3LJ1A

Ire1 complexed with cdk1/2 inhibitor iii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
404
Chain Sequence
NFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQFRTSGWRAPELLEESNNLQTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Flavonol activation defines an unanticipated ligand-binding site in the kinase-RNase domain of IRE1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase
molecule keywords Serine/threonine-protein kinase/endoribonuclease IRE1
total genus 107
structure length 404
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06479 Ribonuc_2-5A Ribonuclease 2-5A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lj1A02
1.20.1440.180 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3lj1A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lj1A01
3QC4A 4G2FA 4L3JA 4D1XA 1JOWB 3LZBA 1ZY4A 2F57A 2VN9A 2C30A 2JDSA 5CVGA 1M7QA 3U9NA 4FV4A 1ZYJA 4QMOA 3E7OA 4DEIA 3U54A 1TQMA 4RT7A 2BPMA 2XJ2A 3KN6A 3NYNA 5DG5A 3RGFA 4GH2A 5BQ0A 4UWBA 1XKKA 2HXLA 3QTQA 1GZOA 4G34A 4BYIA 4C4JA 1XHAA 2HZNA 3KRXA 4IJPA 2C6EA 1ZLTA 4H58A 4OTPA 3KCKA 4LGHA 3VS5A 3UPZA 4E7WA 2B9HA 4MF0A 2J7TA 5DIAA 4JVGA 3JS2A 2ETMA 3A8WA 4FT7A 1P4OA 3FC1X 3SLSA 5BPYA 3N4UA 5K0XA 5IF1A 4YJQA 2F2CB 3LIJA 4BBMA 3FHIA 2PK9A 4G16A 3PSBA 4UXQA 3AD5A 2YLEA 5IH6A 3F5GA 3REPA 1PKGA 4ZY5A 2JGZA 3L9NA 4F6WA 1UWJA 4FTOA 4YTCA 3QALE 4P7EA 3AXWA 1J3HA 5I9ZA 4G5JA 5CSPA 5A46A 3RPVA 3VBVA 4TYJA 2DUVA 4AFEA 4CFVA 3TZ8A 4U79A 4W8DA 3QX2A 5LCJA 2PVNA 2P2IA 4O38A 3DQWA 5TE0A 4FV9A 1KOBA 5AWMA 4PP7A 3Q96A 4M3QA 3VUIA 3VS3A 5CWZA 3R7YA 3IW4A 2X1NA 4UXLA 2Z7QA 3MJ2A 3NNXA 2JD5A 3P78A 5EG3A 5J79A 2ZMDA 2XP2A 4E26A 3O17A 3PP1A 4RVMA 3TUDA 4DFNA 3ROYA 3FLSA 4UX9A 3NSZA 4ANNA 1M17A 4DLIA 5BVEA 2CGXA 4EORA 3C4ZA 4OTRA 4QTCA 5C27A 3D83A 5AP4A 3E62A 3HP2A 5TOZA 5ANOA 4HZRA 3NX8A 3QHRA 2B55A 4FK6A 3LCSA 4IAYA 4M69A 5EI8A 3SAYA 4CNHA 4OW8A 4EWQA 5CASA 2GTMA 4MNEB 3I7BA 3UP2A 4LQMA 2HZ0A 4YJOA 4FKSA 5A3XA 3PE1A 2GCDA 3IDCA 4EOMA 4RIWA 1AQ1A 1R3CA 3G9LX 4GIIA 4J53A 4NM7A 5J8IA 3R8MA 4D4YA 4RFYA 2C47A 1XBCA 3OFMA 3EIDA 3D9VA 4QYYA 3LM0A 3PJ3A 5DRDA 1NW1A 5DNRA 2V7OA 3F5PA 4X6QC 4AAAA 3TXOA 3EYHA 4J97A 2XZSA 4EONA 3G5DA 2W1GA 2YABA 1OUYA 4RA4A 3QD3A 4I1ZA 4U0IA 5CAPA 2HWOA 5GIPE 1HCKA 3BELA 4IMYA 1U5RA 5EI2A 1KE7A 4L42A 4R5SA 3PVBA 1KE9A 1XH7A 2VTNA 5EK7A 3HMNA 2O63A 1LUFA 3MFTA 1JAMA 3KULA 3RPOA 2J90A 3MA3A 3LVPA 2A19B 2I0YA 2VV9A 2XBAA 4FZDB 3QQGA 2BMCA 5HIEA 3LJ0A 3ZUUA 1DM2A 5BNJA 1GAGA 5L2IA 4I23A 4B4LA 2I40A 1GNGA 2AYPA 5F1ZA 2BR1A 4KBCA 4NW5A 5A4LA 2HZ4A 3O8UA 4TN6A 4F99A 5DPVA 1FPUA 3OVVA 5E8WA 4H36A 3QTUA 5A4TA 3KULB 3EQRA 4JAIA 2R3RA 1Z5MA 4RLLA 4K8AA 4FV1A 5AUYA 2BRGA 4FT9A 4KRCA 4CFXA 1YRPA 3MDYA 3GC9A 3MFSA 2G2HA 2YERA 2VO6A 3QX4A 4N6ZA 2PMIA 5AR5A 3U9CA 3VW6A 3O50A 5LMKC 4HVGA 2VWBA 4NCTC 5E1SA 3PRIA 2W7XA 5FM2A 4BCNA 5EOLA 4O91A 4BYJA 1YOLA 3MY0A 5TT7A 4NL0A 4N70A 4HZSA 3PXFA 1SMHA 2E9VA 3Q5IA 3ZFXA 5CQWA 2X9EA 4UMRA 4RIWB 2R9SA 5BX0A 3B8QA 4H39A 2W5BA 2PWLA 3ANRA 4UWCA 4Z7HA 4DT8A 1WVYA 2REIA 2VAGA 1PW2A 3VBTA 5HOAA 2DS1A 4XLIA 5B0XA 1KOAA 3LFCA 2B7AA 3LFNA 2VTTA 4RA5A 3MVJA 5AIKA 1STCE 1ZXEA 1K2PA 2DYLA 1E1VA 4J1RA 2OICA 3K2LA 1RQQA 4C8BA 3BBTB 4EOOA 3O7LD 3ORPA 3PIYA 2V0DA 3EH9A 5DRBA 2F9GA 3TTJA 4ITJA 2R64A 2C6KA 1YXVA 5J5TA 1Z9XA 4G3GA 4C0TA 2A2AA 1OKYA 5IEYA 3ZSGA 1WBNA 1ZYSA 5DI1A 3DBQA 3CD8A 3BYUA 3QKMA 4WD5A 1PXPA 3CBLA 4F4PA 2WTVA 4FKGA 4JAJA 3NW7A 5A9UA 5D7VA 3RM7A 2UW7A 2JC6A 5A4QA 3DXNA 5M44A 4MF1A 4CCUA 4X3FC 2H34A 3EQBA 1FVRA 3F82A 3ZC6A 4E6DA 4GG7A 4NH1A 5AAEA 5KCVA 2W05A 3NUAA 3ODYX 4MTAA 1EH4A 2VNWA 4EHGA 3DBFA 4QNYA 1WAKA 2R3GA 5CXZA 3T3UA 2QCSA 4AUAA 4RVKA 4ZMEA 1UNGA 2XYNA 5FEDA 2WD1A 3ORZA 3R2YA 2UW5A 1OVEA 4TWOA 3C5IA 5D11A 3D7TB 4FC0A 1P5EA 4F09A 2EXCX 4BCJA 3VS2A 4FTMA 4CFWA 4AGWA 4R3RA 2CN5A 3RAHA 2C6LA 3I81A 3Q60A 4L3PA 4EK3A 1KE5A 1REKA 3U8WA 1Q24A 4QPMA 5CEQA 2QONA 5AA9A 2GNLA 1IAJA 3WYYA 3R9OA 2HWPA 2RL5A 3R73A 3RALA 5C1QB 3H0ZA 3PXZA 5EHYA 5HTCA 3QRIA 2WMSA 5TR6A 1QPCA 4XP2A 1ZY5A 3KA0A 3RBWA 1XH6A 4D58A 4ACMA 4LOQA 4DHFA 2J6MA 5JFSA 3I1AA 4X2FA 4FUYA 1VZOA 2WTWA 4YZNA 3RJCA 2B9FA 2F2UA 5E8UA 1H1WA 3DU8A 3GB2A 3G6GA 4HPUE 2QLUA 3R1SA 2P3GX 5BVFA 3BRBA 4DYMA 2VWZA 1NVQA 2SRCA 4YMJA 3NMUF 2ITZA 2PVJA 4UZHA 3RP9A 2W17A 4DBXA 5H8EA 2HENA 3RK9A 1TQPA 3QD2B 4BDDA 5CTPA 5HNGA 3HNGA 5C4LA 3AC5A 3MA6A 3D7ZA 3FLZA 4YBJA 4USDA 3NPCA 1ZYDA 1JSUA 3FWQA 3HLLA 4GT5A 1YHVA 2XKDA 2QOKA 4I21A 5AP2A 4ZTNA 4TL0A 2PU8A 4EH5A 4FA2A 4FT0A 3UNZA 3BYOA 3C1XA 4YSJA 5FD2A 3BHYA 5HHWA 5TF9A 4APPA 3KN5A 3P0MA 2W1EA 1BKXA 5HNIX 1BUHA 4WG3A 4O7LA 3LXNA 4P5ZA 3ZSHA 4DEGA 3CQWA 4KKHA 5CU3A 3BHHA 3IONA 3PTGA 4D55A 3RNYA 5JFVA 4CRLA 5IQFA 2XNNA 5DR6A 3A99A 3P86A 4RMZA 1YOMA 3CQUA 3F5UA 4U9AA 2J0LA 2WTKB 2GQRA 4M66A 3E8EA 2G01A 3LCDA 3I6UA 4XG2A 4JBPA 4CT2A 5CAOA 4GSBA 2OU7A 3BPRA 1WMKA 2OKRA 5E8XA 3LW0A 5J9LA 4AP7A 4I93A 3Q9WA 2PVKA 4ZTQA 4QP3A 5KMLA 4A9SA 4FUXA 2Z2WA 3EL8A 1YQJA 2C5VA 3LHJA 4ASXA 5FXQA 3E8DA 3HGKA 4L52A 4YO6A 3UVPA 5L8JA 4EYJA 4OTFA 3C7QA 2E9PA 3EL7A 3Q6WA 3VJNA 4PDYA 3LFBA 5DLSA 5HORA 3C0HA 3PSDA 5AP6A 3U6IA 3F2RA 4ZSGA 2RF9A 5CVHA 3ZONA 4PWNA 5JQ5A 3KXMA 5AMNA 4RC2A 1YHWA 1PMEA 5HGIA 5E8YA 3CR0A 3PSCA 4O0RA 5D9HA 3ZUVA 4ASZA 5CEKA 5FLFA 5H9BA 4X0MA 5CSWA 3ZEPA 4BN1A 4MXAA 3W2PA 2CKQA 3CTJA 4XBUA 4EK6A 5HIDA 5BYYA 4JT3A 4BBFA 4F9WA 4KWPA 1F3MC 5GZ9A 2X6EA 4RRVA 5HG8A 2YCQA 4PY1A 4QMPA 5DYJA 5DFPA 2ZYBA 3CPCA 4USEA 2PHKA 4QTBA 4IFCA 3E93A 4IM0A 4MXXA 2UZDA 1H24A 4BR3A 3JVSA 1HCLA 3QL8A 4E4MA 5A6OA 2QU5A 2OH0E 4WT6A 5IA4A 2XM8A 4EH7A 3QRJA 5HE2A 5CLPA 3U6HA 3LLTA 4YJPA 4IVDA 3FPQA 4GIHA 2X8IA 4UWYA 5E90A 2XRWA 3GU4A 4WIHA 2YFXA 4CCBA 4U42A 4D2RA 2JFLA 4BKYA 2VGOA 3D94A 4MAOA 1U54B 2OIBA 2WIPA 2OBJA 4PPAA 5AR2A 4X3FB 2H8HA 3F9NA 1DAYA 5DVRA 1PMVA 2UZLA 4A9YA 2C3LA 4AZTA 4O7NA 3E8CA 3ZM9A 3B2TA 4Y85A 1FMOE 3SD0A 4D2WA 3JY0A 2R4BA 1PXLA 4EK5A 3VW8A 2ZV9A 1H1SA 1WZYA 2JAVA 4QMUA 4O0XA 5CF4A 5AV4A 1WVXA 4XS2A 2W1FA 3PWDA 3VBWA 3TDVA 5TO8A 5CS6A 4RIXB 3D15A 1WBPA 3EB0A 4MD9E 3Q4UA 2XNOA 3QTZA 2UZNA 2J0MB 3BU6A 2R0UA 4FOCA 4U80A 4YLLA 2QKWB 4WNKA 3Q52A 4F6UA 3FI2A 4FG7A 3TI1A 4PX6A 3ZZEA 3TNQB 4RIOA 2C1AA 3HMOA 2X4FA 3QCSA 2R3FA 2W9FB 4KS8A 1P2AA 3JUHA 3KL8A 4QQCA 4IDTA 4C2WA 4IAIA 4EHEA 3O8PA 3QTIA 3ZLYA 3H4JA 3R7GA 2HYYA 2OG8A 4S30A 2UZBA 3FJQE 3KFAA 4TNDA 3FYKX 5B7VA 2ZV2A 3LFFA 3L8VA 3QZHA 3OWJA 4QMTA 1PJKA 4AZSA 4E6AA 3UIMA 2BUJA 1ZWSA 4HCUA 2C5OA 3UO4A 4V0GA 3ALNA 1BL6A 4C02A 3IQ7A 2YIWA 3V8WA 2WQOA 3BQRA 1Q8YA 2UW9A 4XMOA 4RBLA 3TKUA 3BHTA 1FOTA 3VRYA 1PKDA 2E2BA 2XH5A 2ITVA 4TY1A 5DBXA 2IN6A 4ALUA 4S32A 2BRHA 3KRLA 3I4BA 3L1SA 3NUNA 2YEXA 3E3PA 4WHZA 5AP3A 3R7VA 5A4CA 5K5NA 4EOKA 4QP7A 3TZ9A 2R7BA 5HVKA 3V5LA 3ZZWA 4C62A 2XK8A 1LPUA 2HY81 2YJRA 5IMEA 4NU1A 2PVRA 4HNIA 4FKIA 3PWYA 4IVCA 4EH2A 2ZVAA 2YA9A 4W9XA 1W84A 5DT3A 2C69A 3HMIA 1IEPA 4DTKA 2BDJA 4L67A 2X7GA 5HZNA 5HVYA 3GU5A 2VX0A 3RHXA 2CNVA 5HTIA 2J50A 3H9RA 2GQGA 3QA0A 3DJ6A 4PF4A 4CYIA 2J5EA 3QXOA 4MYGA 2FB8A 5A4EA 5EDPA 4IX6A 2CKPA 4IC7A 3OS3A 2OXYA 3OEFX 4F9CA 4J95A 3GT8A 3MH1A 3NNWA 4QYGA 3V5JA 2V55A 3ZDUA 1WBWA 4O7ZA 2YM5A 3C9WA 4U81A 3KEXA 4DGMA 5A6NA 4YR8A 5J1WA 5HEZA 3QAME 3FXZA 2PTKA 5CF8A 5CEIA 3CLYA 5I9XA 1BYGA 3OT8A 4CTCA 5KMMA 1ZMUA 1J7UA 5HQ0A 4FYOA 4DG3E 4FE2A 1ZMWA 3ZLWA 3P1AA 4M84A 4U3ZA 3R22A 1KV1A 3QWKA 3V6SA 5ANIA 4P2KA 3TWJA 5ETFA 1XBBA 2Y8OA 5JQ8A 1MQBA 2JFMA 2XKFA 3PJCA 3R7OA 3HVCA 2PZYA 5LJJA 5IISA 4YP8A 4YZDA 5CYIA 4BTKA 1Q41A 2R3PA 1GZNA 4CQGA 3UVQA 3ORKA 5IA1A 2NRYA 5IG1A 2Q83A 3LM5A 3R8PA 3ZH8A 5FP6A 3FMJA 3BBWA 2UW8A 3A60A 4AE6A 4D0WA 5M4UA 3QZFA 4FGBA 4Z55A 4GK4A 2BTSA 4TYEA 5AADA 4DFBA 2HK5A 2W5HA 3E8NA 3RAIA 1Y8GA 3NVKI 3EN9A 5LMKA 5C26A 1PF8A 5IUIA 2QU6A 4FV3A 4QQ5A 3LE6A 3GFEA 4DITA 4H1JA 3NW6A 3P4KA 4UZDA 2C0OA 4TTHB 3WE8A 4QMXA 3TCPA 5GIOE 2IW6A 3NYOA 3FKOA 4PL3A 2BRMA 3QCXA 1BI8A 3OW3A 2XK4A 4AACA 3DOGA 3MH3A 2PUPA 4L43A 2WMRA 4ACGA 3D5VA 4IZYA 1DS5A 1LEWA 1B38A 3DS6A 4GU9A 1H1RA 3D4QA 2OJFE 5EOBA 4BY9E 1YI4A 4DH8A 3LXPA 4CMOA 3FZOA 4GVJA 2R7IA 3EFKA 3AOXA 4O7YA 3MV5A 3ZLSA 2IO6A 2XRUA 3C13A 3BEAA 2R3MA 2YHVA 3R7IA 3KXNA 4TPTA 4D2TA 3MTFA 1URCA 5J7HA 4QNAA 5KUPA 2C6TA 4ZP5A 3F3ZA 3KRJA 1OL5A 4XP3A 4GEOA 5HU9A 4KINA 1PHKA 3DNEA 4RJ7A 3FE3A 2EXMA 4FTAA 2X9FA 3KGAA 1UA2A 1XWSA 2GSFA 4L7FA 2BZKB 4FVRA 3W33A 3HEGA 5HTBA 1X8BA 3IS5A 2R2PA 4D2VA 4ZTLA 3LQ8A 4GK2A 1OL7A 3VF9A 5K9IA 2F7ZE 2LAVA 2FSTX 4PRJA 3UIBA 4IBMA 3EFLA 4ITIA 4IH8A 4KIQA 3F3WA 3UG2A 3F69A 5AX3A 4Z7GA 3OY1A 1JLUE 1YWVA 4WBOA 3CTHA 5DHJA 5DR9A 3WOWA 4BC6A 4DA5A 4WG5A 4QMYA 1QL6A 1H8FA 3FHRA 3UOHA 5K4IA 3TV6A 4E4LA 3QBNA 5IQEA 1H01A 4JX3A 2WTKC 4BB4A 5ETCA 3VULA 4FKQA 3L8SA 4FTCA 5CY3A 5ETAA 5F20A 4BIDA 3NVMB 4TWPA 2HOGA 4OTQA 4XCUA 1Q3WA 3VN9A 2ITOA 2C0TA 2UZEA 2QOQA 4FL3A 4FZ7A 1OUKA 4EH3A 5HO7A 3F5XA 3HRFA 5M09A 5IA5A 4QQTA 4UY9A 5D41A 4UMTA 1LR4A 4RJ4A 2OZOA 3V5WA 4S34A 1VYWA 3G9NA 2ITNA 4WUNA 5AX9A 5JRSA 2VTHA 5ANJA 1CTPE 1UU7A 2QG7A 3K5UA 3M1SA 5IQCA 2X39A 4RFZA 2YAKA 4RX7A 4WSYA 4QYHA 3MS9A 4BHZA 5LVPA 1H4LA 2YIXA 5FEQA 2XIXA 2BHEA 4BWPA 2IPXA 4FSWA 3AC3A 1OPKA 4HGSA 1UKHA 4CRSA 3DKCA 3AC2A 1Q5KA 3G2FA 3QQFA 4ZOGA 4IWDA 1V0PA 2PVFA 3QGYA 3HRCA 3TV7A 4LRKA 1H08A 2BAJA 5EDQA 4JQ8A 4CV9A 4ZTHA 3DDQA 2QOIA 5HLWA 1JKTA 4HCVA 3TN8A 2F7XE 2W1CA 3E63A 2XF0A 3NAYA 4AN9A 3OW4A 3R28A 3W18A 4IAAA 5AIRA 3AD4A 3B8RA 4DGOA 4NYEA 2OJ9A 1YDTE 4A07A 4F6SA 2W06A 1P14A 2VUWA 1J7IA 4FYNA 4PNKA 1NA7A 5CI7A 1J1CA 5AAFA 2OF2A 3DY7A 2XCHA 3P08A 4AOIA 1SNUA 3VJOA 4YZ9A 4TZRA 5D12A 1ND4A 5C01A 4NEUA 1PXNA 4CG9A 4IZ5A 4FKTA 4UN0C 3FI3A 2PSQA 4DLJA 4KABA 4GS6A 4YLKA 2YDKA 4KBAA 4AG8A 4KNBA 2W1IA 1YXSA 2RFSA 2YM7A 2E9UA 2PZRA 2UW0A 4G9CA 5ACBC 3NUYA 3ALOA 3IW7A 5J87A 4FOBA 4LRJA 4E93A 2R3NA 5BVDA 4RPVA 5LVNA 3SOCA 2WOUA 2WMXA 4L3LA 5FBOA 3TV4A 4FSUA 1H1PA 1PXMA 2I1MA 3MBLA 3VS1A 4RIYA 2JDOA 3GCQA 2BVAA 3HL7A 3Q3BA 3WZJA 2CCHA 3CKXA 3FLNC 4K0YA 2O0UA 3F3TA 2PUNA 2CGUA 4RQVA 2BHHA 3JPVA 3UQCA 1QPEA 4EZ7A 3WF9A 3A7GA 3NUSA 4FTRA 2J4ZA 3R1QA 1OL2A 4R1VA 4BDKA 2EB3A 4JBOA 3FXWA 4C57A 3POZA 2JAMA 2VTLA 3DK6A 1OITA 3WBLA 5EQEA 3OMVA 5EI6A 5CENA 3BGQA 4XHKB 4O0YA 5ANDA 4L6QA 3ERKA 2UZOA 4EOPA 3WARA 2QO7A 4J99A 5ICPA 4GUBA 4Q2AA 4S33A 4BDIA 3L9LA 3AQVA 4JBQA 4RSSA 5FUTA 4NFMA 3OEZA 4CXAA 4E5BA 2XA4A 5EM7A 3Q4TA 5HX6A 4AA0A 3FI8A 2GNHA 2C5YA 4I3ZA 2W4OA 5CEOA 3NUPA 4WNMA 2ZMCA 5IMXA 2B9IA 4EOJA 3IK3A 5I3OA 1MUOA 3RVGA 3MFUA 4LGDA 4YNOA 3CQEA 4TT7A 2IW9A 3RNIA 1SVHA 1Y8YA 3MW1A 2ZDUA 1OM1A 2WHBA 4AQCA 4J98A 2YIYA 3PG1A 4QPAA 4CLIA 4JXFA 3ZRLA 3PFQA 5LWMA 5EQYA 4C3RA 5C4KA 2R3KA 2FSMX 3QQJA 5KO1A 2IVUA 3OZ6A 4JIAA 3ZLXA 2O5KA 3KY2A 2XEYA 4PNIA 5IQDA 3MVHA 4BCHA 4F08A 4EH8A 4QMZA 1GZKA 1VEBA 3EKKA 2JEDA 2WU7A 3W8QA 2YZLA 3WE4A 1Q8UA 5M4IA 1URWA 5CX9A 4L44A 4EL9A 3TUBA 5L8KA 1YDRE 2Y6MA 3FMLA 2I0VA 5H8GA 3R8LA 2P4IA 1L8TA 3SRVA 4XLVA 4YGAA 3HECA 1PMNA 3DKOA 4JDJA 5HLPA 4BIBA 3KREA 4N6YA 1PXIA 2F4JA 2J0KA 4IB3A 4ORKA 3ITZA 1M7NA 2PMNX 5AP0A 2R3LA 2C6OA 3MB7A 1RE8A 3DK3A 4R7BA 1G5SA 4ZJJA 4H3BA 4EQUA 5IQIA 1E9HA 3D5UA 3QRUA 4F7SA 3PPZA 4OR5A 4TNBA 4LI5A 1QPJA 4BDAA 3MPMA 3R01A 3IGOA 3AGLA 4OTWA 4FNWA 3SRVB 1OB3A 5HCYA 5AJQA 5E8TA 4Z9LA 3FMKA 3MPTA 3IW6A 3I0QA 4LG4A 5HO6A 4ZLOA 1JSVA 1KSWA 3N51A 5JGDA 4X3JA 2CNQA 3UVRA 3DB6A 4BDFA 3VWAA 4BF2A 4BCQA 3DXPA 1H27A 3RWPA 3LMIA 2QC6A 2JKQA 1R78A 3CE3A 3QD4A 4Q9SA 3ZO2A 4IADA 4YZBA 3HDNA 1W83A 3IPHA 4M7IA 5CNOA 4EOSA 3FKNA 4WO5A 3PZHA 4RJ6A 2C3JA 5JEBA 4DG0E 3EHAA 2O3PA 4QMWA 3ZUTA 1IA9A 3DGKA 3NAXA 4F0GA 3VHEA 2CDZA 3PVGA 2BDFA 3BE9A 4BI2A 2QOOA 2IVSA 3MSSA 4JG8A 5BMMA 4KBKA 4JRVA 1R0EA 2YITA 1ZAOA 4HGEA 3RCJA 2ETKA 3FLQA 4EJNA 4ZEGA 1ZYCA 3ENHA 1S9IA 2KULA 3EN7A 5IA0A 3UDBA 4I24A 2XNGA 5EM8A 2P0CA 4S31A 4XV3A 5AV2A 5GJDA 3PA5A 3COHA 4PL4A 1SVEA 3JXWA 4FKRA 5D7AA 4O0VA 4IB0A 5M07A 4QQJA 2YM3A 3QQKA 3BWFA 4Z16A 3R8UA 2OSCA 2XS0A 3MY5A 4G3EA 4IDVA 4X2KA 2B53A 2YIRA 3LXKA 3ZOSA 4C58A 4O7VA 2Y4PA 4JNWA 4TKSA 4DEHA 4R5YA 4F1OA 3IDPA 3KKVA 4HCTA 4CKIA 3EFJA 3CC6A 3MI9A 4QP6A 4ZTRA 4E4XA 4EH9A 2O64A 3AGMA 4UYNA 4TXCA 1CKIA 4LYNA 4C4GA 3LFQA 4WSQA 1Y57A 2XKEA 4QMSA 4YHFA 3U4WA 4FR4A 3EN6A 1QCFA 4Q9ZA 3OC1A 5B2KA 2XIKA 5IH4A 3QYWA 3VS0A 2Z60A 5ANKA 3W2CA 2PVMA 3ZXZA 3I0OA 5E8ZA 4ZLYA 4WOVA 4FEUA 4BDGA 3UPXA 4DG2E 2RG6A 3FLYA 2ZJWA 3RPSA 4BVUA 2FH9A 2OXXA 4DGGA 2W0JA 4YUQA 2WELA 2BTRA 4I6BA 4U7ZA 4FTKA 1OBDA 3MY1A 3SW7A 4C4HA 5KMNA 4ZXTA 3L8XA 1WBVA 4M13A 2J0JA 2OK1A 3BCEA 4AS0A 4C4EA 3EN5A 3AMYA 4JDHA 2V62A 1B39A 3A4OX 3OWPA 2OJIA 3BLQA 3BV2A 4KSPA 4J52A 4DH1A 2HXQA 3DZOA 4PTCA 4XOZA 4PPBA 5HD4A 1XQZA 2C6MA 2B4SB 1MP8A 3BE2A 4HPTE 3EMGA 4MXCA 4BRXA 1ZZ2A 2WZJA 4GT3A 1WCCA 5LWNA 1OECA 4E8AA 4UMUA 4V04A 3VO3A 1NY3A 5IKWA 5BYLA 3R6XA 4IM3A 4XV2A 4YZCA 2QG5A 3TNHA 3Q53A 3RTPA 3T3VA 4JI9A 3SVVA 1UU3A 3KQ7A 4GVAA 2H96A 4NCTA 5IZFA 3UTOA 2C1BA 2YM4A 3MIAA 4ONAA 3EQIA 4KKEA 4CLJA 1TQIA 3DLZA 1ZRZA 3O51A 2GU8A 2QNJA 3BYVA 5HO8A 4QYFA 2VWXA 4W8EA 1V0OA 2OW3A 3C5UA 4O0SA 4AW1A 3PPJA 5FRIA 4GFMA 2X7FA 5DT4A 4O7SA 3S1HA 2W99B 3QUPA 2UW4A 1L3RE 4I22A 3TJCA 4AW5A 2VTOA 4MWHA 3F2NA 4JR7A 4U41A 1PMUA 3IDBA 4EOLA 2OH4A 5KMJA 4IW0A 5LMAA 4FEWA 2O65A 3NW5A 4MBLA 3ZMMA 2QQ7A 4APCA 2HW7A 3LQ5A 3NNVA 3O7LB 5L6WL 1O9UA 4AGCA 4AZEA 1YOJA 3AC8A 4G1WA 3QQHA 1AD5A 4AF3A 4BFMA 1GIJA 3DKGA 3TKIA 2WAJA 1BLXA 3EJ1A 5C8KA 3GQLA 4EHVA 3FPMA 4A7CA 4EJ7A 3R9HA 3FBVA 3GCSA 2FVDA 4NFNA 4F63A 1M2PA 3PIXA 3WIGA 3R8ZA 4L00A 3MGYA 3OT3A 4M15A 4BL1A 3S00A 3F66A 4ZJVA 5DT0A 2GTNA 2A0CX 2R5TA 3RI1A 5CEPA 1YXUA 3W2QA 4UMQA 2WTIA 1K9AA 4FIEA 2WPAA 5LARA 1XBAA 3KMWA 1WBOA 3ZO3A 3BV3A 5H8BA 4M69B 4LRMA 4OBQA 4GJ2A 4AFJA 1U59A 1PYEA 2ZV7A 4CMUA 1NT2A 2GQSA 4LFIA 2IZRA 5LVMA 3A7FA 4PMTA 4X2NA 4BGGA 3HMPA 5EHOA 5AP1A 2X2KA 3SDJA 2WMTA 3SQQA 3AT4A 2EVAA 4RJ5A 4W4VA 2VTQA 4OBOA 3V5PA 5M55A 3MB6A 5IDPA 4J71A 3DZQA 4XG6A 4QO9A 2B52A 2VWVA 1FMKA 4O0UA 4I5MA 5CVFA 3TNPC 4BDHA 5KBRA 4DTAA 1TVOA 4BICA 2WFYA 4WG4A 4FF8A 4PMSA 3ZEWA 4FV2A 5DE2A 4W4WA 5T68A 5L4QA 1TKIA 2VO3A 3A7IA 3HA8A 2CGWA 3ZFMA 4EC9A 2GFCA 4J8MA 5J95A 3IECA 4ANOA 3F6XA 4MWIA 5C03A 1Z57A 1BI7A 3AT3A 2IJMA 2ESMA 1A9UA 4RC3A 4KD1A 4JJRA 3ZC5A 5B2LA 1H28A 1OKVA 2BAQA 2JBOA 3VNTA 4AA5A 4ZS4A 2Y9QA 5KMIA 1IA8A 2JKKA 2PVLA 2BCJA 3R1YA 4RFMA 3I5ZA 4FKOA 4XNEA 4C4IA 3SXFA 2I6LA 4IFGA 3VQUA 2ACXA 2VTSA 4N0SA 3K3IA 3HUCA 5EYDA 3DBDA 3BYMA 4GMYA 4IEBA 3ULZA 4DC2A 3OBJA 4S2ZA 5M51A 2I0HA 4G3DA 3SV0A 5J5SA 2HY0A 5JK3A 4ZJIA 3LQ3A 5FWKK 3DTCA 3GFWA 3GU7A 5E8VA 2CLQA 3G0EA 4U8ZA 5GNKA 1I44A 5HVJA 4NWMA 1H26A 3BLRA 4FGRA 3Q32A 4FICA 4N57A 2GS2A 4YC3A 4BI1A 2CNUA 3PRFA 3ACJA 5L8LA 1KV2A 4IACA 2OJGA 3NEWA 3KU2A 4WNOA 5BUIA 4R1YA 4X2GA 3UC3A 5I4NA 4KRDA 1NVRA 3GBZA 4BCMA 5CF6A 1FVVA 4L68A 1Q97A 4AXAA 1YKRA 4JQ7A 4PDSA 4GKIA 3HA6A 3FMHA 4FX3A 3R8VA 4K18A 2DQ7X 4IXPA 3FL5A 5IUGA 3UOLA 5AFVA 4JDIA 3QGWA 3W32A 3ACKA 5ANGA 4BDCA 3GOPA 4DEAA 3KK9A 4WBBB 3NUXA 3W10A 4BKZA 5H2UA 5CU0A 2G2FA 4O7RA 3W1FA 3G15A 5FDXA 4B8MA 2EB2A 2VO0A 4IAZA 3RK7A 3P5KA 5EDRA 2KTYA 4FEQA 3BZ3A 3MH2A 4FSTA 4HNFA 1OPLA 5ANEA 2GHLA 4FT3A 3FI4A 2PYWA 2CJMA 3RKBA 4PV0A 4USFA 5L2WA 2CKOA 3NZ0A 4EEVA 4O82A 3HX4A 5CAQA 3ODZX 4NKAA 5G1XA 3P23A 3KXXA 4J96A 4CD0A 3DAJA 5CU4A 3O96A 4C3FA 2VWIA 4X6RA 5CNNA 3OD6X 3OOMA 3Q9YA 3DAEA 4PTGA 4QTAA 2VTRA 4IB1A 4AA4A 3HV7A 3AC1A 3QTRA 4A4OA 3DAKA 3EZRA 3NNUA 1JKLA 2ITWA 3CP9A 3LJ1A 4FIGA 3S0OA 2QOBA 5M53A 2Y4IB 4OGRA 4I5CA 4OBPA 5LCKA 4D1SA 4E3CA 3BKBA 4LUEA 2BRNA 3R21A 5AR4A 3EQPA 4PL5A 2IVVA 3FAAA 3E5AA 4X2JA 4XG4A 5IQHA 1B6CB 3DNDA 3TNIA 2GPHA 2C68A 2Y4IC 3ZBXA 4C38A 2FUMA 3UIUA 4AE9A 3NGAA 3ZO1A 5DH3A 3SG9A 2C4GA 5KBQA 3O23A 4QMVA 4WRGA 4UALA 3ZCLA 4EUUA 3QQLA 3KXHA 2WQMA 4YPDA 1ERKA 1IG1A 4OAVB 3NYVA 1FBNA 4DN5A 4RG0A 1DAWA 1Q8TA 2OZAA 2ZM3A 4Y95A 4GUEA 4XYFA 5HKMA 1LP4A 4L01A 3CIKA 4ENXA 5IQGA 5JGAA 2BIKB 5I9UA 3C4FA 3BGPA 3HKOA 4B9DA 2A4LA 5CALA 1OGUA 3ENMA 4TYHA 5CT7A 3KXGA 4MBIA 4ZY4A 1YDSE 4ZIMA 3OUKA 2FYSA 2ZM1A 2PVHA 4DBNA 2W9ZB 3DQXA 2FO0A 1WBTA 5CSXA 3WF6A 3ULIA 3A62A 4F9BA 3R1NA 1CKPA 3M42A 4GYGA 4GG5A 4PPCA 1KE6A 5E92A 4MXYA 4EUTA 4RLKA 4YZMA 3DJ7A 2UZWE 4B0GA 4AW0A 2XK6A 4BCIA 4JDKA 3R9NA 3TKHA 3I6WA 4XEYA 4CFNA 1SNXA 3GP0A 3LFDA 1Q3DA 5DEYA 3WYXA 4FEVA 4FSQA 3I79A 1OMWA 4H3QA 4RIYB 4WKQA 3GCVA 3ZRKA 4M8TA 3UZTA 4JOAA 4JBVA 4TYIA 4UBAA 2BFXA 3PP0A 1YWRA 4MVFA 1V0BA 5I9WA 2XIYA 1ZYLA 3PZEA 3MWUA 5AUZA 4EH6A 3FZTA 5HU3A 4NIFB 5L2TA 3GCUA 3MESA 5HLNA 1F0QA 4CFMA 1CKJA 3W2OA 1RW8A 3TIZA 3FY0A 2YM8A 3VIDA 3SGCA 3U4UA 1U54A 4ERWA 4DGLC 4C33A 1JNKA 4I94A 5KHXA 2YM6A 1PXKA 3TZ7A 1UU9A 1U5QA 4C35A 4RVLA 3MYGA 5F95A 4CMTA 5HCZA 1U4DA 4JLCA 1CDKA 2Y7JA 5EQPA 3F3VA 2QODA 3KVXA 3FMEA 2BFYA 2VTAA 4X21A 4FNYA 4D2SA 3V04A 5AV1A 3PVUA 4EK8A 4G6LA 4XJ0A 4DCEA 5FXRA 2QO2A 2LGCA 3NIEA 2XK3A 3QU0A 5K0KA 5KMKA 2R3HA 3QQUA 3CXWA 2HIWA 3NCGA 4QOXA 4IJ9A 2V7AA 4FEXA 2W1ZA 4M97A 4BKJA 1KUTA 2B0QA 1OIYA 4WNPA 5HG5A 4AX8A 4OTGA 2VD5A 4WRSA 1XH9A 3PJ8A 2DWBA 5EYCA 2X8EA 2FA2A 2Q0NA 3EQCA 3VBXA 3UMXA 4ID7A 4OT5A 1OIRA 4O21A 2WQEA 4R8QA 4BZDA 4F9AA 3VUHA 4N4SA 2PPQA 4O7TA 4RJ3A 2YDIA 5HBEA 4C3PA 4DF3A 4LGGA 1SYKA 3EQHA 4H1MA 4HYSA 3W2RA 3C0IA 5KE0A 5HE0A 4EBVA 1KWPA 3C4XA 4P5QA 3UIXA 4GU6A 4BGQA 3BI6A 1JVPP 5HIBA 3AC4A 3F7WA 1I09A 2ONLC 5ITAA 1YWNA 2RGPA 3VS6A 5I9VA 1YHSA 3TIYA 1Q8WA 2C6IA 4IVBA 3E87A 3K5VA 3R04A 4C34A 3S4QA 3LCKA 4FTTA 5FDPA 4HOKA 2QLQA 4FIIA 3ZFYA 1GIHA 2WMWA 3DKFA 5IUHA 5E91A 2C3IB 2XB7A 5J1VA 2FSLX 5EHLA 4NW6A 4D9TA 4XRLA 2ERZE 3UQFA 1ZZLA 3WZKA 4RVTA 2W5AA 5CI6A 2FSOX 3UG1A 3VQHA 4CTBA 2XIRA 3W55A 5EM6A 3DBCA 5LVLA 3FV8A 3C4WA 5BUEA 2YAAA 4QP1A 3PE2A 3RINA 4AT3A 1YXXA 2QVSE 2VTMA 2XNEA 2YN8A 1J1BA 1BL7A 3DTWA 2RIOA 3D5XA 2NO3A 4UYAA 3SXRA 3VHKA 4D28A 2Z7LA 3POOA 2UVYA 2CHLA 2G9XA 4NJ3A 5AV0A 3TTIA 4ALWA 5IEXA 2ITYA 3KK8A 4FV6A 4E73A 1YI6A 3V51A 4ASEA 1OKWA 1M14A 2JIIA 3ZDIA 4AU8A 4A9TA 5A14A 1J91A 4PDOA 4KSQA 3D0EA 1YI3A 3DBEA 3G6HA 2PMOX 4I5HA 3LPBA 2C5XA 3A8XA 3PXRA 1Y6BA 4GW8A 3CSVA 5AM6A 3D5WA 3UMWA 4HVDA 4IWQA 2CPKE 3A7JA 3FMMA 4KAOA 2VNYA 3ZSIA 4BZNA 1T46A 3IW5A 3UC4A 4KA3A 4XG3A 5CT0A 4F65A 3A4PA 3KMMA 4EKLA 2O2UA 3AMAA 4K2RA 4HGLA 3LLAA 1JKSA 4IHPA 4K6ZA 5ETIA 4B6LA 3IG7A 4C4FA 4D4RA 4ZSAA 1JQHA 3V8TA 5BVKA 3F2AA 3QLGA 3P7CA 4M12A 3VBQA 4E5AX 2GHGA 4HYIA 3QKLA 3CY2A 4W9WA 5C9CA 4BGHA 3FQEA 4FG9A 3A61A 1DI8A 2ETRA 3S2PA 3TM0A 4PDPA 4JG7A 2ZM4A 3HV3A 4ANSA 4YURA 4EBWA 4B8LA 2P33A 5M57A 2VWYA 4ACHA 3OP5A 4C2VA 1MRYA 4RZVA 3UYSA 3T9IA 3LCOA 2RFEA 2I7QA 1SVGA 2X0GA 3E64A 2H6DA 3PDTA 4MCVA 1T45A 5DR2A 1CMKE 4YLJA 3UYTA 2QKRA 4RGJA 4XOYA 2PZIA 3OXTA 4FKUA 4FZ6A 2QR8A 2NPQA 4LV5A 2WQNA 4AWIA 2XNPA 4Y5HA 5CSVA 4ENYA 4BTJA 2X2LA 4HYHA 4Y73A 4D1ZA 4FVQA 3TL8A 3VUDA 2VX1A 4FBXA 4RQKA 3UQGA 4F7JA 1J7LA 5GJFA 3T8OA 3GXLA 4BCKA 2JIUA 2JLDA 3KRWA 3TZMA 1XJDA 3RZBA 4NM3A 4E4NA 5KHWA 4RIXA 4A4XA 3GU6A 2PL0A 3EKNA 2RG5A 3WZEA 3PA3A 5BVWA 3VVHA 4ACDA 3BU5A 5CU6A 4DH5A 3KVWA 5FQDC 3NS9A 2RFNA 4ZSEA 1NXKA 3QTWA 2GDOA 3CTQA 4DGNA 4GV1A 5JZJA 2IWIA 3HUBA 1W7HA 3QHWA 2OFUA 3COKA 3DK7A 4R7HA 4GFOA 3ZBFA 3F3UA 4F7NA 3DV3A 2OXDA 3VRZA 2JKMA 3IGGA 4FTQA 4CZUA 3KC3A 4UEUA 3GU8A 4G9RA 4ZS0A 2RFDA 1ZOGA 1OPJA 2BZJA 4AZWA 4F7LA 5FEEA 4BDBA 5JT2A 3JY9A 3FEGA 4XG7A 5GZAA 4G31A 5E4HA 3OUNB 2WXVA 3JVRA 3KB7A 1UVRA 4ANBA 4TYGA 5DGZA 5FTQA 3R9DA 4BIEA 4OT6A 4HW7A 2CCIA 5L2QA 5K4JA 3CGFA 2XK7A 4BWKA 3UZRA 3KF4A 2V22A 2UVXA 1GIIA 4NTTA 4O86A 1IRKA 1Y91A 3DXQA 1CM8A 3EWHA 3V6RA 4B7TA 1H00A 3BYSA 4FZFB 2AC3A 2AC5A 3PLSA 5IU2A 5HCXA 3FMDA 1Y6AA 2OFVA 2YWPA 3BX5A 3VUGA 4K9YA 3FXXA 4HGTA 3UNKA 3QZIA 2WGJA 3NDMA 1JBPE 4KIKB 5DEWA 5G6VA 5HBHA 4QP8A 4ANLA 4IZAA 1HOWA 4O6EA 4CQEA 5JMSA 1WFCA 5C8NA 3EZVA 3DDPA 4R3CA 4R6VA 4TWNA 4KUJA 4FG8A 1OIUA 3ZM4A 3R71A 3FMNA 2YJSA 4G6OA 4UB7A 3V01A 4HVIA 2BZHB 1YXTA 3LJ2A 4CT1A 4TYHB 3D14A 2JDTA 2BKKA 1A48A 4U6RA 4QP2A 3BIZA 5IQBA 3DCVA 4HJOA 5HX8A 2RSVA 2UVZA 3PVWA 4P4CA 3WI6A 2GHMA 3G33A 4I6FA 4DFXE 4GCJA 4QTEA 4LM5A 2ZDTA 4KB8A 2ZB1A 3S95A 3V5TA 3K3JA 5AP7A 4DE4A 3NLBA 2GNGA 4MH7A 3EQGA 4L45A 3UODA 4GL9A 3EFWA 4LL0A 3N4VA 3CEKA 5AAGA 3KF7A 4FI1A 3II5A 3HV6A 5H3QA 2J9MA 3WILA 5IH5A 3FZPA 4F1TA 2PZPA 3CPBA 1S9JA 4YJVA 3BGZA 4A9UA 5F94A 3ET7A 2VU3A 4ZZOA 3R83A 4FTJA 3AD6A 3QTXA 3GUBA 3LCTA 3NUUA 4OTIA 5FTOA 4ZSLA 3TUCA 1QMZA 4ANQA 2EUFB 2XM9A 3CJGA 3PYYA 4NK9A 4RX8A 3QYZA 2QHNA 4RZWA 1ZOHA 3V8SA 3LKMA 3U87A 2WTDA 4IC8A 4YJUA 4PTEA 2UZTA 5I5ZA 3OTVA 4Y46A 4DT9A 3PPKA 4M67A 4PMPA 3TNWA 4CEGA 3L9MA 1GY3A 2IVTA 4F64A 2XVDA 3E3BX 1VYZA 2X2MA 3GEQA 4L46A 3RAWA 5CZIA 3OWKA 2PMLX 4U44A 3C4EA 1UNLA 3NCZA 3GQIA 4IAKA 5CAUA 2PUUA 1ATPE 5DWRA 2VZ6A 1FQ1B 4YC8A 3SX9A 2VTJA 2ZOQA 4XX9A 1R1WA 4KIOA 4O2PA 2R3QA 3OCBA 5T6KA 3F88A 4I6HA 2R3OA 3DA6A 4ARKA 4G3CA 2JKOA 5CU2A 3HP5A 4ASDA 5JN2A 4DEEA 3BLHA 5LQFA 3A2CA 4MD8E 4NJDA 4YPSA 4ITHA 2HW6A 4NUSA 3M2WA 3DLSA 4O83A 4PMMA 1ZOEA 4X3FA 5FXSA 2QI8A 1E1XA 1V1KA 3CGOA 3ZHPC 2VRXA 4MHAA 3R7EA 2FGIA 5AR8A 4M68A 4F0FA 3PY3A 3RAKA 5CZHA 3R2BA 3JR1A 2R3JA 4HVSA 4K33A 2B1PA 4O6LA 4XUFA 3NR9A 3QTSA 4FV0A 4U43A 4EQCA 4BI0A 3SC1A 4V0GB 4CV8A 3F7ZA 1IASA 3ZYAA 4O81A 1FGKA 2WKMA 2YDJA 3FKLA 3VUMA 5K5XA 5AUXA 4R77A 1FINA 3K54A 3PXYA 2YZAA 4D4SA 2XNMA 1R39A 4RWLA 2XEZA 3UO6A 3MPAA 5L3AA 4DH3A 1O6LA 3OXIA 4U40A 4EZ5A 5AUVA 3G90X 3H10A 1UKIA 2BRBA 3N9XA 1AGWA 2IW8A 3AG9A 3QA8A 3RPRA 4ZMFA 2NRUA 4YU2A 3GC8A 4C61A 5AEPA 3FC2A 3PIZA 1PY5A 3ETAA 1ZARA 3P7BA 5HICA 2NP8A 5HG7A 2XUUA 3I5NA 4K77A 4M0ZA 4MXOA 3ZRMA 2W4JA 1PRYA 3LFEA 1OBGA 4V05A 1R0PA 4ERKA 3QRTA 1ZMVA 4I6QA 5KNJA 3SKCA 4YTFA 4L7SA 4JIKA 3COIA 3Q9ZA 3NYXA 4CFFA 3HZTA 2Z8CA 3MVLA 3Q6UA 4PUZA 3OHTA 4QMNA 4OTHA 5CANA 1OL1A 3PLAE 2A27A 4D9UA 2XNBA 4RWJA 1XH5A 3F61A 4UMPA 3RK5A 1KE8A 4UV0A 5IEVA 4AN2A 5M08A 3U55A 2NNWB 3IKAA 4IIRA 2WU6A 4CGAA 3R0TA 5E1EA 4NIFA 4V01A 5E8SA 3SG8A 2XJ0A 3R9RA 2A1AB 3P79A 2B9JA 1DI9A 2VGPA 3U6JA 2Z7RA 4WA9A 5B2MA 5JSMA 4GFGA 3V3VA 1Q4LA 2VWWA 4PQNA 3SOAA 4U97A 4FZAB 4I4FA 3Q4CA 3FSKA 2GS6A 2QOHA 4QMLA 2VO7A 3NWWA 3PXKA 1H0VA 3QUDA 3H9OA 4FSMA 5HESA 3SXSA 3VS7A 4ACCA 1H07A 3OTUA 5HE1A 2J0IA 2XK9A 4E1ZA 3C0GA 4BTMA 2QD9A 4R7IA 4E5WA 2WQBA 4ZY6A 3MTLA 3AMBA 4IB5A 1NVSA 2W96B 3B2WA 3HV5A 3Q9XA 2C0IA 4AT5A 3ORLA 3C50A 4BDEA 4DFUA 2BKZA 3OROA 5D1JA 3RHKA 2WO6A 3FDNA 3QWJA 4ZLZA 3FY2A 2X4ZA 3ORTA 2OF4A 3HAMA 5DMZA 4JS8A 3JYAA 4E6QA 5L6PA 1UV5A 4C36A 2E9NA 5CSHA 1Q8ZA 3WF5A 1OIQA 3ORNA 3PA4A 4GRBA 4XV1A 1UNHA 2ZAZA 4MEDA 3D2KA 2WTCA 2JIVA 2XYUA 4K1BA 2QURA 2OZAB 5FG8A 4BDJA 5AM7A 4YTHA 4ZK5A 4HYUA 4O27B 4EOIA 1FGIA 3Q04A 4LV8A 1CSNA 5J7BA 2VWUA 3MIYA 2UZUE 4IX3A 4JRNA 5GHVA 4CZTA 3TDWA 5BMSA 4FV5A 3FZSA 3GI3A 3R00A 1XH4A 3QCYA 1JKKA 3QUEA 3GGFA 2XJ1A 2GNFA 3UOKA 4AN3A 4J7BA 3QKKA 5AA8A 4FL1A 3HDMA 3I60A 4JL9A 4MD7E 3LAUA 4K11A 2ERKA 3E88A 3FZRA 3H0YA 3VF8A 4C7TA 3VUTA 4F0IA 4E20A 1APME 3QZGA 3OCGA 1H0WA 2YISA 4YHJA 3VS4A 4BZOA 3UO5A 2IZTA 3ELJA 3NIZA 1JSTA 5DOSA 2YCFA 5KX8A 1JPAA 4RX9A 5HI2A 3A7HA 4EYMA 4M14A 5KZ0A 2WOTA 4QD6A 3MH0A 4M0YA 4U5JA 4C37A 1Q61A 3R02A 4IAFA 4FTNA 4GKHA 4I5PA 3HMMA 4D5HA 1W8CA 2W4KA 4DFZE 5L2SA 2Q0BA 4XRJA 2XMYA 2XCKA 3CY3A 4Y83A 1IAHA 4GT4A 3FL4A 2WMVA 2BALA 2AUHA 2JDVA 3KRRA 3PXQA 4H3PA 4JG6A 2OJJA 5C8MA 4AGDA 4RX5A 2WMAA 4OTDA 4IE9A 4F70A 5FGKA 5BUJA 4IX5A 2GS7A 3OCSA 4P90A 2G15A 4KIPA 4F9YA 5M06A 3DFAA 4GYIA 5I9YA 4GK3A 3SHEA 4D0XA 2VTPA 4BTFA 5GINE 4CG8A 2ITQA 3EQFA 3DB8A 3GVUA 5EYKA 3GC7A 5HBJA 4A06A 4YTIA 3ID6C 2CMWA 3RCDA 1A06A 2ONLA 4ZZMA 3HRBA 3PJ2A 3R7UA 1K3AA 4AT4A 3FUPA 4BHNA 3Q5ZA 4O1OA 3PG3A 4R3PA 3QRKA 4RJ8A 3FLWA 2BZIB 4CSVA 3W16A 4Y5QA 2PE1A 5BVOA 3AT2A 3ORXA 4G17A 4AZVA 3O0GA 2CKEA 4YJNA 4CZYB 4A9RA 2CLXA 3ZS5A 1RDQE 3G0FA 3FZ1A 2ITPA 3OBGA 3VBYA 4FIHA 3UE4A 5EKOA 2X8DA 3H30A 4Q5EA 2JDRA 4QRCA 3IOPA 4CKJA 3L9PA 2VX3A 4OUCA 5EYMA 2H9VA 3OXZA 4JQEA 4YHTA 4NTSA 3D7TA 2IZSA 4YBKA 5DA3A 4AOTA 1REJA 3FQSA 4LOOA 2YWVA 2YLFA 3CD3A 2J5FA 4XG8A 3I7CA 5EW9A 5HNBA 1Q99A 4ZZNA 4QP4A 3SW4A 3N4TA 3CS9A 3TT0A 4U45A 3G51A 2UV2A 1M52A 1G8SA 4MXZA 2E9OA 4D5KA 4XH6A 1H1QA 5T3QA 4MKCA 5KKRB 2ITXA 2QO9A 5J9ZA 2R3IA 4AZFA 5FBNC 4OAUC 4QYEA 2C5NA 3Q2MA 5ACKA 2ZV8A 2YIQA 4FL2A 1O6KA 4I20A 2QOLA 4TW9A 3TACA 2P55A 1FVTA 1LEZA 4I41A 3FYJX 4NSTA 3UP7A 4EZ3A 3OCTA 3TJDA 5CXHA 4BCOA 4ANMA 1MRVA 3QC9A 3QFVA 4YNEA 4D2PA 2QHMA 3OG7A 4FV7A 2HAKA 3BWJA 4MNFA 4NM0A 2CGVA 3O71A 3P7AA 5AR3A 4Y72A 5JRQA 2V5QA 4EOQA 4CFUA 4FIJA 4LMUA 3W8LA 2GMXA 1GZ8A 5IA3A 5F9EA 5FTGA 1BMKA 4IANA 4FSRA 2X6DA 4FKJA 2XKCA 4XP0A 1BX6A 4FVPA 3UJGA 2IG7A 4MQ1A 3R30A 4EC8A 2WMBA 4O2ZA 4EH4A 2OWBA 3C4CA 3E7VA 2CSNA 3V5QA 2EWAA 4FKLA 5JZNA 2C6DA 2UW6A 5TKDA 3W2SA 4Z3VA 2J2IB 3CCNA 3VUKA 3UNJA 4ZSJA 4YO4A 4EHZA 5JGBA 3IW8A 3KCFA 2Z02A 3Q2JA 3E92A 1XR1A 2OO8X 4L53A 5CEMA 2Y6OA 3OF0A 5JFWA 4TRLA 5AUWA 3RZFA 4TWCA 3WZUA 4AOJA 3ZTXA 1YW2A 4FSNA 3NRMA 4I4EA 3PUPA 2F7EE 3LOKA 3OY3A 4LUDA 5LOHA 4FKPA 3RWQA 4DEDA 3LMHA 4NZWB 3COMA 5EM5A 3BEGA 4KS7A 2UW3A 2WMQA 3H3CA 3ROCA 4BBEA 3RM6A 5CAVA 4W4XA 4NKSA 4EKKA 2W1HA 3UZPA 5GJGA 2PULA 4O96A 4QPSA 2OLCA 1Q62A 4I92A 4L9IA 4EK4A 4G3FA 4DH7A 3EOCA 5IDNA 2X81A 4FV8A 3MFRA 1F5QA 5EH0A 2UUEA 2ITTA 3LXLA 1WBSA 3O2MA 4CKRA 3UBDA 4E6CA 5M4FA 4IQ6A 3HAVA 5BVNA 1UWHA 3P9JA 3FSFA 4IWPA 5LVOA 2I0EA 3GC0A 4QTDA 4FK3A 4FKWA 4XV9A 2P2HA 5HD7A 3O8TA 1PYXA 2PE2A 2O8YA 3FQHA 3BU3A 4FNXA 4YJSA 3PY0A 4MK0A 4O22A 1SM2A 3T9TA 5LXMA 4YJTA 1WVWA 4XG9A 2HZIA 4HVHA 2OI4X 3GCPA 4FIFA 5E7RA 4FNZA 3ZU7A 1SZMA 4AW2A 4BCGA 1IR3A 4BCPA 5M56A 5D10A 1MQ4A 4DCAA 2RKUA 4MBJA 3RPYA 1OI9A 3S3IA 2PUIA 2XIZA 5CF5A 5DN3A 4IVAA 2G1TA 4BCFA 3DFCB 3TG1A 3EYGA 4A4LA 5AUTA 5AV3A 4JX7A 2C3KA 5FP5A 2UZVA 4FSYA 4AGUA 5KKRC 5M4CA 4O0TA 5GZ8A 4IZ7A 4ALVA 4YSMA 3EN4A 1PXOA 4F1MA 5KZIA 5JH6A 3QXPA 1YVJA 5HG9A 4XBRA 3ATTA 2CN8A 2Y0AA 4PP9A 3Q4ZA 3D2IA 5AUUA 2B54A 2XBJA 4EQMA 4R78A 2Z7SA 3C51A 2ITUA 3R63A 4EI4A 4X7QA 2BROA 1UU8A 1VR2A 3DJ5A 5JFXA 3WIKA 3MJ1A 5E9EA 3DT1A 4J8NA 4RWIA 5EW3A 3EQDA 4FODA 4WUAA 2QOCA 3BHVA 2QR7A 3PJ1A 5HE3A 5KMOA 2BDWA 2WIHA 2F49A 1GOLA 3GENA 3HYHA 4H05A 2PZ5A 3QLFA 5LMBA 1OZ1A 4IM2A 4ZTMA 5F4NA 1G3NA 4RWKA 1OKZA 1M2QA 1M2RA 5IA2A 4II5A 3SA0A 4U3YA 1W82A 3OOGA 3WF8A 5AP5A 3CKWA 2QOFA 2WTJA 2X7OA 2WEIA 3ORMA 4GJ3A 4ZAUA 3CJFA 3H9FA 3VC4A 2PY3A 5L6OA 1QPDA 4D4VA 5EKNA 4FTLA 3UOJA 4YJRA 3ORIA 4I0SA 4O84A 4DFYA 2BAKA 1P4FA 3MVMA 3HV4A 4FSZA 4NT4A 1H25A 2WNTA 4FKVA 4I0RA 4DTBA 2VTIA 2IZUA 4RC4A 1MRUA 4FT5A 1VJYA 4FMQA 3ANQA 4G5PA 3ATSA 4BWXA 4QT1A 2GNJA 1XH8A 4EWHA 2WMUA 4B99A 2GFSA 1W0XC 2BIYA 4O0WA 2PVYA 4MQ2A 4DEBA 3IO7A 3IOKA 4LL5A 4L8MA 4O7WA 4DINA 2ZB0A 2YCRA 3MN3A 3LFAA 1G8AA 2OIDA 3QCQA 5I0BA 2PE0A 5FM3A 2G2IA 2GNIA 2YACA 3LMGA 1GJOA 4QMQA 1JWHA 2WEVA 4Y8DA 3KXZA 5EFQA 5EW8A 3THBA 1XO2B 4FTUA 4JR3A 3WF7A 4DFLA 2J51A 5CQUA 5J9YA 5IQAA 1W98A 4KKGA 4LOPA 3WZDA 2OGVA 4NM5A 3GOKA 3LFSA 5K3YA 3QD0A 3KMUA 3VAPA 4CVAA 4ZTSA 3BQCA 2WB8A 4QP9A 2R0IA 5AR7A 5A54A 3OWLA 2YCSA 3ZO4A 5I3RA 2HELA 2JBPA 4IX4A 4C59A 3DPKA 2EXEA 4LMNA 4W4YA 4I0TA 1O6YA 3GNIB 1U46A 4KIKA 2EU9A 2OIQA 1OL6A 3QF9A 4MX9A 4Q5HA 2BILB 3M11A 5IPJA 4MNEA 3RMFA 4G6NA 3L8PA 3UGCA 5JKGA 5BYZA 3U51A 4O1PA 4IWOA 2HCKA 3ZXTA 4DAWA 4YC6A 1RJBA 3TEIA 2JITA 4FTIA 4OLIA 2W1DA 4CYJA 4QMMA 3BHUA 3PY1A 1PXJA
chains in the Genus database with same CATH superfamily
2HGKA 2AQXA 3QC4A 4G2FA 4L3JA 1JOWB 4D1XA 3LZBA 4AXFA 1ZY4A 2F57A 2VN9A 2C30A 2JDSA 5CVGA 1M7QA 3U9NA 4FV4A 1ZYJA 4QMOA 3E7OA 4DEIA 3U54A 1TQMA 4RT7A 2BPMA 2XJ2A 3KN6A 3NYNA 5DG5A 3RGFA 4GH2A 5BQ0A 4UWBA 1XKKA 2HXLA 3QTQA 1GZOA 4G34A 4BYIA 4C4JA 1XHAA 2HZNA 3KRXA 4IJPA 2C6EA 1ZLTA 4H58A 4OTPA 3KCKA 4LGHA 3VS5A 3UPZA 4E7WA 2B9HA 4MF0A 3W0MA 2J7TA 5DIAA 4JVGA 3JS2A 2ETMA 3A8WA 4FT7A 1P4OA 3FC1X 3SLSA 5BPYA 3N4UA 5K0XA 5IF1A 4YJQA 2F2CB 3LIJA 4BBMA 3FHIA 2PK9A 4G16A 3PSBA 4UXQA 3AD5A 2YLEA 5IH6A 3F5GA 3REPA 1PKGA 4ZY5A 2JGZA 3L9NA 4F6WA 1UWJA 4FTOA 4YTCA 3QALE 4P7EA 3AXWA 1J3HA 5I9ZA 4G5JA 5CSPA 5A46A 3RPVA 3VBVA 4TYJA 2DUVA 4AFEA 4CFVA 3TZ8A 4U79A 4W8DA 3QX2A 5LCJA 2PVNA 2P2IA 4O38A 3DQWA 5TE0A 4FV9A 1KOBA 5AWMA 4PP7A 4AAYA 3Q96A 4M3QA 3VUIA 3VS3A 5CWZA 3R7YA 3IW4A 2X1NA 4UXLA 2Z7QA 3MJ2A 3NNXA 2JD5A 3P78A 5EG3A 5J79A 2ZMDA 2XP2A 3ML1A 4E26A 3O17A 3PP1A 4RVMA 3TUDA 4DFNA 3ROYA 3FLSA 4UX9A 3NSZA 4ANNA 1M17A 4DLIA 5BVEA 2CGXA 4EORA 3C4ZA 4OTRA 4QTCA 5C27A 3D83A 5AP4A 3E62A 1TFFA 3HP2A 5TOZA 5ANOA 3O5AA 4HZRA 3NX8A 3QHRA 2B55A 4FK6A 3LCSA 4IAYA 4M69A 5EI8A 3SAYA 4CNHA 2ETDA 4OW8A 4EWQA 5CASA 2GTMA 4MNEB 3I7BA 3UP2A 4LQMA 2HZ0A 4YJOA 4FKSA 5A3XA 3PE1A 2GCDA 3IDCA 4EOMA 4RIWA 1AQ1A 1R3CA 3G9LX 4GIIA 4J53A 4NM7A 5J8IA 3R8MA 4D4YA 4RFYA 2C47A 2FUG1 1XBCA 3OFMA 3I9V1 3EIDA 3D9VA 4QYYA 3LM0A 3PJ3A 5DRDA 1NW1A 5DNRA 2V7OA 3F5PA 4X6QC 4AAAA 3TXOA 3EYHA 4J97A 2XZSA 4EONA 3G5DA 2W1GA 2YABA 1OUYA 4RA4A 3QD3A 4I1ZA 4U0IA 5CAPA 2HWOA 5GIPE 1HCKA 3BELA 4IMYA 1U5RA 5EI2A 1KE7A 4L42A 4R5SA 3PVBA 1KE9A 1XH7A 2VTNA 5EK7A 3HMNA 2O63A 1LUFA 3MFTA 1JAMA 3KULA 3RPOA 2J90A 3MA3A 3LVPA 2A19B 2I0YA 2VV9A 2XBAA 4FZDB 3QQGA 2BMCA 5HIEA 3LJ0A 3ZUUA 1DM2A 2V6EA 2AEGA 5BNJA 1GAGA 5L2IA 4I23A 4B4LA 2I40A 1GNGA 2AYPA 5F1ZA 2BR1A 4KBCA 4NW5A 5A4LA 2HZ4A 3O8UA 4TN6A 4F99A 5DPVA 1FPUA 3OVVA 4QDEA 5E8WA 4H36A 3QTUA 5A4TA 3KULB 3EQRA 4JAIA 2R3RA 1Z5MA 4RLLA 4K8AA 4FV1A 5AUYA 2BRGA 4FT9A 4KRCA 4CFXA 1YRPA 3MDYA 3GC9A 3MFSA 2G2HA 2YERA 2VO6A 3QX4A 4N6ZA 2PMIA 5AR5A 3U9CA 3VW6A 3O50A 5LMKC 4HVGA 2VWBA 4NCTC 5E1SA 3W0OA 3PRIA 2W7XA 5FM2A 4BCNA 5EOLA 4O91A 4BYJA 1YOLA 3MY0A 5TT7A 4NL0A 4N70A 4HZSA 3PXFA 1SMHA 2E9VA 3Q5IA 3ZFXA 5CQWA 2X9EA 4UMRA 4RIWB 2R9SA 5BX0A 3B8QA 4H39A 2W5BA 2PWLA 3ANRA 4UWCA 4Z7HA 4DT8A 1WVYA 2REIA 2VAGA 1PW2A 3VBTA 5HOAA 2DS1A 4XLIA 5B0XA 1KOAA 3LFCA 2B7AA 3LFNA 2VTTA 4RA5A 3F4MA 3MVJA 5AIKA 1STCE 1ZXEA 3BLAA 1K2PA 2DYLA 1E1VA 4J1RA 2OICA 3K2LA 1RQQA 4C8BA 3BBTB 4EOOA 3O7LD 3ORPA 3PIYA 2V0DA 3EH9A 5DRBA 2F9GA 3TTJA 4ITJA 4O4CA 2R64A 2C6KA 1YXVA 5J5TA 1Z9XA 4G3GA 4C0TA 2A2AA 1OKYA 5IEYA 3ZSGA 1WBNA 1ZYSA 5DI1A 3DBQA 3CD8A 3BYUA 3QKMA 4WD5A 1PXPA 3CBLA 4F4PA 2WTVA 4FKGA 4JAJA 3NW7A 5A9UA 2E8GA 5D7VA 3RM7A 2UW7A 2JC6A 5A4QA 3DXNA 5M44A 4MF1A 4CCUA 4X3FC 2H34A 3EQBA 1FVRA 3F82A 3ZC6A 4E6DA 4GG7A 4NH1A 5AAEA 5KCVA 2W05A 3NUAA 3ODYX 4MTAA 1EH4A 2VNWA 2QGMA 4EHGA 3DBFA 4QNYA 1WAKA 2R3GA 5CXZA 1ST0A 3T3UA 2QCSA 4AUAA 4RVKA 4ZMEA 1UNGA 2XYNA 5FEDA 2WD1A 3ORZA 3R2YA 2UW5A 1OVEA 4TWOA 3C5IA 5D11A 3D7TB 4FC0A 1P5EA 4F09A 2EXCX 4BCJA 3VS2A 4FTMA 4CFWA 4AGWA 4R3RA 2CN5A 3RAHA 2C6LA 3I81A 3Q60A 4L3PA 4EK3A 1KE5A 1REKA 3U8WA 1Q24A 4QPMA 5CEQA 2QONA 5AA9A 2GNLA 4FJVA 1IAJA 3WYYA 3R9OA 2HWPA 2RL5A 3R73A 3RALA 5C1QB 3H0ZA 3PXZA 5EHYA 5HTCA 3QRIA 2WMSA 5TR6A 1QPCA 4XP2A 1ZY5A 3KA0A 3RBWA 1XH6A 4D58A 3W0RA 4ACMA 4LOQA 4DHFA 2J6MA 5JFSA 3I1AA 4X2FA 4FUYA 1VZOA 2WTWA 4YZNA 3RJCA 2B9FA 2F2UA 5E8UA 1H1WA 3DU8A 3GB2A 3G6GA 4HPUE 2QLUA 3R1SA 2P3GX 5BVFA 3BRBA 4DYMA 1TZDA 1NVQA 2SRCA 2VWZA 4YMJA 2ITZA 2PVJA 4UZHA 3RP9A 2W17A 2RADA 5H8EA 4DBXA 2HENA 3RK9A 1TQPA 3QD2B 4BDDA 5CTPA 5HNGA 3HNGA 5C4LA 3AC5A 3MA6A 3D7ZA 3FLZA 4YBJA 4USDA 3NPCA 1ZYDA 1JSUA 3FWQA 3HLLA 4GT5A 1YHVA 2XKDA 2QOKA 4I21A 5AP2A 4ZTNA 4TL0A 2IP6A 4EH5A 2PU8A 4FA2A 4FT0A 3UNZA 3BYOA 3C1XA 4YSJA 5FD2A 3BHYA 5HHWA 5TF9A 4APPA 3KN5A 3P0MA 2W1EA 1BKXA 5HNIX 1BUHA 4WG3A 4O7LA 3LXNA 4P5ZA 3ZSHA 4DEGA 3CQWA 4KKHA 5CU3A 3BHHA 3IONA 3PTGA 4D55A 3RNYA 5JFVA 4CRLA 5IQFA 2XNNA 5DR6A 3A99A 3P86A 4RMZA 1ST4A 1YOMA 3CQUA 3F5UA 4U9AA 2J0LA 2WTKB 2GQRA 4M66A 3E8EA 2G01A 3LCDA 4AXDA 3I6UA 4XG2A 4JBPA 4CT2A 5CAOA 4GSBA 2OU7A 3BPRA 1WMKA 2OKRA 5E8XA 3LW0A 5J9LA 4AP7A 4I93A 3Q9WA 2PVKA 4ZTQA 4QP3A 5KMLA 4A9SA 4FUXA 2Z2WA 3EL8A 1YQJA 2C5VA 3LHJA 4ASXA 5FXQA 3E8DA 3HGKA 4L52A 4YO6A 3UVPA 5L8JA 4EYJA 4OTFA 3C7QA 2E9PA 3EL7A 3Q6WA 3VJNA 4PDYA 3LFBA 5DLSA 5HORA 3C0HA 3PSDA 5AP6A 3U6IA 3F2RA 4ZSGA 2RF9A 5CVHA 3ZONA 4PWNA 5JQ5A 3KXMA 5AMNA 4RC2A 1YHWA 1PMEA 5HGIA 5E8YA 3CR0A 3PSCA 4O0RA 5D9HA 3ZUVA 4ASZA 5CEKA 5FLFA 5H9BA 4X0MA 5CSWA 1XMLA 3ZEPA 4BN1A 4MXAA 3W2PA 2CKQA 3CTJA 4XBUA 4EK6A 5HIDA 5BYYA 2V1CC 4JT3A 4BBFA 4F9WA 4KWPA 1F3MC 5GZ9A 2X6EA 4RRVA 5HG8A 2YCQA 4PY1A 4QMPA 5DYJA 5DFPA 2ZYBA 3CPCA 4USEA 2PHKA 4QTBA 4IFCA 3E93A 4IM0A 4MXXA 2UZDA 1H24A 4BR3A 3JVSA 1HCLA 3QL8A 4E4MA 5A6OA 2QU5A 2OH0E 4WT6A 5IA4A 2XM8A 4EH7A 3QRJA 5HE2A 5CLPA 3U6HA 3LLTA 4YJPA 4IVDA 3FPQA 4GIHA 2X8IA 3DA4A 4UWYA 5E90A 2XRWA 3GU4A 4WIHA 2YFXA 1G8JA 4CCBA 4U42A 4D2RA 2JFLA 4BKYA 2VGOA 3D94A 4MAOA 1U54B 2OIBA 2WIPA 2OBJA 4PPAA 5AR2A 4X3FB 2H8HA 3F9NA 1DAYA 5DVRA 1PMVA 2UZLA 4A9YA 2C3LA 4AZTA 4O7NA 3E8CA 3ZM9A 3B2TA 4Y85A 1FMOE 3SD0A 4D2WA 3JY0A 2R4BA 1PXLA 4EK5A 3VW8A 3L0IA 3KIOC 2ZV9A 1H1SA 1WZYA 2JAVA 4QMUA 4O0XA 5CF4A 5AV4A 1WVXA 4XS2A 2W1FA 3PWDA 3VBWA 3TDVA 5TO8A 5CS6A 4RIXB 3D15A 1WBPA 3EB0A 4MD9E 3Q4UA 2XNOA 3QTZA 2UZNA 2J0MB 3BU6A 2R0UA 4FOCA 4U80A 4YLLA 2QKWB 4WNKA 3Q52A 4F6UA 2MJFB 3FI2A 2BL7A 4FG7A 3TI1A 4PX6A 3ZZEA 3TNQB 4RIOA 2C1AA 3HMOA 2X4FA 3QCSA 2R3FA 2W9FB 4KS8A 1P2AA 3JUHA 3KL8A 4QQCA 4IDTA 4C2WA 4IAIA 4EHEA 3O8PA 3QTIA 3ZLYA 3H4JA 3R7GA 2HYYA 2OG8A 4S30A 2UZBA 3FJQE 3KFAA 4TNDA 3FYKX 5B7VA 2ZV2A 3LFFA 3L8VA 3QZHA 3OWJA 4QMTA 1PJKA 4AZSA 4E6AA 3UIMA 2BUJA 1ZWSA 4HCUA 2C5OA 3UO4A 4V0GA 3ALNA 1BL6A 4C02A 3IQ7A 2YIWA 3V8WA 2WQOA 3BQRA 1Q8YA 2UW9A 4XMOA 4RBLA 3TKUA 3BHTA 1FOTA 3VRYA 1PKDA 2E2BA 2XH5A 2ITVA 4TY1A 5DBXA 2IN6A 4ALUA 4S32A 2BRHA 3KRLA 3I4BA 3L1SA 3NUNA 2YEXA 3E3PA 4WHZA 5AP3A 3R7VA 5A4CA 5K5NA 4EOKA 4QP7A 3TZ9A 2R7BA 5HVKA 3V5LA 3ZZWA 4C62A 2XK8A 1LPUA 2HY81 2YJRA 5IMEA 4NU1A 2PVRA 4HNIA 4FKIA 3PWYA 4IVCA 4EH2A 2ZVAA 2YA9A 4W9XA 1W84A 5DT3A 2C69A 3HMIA 1IEPA 4DTKA 2BDJA 4L67A 2X7GA 5HZNA 5HVYA 3GU5A 2VX0A 3RHXA 2CNVA 5HTIA 2J50A 3H9RA 2GQGA 3QA0A 3DJ6A 4PF4A 4CYIA 2J5EA 3QXOA 3JSBA 4MYGA 2FB8A 5A4EA 5EDPA 4IX6A 2CKPA 4IC7A 3OS3A 2OXYA 3OEFX 4F9CA 4J95A 3GT8A 3MH1A 3NNWA 4QYGA 3V5JA 2V55A 3ZDUA 1WBWA 4O7ZA 2YM5A 3C9WA 4U81A 3KEXA 4DGMA 5A6NA 4YR8A 4AQKA 5J1WA 5HEZA 3QAME 3FXZA 2PTKA 5CF8A 5CEIA 3CLYA 5I9XA 1BYGA 3OT8A 4CTCA 5KMMA 1ZMUA 1J7UA 5HQ0A 4FYOA 4DG3E 4FE2A 1ZMWA 3ZLWA 3P1AA 4M84A 4U3ZA 3DA3A 3R22A 1KV1A 3QWKA 3V6SA 5ANIA 4P2KA 3TWJA 5ETFA 1XBBA 2Y8OA 5JQ8A 1MQBA 2JFMA 2XKFA 3PJCA 4BJJA 3R7OA 3HVCA 2PZYA 5LJJA 5IISA 4YP8A 4YZDA 5CYIA 4BTKA 3KP9A 1Q41A 2R3PA 1GZNA 4CQGA 3UVQA 3ORKA 5IA1A 2NRYA 5IG1A 2Q83A 3LM5A 3R8PA 3ZH8A 5FP6A 3FMJA 3BBWA 2UW8A 3A60A 4AE6A 4D0WA 3NMUF 5M4UA 3QZFA 4FGBA 4O4FA 4Z55A 4GK4A 2BTSA 4TYEA 5AADA 4DFBA 2HK5A 2W5HA 3E8NA 3RAIA 1Y8GA 2QSBA 3EN9A 3NVKI 5LMKA 5C26A 2A2DA 1PF8A 5IUIA 2QU6A 4FV3A 4QQ5A 3LE6A 3GFEA 4DITA 4H1JA 3NW6A 3P4KA 4UZDA 2C0OA 4TTHB 3WE8A 4QMXA 3TCPA 5GIOE 2IW6A 3NYOA 3FKOA 4PL3A 2BRMA 3QCXA 1BI8A 3OW3A 2XK4A 4AACA 3DOGA 3MH3A 2PUPA 4L43A 2WMRA 4ACGA 3D5VA 4IZYA 1DS5A 1LEWA 1B38A 3DS6A 4GU9A 1H1RA 3D4QA 2OJFE 5EOBA 4BY9E 1YI4A 4DH8A 3LXPA 4CMOA 3FZOA 4GVJA 2R7IA 3EFKA 3AOXA 4O7YA 3MV5A 3ZLSA 2IO6A 2XRUA 3C13A 3BEAA 2R3MA 2YHVA 3R7IA 3KXNA 4TPTA 4D2TA 3MTFA 1URCA 5J7HA 4QNAA 5KUPA 2C6TA 4ZP5A 3F3ZA 3KRJA 1OL5A 4XP3A 4GEOA 5HU9A 4KINA 1PHKA 3DNEA 4RJ7A 3FE3A 2EXMA 4FTAA 2X9FA 3KGAA 1UA2A 1XWSA 2GSFA 4L7FA 2BZKB 4FVRA 3W33A 3HEGA 5HTBA 1X8BA 3IS5A 2R2PA 4D2VA 2XMXA 4ZTLA 3LQ8A 4GK2A 1OL7A 3VF9A 5K9IA 2F7ZE 2LAVA 2FSTX 4PRJA 3UIBA 4IBMA 3EFLA 4ITIA 4IH8A 4KIQA 3F3WA 3UG2A 3F69A 5AX3A 4Z7GA 3OY1A 1JLUE 1YWVA 4WBOA 3CTHA 5DHJA 5DR9A 3WOWA 4BC6A 4DA5A 4WG5A 4QMYA 1QL6A 1H8FA 3FHRA 3UOHA 5K4IA 3TV6A 4E4LA 3QBNA 5IQEA 1H01A 4JX3A 2WTKC 4BB4A 5ETCA 3VULA 4FKQA 3L8SA 4FTCA 5CY3A 5ETAA 5F20A 4BIDA 3NVMB 4TWPA 2HOGA 4OTQA 4XCUA 1Q3WA 3VN9A 2ITOA 2C0TA 2UZEA 2QOQA 4FL3A 4FZ7A 1OUKA 4EH3A 5HO7A 3F5XA 3HRFA 5M09A 5IA5A 4QQTA 4UY9A 5D41A 4UMTA 1LR4A 3AKKA 4RJ4A 2OZOA 3V5WA 4S34A 1VYWA 3G9NA 2ITNA 4WUNA 5AX9A 5JRSA 2VTHA 5ANJA 1CTPE 1UU7A 2QG7A 3K5UA 3M1SA 5IQCA 2X39A 4RFZA 2YAKA 4RX7A 4WSYA 4QYHA 3MS9A 4BHZA 5LVPA 1H4LA 2YIXA 5CAVA 5FEQA 2XIXA 2BHEA 4BWPA 2IPXA 4FSWA 3AC3A 1OPKA 4HGSA 1UKHA 4CRSA 3DKCA 3AC2A 1Q5KA 3G2FA 3QQFA 4ZOGA 4IWDA 1V0PA 2PVFA 3QGYA 3HRCA 3TV7A 4LRKA 1H08A 2BAJA 5EDQA 4JQ8A 4CV9A 3Q8DA 4ZTHA 3DDQA 2QOIA 5HLWA 1JKTA 4HCVA 3TN8A 2F7XE 2W1CA 3E63A 2XF0A 3NAYA 4AN9A 3OW4A 3R28A 3W18A 4IAAA 5AIRA 3AD4A 3B8RA 4DGOA 4NYEA 2OJ9A 1YDTE 4A07A 4F6SA 2W06A 1P14A 2VUWA 1J7IA 4FYNA 4PNKA 1NA7A 5CI7A 1J1CA 5AAFA 2OF2A 3DY7A 2XCHA 4DHIB 3P08A 4AOIA 1SNUA 3VJOA 4YZ9A 4TZRA 5D12A 1ND4A 5C01A 4NEUA 1PXNA 4CG9A 4IZ5A 4FKTA 4UN0C 3FI3A 2PSQA 4DLJA 4KABA 4GS6A 4YLKA 2YDKA 4KBAA 4AG8A 4KNBA 2P22B 2W1IA 1YXSA 2RFSA 2YM7A 2E9UA 2PZRA 2UW0A 4G9CA 5ACBC 3NUYA 3ALOA 3IW7A 5J87A 4FOBA 4LRJA 4E93A 2R3NA 5BVDA 4RPVA 5LVNA 2YFBA 3SOCA 2WOUA 2WMXA 4L3LA 5FBOA 3TV4A 4FSUA 2XAMA 4DHZA 1H1PA 1PXMA 4LV7A 2I1MA 3MBLA 3VS1A 4RIYA 2JDOA 3GCQA 2BVAA 3HL7A 3Q3BA 3WZJA 2CCHA 3CKXA 3FLNC 4K0YA 2O0UA 3F3TA 2PUNA 2CGUA 4RQVA 2BHHA 3JPVA 3UQCA 1QPEA 4EZ7A 3WF9A 3A7GA 3NUSA 4FTRA 2J4ZA 3R1QA 1OL2A 4R1VA 4BDKA 2EB3A 3UDTA 4JBOA 3FXWA 4C57A 3POZA 2JAMA 2VTLA 3DK6A 1OITA 3WBLA 5EQEA 3OMVA 5EI6A 5CENA 3BGQA 4XHKB 4O0YA 5ANDA 4L6QA 3ERKA 2UZOA 4EOPA 3WARA 2QO7A 4J99A 5ICPA 4GUBA 4Q2AA 4S33A 4BDIA 3L9LA 3AQVA 4JBQA 4RSSA 5FUTA 4NFMA 3OEZA 4CXAA 4E5BA 2XA4A 5EM7A 3Q4TA 5HX6A 4AA0A 3FI8A 2GNHA 2C5YA 4I3ZA 2W4OA 5CEOA 3NUPA 4WNMA 2ZMCA 5IMXA 2B9IA 4EOJA 3IK3A 5I3OA 2ZRRA 1MUOA 3RVGA 3MFUA 4LGDA 4BJJB 4YNOA 3CQEA 4TT7A 2IW9A 3RNIA 1SVHA 1Y8YA 3MW1A 2ZDUA 1OM1A 2WHBA 4AQCA 3W0NA 4J98A 2YIYA 3PG1A 4QPAA 4CLIA 4JXFA 3ZRLA 3PFQA 5LWMA 5EQYA 4C3RA 5C4KA 2R3KA 2FSMX 3QQJA 5KO1A 2IVUA 3OZ6A 4JIAA 3ZLXA 2O5KA 3KY2A 2XEYA 4PNIA 5IQDA 3MVHA 4BCHA 4F08A 4EH8A 4QMZA 1GZKA 1VEBA 3EKKA 2JEDA 2WU7A 3W8QA 2YZLA 3WE4A 1Q8UA 5M4IA 1URWA 5CX9A 4L44A 4EL9A 3TUBA 5L8KA 1YDRE 2Y6MA 3FMLA 2I0VA 5H8GA 3R8LA 2P4IA 1L8TA 3SRVA 4XLVA 4YGAA 3HECA 1PMNA 3DKOA 4JDJA 5HLPA 4BIBA 3KREA 4N6YA 1PXIA 2F4JA 2J0KA 4IB3A 4ORKA 3ITZA 1M7NA 2PMNX 5AP0A 2R3LA 2C6OA 3MB7A 1RE8A 3DK3A 4R7BA 1G5SA 4ZJJA 4H3BA 4EQUA 2IEWA 1E9HA 5IQIA 3D5UA 3QRUA 3VA9A 4F7SA 3PPZA 4OR5A 4TNBA 4LI5A 1QPJA 4BDAA 3MPMA 3R01A 3IGOA 3AGLA 4OTWA 4FNWA 2XAOA 3SRVB 2XARA 1OB3A 5HCYA 5AJQA 5E8TA 4Z9LA 3FMKA 3MPTA 3IW6A 3I0QA 4LG4A 5HO6A 4ZLOA 1JSVA 1KSWA 3N51A 5JGDA 4X3JA 2CNQA 3UVRA 3DB6A 4BDFA 3VWAA 4BF2A 4BCQA 3DXPA 1H27A 3RWPA 3LMIA 5BV3A 2QC6A 2JKQA 1R78A 3CE3A 3QD4A 4Q9SA 3ZO2A 4IADA 4YZBA 3HDNA 1W83A 3IPHA 3W0QA 4M7IA 5CNOA 4EOSA 3FKNA 4WO5A 3PZHA 4RJ6A 2C3JA 5JEBA 4DG0E 3EHAA 2O3PA 4QMWA 3ZUTA 1IA9A 3DGKA 3NAXA 4F0GA 3VHEA 2CDZA 3PVGA 2BDFA 3BE9A 4BI2A 2QOOA 2IVSA 3MSSA 1JQOA 4JG8A 5BMMA 4KBKA 4JRVA 1R0EA 2YITA 1ZAOA 4HGEA 3RCJA 2ETKA 3FLQA 4EJNA 4ZEGA 1ZYCA 3ENHA 1S9IA 2KULA 3EN7A 5IA0A 3UDBA 4I24A 2XNGA 5EM8A 2P0CA 4S31A 4XV3A 5AV2A 5GJDA 3PA5A 3COHA 4PL4A 3UITA 1SVEA 3JXWA 4FKRA 5D7AA 4O0VA 4IB0A 5M07A 4QQJA 2YM3A 3QQKA 3BWFA 4Z16A 3R8UA 2OSCA 2XS0A 3MY5A 4G3EA 4IDVA 4X2KA 2B53A 2YIRA 3LXKA 3ZOSA 4C58A 4O7VA 2Y4PA 4JNWA 4TKSA 4DEHA 4R5YA 4F1OA 3IDPA 3KKVA 4HCTA 4CKIA 3EFJA 3CC6A 3MI9A 4QP6A 4ZTRA 4E4XA 4EH9A 2O64A 3AGMA 4UYNA 4TXCA 1CKIA 4LYNA 4C4GA 3LFQA 4WSQA 1Y57A 2XKEA 4QMSA 4YHFA 3U4WA 4FR4A 3EN6A 1QCFA 4Q9ZA 3OC1A 5B2KA 2XIKA 5IH4A 3QYWA 3VS0A 2Z60A 5ANKA 3W2CA 2PVMA 3ZXZA 3I0OA 5E8ZA 4ZLYA 4WOVA 4FEUA 4BDGA 3UPXA 4DG2E 2RG6A 3FLYA 2ZJWA 3RPSA 4BVUA 2FH9A 2OXXA 4DGGA 2W0JA 4YUQA 2WELA 2BTRA 4I6BA 4U7ZA 4FTKA 1OBDA 3MY1A 3SW7A 4C4HA 5KMNA 4ZXTA 3L8XA 1WBVA 4M13A 2J0JA 2OK1A 3BCEA 4AS0A 4C4EA 3EN5A 3AMYA 4JDHA 2V62A 1B39A 3A4OX 3OWPA 2OJIA 3BLQA 3BV2A 4KSPA 4J52A 4DH1A 2HXQA 3DZOA 2FEFA 4PTCA 4XOZA 4PPBA 5HD4A 1XQZA 2C6MA 2B4SB 1MP8A 3BE2A 4HPTE 3EMGA 4MXCA 4BRXA 1ZZ2A 2WZJA 4GT3A 1WCCA 5LWNA 1OECA 4E8AA 4UMUA 4V04A 3VO3A 1NY3A 5IKWA 5BYLA 3R6XA 4IM3A 4O4BB 4XV2A 4YZCA 2QG5A 3TNHA 3Q53A 3RTPA 3T3VA 4JI9A 3SVVA 1UU3A 3KQ7A 4GVAA 2H96A 4NCTA 5IZFA 3UTOA 2C1BA 2YM4A 3MIAA 4ONAA 3EQIA 4KKEA 4CLJA 1TQIA 3DLZA 1ZRZA 3O51A 2GU8A 2QNJA 3BYVA 5HO8A 4QYFA 2VWXA 4W8EA 1V0OA 2OW3A 3C5UA 4O0SA 4AW1A 3PPJA 5FRIA 4GFMA 2X7FA 5DT4A 4O7SA 3S1HA 2W99B 3QUPA 2UW4A 2JB2A 1L3RE 4I22A 3TJCA 4AW5A 2VTOA 4MWHA 3F2NA 4JR7A 4U41A 1PMUA 3IDBA 4EOLA 2OH4A 5KMJA 4IW0A 5LMAA 4FEWA 2O65A 3NW5A 4MBLA 3ZMMA 2QQ7A 4APCA 2HW7A 3LQ5A 3NNVA 3O7LB 5L6WL 1O9UA 4AGCA 4AZEA 1YOJA 3AC8A 4G1WA 3QQHA 1AD5A 4AF3A 4BFMA 1GIJA 3DKGA 3TKIA 2WAJA 1BLXA 3EJ1A 5C8KA 3IAS1 3GQLA 4EHVA 3FPMA 4A7CA 4EJ7A 4HEA1 3R9HA 3FBVA 3GCSA 2FVDA 4NFNA 4F63A 1SJ8A 1M2PA 3PIXA 4JCVE 3WIGA 3R8ZA 4L00A 1YO7A 3MGYA 3OT3A 4M15A 4BL1A 3S00A 3F66A 4ZJVA 5DT0A 2GTNA 2A0CX 2R5TA 3RI1A 5CEPA 1YXUA 3W2QA 4UMQA 2WTIA 1K9AA 4FIEA 2WPAA 5LARA 1XBAA 3KMWA 1WBOA 3ZO3A 3BV3A 5H8BA 4M69B 4LRMA 4OBQA 4GJ2A 4AFJA 1U59A 1PYEA 2ZV7A 4CMUA 1NT2A 2GQSA 4LFIA 2IZRA 5LVMA 3A7FA 4PMTA 4X2NA 4BGGA 3HMPA 5EHOA 5AP1A 2X2KA 3SDJA 2WMTA 3SQQA 3AT4A 2EVAA 4RJ5A 4W4VA 2VTQA 4OBOA 3V5PA 5M55A 3MB6A 5IDPA 4J71A 3DZQA 4XG6A 4QO9A 2B52A 2VWVA 1FMKA 4O0UA 4I5MA 5CVFA 3TNPC 4BDHA 5KBRA 4DTAA 1TVOA 4BICA 2WFYA 4WG4A 4FF8A 4PMSA 3ZEWA 4FV2A 5DE2A 4W4WA 5T68A 5L4QA 1TKIA 2VO3A 3A7IA 3HA8A 2CGWA 3ZFMA 4EC9A 2GFCA 4J8MA