3LJ2A

Ire1 complexed with jak inhibitor i
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
427
structure length
404
Chain Sequence
NFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQFRTSGWRAPELLEESNNLQTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Flavonol activation defines an unanticipated ligand-binding site in the kinase-RNase domain of IRE1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase
molecule keywords Serine/threonine-protein kinase/endoribonuclease IRE1
total genus 113
structure length 404
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06479 Ribonuc_2-5A Ribonuclease 2-5A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lj2A02
1.20.1440.180 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3lj2A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lj2A01
4C38A 1J3HA 3QTZA 5DR2A 5I9UA 4PPCA 2GNHA 3KC3A 4GVJA 1QCFA 3GC0A 2HWOA 4PTGA 3FLWA 4I0TA 2JKQA 5I9XA 2RKUA 2F2CB 3SC1A 3E92A 4E4NA 5K9IA 3OCSA 4LOOA 4BIDA 4CCBA 3VQUA 2IVTA 3LLTA 2YDJA 5HGIA 2WAJA 3QTWA 3KQ7A 2XNPA 5B2KA 4F1TA 5IDPA 2HY81 4E1ZA 3QRUA 2F2UA 4HYHA 3H9RA 1J1CA 4FKJA 3QHRA 3UPZA 3HUCA 1YDRE 4IXPA 4E5AX 3H4JA 2ITUA 4ZZNA 3QL8A 4DCEA 2ITOA 2JITA 3NUYA 4G34A 3A7JA 5HE1A 2WGJA 3PPZA 4X6QC 3G5DA 3PA5A 1O6KA 1R1WA 1UNLA 1WBWA 3HLLA 4PL5A 2GS6A 3ORZA 5CVFA 3K2LA 5ANJA 5E8WA 5FXQA 3SQQA 1OMWA 4M0ZA 4DINA 4I41A 2WXVA 4PP7A 2PUUA 1YWNA 4QMWA 3IO7A 1MQ4A 4WG3A 5EYMA 4UX9A 4JG8A 5AAEA 4FTAA 5AFVA 4GT4A 3IW8A 1YOJA 5L6PA 2QI8A 3DB8A 3DKCA 2OICA 4EK8A 4FICA 3FZ1A 4S2ZA 2A0CX 2IJMA 3BHUA 3TV6A 3BU5A 1B39A 4A4OA 1YXTA 2WMTA 4EQUA 2BRBA 3KA0A 4QD6A 2RG6A 4KWPA 1U4DA 1CKJA 3LMHA 3A4PA 4CLIA 3K3IA 1M2RA 1OL5A 5J5TA 4BB4A 4KIKB 3LXPA 3OW4A 4C59A 3UO4A 2Q83A 4P5QA 4PMPA 2CMWA 4O2ZA 1GY3A 3IW4A 2QU5A 2E9VA 5EK7A 3REPA 3FMLA 3C0IA 4AXAA 3GCSA 4EHGA 2WQEA 4C57A 3EKKA 4AZWA 1H26A 3OZ6A 4M97A 3ATTA 5M07A 5CAVA 1PXKA 5EOBA 2PE2A 5TO8A 3R00A 5J9YA 5E9EA 5E92A 3D9VA 3PIXA 2G9XA 3FZOA 2CGXA 1OL1A 5GHVA 3PJ3A 3CTJA 3U55A 4FKWA 3ANQA 3RBWA 1DS5A 4O0VA 4F0IA 1H08A 3OWKA 1Q97A 2PVMA 2W5AA 4ANBA 3DB6A 4C4HA 4QYHA 3CIKA 5FEQA 3B8QA 3D5UA 2GFCA 3O8TA 1KV2A 4PMTA 4HZSA 3CXWA 3VS7A 1OBDA 1VR2A 2ITTA 4EWHA 3FLZA 2R64A 2WFYA 2XUUA 4XJ0A 2GNJA 4J95A 3TEIA 3UNKA 4UY9A 5FTGA 2BAKA 2PMNX 4K18A 2O0UA 2WNTA 4TYJA 3W8QA 3I0QA 4AN3A 4L42A 2NO3A 3F69A 3R73A 4MD7E 2YM3A 2V0DA 4P4CA 3HGKA 3P86A 3KN5A 4M69A 4RVKA 4HVHA 2B54A 2QOKA 4BGQA 2J9MA 5GJDA 3QU0A 5C1QB 4FK3A 5HCXA 4DC2A 5AX9A 5E1EA 3VUDA 2R7BA 4F70A 2FA2A 2QO2A 3GC7A 4KBAA 4QOXA 2OJGA 3OG7A 5CASA 2WD1A 4O7YA 2R2PA 3DFCB 4D1ZA 4E6QA 2OJIA 2G15A 3GOKA 4YBJA 3C50A 4G9RA 4ZTQA 2A2AA 3BGPA 2VX3A 4E20A 5L4QA 2UZVA 3T3UA 3Q9WA 4F9AA 2X7GA 2EVAA 2OXYA 3TKUA 3RAKA 1Q4LA 1S9IA 3FPQA 3UYTA 1PYEA 3UNZA 4AQCA 3UPXA 4F65A 3F9NA 3EQIA 1R0PA 3UG1A 5ICPA 3GNIB 2F9GA 3ZEPA 1STCE 3IDBA 4OTHA 2X8DA 3BHYA 2ITNA 5LXMA 1ZYLA 1VYZA 2R3FA 4JRNA 2CNUA 2XBAA 3MPMA 1JKSA 3NW7A 3F88A 3PFQA 4FTMA 4UMRA 4C3RA 5D11A 4BDFA 2ZB0A 4A9TA 1XH4A 3T9IA 3AC3A 3R9NA 3QKLA 2OH4A 2YWVA 2HYYA 3IW5A 4BDCA 1UU9A 1YXXA 4XG2A 4WKQA 3UQFA 2FVDA 3PXYA 4Y5QA 5AP2A 5L2WA 4QP6A 3ZBXA 4DITA 4K6ZA 1XHAA 3ZUUA 2XIKA 4ZEGA 3BGQA 5AJQA 2HK5A 5IQDA 3ANRA 4QPAA 3ZM4A 5IMEA 3I60A 3MIYA 4MF0A 3CD8A 3Q6WA 5CEPA 1YXUA 3NSZA 4CQGA 3R71A 5DT3A 3ZLWA 4QYGA 4G1WA 1ND4A 3RTPA 3VWAA 4D9TA 4D5HA 5IKWA 5M51A 1BX6A 4G6OA 3PLSA 3EWHA 5GZ8A 5EQEA 3LFFA 2YFXA 3FUPA 4ERKA 5HZNA 3ATSA 2RGPA 2VV9A 3MH3A 4K1BA 1REJA 4QP9A 3DPKA 3WF5A 4F09A 3EFLA 3KKVA 4IE9A 5FG8A 1ZYSA 3G0EA 1YI4A 4N57A 2V62A 4L52A 3O17A 3R1QA 4RIWB 4EHEA 2QHMA 2XJ1A 3OT8A 4XHKB 3U4WA 4S30A 5HD7A 3UMWA 3VBXA 4A07A 3TZMA 4DTKA 4H05A 3I4BA 3I5ZA 3VF8A 4W9WA 5L8KA 3QF9A 4TWNA 4CRLA 3GCPA 4JDIA 4B99A 3ID6C 4AZFA 2PVRA 4XV3A 5DVRA 5A14A 3VBYA 1H4LA 3GQIA 4QYFA 5HNBA 3ZDIA 2OF4A 2YZAA 3N4UA 2EB3A 3KK9A 3H9OA 4EH9A 3GU8A 3KCFA 2I0YA 2W1GA 3R6XA 5IUGA 3D4QA 4KIPA 2J0MB 2W4KA 3BZ3A 1PXNA 4S33A 3C1XA 2V55A 4YSMA 1FQ1B 2C3KA 5F20A 3PVBA 4X2KA 4IFGA 5TR6A 4J71A 1M2QA 2ZDUA 2YM6A 2ETKA 4L6QA 4C58A 3SVVA 3GCVA 4QYYA 2W1DA 4GEOA 4WNMA 5CNOA 3KMMA 2GSFA 2QNJA 2YZLA 2H8HA 4FTNA 4FZAB 4H1MA 4F63A 4IIRA 3LM0A 2W4OA 3A99A 4JBVA 1WZYA 3V5WA 4FV9A 2WMXA 4S32A 3IW7A 4RQKA 2R3RA 5HHWA 1CKIA 4FT0A 4M13A 4WRSA 2IPXA 2XRWA 3G15A 1OPKA 2XIXA 2BRHA 3UZPA 5IG1A 2VX0A 1JQHA 2HW7A 3IONA 4D28A 4DFLA 4EH2A 5C4KA 3Q04A 1X8BA 3D14A 1JNKA 5DOSA 1IG1A 4EHVA 2CGWA 2I0VA 5HORA 2W0JA 3O2MA 3OFMA 5IA3A 4OW8A 4W8EA 3R21A 3U9CA 2NNWB 5AX3A 4KAOA 4L7SA 3PIYA 4XS2A 3C0HA 3FV8A 3SD0A 4D4RA 3PG1A 3LIJA 5IA0A 4JQ8A 4O0WA 3ENHA 3MI9A 1J7UA 1XH5A 3C9WA 5CU4A 2WMBA 3HMOA 3OEFX 4F64A 1SVGA 3MVLA 5HE3A 3FHIA 1ZOGA 2P55A 4FIFA 2GU8A 4C2WA 2PUNA 2B1PA 2SRCA 3NPCA 4BI1A 4TYIA 4AG8A 1DI8A 4C0TA 4D4VA 4FGRA 3BLHA 1DAYA 2OIDA 2W4JA 1ZY5A 4RVLA 4BC6A 3U6JA 1NT2A 2B9HA 4RIOA 2VU3A 2YEXA 2BDJA 2NP8A 4DGLC 3TIYA 2ERKA 1GIIA 2YJSA 4UWCA 5LMKA 3HECA 3K54A 3KXMA 3ZFXA 3ZXZA 2BILB 3F3TA 3OS3A 3VRZA 5EW3A 5CAQA 2YLEA 5L2SA 3BBTB 4FV0A 4C3FA 5J1VA 1ZOHA 2X0GA 4NL0A 4UMUA 4DFBA 4FMQA 3PZEA 4FKPA 4WT6A 1W98A 2LGCA 2ZV2A 2C6MA 4R3PA 3OBGA 4B8LA 2IVUA 5ANOA 4LV5A 4XP3A 3VS6A 2XVDA 4YC8A 4Z3VA 1PRYA 1XWSA 1H8FA 4O27B 5L8JA 3RPSA 3LM5A 4D2RA 4M66A 3UYSA 4JAJA 3OD6X 2XCHA 5K0KA 3UOHA 3WILA 2XA4A 4UWYA 5C27A 3QRKA 3RM7A 2WKMA 3EKNA 5AP5A 2UVXA 2JAVA 3OOGA 2PZRA 4IWOA 3W1FA 4EOKA 5HVKA 4EKKA 4O0XA 2WTKC 3KEXA 4W4YA 3TV7A 2NPQA 2W05A 3PE1A 1ZY4A 3AC1A 5EYDA 5EHYA 5BMMA 4EK4A 1OKZA 2XMYA 3CPCA 4GW8A 3BU6A 3RI1A 4AUAA 4P5ZA 5T3QA 4LUEA 4O0UA 1P14A 4CD0A 4DT8A 4NFMA 2VX1A 2VWZA 2G2IA 3BHTA 3OTVA 1UVRA 4IM2A 2WU6A 2R3IA 4IDTA 2W9FB 4A9UA 4CRSA 3UIMA 4MK0A 1XH8A 4FZ6A 3IS5A 4GT5A 5CX9A 3R83A 2Z60A 4R78A 1RW8A 3P5KA 4XMOA 4QMLA 2BRMA 3JR1A 2PZIA 3ZFYA 2WEIA 4I92A 4LGHA 4NCTA 4CEGA 4YZ9A 3DBDA 5AR8A 3PSBA 1FPUA 4GUBA 2JBPA 4F7NA 4U7ZA 4JOAA 4AOTA 4PF4A 3OOMA 4FX3A 5IQGA 2CNVA 2CCIA 3LJ1A 4LL5A 3F7WA 4CQEA 1KSWA 2PMIA 3EL7A 4BCHA 2W9ZB 5J9ZA 4U97A 3RCJA 4TXCA 3DLZA 5CU6A 2F49A 4D58A 5AV1A 4AT3A 1GJOA 3UGCA 3OUNB 3AC4A 4BL1A 2OG8A 4FVPA 4GUEA 2QR7A 5M4UA 4IB0A 2ITPA 2QO7A 4L00A 3D15A 3P7CA 5DE2A 4K9YA 4USFA 3ZYAA 4U3ZA 3O7LB 2FB8A 2W1FA 3R9RA 4CFMA 2QOIA 4IX5A 2IG7A 1H07A 4ARKA 1XQZA 3R1NA 3R7GA 3SLSA 4U9AA 2YHVA 4EH7A 3A60A 3VUIA 4ZTHA 4EEVA 1LEZA 4JBQA 4RC4A 2CJMA 5FWKK 4PPAA 4ANLA 3I79A 4I20A 5HIDA 4C4FA 5A4CA 4JDHA 3V5PA 5GZ9A 3DV3A 2HAKA 3E93A 4QMXA 4FYOA 3Q4ZA 5BYYA 2R9SA 2C5OA 3QUEA 4JT3A 3TACA 4B6LA 4D4YA 4M67A 4FTRA 2P2IA 2F7ZE 4YTIA 4NIFA 3EOCA 4EOOA 1OPJA 4GIIA 4ONAA 1LP4A 3HZTA 5FTQA 5EM6A 1UNHA 4BTKA 4DH1A 5JFWA 2BPMA 5J95A 2J90A 2OWBA 3FLNC 2WMUA 4JNWA 4YTFA 2CGUA 3CBLA 3P08A 2XK3A 5L8LA 1URCA 2XYNA 3NUAA 4QYEA 2PU8A 3SG9A 4ZJJA 1UKIA 2X39A 3KMWA 5CAUA 4D2TA 4BR3A 2WOUA 2W1HA 3V04A 3LLAA 3F3UA 4AA0A 4MXXA 5KMJA 2JBOA 2OF2A 2WMRA 3CKWA 4EC9A 3QTUA 4MXZA 1IA8A 1PKDA 2VTPA 2Y4PA 1H28A 2YM5A 2ZOQA 5H8EA 3TNQB 5CYIA 3I7CA 4QMUA 5K5NA 3U9NA 2XK9A 3WIGA 4C3PA 2WOTA 3LW0A 4EBVA 2X6EA 1JLUE 3EQCA 3I7BA 3QRTA 4C34A 5AEPA 4NCTC 5HO7A 4FYNA 4E4XA 5BUJA 4EZ7A 4NSTA 1P4FA 5D9HA 5LCKA 4PUZA 5D41A 2UZBA 2YIXA 3R04A 3SRVB 4HNFA 4Q5HA 4IAAA 2R7IA 4G5JA 4V0GA 3G2FA 2UZUE 4X3FB 3V8SA 4YJPA 3FYKX 2VN9A 3AD5A 3ACJA 2R3QA 2VTRA 4RPVA 3OXTA 3LQ5A 4DHFA 5ACBC 3DLSA 1I44A 1U5QA 2GMXA 2BVAA 3LCKA 3NW5A 4LQMA 4RFZA 4I24A 4BRXA 4DEBA 5AA8A 3LVPA 2GQRA 2B9IA 1KE6A 2GQGA 4R7HA 3TL8A 3W2QA 2BTSA 3E7VA 2EXCX 1LPUA 2QVSE 3Q52A 4GL9A 2BR1A 3GOPA 4JX3A 5DYJA 2GCDA 1G3NA 4N4SA 3UIBA 4O7LA 2ZMDA 4JXFA 3II5A 4UMQA 4O7RA 5JFSA 4L46A 5D1JA 2WMQA 3LQ3A 5HOAA 5L6WL 2UZTA 4LRKA 2PVNA 5H8BA 4F0FA 2R3MA 4RMZA 3FMJA 4NU1A 3UTOA 4ANSA 2J7TA 5FP6A 4AGCA 1DAWA 4FNZA 4ALUA 1H1WA 1SVHA 2O5KA 3EH9A 4N70A 2C5VA 4ZK5A 1IEPA 1WVXA 5HG8A 3EN7A 1CM8A 3O0GA 3FZRA 3MV5A 3GT8A 4IZAA 5E8ZA 4XG4A 2XNEA 3EFWA 3HRCA 4UZDA 4RA5A 5DT4A 5AUTA 1UNGA 3CE3A 5KMLA 3F2AA 2Z8CA 1EH4A 5DNRA 1XBAA 1PJKA 3BRBA 4ZXTA 3H30A 5BUIA 4CKRA 2XJ2A 3KRRA 3EQHA 4TT7A 2GNIA 2QKWB 2R3PA 4X7QA 5DI1A 4CT2A 4D0XA 4PDSA 2EU9A 3KULB 3PA3A 3VW8A 2C0OA 4RX7A 4I93A 3GUBA 5JRSA 2ZVAA 5CT7A 4FA2A 2VTNA 4ITIA 4MHAA 5IEVA 4JAIA 1KE7A 3BYUA 3G90X 2VRXA 4YJQA 1XBBA 4P2KA 4I5HA 4RRVA 4EL9A 3HV4A 3QX2A 2RFNA 2UZNA 3MW1A 4D2SA 3BEGA 5BVWA 4C7TA 1A9UA 5K0XA 2PTKA 4QRCA 4F1MA 4PNKA 4K0YA 5AM7A 5CXHA 3PTGA 2DWBA 2YM4A 3AOXA 3L8XA 4APPA 3OROA 1CSNA 2QR8A 4RGJA 3SX9A 1Y8GA 5I9VA 2QOLA 4FV8A 4QP4A 3LMGA 3OHTA 5TE0A 3R8UA 5CALA 3U6HA 5EQYA 3QA8A 3ZEWA 4FTQA 4RJ6A 2C1AA 5LARA 2BIYA 2YDKA 3S0OA 2OH0E 4V0GB 4M7IA 3VW6A 4QMNA 2VWWA 4KSPA 2CN8A 4R7IA 4U79A 5F95A 4QTEA 4HGEA 2OGVA 4KIOA 3OXIA 3ROCA 2UW6A 4WD5A 3QC9A 5CNNA 2XK7A 4YPSA 2W1CA 4IAFA 5AP3A 4Y95A 3EMGA 3RGFA 1YWVA 2W7XA 4AW0A 3PXKA 3BWFA 1DM2A 2OIBA 3MVMA 2XKDA 4AP7A 4BFMA 3V51A 2CCHA 3QBNA 4AFJA 4D0WA 3AGLA 3S4QA 4NJ3A 1OITA 1PXOA 3I6UA 3VIDA 1IA9A 4F9CA 2J5FA 1Y91A 2ZJWA 2FUMA 3ORKA 5FDPA 3VQHA 3KL8A 4PQNA 2C5XA 4IC8A 4YGAA 5CVHA 3BV3A 3VBWA 5JKGA 1ZXEA 2R0IA 3MPAA 4TYGA 2AYPA 1M2PA 2W96B 3QQJA 4Y85A 5DWRA 4M8TA 3DTCA 4J53A 4AA4A 5HE0A 4GG7A 4BIEA 2P33A 4DFUA 3R1YA 1KE5A 4E6AA 2V5QA 4OAUC 3NYOA 3QQKA 4GCJA 1XKKA 4ZSJA 1KE8A 1ZMUA 3PPKA 2Z7RA 4DFXE 4ASXA 3ZMMA 5AV3A 2YACA 4KKGA 4MNFA 3TT0A 5I5ZA 4XG7A 2WB8A 1U59A 5C03A 4KD1A 3O50A 4YTHA 4PY1A 3T8OA 4AE6A 4EOPA 1WBOA 3VNTA 3A7HA 3FI4A 5FBOA 3E62A 3R30A 3CY2A 3PVUA 4FSTA 3PSCA 4TYEA 1PXPA 4DH7A 4U6RA 2YIQA 4X2NA 5M56A 3UJGA 3L9MA 5CSPA 5KHXA 4S34A 2VTIA 5F1ZA 2BALA 3HVCA 2B55A 4RLKA 4C02A 2Z02A 4ZTNA 4R7BA 4AT5A 3BHVA 2OXDA 1OGUA 3LPBA 3MJ1A 3ODYX 4KRCA 5JT2A 5HBJA 5GINE 5CVGA 3QUPA 2HENA 3OCGA 5I0BA 4E93A 5BVDA 3MWUA 4QPMA 1GZKA 3PIZA 4JJRA 4G9CA 5FQDC 3RPVA 4BTJA 4A7CA 1Y6AA 4WSYA 2JKKA 2JKMA 3BU3A 1QL6A 2XP2A 4KKHA 5IUHA 3U6IA 1CMKE 2BAQA 1IAJA 4U43A 5E7RA 4F1OA 3A61A 4EH6A 3DXQA 3FQHA 4AE9A 4CTCA 2W5HA 5EKNA 4O7ZA 4FIHA 5CANA 3MTFA 2XB7A 1J91A 2XM8A 5BVKA 4DEAA 3UZRA 3MDYA 4ITJA 2CHLA 2CKEA 4TTHB 4XP2A 4CFVA 3WIKA 4Z55A 3HRFA 2C47A 2QOBA 2F57A 3FKOA 3LFQA 3UIXA 3NAXA 4HCTA 4E4MA 5I9WA 3JPVA 1Q5KA 4PNIA 3BKBA 3TTIA 4IWDA 1VYWA 3ZOSA 3BE9A 4I1ZA 3R8VA 2JD5A 4I22A 3NUUA 4AW2A 5HD4A 3R8MA 4PMSA 3DAEA 4U44A 3D94A 2CSNA 2P4IA 5KZ0A 4BF2A 3QKKA 1ATPE 3M11A 3RZFA 5LVPA 5FXRA 4XG3A 4FGBA 2E9OA 5JRQA 2C0IA 4AOJA 2PE1A 2X81A 1OBGA 4DCAA 3RPYA 4FSWA 3IG7A 3ROYA 1PF8A 2VTOA 1JVPP 3VULA 3FL5A 2ZV9A 3N51A 3UP2A 2ITQA 4EUUA 3TUDA 5T68A 4GS6A 3QA0A 2I7QA 2QQ7A 5IA1A 2JIUA 1TQPA 2IZTA 3ACKA 4D4SA 5JEBA 4UBAA 4ASDA 5KMOA 2WTKB 4GVAA 3VJNA 4CFFA 4QTDA 3PVGA 1O9UA 1JOWB 3ET7A 3QFVA 3QQFA 4S31A 4YJSA 3MSSA 2PVFA 3EN6A 4Q9ZA 5A54A 2W1EA 3QZIA 5J79A 1RQQA 2IW6A 4FG9A 4XG6A 3LXKA 5HCYA 3FXZA 4AGWA 3R9DA 3VF9A 4BCQA 5ANDA 3WZDA 4MWHA 4E5WA 4EOJA 3W2CA 2WTJA 3EYGA 4YNEA 1T45A 2C68A 4RJ3A 3VBTA 3ZS5A 3A8XA 4BIBA 3F2NA 1QPCA 1S9JA 3LFCA 2WIPA 4I4FA 4J8MA 3FSKA 4HYIA 4YMJA 4O6LA 3KMUA 3MESA 5EHOA 5IEXA 3FMEA 2VD5A 4FKVA 1WVYA 4OGRA 4I5CA 3RM6A 4ID7A 4L53A 4CZTA 4EUTA 5IQBA 4OT5A 3CJGA 2ZDTA 4DFZE 3KRJA 3PPJA 4BHZA 5CEQA 3NEWA 2JDTA 4IWQA 3R9OA 4WSQA 3G9LX 1Q62A 3WARA 3QALE 3R7OA 3OWJA 3NYNA 4IZYA 5A6NA 1OIRA 3CTHA 3HYHA 5HG5A 3SOAA 3UVPA 1YHVA 3V5JA 4ZAUA 3NZ0A 2JDOA 2WTWA 3DBCA 4QMZA 4E8AA 2A27A 2YN8A 5FM2A 4HVDA 3EFJA 4IVDA 5HO6A 5ANKA 1TVOA 2I6LA 4QMTA 5AAFA 4J98A 3ZZEA 5M57A 1WBTA 2OW3A 4NH1A 5JQ8A 2VTTA 4EBWA 4IAIA 4L44A 3GENA 4FV6A 4BHNA 4MXAA 4NJDA 2YCQA 5CY3A 4PL4A 5BUEA 3NX8A 3HRBA 4EH3A 3G0FA 2BIKB 2YDIA 3FXXA 4AZTA 2RFEA 3OEZA 4H58A 4RFYA 1K2PA 3UIUA 4BVUA 2OLCA 4HCVA 2ITZA 3DZQA 4FKTA 1YXSA 1UU8A 4R3CA 4GFMA 4RC3A 5DPVA 5AWMA 2FSTX 2XM9A 4FTUA 4FVQA 4TKSA 5CF8A 2R4BA 2BHHA 3RHXA 2A19B 2RIOA 4D1XA 2O65A 4DFYA 4GK3A 1O6LA 4R1YA 3LAUA 2UVYA 4A4LA 1IRKA 3Q6UA 3V01A 2WHBA 3ZDUA 4ANNA 1L3RE 3KXHA 4D55A 5HEZA 1QPDA 1A48A 3EHAA 2XH5A 5IQEA 2ITVA 2IZUA 2QLQA 4EQCA 5M44A 3RINA 4EOQA 5AP4A 3RCDA 5EDRA 4ZTLA 4I3ZA 4G3EA 5HLPA 5HCZA 4HVIA 4ZLOA 4GIHA 2E9NA 4IFCA 3UOLA 4USDA 2Y8OA 5LWMA 3NUSA 3GU6A 2Z2WA 1IASA 4IEBA 4C4JA 4ZSLA 4W4XA 4DGOA 4IMYA 4PTEA 4ACHA 3NNXA 4XYFA 3ZO3A 2HCKA 4BCNA 2B9JA 3ORIA 3O7LD 4PRJA 4QP7A 4IADA 5J87A 5IQFA 3BLQA 2VTJA 3ENMA 3SW7A 4AWIA 5ITAA 1UU3A 2VTQA 5BYLA 3KXXA 4UMTA 2JAMA 4I6HA 2OZAB 5HNIX 3P7BA 4EH8A 4KINA 2Y4IC 1W83A 4TYHB 3VS3A 5AUWA 5EOLA 5IQAA 2UZOA 3AC8A 4ALVA 4FT7A 3BLRA 4BCMA 5HU9A 1ZZLA 4XNEA 2R3KA 1NW1A 4FTIA 5HESA 5JK3A 5LWNA 3QTQA 3R7VA 4FSQA 3THBA 3NUXA 4CFUA 1KE9A 3GFWA 5KZIA 1JSVA 3FC1X 3HV3A 4IB1A 4IW0A 2YIYA 3DDPA 4KBCA 2I40A 4JG6A 4OTQA 5CQWA 4ZIMA 4BI0A 3BI6A 4FG7A 4HPTE 4IX4A 4L01A 5D10A 5AM6A 3UC3A 2WTCA 2CLXA 2V7OA 4XG8A 3NLBA 3ZLSA 4BDDA 2OSCA 1HCLA 2E9UA 1H00A 3FI8A 3NUPA 1KUTA 3IDPA 5CSHA 4GU9A 1UU7A 4FV5A 5A4QA 2HELA 3SAYA 1FINA 3L9NA 3U87A 2ONLC 3RPRA 4BBMA 3TZ7A 4FOBA 5J1WA 1FMKA 4DH5A 4CFNA 4JIKA 1JWHA 3BEAA 2ZYBA 4CFWA 4RIYA 3O23A 3PRFA 4YZDA 3ORMA 3DZOA 2XKFA 4RJ8A 2PMLX 3O51A 4U8ZA 3Q4UA 4MX9A 3JVSA 4MCVA 2E2BA 2VO0A 3C0GA 4GFOA 5JZJA 3ORTA 1NVRA 4NEUA 3QXOA 4GKHA 2FO0A 4YHJA 1SZMA 3F7ZA 4QMYA 3F5UA 5H8GA 2YAKA 3CGFA 1FVRA 4IZ5A 4ZMEA 4BGGA 4HYUA 5IEYA 3AT3A 3DBFA 2XNGA 1M7NA 5AUXA 3VS2A 2XCKA 4L3PA 4YHFA 1SNXA 3IKAA 2QOOA 2UW3A 4QMVA 4XOYA 3AMBA 5DR9A 5FEDA 2JDVA 4WG5A 5T6KA 3TNPC 3ZH8A 4DG3E 2X9FA 2GTMA 4QNAA 4ZLYA 2GFSA 1H1RA 2J5EA 1DI9A 3OUKA 3ZRLA 3NIEA 2ESMA 4GJ3A 1VJYA 4RIYB 3KREA 3HUBA 3DU8A 3R7EA 2Y0AA 5AP7A 1Y6BA 1XBCA 5L2IA 2X2LA 1ZYCA 3UMXA 4FTCA 2OU7A 4KABA 3BBWA 4GJ2A 4XBRA 4LG4A 2J0IA 3QQLA 3FI3A 4W4WA 3DY7A 3ALOA 3V6RA 5FTOA 5C9CA 4BZOA 5CI7A 1YWRA 4FEUA 5I9YA 1P4OA 1U46A 3N4TA 3E8DA 2Y4IB 5CTPA 3WYXA 4LV8A 4TW9A 3CY3A 5GZAA 1KOAA 3W33A 3WZJA 1YVJA 5DA3A 1OL2A 5ETFA 3FDNA 2BRGA 4TZRA 4FL3A 3PJ8A 1J1BA 2VUWA 3FZTA 1LR4A 1YI3A 4M84A 3LE6A 4FT3A 1A06A 5IH5A 5BPYA 2CGVA 2GPHA 5CEIA 3NWWA 4BDHA 2GTNA 3VRYA 1BLXA 2PVKA 5ANGA 3HL7A 4ZJIA 3GGFA 3ZRMA 4BBFA 4ZZOA 1WAKA 1UKHA 5JSMA 4HGLA 5IZFA 4B4LA 4EONA 2G1TA 1XR1A 1PHKA 1BMKA 5A46A 2NRYA 4JR7A 1OUKA 3DK7A 5HIBA 2B9FA 2XNNA 1YHWA 2I0HA 4RQVA 1JKLA 4Y83A 4XUFA 4OTFA 3CSVA 4M14A 4QQTA 5HLNA 2QD9A 3Q9ZA 4MWIA 4YJOA 4PMMA 5BX0A 4YZMA 5BVOA 2R3GA 5HNGA 4WIHA 4IHPA 2Z7LA 4II5A 2YM7A 4ALWA 4RLLA 5CU2A 1KOBA 2PVLA 3FKLA 5DHJA 1OKVA 4U81A 1F5QA 5KNJA 4O6EA 4BCFA 4EZ3A 2KTYA 3WF7A 2G2FA 1V0OA 4F08A 3QAME 3GCQA 3DQXA 1W8CA 4J52A 4YO6A 5K5XA 1AD5A 5I3RA 3UZTA 4PX6A 4FTJA 3DKOA 4IAKA 2OJ9A 3FBVA 4RWKA 4K33A 5HIEA 5LVMA 1NA7A 2YWPA 3HP2A 5GIOE 3H0YA 4RG0A 4PDPA 4FIJA 2XS0A 3BWJA 3EIDA 3FMNA 4L3LA 4TNDA 3V8TA 3M42A 5JQ5A 5FGKA 3WF9A 4XRLA 2BDFA 2C6OA 2X7OA 4BYIA 4MQ1A 2YA9A 4X0MA 4IBMA 4RT7A 3EN9A 5C26A 4YJTA 3MGYA 3W16A 3H0ZA 4HVSA 3ERKA 3MPTA 4I6FA 4TL0A 4AACA 1JKKA 2YITA 1Z9XA 4QP3A 2PPQA 3QTXA 4HCUA 3ZU7A 4CMTA 2OO8X 4XCUA 4C8BA 2XK6A 2PZYA 3NYVA 4FUXA 5A4TA 2QOHA 2HZ0A 3G6HA 1JAMA 2XIYA 3OMVA 3Q53A 3PWYA 3FQEA 4ASZA 2C6KA 5EYCA 4I6BA 2X7FA 2EB2A 1CTPE 3MFRA 4EHZA 2CKOA 4U3YA 4I21A 3EQBA 4PWNA 4QTBA 3VS0A 4YJRA 3KXNA 2OI4X 4CV8A 2XIRA 2QONA 3CCNA 3QUDA 2BZKB 4AW5A 4NM5A 1PXLA 2QG7A 4G31A 3BYMA 1OL7A 2C0TA 4LI5A 4DFNA 3C4WA 3OW3A 4A4XA 2ZM3A 1Q8UA 5LOHA 4AZEA 4IC7A 4D1SA 4KNBA 3FPMA 4XX9A 3FAAA 3C5IA 3NRMA 4DYMA 5LVOA 3PDTA 4GK4A 1BI7A 4FSRA 3IPHA 5KCVA 2XNBA 4XLVA 4X6RA 4YO4A 1R78A 4HZRA 1YQJA 5L6OA 2C6EA 4PPBA 4EWQA 1OUYA 2YJRA 3EQGA 4AF3A 3KU2A 1QPEA 5FRIA 3TN8A 3ZLXA 2VZ6A 4UALA 1XH6A 3DXNA 5AIKA 1WBPA 3ZO4A 1R3CA 4FV1A 4DGMA 5CAOA 1YKRA 4Z9LA 2Y9QA 1QMZA 2JC6A 3DNDA 4O7SA 3SG8A 3QTRA 4KBKA 2IO6A 4NZWB 3EL8A 3LFAA 4NM7A 3QGWA 3RKBA 3VS4A 3F3WA 3RK5A 3FZSA 4CFXA 5CLPA 3IGOA 4UYAA 3C5UA 3MYGA 4FEQA 4ZTSA 2P2HA 2C5NA 3FE3A 1WFCA 5IUIA 3P23A 4F7JA 1W84A 3OXZA 1K3AA 3P78A 3TNIA 4NW5A 1UWJA 1Q3WA 3FMKA 2RFDA 2QHNA 4PDYA 2J0LA 5HLWA 4C61A 2C6TA 4GFGA 4P90A 4FKSA 5B0XA 4EOLA 4Z7GA 4JDJA 3DK3A 5DBXA 4F9WA 3D7ZA 3LFBA 2IVVA 3IECA 4W4VA 3UVRA 4HW7A 1Z57A 4I23A 3VJOA 5LMKC 2GHLA 3CS9A 4XG9A 5K4IA 5LJJA 3W32A 2LAVA 3QZFA 3Q2MA 2XKCA 3BV2A 2GHGA 4CZUA 1SM2A 4WHZA 4DEDA 3Q32A 4W9XA 1TKIA 2G2HA 3JVRA 5M4IA 4FC0A 2RF9A 4RIXA 2C6LA 3HMPA 4OTDA 5LVNA 2WMVA 4UEUA 5KMNA 4B7TA 1CDKA 2UZLA 4YLJA 5CU3A 3IDCA 4O82A 5AV4A 4I6QA 4YC3A 2PVHA 3ZLYA 3QD0A 3KXGA 4Y72A 5HE2A 2I0EA 4O0SA 3N4VA 3TDWA 4FT9A 3AC5A 3SV0A 3D0EA 5KMKA 4CG8A 3C13A 5HTBA 3AG9A 5CEKA 2B52A 4QMMA 1Q8WA 3ZC5A 1GNGA 2UW4A 2VWIA 4HGSA 1YXVA 1ZWSA 4OR5A 3TCPA 1ZOEA 5BQ0A 1G5SA 5JMSA 4ORKA 3F3VA 3QYWA 1O6YA 1LUFA 1PY5A 3DK6A 4H36A 4AN9A 2HY0A 5CZIA 5TKDA 3EQDA 3SKCA 3DDQA 3PJ1A 4I0SA 4JQEA 4C4GA 4ENXA 3OY1A 4CT1A 4CZYB 2ITYA 3PJCA 1Q24A 5AUYA 2R3OA 3BIZA 2JDRA 3EYHA 4GT3A 1SNUA 2X1NA 4OBPA 4RA4A 5ANIA 2J2IB 2YLFA 3CP9A 4FIGA 5DG5A 3LFSA 4OTWA 3HMNA 5M08A 2R0UA 2UZWE 1WMKA 2E9PA 3RAHA 3QCSA 5DEYA 1R39A 2VWUA 3RP9A 3VBVA 4DAWA 3D7TA 3HV6A 5CF6A 2C4GA 3HKOA 3L8VA 5TT7A 2J0KA 3JXWA 3TJCA 4LRMA 3U54A 4U45A 1YW2A 2OBJA 4DGNA 2JGZA 4V04A 4AZSA 3LXLA 1MRYA 3F5GA 4C36A 2OFVA 3ZBFA 4RBLA 3R0TA 5FLFA 3QQUA 4BDEA 4N6ZA 5HG9A 3NNUA 3QLFA 4DGGA 5BYZA 3U4UA 5KBQA 2JEDA 3SXRA 4G6LA 4IANA 1K9AA 3Q60A 3QTIA 3QWJA 4MBLA 4O1PA 2AC5A 4DF3A 5CT0A 5JGAA 5C8NA 4GKIA 2YIWA 4R3RA 2EWAA 5CSXA 3SGCA 3PXZA 1OIUA 3S00A 2X9EA 3F5XA 4QMOA 3VS5A 4FBXA 5DN3A 5J7HA 4R77A 3NNVA 2ITXA 3E64A 4JLCA 5CENA 4BDJA 4ZLZA 1KV1A 3NVMB 1PMNA 4O22A 2XNMA 1SYKA 3ZUTA 5IH6A 4XBUA 4EOMA 2YISA 4C4EA 2BCJA 3OWPA 2FH9A 2XJ0A 3PVWA 3QHWA 4HNIA 5EKOA 5IQIA 2OJJA 4RJ7A 3PXFA 3TUBA 3BQRA 3R63A 4PV0A 3DAJA 5M53A 4BCPA 2BKZA 4KIKA 4X3FA 4K77A 2DQ7X 4UXLA 4WNKA 4XH6A 4J7BA 3TI1A 3WE8A 4AA5A 5AP6A 1M14A 5GIPE 4FSYA 4FF8A 1OB3A 3CTQA 3JY0A 3NCGA 5F9EA 2WQNA 2B7AA 1M17A 2R3LA 3TNWA 4ANMA 3AT2A 1Q61A 4ZTMA 3V5QA 4CYJA 3P7AA 3UE4A 4YNOA 5I3OA 3UO5A 3HX4A 4BTFA 4JBOA 3ZUVA 4XRJA 3UBDA 3TWJA 1XH9A 4MD9E 4CCUA 2WPAA 5J9LA 4BCKA 2GNGA 4OBQA 4RWJA 2W5BA 3T3VA 4ANQA 1ZAOA 4FT5A 1OPLA 3BYVA 3CPBA 5E8XA 4HVGA 5ETAA 5JGDA 3ORXA 5AMNA 4QQJA 5DRBA 4FR4A 3R8PA 4O7TA 4AOIA 3R8ZA 5HTCA 3GFEA 3Q9XA 1VZOA 4YHTA 3MB6A 5L3AA 4IDVA 2VGPA 5IA2A 1J7LA 4WG4A 4P7EA 2BZHB 2RL5A 3UC4A 3NVKI 4MKCA 4JG7A 3JUHA 4H3BA 1PMUA 2REIA 4AX8A 3RAWA 2F7XE 1YDTE 2XK4A 2QG5A 3AGMA 2H6DA 3QRJA 3K5VA 5L2QA 5HKMA 3T9TA 4RX9A 1H01A 3SRVA 4BBEA 3GEQA 3I0OA 3QTSA 5KUPA 3QKMA 1OIYA 3UOJA 2BDWA 4MTAA 4BCOA 3RALA 2W99B 3FMDA 4QO9A 3OBJA 3MA6A 4YC6A 4ERWA 4FNWA 3RPOA 4G6NA 2C1BA 4TWOA 5EDPA 3UP7A 3WF8A 5HX6A 3VO3A 3KVWA 2WU7A 3UDBA 2PSQA 1R0EA 4WBBB 1TQMA 1OECA 4OTPA 4YZCA 2FYSA 4E5BA 1URWA 3HMMA 3EJ1A 5GJFA 3KULA 3QCQA 3ZO1A 3TV4A 3GC9A 5FD2A 4YJVA 3RK7A 1GOLA 4G3FA 4FIEA 3PLAE 2O8YA 4IVAA 3R7YA 1WBVA 4M68A 4RJ4A 2BRNA 3RAIA 2Y7JA 4FKGA 4U40A 4A9YA 5KKRB 3NYXA 5AADA 2V22A 1FVTA 4Z16A 5IH4A 2DS1A 4GK2A 1WBSA 4L45A 4X3FC 4B9DA 3U51A 2ACXA 4Y5HA 2BFYA 3G9NA 3E8NA 4MD8E 4UZHA 2BTRA 2W06A 4HPUE 3S1HA 2HZNA 1JKTA 5AR5A 4LMUA 2QOFA 3WE4A 3COKA 3BE2A 4O0YA 2QCSA 3MY0A 4EJ7A 1PMVA 4IACA 4RWIA 2AUHA 3GU4A 3KF4A 1P5EA 5HICA 2XYUA 4V01A 2XF0A 1UA2A 3BELA 3GI3A 4O38A 4ANOA 2CKQA 5KE0A 3FEGA 3DFAA 4GG5A 5EM5A 5C8MA 2PVJA 3POOA 5KMMA 3G33A 4IB5A 1BL6A 4O7WA 3KVXA 4O0TA 2FSOX 2IVSA 3KXZA 1V1KA 1WCCA 2UW8A 3FYJX 3PP0A 5EW8A 5F94A 3D2IA 4LGDA 3LQ8A 3JS2A 2PMOX 4BKJA 4C37A 3UG2A 3FZPA 4Z7HA 3FC2A 4YU2A 3WZEA 2WEVA 5E8YA 4AN2A 5D7VA 2WELA 2GNLA 4EJNA 5HTIA 3AC2A 5B7VA 1E9HA 4O0RA 2WTVA 3AQVA 3PY0A 4RJ5A 4A9RA 2XRUA 3VHEA 4IAYA 3ALNA 4FI1A 4PL3A 5HVJA 1Q8ZA 3VC4A 5CF4A 2DYLA 2HXLA 3WF6A 4ZY4A 2X8EA 2WZJA 2ZB1A 5F4NA 2C69A 3B8RA 3CR0A 4DEGA 3ETAA 4RZWA 4IM3A 3E3PA 3DS6A 3BPRA 4BWKA 4A06A 3HMIA 5HBHA 4MNEB 4BY9E 3KK8A 4FTTA 4L68A 5FP5A 4RIWA 1U5RA 5E4HA 4XOZA 5H2UA 3C7QA 3ELJA 4PP9A 5BVEA 3LCDA 3VN9A 1XJDA 5AR4A 4APCA 4EOSA 3ZRKA 2J4ZA 4EH4A 4FODA 1YOLA 3QC4A 1E1XA 3JY9A 3ORNA 4BDKA 4F6WA 3MJ2A 4LFIA 3FY2A 5M4FA 2BKKA 3Q2JA 3E8CA 4RZVA 4YR8A 5EDQA 2CDZA 3DJ7A 3F82A 2X2MA 4IH8A 5HG7A 4BWXA 3QQHA 4LOPA 3RNIA 3LFDA 4UV0A 2IW8A 5KX8A 3RNYA 4DBNA 5CEOA 3FQSA 4K2RA 4QQCA 4IAZA 3A7GA 3PWDA 3R22A 3S2PA 3AXWA 4L3JA 4BDBA 2CLQA 3KY2A 2C3JA 3LCSA 4KS8A 4FG8A 4FNXA 3KGAA 1ZMVA 3HEGA 3RWQA 4RSSA 2PYWA 4CLJA 4I5PA 4MF1A 4OUCA 2F7EE 4NW6A 5IA4A 2BZJA 3F3ZA 3E87A 2P3GX 4FKUA 5A9UA 2VAGA 3B2TA 2WQOA 4TWCA 5AA9A 4FSNA 2ZM4A 4Q9SA 4A9SA 3S3IA 3NW6A 5KBRA 1XO2B 4EKLA 4QQ5A 4I4EA 3H9FA 4IX6A 4JI9A 5DR6A 5AR3A 2WTDA 1PYXA 4CKIA 4O96A 5JGBA 3ZTXA 1CKPA 2ZV8A 5CS6A 3NCZA 3R28A 2OJFE 4LM5A 2IWIA 2JIVA 3EN4A 4GU6A 4NTTA 2OK1A 4L9IA 2YAAA 4E6DA 3S95A 3UO6A 4FSMA 3TNHA 1G8AA 2UW7A 2W1ZA 4D2PA 4DEIA 3LOKA 3E63A 4E73A 3UVQA 3D5XA 2VTHA 4CGAA 3E88A 4DG0E 2H96A 2ITWA 4WNPA 3LCTA 5AUZA 3D7TB 3RZBA 2O3PA 2GS2A 2XEYA 3VS1A 5CEMA 5L2TA 4MXCA 3H10A 3HDNA 4NK9A 5FEEA 1HOWA 3COHA 5IQCA 4N0SA 1XH7A 4RFMA 4AZVA 3HA8A 4DEEA 2C30A 5HVYA 3G6GA 3PJ2A 3KF7A 5E8UA 2ZAZA 3O96A 2BZIB 2XEZA 3COMA 2HZ4A 5E8SA 3TZ9A 4FZFB 4GV1A 4JVGA 3A62A 1OKYA 5DEWA 2A4LA 4DE4A 2O64A 4OTIA 1W0XC 4YJNA 5LMBA 4FSZA 3L1SA 4IB3A 3TKHA 3ZCLA 4O84A 4L7FA 1JSTA 3R1SA 4QTCA 4FKRA 2EUFB 3EQRA 4TYHA 5E8VA 4N6YA 5A3XA 3M2WA 1MRUA 2HXQA 1JSUA 1AGWA 2BFXA 3R2YA 4J1RA 5TOZA 4AFEA 1NXKA 3NDMA 2WMWA 4LUDA 4LRJA 1JPAA 1H0WA 2HZIA 4YP8A 3FKNA 1IR3A 1Q41A 4D5KA 4F7LA 3EQPA 4FE2A 3A4OX 4DT9A 2PVYA 2ETRA 4AGUA 2BMCA 1Q99A 3Q96A 3QX4A 1U54A 4YTCA 5EI8A 2W1IA 4RX8A 4FTOA 4GSBA 5E1SA 3FY0A 1ZLTA 3I81A 4BKZA 4AAAA 2UW9A 4PDOA 3IK3A 3A8WA 2X4FA 2G01A 3DOGA 4FEWA 2EXMA 3B2WA 4RVTA 5EM8A 4MYGA 4CNHA 3I1AA 3JYAA 2C3IB 3BX5A 4O1OA 1ZARA 4WNOA 4BTMA 4C4IA 2PHKA 1H1PA 4U5JA 4F99A 4RX5A 2WQMA 5CI6A 5LCJA 4MBIA 5GNKA 3TDVA 2JIIA 3PYYA 3SW4A 3R2BA 1V0BA 5HBEA 5B2MA 5HQ0A 4WUNA 3OC1A 4G16A 3SOCA 4FEXA 2UUEA 2QC6A 2OKRA 1LEWA 3CJFA 4F9BA 1Z5MA 3POZA 4R5SA 3RJCA 3SDJA 3P4KA 2GQSA 3QXPA 4X21A 4E26A 4KA3A 4DA5A 1GZ8A 4Q5EA 3QYZA 5GJGA 3TUCA 1BI8A 5LQFA 2DUVA 2VGOA 3OT3A 4IJPA 5J8IA 3W2RA 3D2KA 4ZJVA 1SVEA 4JQ7A 2JDSA 4KB8A 3FHRA 5C4LA 4O7VA 4G3GA 3QZGA 3LXNA 2HW6A 3ZSGA 3L9PA 3UQCA 3C4XA 3GU7A 2XKEA 3O8UA 5ETCA 4EK6A 2QU6A 4CSVA 3DKGA 3NNWA 3GU5A 3QRIA 4L67A 3DKFA 4L8MA 3BYOA 2J0JA 5EI6A 2JFMA 2QURA 4LL0A 5KO1A 3QD3A 3R7UA 3OCBA 3O71A 3ULIA 5H9BA 3R01A 1QPJA 4CXAA 5AR7A 3GXLA 3VUGA 4IQ6A 3PSDA 5KMIA 2B0QA 5A4LA 4NT4A 1OVEA 2PK9A 3TM0A 4YPDA 2Y6OA 3CLYA 3C4CA 5AR2A 3FLYA 4BN1A 1UWHA 4YSJA 3QZHA 3VVHA 4W8DA 3VUHA 4ZTRA 5H3QA 2QLUA 1OL6A 4JIAA 3KFAA 3TXOA 3QGYA 4NKSA 3VUMA 4UXQA 1FVVA 1I09A 3NAYA 4JX7A 2PUPA 1PXMA 4D2WA 5C8KA 5EH0A 3C4ZA 3TJDA 3V5LA 1J7IA 4J8NA 1OZ1A 3FSFA 2C3LA 5DIAA 4DTBA 3VBQA 5A6OA 1BYGA 4QMPA 3DQWA 5LVLA 3PG3A 3MIAA 2B53A 4FV4A 1V0PA 3MH0A 4TRLA 2OZAA 4GRBA 3HNGA 4XV2A 2YCRA 2QO9A 2YCSA 2Z7QA 3C4EA 4MH7A 2WQBA 3ZC6A 5LMAA 1MQBA 3ZONA 2OZOA 3BQCA 4Y46A 3L8SA 1F0QA 4UN0C 1M52A 3FWQA 2VO3A 2WMAA 4IVCA 4M15A 5TF9A 1L8TA 3LJ2A 3MY1A 1MRVA 4KKEA 3AT4A 3V5TA 4BICA 4FVRA 3WYYA 4M0YA 1VEBA 1H24A 1OIQA 5M55A 5B2LA 1H1QA 2C5YA 3MFUA 4X3JA 5FM3A 4MQ2A 3V3VA 3MH1A 4ACCA 4YURA 2UW0A 1JBPE 1H27A 3PXRA 3W2SA 3PY1A 3QCXA 4FOCA 3E3BX 1WBNA 3PP1A 5HX8A 1FGKA 3R7IA 5ETIA 4BZNA 1E1VA 1OKWA 4E7WA 3RK9A 4RWLA 4G3CA 2PWLA 3DCVA 3MY5A 4FKQA 4CG9A 2H9VA 5CQUA 5BMSA 4O7NA 3DA6A 4FK6A 3VUKA 3WBLA 4O86A 4U0IA 2PZ5A 3EFKA 4FTLA 5JZNA 2VWYA 3TZ8A 3BHHA 3CGOA 3RMFA 1OI9A 4IM0A 3I5NA 3OVVA 4FKOA 2R3NA 3ZHPC 1PXIA 2YIRA 5E8TA 3MFTA 4E4LA 3EN5A 3OCTA 1GZOA 3IOKA 5DH3A 3FXWA 3R9HA 4MNEA 4G3DA 3ZFMA 1NY3A 2A1AB 5CSVA 4BDGA 5JFVA 3UOKA 3ZXTA 4DBXA 2FSLX 2VTAA 1NVQA 3W18A 4J96A 3RHKA 3ZSHA 2WO6A 3E8EA 1ZYJA 4M69B 3A2CA 4B8MA 2FGIA 5IQHA 3LCOA 4XLIA 1RE8A 2HIWA 2X6DA 3QLGA 2UZEA 3TG1A 4QT1A 3DXPA 3O8PA 1BUHA 3WZKA 3EZVA 3CC6A 3IW6A 3GCUA 4WOVA 5G1XA 4DG2E 2GDOA 3MN3A 3HV5A 5M09A 4ENYA 2WIHA 5M4CA 3DBQA 5I4NA 4CYIA 3NMUF 1GAGA 1PW2A 4FV2A 1ERKA 3HA6A 5D12A 4DEHA 2R3JA 2R5TA 5AIRA 3CQWA 1ZRZA 4ACDA 4TWPA 5DLSA 4AU8A 3Q5ZA 4TY1A 5AP1A 1UV5A 3QCYA 3CQUA 1RDQE 3E5AA 4HOKA 4X2FA 4BI2A 4EQMA 2VWBA 3FMMA 4FTKA 4FKIA 5EYKA 3DAKA 3QQGA 4YUQA 4ZY6A 3F6XA 1YI6A 2O63A 2PZPA 2X2KA 2QODA 3FMHA 4MEDA 4Q2AA 4H1JA 4H39A 3QWKA 5CAPA 4TNBA 4YZNA 5IDNA 5J5SA 2GNFA 1Q3DA 5DMZA 5M06A 4HJOA 3MH2A 4O2PA 3AMYA 4YBKA 1FOTA 4BYJA 5FUTA 3NGAA 1ZYDA 3D5VA 5FDXA 3W55A 4CVAA 3F2RA 3DT1A 1GZNA 4CMOA 4IZ7A 3PZHA 3MA3A 5CZHA 4ACGA 4C33A 2OFUA 5K4JA 5K3YA 2C6IA 3BGZA 4GH2A 4CV9A 4OAVB 3K5UA 5HU3A 4NM0A 4L43A 4WUAA 5EW9A 4WBOA 3UQGA 3VUTA 1Q8TA 2P0CA 4GMYA 4EYMA 2V7AA 2W17A 4ZSGA 2PL0A 3QD4A 5BVFA 4J97A 4K11A 3IOPA 3BYSA 2EXEA 2F4JA 2ZM1A 4KS7A 3SXFA 3GQLA 4KUJA 2RG5A 4FIIA 3GC8A 2IZRA 3TTJA 5D7AA 1PKGA 2UZDA 3UODA 1RJBA 2IN6A 2JFLA 4Y8DA 1P2AA 4H3QA 5CU0A 4NFNA 5CWZA 3LKMA 3C51A 2XNOA 5EI2A 4BCGA 4EI4A 4FV3A 5IU2A 4U42A 3W10A 1W82A 4F6UA 5DRDA 3GP0A 4XP0A 3VAPA 3FL4A 1B38A 1WVWA 3TIZA 3V6SA 4K8AA 2R3HA 4CKJA 1H0VA 2IZSA 3L8PA 4D2VA 1GIJA 2ZMCA 4DTAA 1MUOA 3CQEA 4EK5A 4CTBA 2VO6A 4QP1A 2CN5A 2VWXA 3VHKA 3ODZX 4R8QA 4F7SA 3LJ0A 5BVNA 3ULZA 1ZMWA 3BCEA 2ERZE 1BL7A 1FMOE 3PA4A 4GYIA 4RIXB 3KRXA 4V05A 4FNYA 3SXSA 4ITHA 5IPJA 4WRGA 4AS0A 3A7FA 5EQPA 4R1VA 4FSUA 3D83A 2YM8A 4IJ9A 2AC3A 4M3QA 5JH6A 3ITZA 2OIQA 2IW9A 5CXZA 4F0GA 4YLKA 5E91A 3IGGA 3P0MA 1KWPA 2B4SB 4YZBA 3RVGA 3SA0A 3LHJA 4G5PA 3PXQA 4EORA 4JL9A 3PY3A 2BAJA 3N9XA 2X4ZA 1HCKA 4FL1A 3MB7A 3NUNA 3HV7A 2VO7A 4G17A 4KSQA 4YJUA 4ZP5A 3LFEA 5DFPA 4R6VA 4QNYA 3MVJA 5AV0A 5HI2A 4MBJA 3HAVA 3DJ6A 1NVSA 5IISA 4QP2A 4TPTA 4JR3A 3KCKA 1AQ1A 4YLLA 3PRIA 4FZDB 3Q5IA 4IX3A 3MS9A 1Y57A 4QTAA 4XV9A 1IAHA 4NYEA 2Y6MA 4F6SA 1ZZ2A 2CPKE 4OBOA 4UYNA 5EM7A 2VNWA 4D9UA 4UMPA 1FGIA 1APME 5KKRC 2PULA 3LMIA 4ASEA 1YDSE 2OXXA 3Q9YA 4NKAA 4XV1A 4DN5A 4KRDA 4BCIA 3FJQE 5JN2A 4NUSA 3DBEA 4FEVA 4MAOA 2PUIA 3ZM9A 4OLIA 4QMSA 1SMHA 3AMAA 3KRLA 4RVMA 4I0RA 2YERA 4B0GA 2JLDA 2ETMA 5FBNC 4UB7A 3ZZWA 3Q3BA 4F9YA 3A7IA 3SHEA 2J51A 5AUUA 2UVZA 2Z7SA 1REKA 4TN6A 4C2VA 3TKIA 5IMXA 3DJ5A 3KB7A 4IWPA 5DGZA 3EB0A 4AGDA 3FI2A 5EHLA 1M7QA 2XK8A 3OWLA 4OTRA 4E6CA 1FBNA 2VNYA 3R8LA 1Q8YA 2JKOA 4WO5A 4BDIA 3HAMA 4BGHA 4HGTA 3KN6A 5DT0A 4BWPA 4JDKA 4BZDA 2BROA 3F5PA 3E7OA 4EOIA 5JFXA 3OF0A 4ZS0A 2UW5A 2HWPA 3MVHA 4NIFB 1PMEA 2PY3A 5I9ZA 4QP8A 3NR9A 4U80A 2H34A 3EQFA 4DH8A 2QOQA 3FLSA 4QMQA 1TQIA 1U54B 5AP0A 3W2PA 3ZSIA 4FL2A 5HO8A 2YABA 4DH3A 4ACMA 4R5YA 3K3JA 4RC2A 3OY3A 4MXOA 1PXJA 2BHEA 1F3MC 2Q0BA 5KHWA 4LMNA 4EK3A 2YCFA 2GHMA 2ZV7A 4PTCA 2J6MA 4NM3A 2NRUA 2RSVA 5ANEA 3AD6A 2O2UA 4BCJA 3P1AA 4O91A 4G2FA 4OT6A 4UWBA 2VTSA 4JS8A 4X2GA 4E3CA 5AAGA 3PUPA 2PE0A 4C62A 4ZY5A 3P79A 2WTIA 4LOQA 4ZSEA 4H3PA 4BKYA 4EYJA 3RWPA 5E90A 5BNJA 1Y8YA 3CEKA 1OM1A 2KULA 3NS9A 3UNJA 3W2OA 3WI6A 4EH5A 3U8WA 4QPSA 2BUJA 2VTMA 3C4FA 2Q0NA 5ACKA 3ZO2A 3DTWA 4HYSA 2HOGA 2VWVA 3P9JA 4FKLA 3F61A 4O21A 5FXSA 3I6WA 3AD4A 2RFSA 2I1MA 3F66A 2WMSA 4M12A 4USEA 4LGGA 4FUYA 3LZBA 4XEYA 2CNQA 4BDAA 3W8LA 3OTUA 4EC8A 1T46A 2QKRA 1B6CB 3Q4TA 4NWMA 3QD2B 1MP8A 4DLJA 3DGKA 4O81A 3V8WA 2VTLA 4I5MA 4MXYA 3CKXA 4NTSA 3R02A 5IA5A 2XIZA 4CMUA 4WA9A 4F4PA 4I94A 2XBJA 1G8SA 1YRPA 4MVFA 4IVBA 4KIQA 3MBLA 1H25A 5AV2A 4AW1A 4JBPA 4C35A 5A4EA 2QOCA 4O83A 5G6VA 3G51A 3WOWA 5EFQA 4X2JA 1H1SA 3NIZA 4ZSAA 3MFSA 5J7BA 3IQ7A 3H3CA 4ZOGA 4ZZMA 4AT4A 2ONLA 3EZRA 2CKPA 1GIHA 3WZUA 3L9LA 3LFNA 5CF5A 3GBZA 3PE2A 3ORLA 2C6DA 3CD3A 4FZ7A 3D5WA 2FSMX 4GYGA 4LYNA 5CSWA 4ZS4A 3GVUA 4U41A 2X8IA 2GS7A 3KRWA 3HDMA 2UV2A 4ZMFA 4DLIA 1BKXA 3HP5A 5C01A 2XZSA 3OP5A 3FLQA 5AUVA 4Y73A 3GB2A 3Q4CA 5IF1A 3MTLA 1YOMA 4J99A 3ORPA 3COIA 3M1SA 4EZ5A 4OTGA 1YHSA 4JRVA 4FV7A 1W7HA 2J50A 3DNEA 5EG3A
chains in the Genus database with same CATH superfamily
4C38A 1J3HA 3QTZA 5DR2A 5I9UA 4PPCA 2GNHA 3KC3A 4GVJA 1QCFA 3GC0A 2HWOA 4PTGA 3FLWA 4I0TA 2JKQA 5I9XA 2RKUA 2F2CB 3SC1A 3E92A 4E4NA 5K9IA 3OCSA 4LOOA 4BIDA 4CCBA 3VQUA 2IVTA 3LLTA 2YDJA 5HGIA 2WAJA 3QTWA 3KQ7A 2XNPA 5B2KA 4F1TA 5IDPA 2HY81 4E1ZA 3QRUA 2F2UA 4HYHA 3H9RA 1J1CA 4FKJA 3QHRA 3UPZA 3HUCA 1YDRE 4IXPA 4E5AX 3H4JA 2ITUA 4ZZNA 3QL8A 4DCEA 2ITOA 2JITA 3NUYA 4G34A 3A7JA 5HE1A 2XAMA 2WGJA 3PPZA 4X6QC 3G5DA 3PA5A 1O6KA 1R1WA 1UNLA 1WBWA 3HLLA 4PL5A 2GS6A 3ORZA 5CVFA 3K2LA 5ANJA 5E8WA 5FXQA 3SQQA 1OMWA 4M0ZA 4DINA 4I41A 2WXVA 4PP7A 2PUUA 1YWNA 4QMWA 3IO7A 1MQ4A 4WG3A 5EYMA 4UX9A 4JG8A 5AAEA 4FTAA 5AFVA 4GT4A 3IW8A 1YOJA 5L6PA 2QI8A 3DB8A 3DKCA 2OICA 4EK8A 4FICA 3FZ1A 4S2ZA 2A0CX 2IJMA 3BHUA 3TV6A 3BU5A 1B39A 4A4OA 1YXTA 2WMTA 4EQUA 2BRBA 3KA0A 4QD6A 2RG6A 4KWPA 1U4DA 1CKJA 3LMHA 3A4PA 4CLIA 3K3IA 2XMXA 1M2RA 1OL5A 5J5TA 4BB4A 4KIKB 3LXPA 3OW4A 4C59A 3UO4A 2Q83A 4P5QA 4PMPA 4LDTA 2CMWA 4O2ZA 1GY3A 3IW4A 2QU5A 2E9VA 5EK7A 3KIOC 3REPA 3FMLA 3C0IA 4AXAA 3GCSA 4EHGA 2WQEA 4C57A 3EKKA 4AZWA 1H26A 3OZ6A 4M97A 3ATTA 5M07A 5CAVA 1PXKA 5EOBA 2PE2A 5TO8A 3R00A 5J9YA 5E9EA 5E92A 3D9VA 3PIXA 2G9XA 3FZOA 2CGXA 1OL1A 5GHVA 3PJ3A 3CTJA 3U55A 4FKWA 3ANQA 3RBWA 1DS5A 4O0VA 4F0IA 1H08A 3OWKA 1Q97A 2PVMA 2W5AA 4ANBA 3DB6A 4C4HA 4QYHA 3CIKA 4DDIA 5FEQA 3B8QA 3D5UA 2GFCA 3O8TA 1KV2A 4PMTA 4HZSA 3AKKA 3CXWA 3VS7A 1OBDA 1VR2A 2ITTA 4EWHA 3FLZA 3NFGB 2R64A 2WFYA 2XUUA 4XJ0A 2GNJA 4J95A 3TEIA 3UNKA 4UY9A 5FTGA 2BAKA 2PMNX 4K18A 2O0UA 2WNTA 4TYJA 3W8QA 3I0QA 4AN3A 4L42A 2NO3A 3F69A 3R73A 4MD7E 2YM3A 2V0DA 4P4CA 3HGKA 3P86A 3KN5A 4M69A 4RVKA 4HVHA 2B54A 2QOKA 4BGQA 2J9MA 5GJDA 3QU0A 5C1QB 4FK3A 5HCXA 4DC2A 5AX9A 5E1EA 3VUDA 2R7BA 4F70A 2FA2A 2QO2A 3GC7A 4KBAA 4QOXA 2OJGA 3OG7A 5CASA 2WD1A 4O7YA 2R2PA 3DFCB 4D1ZA 4E6QA 2OJIA 2G15A 3GOKA 4YBJA 3C50A 4G9RA 4ZTQA 2A2AA 3BGPA 2VX3A 4E20A 5L4QA 2UZVA 3T3UA 3Q9WA 4F9AA 2X7GA 2EVAA 2OXYA 3TKUA 3RAKA 1Q4LA 1S9IA 3FPQA 3UYTA 1PYEA 3UNZA 4AQCA 3UPXA 4F65A 3F9NA 3EQIA 1R0PA 3UG1A 5ICPA 3GNIB 2F9GA 3ZEPA 1STCE 3IDBA 1TFFA 4OTHA 2X8DA 3BHYA 2ITNA 5LXMA 1ZYLA 1VYZA 2R3FA 4JRNA 2CNUA 2XBAA 3MPMA 1JKSA 3NW7A 3F88A 3PFQA 4FTMA 4UMRA 4C3RA 5D11A 4BDFA 2ZB0A 4A9TA 1XH4A 3T9IA 3AC3A 3R9NA 3QKLA 2OH4A 2YWVA 2HYYA 3IW5A 4BDCA 1UU9A 1YXXA 4XG2A 4WKQA 3UQFA 2FVDA 3PXYA 4Y5QA 5AP2A 5L2WA 4QP6A 3ZBXA 4DITA 4K6ZA 1XHAA 3ZUUA 2XIKA 4ZEGA 3BGQA 5AJQA 2HK5A 5IQDA 3ANRA 4QPAA 3ZM4A 5IMEA 3I60A 3MIYA 4MF0A 3CD8A 3Q6WA 5CEPA 1YXUA 3NSZA 4CQGA 3R71A 5DT3A 3ZLWA 4QYGA 4G1WA 1ND4A 3RTPA 3VWAA 4D9TA 4D5HA 5IKWA 5M51A 1BX6A 4G6OA 3PLSA 3EWHA 5GZ8A 5EQEA 3LFFA 2YFXA 3FUPA 4DHJA 4ERKA 5HZNA 3ATSA 2RGPA 2VV9A 3MH3A 4K1BA 1REJA 4QP9A 3DPKA 3WF5A 4F09A 3EFLA 3KKVA 4IE9A 5FG8A 1ZYSA 3G0EA 1YI4A 4N57A 2V62A 4L52A 3O17A 3R1QA 4RIWB 4EHEA 2QHMA 2XJ1A 3OT8A 4XHKB 3U4WA 4S30A 5HD7A 3UMWA 3VBXA 4A07A 3TZMA 4DTKA 2V1CC 3I4BA 4H05A 2K19A 3I5ZA 3VF8A 4W9WA 5L8KA 3QF9A 4TWNA 4CRLA 3GCPA 4JDIA 4B99A 3ID6C 4AZFA 2PVRA 4XV3A 5DVRA 5A14A 3VBYA 1H4LA 3GQIA 4QYFA 5HNBA 3ZDIA 2OF4A 2YZAA 2X0PA 2EB3A 3N4UA 3KK9A 3H9OA 4EH9A 3GU8A 3KCFA 2I0YA 2W1GA 3R6XA 5IUGA 3D4QA 4KIPA 2YFAA 2J0MB 2W4KA 3BZ3A 1PXNA 4S33A 3C1XA 2V55A 4YSMA 1FQ1B 2C3KA 5F20A 3PVBA 4X2KA 4IFGA 5TR6A 4J71A 1M2QA 2ZDUA 2YM6A 2ETKA 4L6QA 4C58A 3SVVA 3GCVA 4QYYA 2W1DA 4GEOA 4WNMA 5CNOA 3KMMA 4BJJB 2GSFA 2QNJA 2YZLA 2H8HA 4FTNA 4FZAB 4H1MA 4F63A 4IIRA 3LM0A 2W4OA 3A99A 4JBVA 1WZYA 3V5WA 4FV9A 2WMXA 4S32A 3IW7A 4RQKA 2R3RA 5HHWA 1CKIA 4FT0A 4M13A 4WRSA 2IPXA 2XRWA 3G15A 1OPKA 3UITA 2XIXA 2BRHA 3UZPA 5IG1A 2VX0A 1VLRA 1JQHA 2HW7A 3IONA 4D28A 4DFLA 4EH2A 5C4KA 3Q04A 1X8BA 2FEFA 3D14A 1JNKA 5DOSA 1IG1A 4EHVA 2CGWA 2I0VA 5HORA 2W0JA 3O2MA 3OFMA 5IA3A 4OW8A 4W8EA 3R21A 3U9CA 2NNWB 5AX3A 4KAOA 4L7SA 3PIYA 4XS2A 3C0HA 3FV8A 3SD0A 4D4RA 3PG1A 3LIJA 5IA0A 4JQ8A 4O0WA 3ENHA 3MI9A 1J7UA 1XH5A 3C9WA 5CU4A 2WMBA 3HMOA 3OEFX 4F64A 1SVGA 3MVLA 5HE3A 3FHIA 1ZOGA 2P55A 4FIFA 2GU8A 4C2WA 2PUNA 2B1PA 2SRCA 3NPCA 4BI1A 4TYIA 4AG8A 1DI8A 4C0TA 4D4VA 4FGRA 2L1LB 3BLHA 1DAYA 2OIDA 2W4JA 1ZY5A 4RVLA 4BC6A 2ZW3A 3U6JA 4O4FA 1NT2A 2B9HA 4RIOA 2VU3A 2YEXA 2BDJA 2NP8A 4DGLC 3TIYA 2ERKA 1GIIA 2YJSA 4UWCA 5LMKA 3HECA 3K54A 3KXMA 3ZFXA 3ZXZA 2BILB 3F3TA 3OS3A 3VRZA 5EW3A 5CAQA 2YLEA 5L2SA 3BBTB 4FV0A 4C3FA 5J1VA 1ZOHA 2X0GA 4NL0A 4UMUA 4DFBA 4FMQA 3PZEA 4FKPA 4WT6A 1W98A 2LGCA 2ZV2A 2C6MA 4R3PA 3OBGA 4B8LA 2IVUA 5ANOA 4LV5A 4XP3A 3VS6A 2XVDA 4YC8A 4Z3VA 1PRYA 1XWSA 1H8FA 4O27B 5L8JA 3RPSA 3LM5A 4D2RA 4M66A 3UYSA 4JAJA 3OD6X 2XCHA 5K0KA 3UOHA 3WILA 2XA4A 4UWYA 5C27A 3QRKA 3RM7A 2WKMA 3EKNA 5AP5A 4AS3A 2UVXA 2JAVA 3OOGA 2PZRA 4IWOA 3W1FA 4EOKA 5HVKA 4EKKA 4O0XA 2WTKC 3KEXA 4W4YA 3TV7A 2NPQA 2W05A 3PE1A 1ZY4A 3AC1A 5EYDA 5EHYA 5BMMA 4EK4A 1OKZA 2XMYA 3CPCA 4GW8A 3BU6A 3RI1A 4AUAA 4P5ZA 5T3QA 4LUEA 4O0UA 1P14A 4CD0A 4DT8A 4NFMA 2VX1A 2VWZA 2A2DA 2G2IA 3BHTA 3OTVA 1UVRA 4IM2A 2WU6A 2R3IA 4IDTA 2W9FB 4A9UA 4CRSA 3UIMA 4MK0A 1XH8A 4FZ6A 3IS5A 1U5KA 4GT5A 5CX9A 3R83A 2Z60A 2JB1A 1RW8A 3P5KA 4R78A 2X0QA 3AJFA 4XMOA 4QMLA 2BRMA 3JR1A 2PZIA 3ZFYA 2WEIA 4I92A 4LGHA 4NCTA 4CEGA 4YZ9A 3DBDA 5AR8A 3PSBA 1FPUA 4GUBA 2JBPA 4F7NA 4U7ZA 4JOAA 4AOTA 4PF4A 3OOMA 4FX3A 5IQGA 2CNVA 2CCIA 3LJ1A 4LL5A 3F7WA 4CQEA 1KSWA 2A2CA 2PMIA 3EL7A 4BCHA 2W9ZB 5J9ZA 4U97A 3RCJA 4TXCA 3DLZA 5CU6A 2F49A 4D58A 5AV1A 4AT3A 1GJOA 3UGCA 3OUNB 3AC4A 4BL1A 2OG8A 4FVPA 4GUEA 2QR7A 5M4UA 4IB0A 3KP9A 2ITPA 2QO7A 4L00A 3D15A 3P7CA 5DE2A 4K9YA 4USFA 3ZYAA 4U3ZA 3O7LB 2FB8A 2W1FA 3R9RA 4CFMA 2QOIA 4IX5A 2IG7A 1H07A 4ARKA 1XQZA 3R1NA 3R7GA 3SLSA 4U9AA 2YHVA 4EH7A 3A60A 3VUIA 4ZTHA 4EEVA 1LEZA 4JBQA 4RC4A 2CJMA 5FWKK 4PPAA 4ANLA 3I79A 4I20A 5HIDA 4C4FA 5A4CA 4JDHA 3V5PA 5GZ9A 3DV3A 2HAKA 3E93A 4QMXA 4FYOA 3Q4ZA 5BYYA 2QZGA 2R9SA 2C5OA 3QUEA 4JT3A 3TACA 4B6LA 4D4YA 3UDTA 4M67A 4FTRA 2P2IA 2F7ZE 2IEWA 4YTIA 4NIFA 3EOCA 4EOOA 1OPJA 4GIIA 4ONAA 1LP4A 3HZTA 5FTQA 5EM6A 1UNHA 4BTKA 4DH1A 5JFWA 2BPMA 5J95A 2J90A 2OWBA 3FLNC 2WMUA 4JNWA 4YTFA 2CGUA 2IF8A 3CBLA 3P08A 2XK3A 5L8LA 1URCA 2XYNA 3NUAA 4QYEA 2PU8A 3SG9A 4ZJJA 1UKIA 2X39A 3KMWA 5CAUA 4D2TA 4BR3A 2WOUA 2W1HA 3V04A 3LLAA 3F3UA 4AA0A 3W0MA 4MXXA 5KMJA 2JBOA 2OF2A 2WMRA 3CKWA 4EC9A 3QTUA 4MXZA 1IA8A 1PKDA 2VTPA 2Y4PA 1H28A 2YM5A 2ZOQA 5H8EA 3TNQB 5CYIA 3I7CA 4QMUA 5K5NA 3U9NA 2XK9A 3WIGA 4C3PA 2WOTA 3LW0A 4EBVA 2X6EA 1JLUE 3EQCA 3I7BA 3QRTA 1W2CA 4C34A 4NCTC 5AEPA 5HO7A 4FYNA 4E4XA 5BUJA 4EZ7A 4NSTA 1P4FA 5D9HA 5LCKA 4PUZA 5D41A 2UZBA 2YIXA 3R04A 3SRVB 4HNFA 4Q5HA 4IAAA 2R7IA 4G5JA 4V0GA 3G2FA 2UZUE 4X3FB 3V8SA 4YJPA 3FYKX 2VN9A 3AD5A 3ACJA 2R3QA 2VTRA 4RPVA 3OXTA 3LQ5A 4DHFA 5ACBC 3DLSA 1I44A 1U5QA 2GMXA 2BVAA 3LCKA 3NW5A 4LQMA 4RFZA 4I24A 4BRXA 4DEBA 5AA8A 3LVPA 2GQRA 2B9IA 1KE6A 2GQGA 4R7HA 3TL8A 3W2QA 2BTSA 3E7VA 1XMMA 2EXCX 1LPUA 2QVSE 3Q52A 4GL9A 2BR1A 3GOPA 4JX3A 5DYJA 2GCDA 1G3NA 4N4SA 3UIBA 4O7LA 2ZMDA 4JXFA 3II5A 4UMQA 4O7RA 5JFSA 4L46A 5D1JA 2WMQA 3LQ3A 4JCVE 5HOAA 5L6WL 2UZTA 4LRKA 2PVNA 5H8BA 3PFYA 4F0FA 2R3MA 4RMZA 3FMJA 4NU1A 3UTOA 4ANSA 2J7TA 3TMOA 5FP6A 4AGCA 1DAWA 4FNZA 4ALUA 1H1WA 1SVHA 2O5KA 3EH9A 4N70A 5LNK1 2C5VA 4ZK5A 1IEPA 1WVXA 5HG8A 3EN7A 1CM8A 3O0GA 3FZRA 3MV5A 3GT8A 4IZAA 5E8ZA 4XG4A 2XNEA 3EFWA 3HRCA 4UZDA 4RA5A 5DT4A 5AUTA 1UNGA 3CE3A 5KMLA 3F2AA 2Z8CA 3IAS1 1EH4A 5DNRA 1XBAA 1PJKA 3BRBA 4ZXTA 3H30A 5BUIA 4CKRA 2XJ2A 3KRRA 3EQHA 4TT7A 2GNIA 2QKWB 2R3PA 4X7QA 5DI1A 4CT2A 4D0XA 4PDSA 2EU9A 4AS2A 3KULB 3PA3A 3VW8A 2C0OA 4RX7A 4I93A 3GUBA 5JRSA 2ZVAA 5CT7A 4FA2A 2VTNA 4ITIA 4MHAA 5IEVA 2IP6A 4JAIA 1KE7A 3BYUA 3G90X 2VRXA 4YJQA 1XBBA 4P2KA 4I5HA 4RRVA 4EL9A 3HV4A 3QX2A 2RFNA 2UZNA 3MW1A 4D2SA 3BEGA 5BVWA 4C7TA 3BL9A 1A9UA 5K0XA 2PTKA 4QRCA 4F1MA 4PNKA 4K0YA 5AM7A 5CXHA 3PTGA 2DWBA 2YM4A 3AOXA 3L8XA 4APPA 3OROA 1CSNA 2QR8A 4RGJA 3SX9A 1Y8GA 5I9VA 2QOLA 4FV8A 4QP4A 3LMGA 3OHTA 5TE0A 3R8UA 5CALA 3U6HA 2KKMA 5EQYA 3QA8A 2RLDA 3ZEWA 4FTQA 4RJ6A 2C1AA 5LARA 2BIYA 2YDKA 3S0OA 2OH0E 4V0GB 4M7IA 3VW6A 4QMNA 2VWWA 4KSPA 2CN8A 4R7IA 4U79A 5F95A 4QTEA 4HGEA 2OGVA 4KIOA 3OXIA 3ROCA 2UW6A 4WD5A 3QC9A 5CNNA 2XK7A 4YPSA 2W1CA 4IAFA 5AP3A 4Y95A 3EMGA 3RGFA 1YWVA 2W7XA 3W0SA 4BJJA 4AW0A 3PXKA 3BWFA 1DM2A 2OIBA 3MVMA 2XKDA 4AP7A 4BFMA 3V51A 2CCHA 3QBNA 4AFJA 4D0WA 3AGLA 3S4QA 4NJ3A 1OITA 1PXOA 3I6UA 3VIDA 1IA9A 4F9CA 2J5FA 1Y91A 2ZJWA 2FUMA 3ORKA 2A98A 3VQHA 5FDPA 3KL8A 4PQNA 1G8JA 2C5XA 4FJVA 4IC8A 4YGAA 5CVHA 3BV3A 3VBWA 5JKGA 1ZXEA 2R0IA 3MPAA 4TYGA 2AYPA 1XMLA 1M2PA 2W96B 3QQJA 4Y85A 5DWRA 4M8TA 3DTCA 4J53A 4AA4A 5HE0A 4GG7A 4BIEA 2P33A 4DFUA 3R1YA 1KE5A 4E6AA 2V5QA 4OAUC 3NYOA 3QQKA 3BLAA 4GCJA 1XKKA 1TDPA 4ZSJA 1KE8A 1ZMUA 3PPKA 2Z7RA 4DFXE 4ASXA 3ZMMA 5AV3A 2YACA 4KKGA 4MNFA 3TT0A 5I5ZA 4XG7A 2WB8A 1U59A 5C03A 4KD1A 3O50A 4YTHA 4PY1A 3T8OA 4AE6A 4EOPA 1WBOA 3VNTA 3A7HA 3FI4A 5FBOA 3E62A 3R30A 3CY2A 3PVUA 4FSTA 3PSCA 4TYEA 1PXPA 4DH7A 4U6RA 2YIQA 4X2NA 5M56A 3UJGA 3L9MA 5CSPA 5KHXA 4S34A 2VTIA 5F1ZA 2BALA 3HVCA 2B55A 4RLKA 4C02A 2Z02A 4ZTNA 4R7BA 4AT5A 3BHVA 2OXDA 1OGUA 3LPBA 3MJ1A 3ODYX 4KRCA 5JT2A 5HBJA 5GINE 5CVGA 3QUPA 2HENA 3OCGA 5I0BA 4E93A 5BVDA 3MWUA 4QPMA 1GZKA 3PIZA 4JJRA 4G9CA 5FQDC 3RPVA 4BTJA 4A7CA 1Y6AA 4WSYA 2JKKA 2JKMA 3BU3A 1QL6A 2XP2A 4KKHA 5IUHA 3U6IA 1CMKE 2BAQA 1IAJA 4U43A 5E7RA 4F1OA 3A61A 4EH6A 3DXQA 3FQHA 4AE9A 4CTCA 2W5HA 5EKNA 4O7ZA 4FIHA 5CANA 3MTFA 2XB7A 1J91A 2XM8A 5BVKA 4DEAA 3UZRA 3MDYA 4ITJA 2CHLA 2CKEA 4TTHB 4XP2A 4CFVA 3WIKA 4Z55A 3JSBA 3HRFA 2C47A 2QOBA 2F57A 3FKOA 3LFQA 3UIXA 3NAXA 4HCTA 4E4MA 5I9WA 3JPVA 1Q5KA 4PNIA 3BKBA 3TTIA 4IWDA 1VYWA 3ZOSA 3BE9A 4I1ZA 3R8VA 2JD5A 4I22A 3NUUA 4AW2A 5HD4A 4AXFA 3R8MA 4PMSA 3DAEA 4U44A 3D94A 4NV5A 2CSNA 2P4IA 5KZ0A 4BF2A 3QKKA 1ATPE 3M11A 3RZFA 5LVPA 5FXRA 4XG3A 4QDVA 4FGBA 2E9OA 5JRQA 2C0IA 4AOJA 2PE1A 2X81A 1OBGA 4DCAA 3RPYA 4FSWA 3IG7A 3ROYA 1PF8A 2VTOA 1JVPP 3VULA 3FL5A 2ZV9A 3N51A 3UP2A 2ITQA 4EUUA 3TUDA 5T68A 4GS6A 3QA0A 2I7QA 2QQ7A 5IA1A 2JIUA 1TQPA 2IZTA 3ACKA 4D4SA 5JEBA 4UBAA 4ASDA 5KMOA 2WTKB 4GVAA 3VJNA 4CFFA 4QTDA 3PVGA 1O9UA 2AEGA 1JOWB 3ET7A 3QFVA 3QQFA 4S31A 4YJSA 3MSSA 2PVFA 3EN6A 4Q9ZA 5A54A 2W1EA 3QZIA 5J79A 1RQQA 2IW6A 4FG9A 4XG6A 3LXKA 5HCYA 3FXZA 4AGWA 3R9DA 3VF9A 4BCQA 5ANDA 3WZDA 4MWHA 4E5WA 4EOJA 3W2CA 2WTJA 3EYGA 4YNEA 1T45A 2C68A 4RJ3A 3VBTA 3ZS5A 3A8XA 4BIBA 3F2NA 1QPCA 1S9JA 3LFCA 2WIPA 4I4FA 4J8MA 3FSKA 4HYIA 4YMJA 4O6LA 3KMUA 3MESA 5EHOA 5IEXA 3FMEA 2JB3A 2VD5A 4FKVA 1WVYA 4OGRA 4I5CA 3RM6A 4ID7A 4L53A 4CZTA 4EUTA 5IQBA 4OT5A 3CJGA 2ZDTA 4DFZE 3KRJA 3PPJA 4BHZA 5CEQA 3NEWA 2JDTA 4IWQA 3R9OA 4WSQA 3G9LX 1Q62A 3WARA 3QALE 3R7OA 3OWJA 3NYNA 4IZYA 5A6NA 1OIRA 3CTHA 3HYHA 5HG5A 3SOAA 3UVPA 1YHVA 3V5JA 4ZAUA 3NZ0A 2JDOA 2WTWA 3DBCA 4QMZA 4E8AA 2A27A 2YN8A 5FM2A 4HVDA 3EFJA 4IVDA 5HO6A 4O4DA 1TVOA 2I6LA 5ANKA 4QMTA 5AAFA 4J98A 3ZZEA 5M57A 1WBTA 2OW3A 4NH1A 5JQ8A 2VTTA 4EBWA 4IAIA 4L44A 3GENA 4FV6A 4BHNA 4MXAA 4NJDA 2YCQA 5CY3A 4PL4A 5BUEA 3NX8A 3HRBA 4EH3A 2ZRRA 3G0FA 2BIKB 2YDIA 3FXXA 4AZTA 2RFEA 3OEZA 4H58A 4RFYA 1K2PA 3UIUA 4BVUA 2HGKA 2OLCA 4HCVA 2ITZA 3DZQA 4FKTA 1YXSA 1UU8A 4R3CA 3FNBA 4GFMA 4RC3A 5DPVA 5AWMA 2FSTX 2XM9A 4FTUA 3I9V1 4FVQA 4TKSA 5CF8A 2R4BA 2BHHA 3RHXA 2A19B 2RIOA 4D1XA 2O65A 4DFYA 4GK3A 1O6LA 4R1YA 3LAUA 2UVYA 4A4LA 1IRKA 3Q6UA 3V01A 2WHBA 3ZDUA 4ANNA 1L3RE 3KXHA 4D55A 5HEZA 1QPDA 1A48A 3EHAA 2XH5A 5IQEA 2ITVA 2IZUA 2QLQA 4EQCA 5M44A 3RINA 4EOQA 5AP4A 3RCDA 5EDRA 4ZTLA 4I3ZA 4G3EA 5HLPA 5HCZA 4HVIA 4ZLOA 4GIHA 2E9NA 4IFCA 3UOLA 4USDA 2Y8OA 3FVVA 5LWMA 3NUSA 3GU6A 2Z2WA 1IASA 4IEBA 4C4JA 4ZSLA 4W4XA 4DGOA 4IMYA 4PTEA 4ACHA 3NNXA 4XYFA 3ZO3A 2HCKA 4BCNA 2B9JA 3ORIA 3O7LD 4PRJA 4QP7A 4IADA 5J87A 5IQFA 3BLQA 2VTJA 3ENMA 3SW7A 4AWIA 5ITAA 1UU3A 2VTQA 5BYLA 3KXXA 4UMTA 2JAMA 4I6HA 2OZAB 5HNIX 3P7BA 4EH8A 4KINA 2Y4IC 4QEBA 1W83A 4TYHB 3VS3A 5AUWA 5EOLA 5IQAA 2UZOA 3AC8A 4ALVA 4FT7A 3BLRA 4BCMA 5HU9A 1ZZLA 4XNEA 2R3KA 1NW1A 4FTIA 5HESA 5JK3A 5LWNA 3QTQA 3R7VA 4FSQA 3THBA 3NUXA 4CFUA 2ETDA 1KE9A 3GFWA 5KZIA 1JSVA 3FC1X 3HV3A 4IB1A 4IW0A 2YIYA 3DDPA 4KBCA 2I40A 4JG6A 4OTQA 5CQWA 4ZIMA 4BI0A 3BI6A 4FG7A 4HPTE 4IX4A 4L01A 5D10A 5AM6A 3UC3A 2WTCA 2CLXA 2V7OA 4XG8A 3NLBA 3ZLSA 4BDDA 2OSCA 1HCLA 2E9UA 1H00A 3FI8A 3NUPA 1KUTA 3IDPA 5CSHA 4GU9A 1UU7A 4FV5A 5A4QA 2HELA 3SAYA 1FINA 3L9NA 3U87A 2ONLC 3RPRA 4BBMA 3TZ7A 4FOBA 5J1WA 1FMKA 4DH5A 4CFNA 4JIKA 4JMQA 1JWHA 3BEAA 2ZYBA 4CFWA 4RIYA 3O23A 3PRFA 4YZDA 3ORMA 3DZOA 2XKFA 4RJ8A 2PMLX 3O51A 4U8ZA 3Q4UA 4MX9A 3JVSA 4MCVA 2E2BA 2VO0A 3C0GA 4GFOA 5JZJA 3ORTA 1NVRA 4NEUA 3QXOA 4GKHA 2FO0A 4YHJA 1SZMA 3F7ZA 4QMYA 3F5UA 5H8GA 2YAKA 2XANA 3CGFA 1FVRA 4IZ5A 4ZMEA 4BGGA 4HYUA 5IEYA 3AT3A 3DBFA 2XNGA 1M7NA 5AUXA 3VS2A 2XCKA 4L3PA 4YHFA 1SNXA 3IKAA 1W2DA 2QOOA 2UW3A 4QMVA 3AMBA 4XOYA 5DR9A 2JDVA 4WG5A 5FEDA 5T6KA 3TNPC 3ZH8A 2X9FA 2GTMA 4QNAA 4DG3E 4ZLYA 2GFSA 1H1RA 2J5EA 1DI9A 3OUKA 3ZRLA 3NIEA 2ESMA 4GJ3A 1VJYA 4RIYB 3KREA 3HUBA 3DU8A 3R7EA 2Y0AA 5AP7A 1Y6BA 1XBCA 5L2IA 2X2LA 1ZYCA 3UMXA 4FTCA 2OU7A 4KABA 3BBWA 4GJ2A 4XBRA 4LG4A 2J0IA 3QQLA 3FI3A 4W4WA 3DY7A 3ALOA 3V6RA 5FTOA 5C9CA 4BZOA 5CI7A 1YWRA 4FEUA 4O4CA 5I9YA 1P4OA 1U46A 3N4TA 3E8DA 2Y4IB 5CTPA 3WYXA 4NV2A 4LV8A 4TW9A 3CY3A 5GZAA 1KOAA 3W33A 3WZJA 1YVJA 5DA3A 1OL2A 5ETFA 1SJ8A 3DA3A 3FDNA 2BRGA 4TZRA 4FL3A 3PJ8A 1J1BA 2VUWA 3FZTA 1LR4A 1YI3A 4M84A 3LE6A 4FT3A 1A06A 5IH5A 5BPYA 2CGVA 2GPHA 5CEIA 3NWWA 4BDHA 2GTNA 3VRYA 1BLXA 2PVKA 5ANGA 3HL7A 4ZJIA 3GGFA 3ZRMA 4BBFA 4ZZOA 1WAKA 1UKHA 5JSMA 4HGLA 5IZFA 4B4LA 4EONA 2G1TA 1PHKA 1XR1A 1BMKA 5A46A 2NRYA 4JR7A 1OUKA 3DK7A 5HIBA 2B9FA 2XNNA 1YHWA 2I0HA 1ST0A 4RQVA 1JKLA 4Y83A 4XUFA 4OTFA 3CSVA 4M14A 4QQTA 5HLNA 2QD9A 3Q9ZA 4MWIA 4YJOA 4PMMA 5BX0A 4YZMA 5BVOA 2R3GA 5HNGA 4WIHA 4IHPA 2Z7LA 4II5A 2YM7A 4ALWA