 4TZRA 3Q04A 3BZ3A 2WTCA 3G51A 4WNKA 2H8HA 3BE9A 5AM6A 5LMAA 4CYJA 3U6JA 3HAMA 1U59A 3AC2A 5AM7A 2VNYA 1ST4A 4IAIA 4KKGA 3LPBA 3OZ6A 2GNIA 3Q3BA 4DEBA 1TFFA 1QPJA 4R8QA 1YKRA 5I0BA 4I3ZA 5HIDA 5HVKA 4O6EA 4GKIA 1UU3A 3BYSA 1XH5A 3CPCA 4FVRA 5CI6A 3CS9A 3ZM4A 3GCVA 4IVBA 4ENXA 2W0JA 5I9XA 3CD8A 3DKOA 5FWKK 3IS5A 2OF4A 4QD6A 4WUAA 5HIBA 4KKEA 2PUPA 5H8GA 2X8EA 2WMWA 2PMOX 2Y9QA 4IWDA 2I1MA 4DDIA 5DFPA 5LCKA 1JOWB 2VWBA 2OJJA 2UZVA 4F9CA 2W9FB 3QKLA 4MX9A 4H3QA 3VONA 3KQ7A 1FVRA 1OVEA 2YA9A 4N70A 4EC9A 4JBPA 4BJJB 4IFCA 3WYYA 4Q2AA 2ITZA 2AUHA 4FV2A 4O4CA 3NYVA 3DTCA 2WTVA 5CT7A 5HE3A 5IZFA 5JRQA 5BV3A 2GDOA 3QD3A 2BILB 3THBA 4AXCA 4Y83A 5M4FA 4W8EA 4ACGA 5A6OA 4QYGA 2V1CC 1W8CA 5F94A 5BVDA 5EKNA 3PPZA 3QBNA 2PE0A 3COMA 5AA9A 3FNBA 4ZTNA 1Q8TA 3AC4A 5AR8A 2V55A 5AFVA 3ZHPC 4ZY5A 2OIBA 4RJ7A 1IR3A 3ZSGA 4IWPA 3NW7A 4OTHA 4BI1A 1J7UA 5IEYA 3TZ8A 2OLCA 4UMRA 3QQJA 1YRPA 5I9UA 4FTRA 3V5LA 2B9FA 3AT3A 4K8AA 5BUJA 4GCJA 4L68A 3C4CA 5EM7A 4Z7HA 5I9YA 5IUHA 2F66B 4HPUE 2B9IA 4RRVA 4G3EA 2VO3A 3BI6A 3OFMA 3V51A 3H3CA 2W1FA 1O9UA 1Y91A 4OTPA 4F1OA 4R7BA 4I5CA 4H58A 4FKVA 4BCIA 4C62A 4O7VA 4WA9A 4AX8A 3EFJA 3KK9A 2OICA 5CY3A 4ZSLA 4NH1A 4ORKA 5EW9A 4JR3A 5GJGA 4AAYA 3Q4CA 4L9IA 4IIRA 4EHZA 2YIYA 4UMUA 1DS5A 2VGOA 4U3ZA 2XNEA 2YAAA 4S2ZA 5E8XA 2GQSA 2HENA 4ANNA 4E6DA 3O17A 4U8ZA 3NW6A 3HGKA 3NIZA 3F5GA 3TTIA 1K3AA 4N6ZA 3TNIA 4A4OA 2OSCA 3UITA 2C6IA 2XAOA 5EQPA 3Q9YA 5DT4A 5AUZA 3VS7A 5CEQA 3D7TA 4FV7A 1KE5A 5M4IA 4IMYA 4RIXB 2F6MB 5FBNC 4PQNA 3MJ2A 2QZGA 4MXZA 3KCFA 5FDPA 3TDWA 4RMZA 5HEZA 4Y95A 1GOLA 3Q6UA 2ONLC 3R1SA 3UNJA 5AAGA 2X39A 3HVCA 4R5SA 2V22A 4U43A 4XG3A 3LCSA 4U79A 4LRKA 4I6LA 3CC6A 2A0CX 3AC3A 4D2VA 3I5ZA 1YHVA 3OBGA 3DCVA 3FMLA 4MXOA 4E5WA 2YERA 2YIQA 4EHEA 1XMMA 4YTHA 2Z02A 3GC8A 2BRHA 3KN5A 2ZMCA 4FKOA 4HCVA 3DBQA 3S4QA 4DHJA 2XIZA 3BCEA 4JDIA 4MXCA 5DI1A 1CM8A 1UNLA 1TQMA 4ERKA 4KIQA 1PXNA 3CQWA 1ZMWA 4IZAA 4NJ3A 3VS4A 2OH0E 1FMKA 1OIRA 3F3UA 3FLWA 3K2LA 4JDHA 3R22A 4TT7A 5JQ8A 3M42A 3QQKA 3EIDA 3R1QA 4A9SA 4U40A 5LNK1 2FSTX 4WD5A 2Y6MA 3OCGA 5KZIA 5KX8A 5LMKA 2C68A 3ZBXA 4HYHA 4BC6A 4CFMA 5DE2A 4GT3A 3IGGA 4M84A 5KUPA 1U4DA 2WO6A 3Q52A 5J5TA 2R7IA 4JRNA 1PXOA 3KF7A 3OEFX 2VTRA 3VBQA 5HLNA 4IJ9A 4H3BA 4GU9A 1G3NA 4C37A 3QL8A