3LJAA

Using soft x-rays for a detailed picture of divalent metal binding in the nucleosome
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ljaA00
5GT0A 5AV5C 4KGCB 5CPJA 1P3GD 5E5AB 1KX4B 2YFVB 3LELC 4JJND 5AV6D 1ID3C 1R4VA 4QLCB 4KUDA 3X1SC 3AZNA 3X1UA 1M1AB 3UTAB 3RELC 5DNNA 1P3AC 4H9QB 4HGAC 5BS7C 4J8UD 4G92C 4H9OA 3KUYC 4ZUXA 1KX5A 3TU4B 3MVDC 4NE5A 1ZLAA 3AZFD 3W98B 5KDMA 3AZMD 2F8NG 3W97A 3LZ0A 5C3IB 3A6ND 5B0ZA 3WA9B 1P3FA 4YM6B 3MGQB 3AN2C 3AZIA 3X1VB 4H9PB 1F66D 2BYMA 3KWQD 3UTBD 3AZHB 4J8VA 2CV5A 3UT9D 5B1LD 1P3GB 5G49B 1M19D 1B67A 3REID 1P3ID 5CHLB 2F8NB 4XUJA 3AZED 3AV2A 4M6BA 4R8PC 4CSRA 3REKC 3B0CT 5E5AC 4XZQA 1AOIA 1F1EA 5B33D 1U35B 2PYOB 2NZDA 4H9RA 5AVBA 5B31A 3W96D 4YS3C 2NQBB 2RVQC 5GT3D 1P3MD 1P3BC 1M18B 1JFIB 3AFAD 5B32A 3LJAA 1EQZC 3VH6T 1KX3B 3AV1C 1S32D 5B2JA 1P3OD 5CPKB 5B1MD 3X1UB 5B40C 5B24C 1F66B 3KWQB 4YM6C 5DNNB 5AV9C 4Z2MG 3MGRA 3C1CA 3REJC 3AZJB 3X1TA 4WU8D 4AWLB 5AY8D 4KGCA 2AROC 5B1LB 5BO0B 4ZUXB 2FJ7C 5AVCA 3B6FC 5AV5D 1KX4A 2YFVA 3AZEB 4QLCA 3LELD 3VH5T 1M1AA 4G91B 5DNMB 3UTAA 3X1SD 3WAAC 5GT3B 4LD9B 4H9QA 5JRGD 1P3FB 1U35C 5GXQB 1P3PD 4KHAB 3TU4A 3AFAB 3O62B 4Z66C 3W98A 4H9NB 5JA4B 5GT0C 4DRBA 3VH5A 4XUJB 5CPJC 4J8XA 5AV8B 3WA9A 3MGQA 1AOIB 2NZDB 3X1VA 4H9PA 3AN2D 2L5AA 4KUDC 3AZNC 5B2IB 3KSYA 3X1UC 3AZHA 4WU8B 3KXBD 5AY8B 1BH8B 5DNNC 2HUEC 4NE6A 4X23B 5G49A 1P3GA 3NQUB 4ZUXC 5AV6A 1KX5C 5F99B 3C1BB 2BYKA 2PYOA 1ZLAC 1BH9B 5CPID 2NQBA 3W97C 5CP6B 3LZ0C 2RVQD 3WTPD 1M18A 1JFIA 5B0ZC 1P3BD 1P3FC 3AZIC 3X1TB 3AZKB 3AZFA 5AVCB 3B6GC 4J8VC 2CV5C 1P3LB 1WWSA 1TZYD 2YFWB 3W99D 4J8WB 4WU9B 1KX3A 1ULYA 3A6NA 5CPKA 4XUJC 3AZLB 3AV2C 5GSUD 1F66A 3WKJC 3KWQA 5B40D 4XZQC 3AZJA 3MGSB 5B24D 3UTBA 2NZDC 5AVBC 3KXBB 5B31C 5B1LA 5BO0A 4E45A 3AYWB 2AROD 3MNND 3B6FD 3AZEA 4CAYB 5B0YB 5B32C 3LJAC 5DNMA 4J8XB 5GT3A 3AZGB 4LD9A 1P3MA 1P34D 3WTPB 5B2JC 5GXQA 4KHAA 4Z5TD 5BT1D 3AFAA 3O62A 3MGRC 3C1CC 3B0DC 4H9NA 4Z66D 5JA4A 1TZYB 3W99B 4KGCC 4JJNB 4ZBJB 5AV6B 3NQJB 5AVCC 5GT0D 1S32A 5AV8A 2BYKB 2HIOD 5CPJD 1KX4C 5GSUB 4QLCC 3REHD 3V9RB 4J8UB 5B2IA 1M1AC 3UTAC 4WU8A 4KUDD 5AY8A 1BH8A 1HQ3D 1P3KD 4UUZB 4X23A 3MGPD 3NQUA 5F99A 3AZFB 3TU4C 3C1BA 3AZMB 1KX5D 1BH9A 3W98C 3A6NB 5JRGA 3LZ1D 1P34B 4EO5B 5CP6A 5C3IC 3W97D 3WA9C 1P3PA 3LZ0D 3MGQC 3UTBB 3B0BA 5B0ZD 3X1VC 4WZSB 3B0CW 3UT9B 3AZKA 1M19B 3VH6A 3AZHC 3REIB 1P3IB 1P3LA 4J8WA 2YFWA 4H9SA 4WU9A 3B6GD 4J8VD 1P3GC 4E44A 2HIOB 5B33B 5AV6C 1ID3D 3AZLA 3W96B 3REHB 3AV2D 2PYOC 1N1JB 3MGSA 1P3MB 3WKJD 3KXBA 3RELD 1P3AD 4XZQD 1HQ3B 1P3KB 2NQBC 5AVBD 5B31D 3KUYD 3AYWA 1M18C 3MVDD 2IO5B 4CAYA 5B0YA 5FUGB 3AZFC 5CPIA 1S32B 5B32D 3LJAD 1P3OB 3AZGA 3LZ1B 1KX3C 5B1MB 3WTPA 3A6NC 5CPKC 1F66C 3KWQC 3AZJC 3UTBC 5AV5B 3MGRD 3C1CD 1TZYA 4AWLC 3W99A 5B1LC 4JJNA 3NQJA 5BNXA 3LELB 1ID3B 3AZEC 4R8PD 5GSUA 3REKD 3X1SB 5E5AD 3V9RA 5JRGB 4J8UA 3RELB 4G91C 5DNMC 4HGAB 4YS3D 4G92B 1P3AB 5GT3C 4LD9C 1M1AD 1P3PB 3UTAD 3KUYB 4UUZA 3MNNA 2CWEA 5GXQC 3MVDB 3AZMA 1BFMA 3AFAC 3O62C 1EQZD 3AV1D 1P34A 1S32C 3AN2B 5AV8C 1AOIC 3WTPE 4Z5TA 4YM6D 5AV9D 3MGQD 3REJD 3UT9A 5B2IC 1M19A 4WU8C 3REIA 1P3IA 5AY8C 4WNNB 2FJ7D 3AZHD 4X23C 2HIOA 1TAFA 5B33A 4R8PB 5F99C 3REKB 3C1BC 5CPIB 2F8ND 3W96A 3REHA 1HTAA 1N1JA 4YS3B 4NE3A 3WAAD 1A7WA 2PYOD 1HQ3A 1U35D 5JRGC 1P3KA 4Z2MH 1P3BB 3MGPA 5CP6C 2NQBD 1P3PC 1M18D 3X1TC 5FUGA 1EQZB 3AZKC 5BNXB 1P3LC 1P3OA 3AV1B 4J8WC 3LZ1A 4H9SC 4WU9C 5B1MA 1KX3D 5B40B 1WWIA 5B24B 3AZLC 5AV9B 5CPKD 3REJB 3AZND 3X1UD 4WV4B 3MGSC 3KXBC 5AV5A 5DNND 3AZJD 2AROB 3MNNB 2FJ7B 3B6FB 3B6GA 3AYWC 2LY8A 1H3OB 4ZUXD 3LELA 3R45B 1ID3A 3X1SA 5B0YC 1ZLAD 3WKJA 3RELA 3WAAB 5CPIC 1P3AA 5BS7A 4J8XC 3AZGC 5DNMD 3KUYA 4LD9D 4Z5TB 3WTPC 1P3FD 5BNVA 3AZID 3MVDA 5GXQD 4Z66B 5GT0B 2CV5D 3O62D 1TZYC 5CPJB 1TAFB 3W99C 1B6WA 4ZBJC 4JJNC 3AN2A 4XUJD 3VH6W 5AV8D 5GSUC 4KUDB 3AZNB 1AOID 4J8UC 2NZDD 3MGPB 2HUEB 5B2ID 4WNNA 4H9OB 2JSSA 3MNNC 1KX5B 4X23D 4R8PA 3REKA 5E5AA 3AZMC 1ZLAB 5F99D 3C1BD 5KDMB 4YS3A 3W97B 1KU5A 1P3BA 3LZ0B 1P34C 4EO5C 5B2JD 5B0ZB 3AZIB 5B31G 5CP6D 3VH5W 2BYMB 4Z5TC 5BT1C 3UT9C 1EQZA 1Q9CA 3B6GB 4J8VB 2CV5B 3X1TD 1M19C 2F8NH 3REIC 3AZKD 1P3IC 4KGCD 3AV1A 5AVCD 5B32G 1P3LD 4J8WD 4WU9D 2HIOC 1KX4D 5B40A 3AV2B 5B24A 5B33C 3WKJB 4CSRB 4QLCD 4YM6A 5AV9A 4XZQB 3REJA 3W96C 3REHC 3AZLD 4H9RB 5AVBB 4DRAA 1P3MC 5B31B 2AROA 3MGSD 1HQ3C 1P3KC 2FJ7A 5BNVB 3B6FA 3MGPC 1H3OA 3R45A 3TU4D 3AYWD 2IO5C 4NFTA 2F8NA 5B32B 3LJAB 3W98D 3WAAA 5B0YD 1U35A 1P3OC 3LZ1C 5B1MC 5B2JB 4J8XD 3AZGD 3WA9D 2F8NK 3X1VD 3MGRB 3C1CB 4Z66A 3B0DB
chains in the Genus database with same CATH superfamily
5GT0A 5AV5C 4KGCB 5CPJA 1P3GD 5E5AB 1KX4B 2YFVB 3LELC 4JJND 5AV6D 1ID3C 1R4VA 4QLCB 4KUDA 3X1SC 3AZNA 3X1UA 1M1AB 1T3UA 3UTAB 3RELC 5DNNA 1P3AC 4H9QB 4HGAC 5BS7C 4J8UD 4G92C 2ZM5A 4H9OA 3KUYC 4ZUXA 1KX5A 3TU4B 3MVDC 4NE5A 3H0LC 3AL0C 1ZLAA 3AZFD 3W98B 5KDMA 3AZMD 2F8NG 3W97A 3LZ0A 5C3IB 3A6ND 5B0ZA 3WA9B 1P3FA 4YM6B 3MGQB 3AN2C 2RIQA 3AZIA 3X1VB 4H9PB 1F66D 2BYMA 3KWQD 3UTBD 3AZHB 4J8VA 2CV5A 3UT9D 3EPKA 5B1LD 1P3GB 5G49B 1M19D 1B67A 3REID 3H0RC 5CHLB 1P3ID 2F8NB 4XUJA 3AZED 3AV2A 4M6BA 4R8PC 4CSRA 3REKC 3B0CT 4XZQA 5E5AC 1AOIA 1F1EA 5B33D 1U35B 2PYOB 2NZDA 2UWXA 4H9RA 5AVBA 5B31A 3W96D 4YS3C 2NQBB 2RVQC 5GT3D 1P3MD 1P3BC 1M18B 1JFIB 3AFAD 5B32A 3LJAA 1EQZC 3VH6T 1KX3B 3AV1C 1S32D 1Z2CB 5B2JA 1P3OD 5CPKB 5B1MD 3X1UB 5B40C 5B24C 1F66B 3KWQB 5DNNB 5AV9C 4YM6C 4Z2MG 3MGRA 3C1CA 3REJC 3AZJB 3X1TA 4WU8D 4AWLB 5AY8D 4KGCA 2AROC 5B1LB 5BO0B 4ZUXB 2FJ7C 5AVCA 3B6FC 5AV5D 1KX4A 2YFVA 3AZEB 4QLCA 3LELD 3EG5B 3VH5T 1M1AA 4G91B 5DNMB 3UTAA 3X1SD 3WAAC 5GT3B 4LD9B 4H9QA 5JRGD 1P3FB 1U35C 3EPHA 5GXQB 1P3PD 4KHAB 3TU4A 2Y2MA 3AFAB 3O62B 4Z66C 3W98A 4H9NB 5JA4B 5GT0C 4DRBA 3VH5A 2Y2QA 4XUJB 5CPJC 4J8XA 5AV8B 2G5HC 3WA9A 3MGQA 1AOIB 2NZDB 3X1VA 4H9PA 3AN2D 2L5AA 2ZY2A 4KUDC 3AZNC 5B2IB 3KSYA 3X1UC 2G5IC 4WU8B 3KXBD 3AZHA 5AY8B 1BH8B 5DNNC 2HUEC 4NE6A 4X23B 5G49A 1P3GA 3NQUB 4ZUXC 5AV6A 1KX5C 5F99B 3C1BB 2JE5A 2BYKA 2PYOA 3EPLA 1ZLAC 1BH9B 5CPID 2NQBA 3W97C 5CP6B 3LZ0C 2RVQD 3WTPD 1M18A 1JFIA 5B0ZC 1P3BD 1P3FC 3AZIC 3X1TB 3AZKB 3AZFA 5AVCB 2BG1A 3B6GC 4J8VC 2CV5C 1P3LB 1WWSA 1TZYD 2YFWB 3W99D 4J8WB 4WU9B 1KX3A 1ULYA 3A6NA 5CPKA 4XUJC 3AZLB 3AV2C 5GSUD 1F66A 3WKJC 3KWQA 5B40D 4XZQC 3AZJA 3MGSB 5B24D 3UTBA 2NZDC 5AVBC 3KXBB 5B31C 5B1LA 5BO0A 2W8SA 4E45A 3AYWB 2AROD 3MNND 3B6FD 3AZEA 4CAYB 5B0YB 5B32C 3LJAC 5DNMA 4J8XB 5GT3A 3AZGB 4LD9A 1P3MA 1P34D 2Y2GA 3WTPB 5B2JC 5GXQA 3H0MC 4KHAA 4Z5TD 5BT1D 3AFAA 3O62A 3MGRC 3C1CC 3B0DC 4WJ3C 4H9NA 4Z66D 5JA4A 1TZYB 2XD1A 3W99B 4KGCC 4JJNB 4ZBJB 5AV6B 3NQJB 5AVCC 5GT0D 1S32A 2XD5A 5AV8A 2BYKB 2HIOD 5CPJD 1KX4C 5GSUB 4QLCC 3REHD 3V9RB 4J8UB 5B2IA 1M1AC 3UTAC 4WU8A 4KUDD 5AY8A 1BH8A 1HQ3D 1P3KD 4UUZB 4X23A 3MGPD 3NQUA 5F99A 3AZFB 3KFUG 3TU4C 3C1BA 3AZMB 1KX5D 1BH9A 3W98C 3A6NB 5JRGA 3LZ1D 1P34B 4EO5B 5CP6A 5C3IC 3W97D 3WA9C 1P3PA 3LZ0D 3MGQC 3UTBB 3B0BA 5B0ZD 3X1VC 4WZSB 3B0CW 3UT9B 3AZKA 2ZY3A 1M19B 3VH6A 3AZHC 3REIB 1P3IB 1P3LA 4J8WA 2YFWA 3IP4C 4H9SA 4WU9A 3B6GD 4J8VD 3A1IA 1P3GC 4E44A 2HIOB 5B33B 5AV6C 1ID3D 3AZLA 3W96B 3REHB 3AV2D 2PYOC 1N1JB 3MGSA 1P3MB 3WKJD 3KXBA 3RELD 1P3AD 4XZQD 1HQ3B 1P3KB 2NQBC 5AVBD 5B31D 3KUYD 3AYWA 1M18C 2F2AC 3MVDD 2IO5B 4CAYA 5B0YA 5FUGB 3AZFC 5CPIA 1S32B 5B32D 3LJAD 1P3OB 3AZGA 3LZ1B 1KX3C 5B1MB 3WTPA 3A6NC 5CPKC 1F66C 3KWQC 3AZJC 1PZRA 3UTBC 5AV5B 3MGRD 3C1CD 1TZYA 4AWLC 3W99A 5B1LC 4JJNA 3NQJA 5BNXA 3LELB 2Y2JA 1ID3B 3AZEC 4R8PD 2Y2HA 5GSUA 3REKD 3X1SB 5E5AD 3V9RA 5JRGB 4J8UA 2ZY4A 3RELB 4G91C 5DNMC 4HGAB 4YS3D 4G92B 1P3AB 5GT3C 4LD9C 1M1AD 1P3PB 4DQYB 3UTAD 3KUYB 4UUZA 3MNNA 2CWEA 5GXQC 3MVDB 3AZMA 1BFMA 3AFAC 3O62C 1EQZD 2VQRA 3AV1D 2Y2NA 1P34A 1S32C 3AN2B 5AV8C 1AOIC 3WTPE 4Z5TA 4YM6D 5AV9D 3MGQD 3REJD 3UT9A 2FFFB 5B2IC 1M19A 4WU8C 3REIA 1P3IA 5AY8C 4WNNB 2FJ7D 3AZHD 4X23C 2Y2IA 2HIOA 1TAFA 2Y2LA 5B33A 4R8PB 5F99C 3REKB 3C1BC 5CPIB 2F8ND 3W96A 3REHA 1HTAA 1N1JA 4YS3B 4NE3A 3WAAD 1A7WA 2PYOD 1HQ3A 1U35D 5JRGC 1P3KA 4Z2MH 1P3BB 3MGPA 5CP6C 2NQBD 1P3PC 1M18D 3X1TC 5FUGA 1EQZB 3AZKC 5BNXB 1P3LC 1P3OA 3AV1B 4J8WC 3LZ1A 4H9SC 4WU9C 5B1MA 3EPJA 2DF4C 1KX3D 5B40B 1WWIA 5B24B 3AZLC 5AV9B 5CPKD 3REJB 3AZND 3X1UD 2Y2KA 4WV4B 3MGSC 3KXBC 5AV5A 5DNND 3AZJD 2AROB 3MNNB 2FJ7B 3B6FB 3B6GA 3AYWC 2LY8A 1H3OB 4ZUXD 3LELA 3R45B 1ID3A 2Y2PA 3X1SA 5B0YC 1ZLAD 3WKJA 3RELA 3WAAB 5CPIC 1P3AA 5BS7A 4J8XC 2JCHA 3AZGC 5DNMD 3KUYA 4LD9D 4Z5TB 3WTPC 1P3FD 5BNVA 3AZID 3MVDA 5GXQD 4Z66B 5GT0B 2CV5D 3O62D 1TZYC 5CPJB 1TAFB 3W99C 1B6WA 4ZBJC 4JJNC 3AN2A 4XUJD 3A1KA 3VH6W 5AV8D 5GSUC 4KUDB 3AZNB 1AOID 2DQNC 4J8UC 2NZDD 3MGPB 2HUEB 2ZY5A 5B2ID 4WNNA 4H9OB 2JSSA 3MNNC 1KX5B 4X23D 4R8PA 3REKA 5E5AA 3AZMC 1ZLAB 5F99D 3C1BD 5KDMB 4YS3A 3FDDA 1KU5A 3W97B 1P3BA 3LZ0B 1P34C 4EO5C 5B2JD 5B0ZB 3AZIB 5B31G 5CP6D 3VH5W 2BYMB 4Z5TC 5BT1C 3UT9C 1EQZA 1Q9CA 3B6GB 4J8VB 2CV5B 3X1TD 1M19C 2F8NH 3REIC 3AZKD 1P3IC 4KGCD 3AV1A 5AVCD 2J8PA 5B32G 1P3LD 4J8WD 4WU9D 2HIOC 1KX4D 5B40A 3AV2B 5B24A 5B33C 3WKJB 4CSRB 4QLCD 4YM6A 5AV9A 4XZQB 3REJA 3W96C 3REHC 3AZLD 4H9RB 5AVBB 4DRAA 1P3MC 5B31B 2AROA 3MGSD 1HQ3C 1P3KC 2FJ7A 5BNVB 3F6TA 3B6FA 3MGPC 1H3OA 3R45A 3TU4D 3AYWD 2IO5C 4NFTA 3P5JB 2F8NA 5B32B 3LJAB 3W98D 4UPKA 3WAAA 5B0YD 2Y2OA 1U35A 1P3OC 1W2EA 3LZ1C 5B1MC 5B2JB 4J8XD 3AZGD 3WA9D 2F8NK 3X1VD 3MGRB 3C1CB 4Z66A 3B0DB
chains in the Genus database with same CATH topology
5GT0A 5AV5C 4KGCB 5CPJA 1P3GD 5E5AB 1KX4B 2YFVB 3LELC 4JJND 5AV6D 1ID3C 1R4VA 4QLCB 4KUDA 3X1SC 3AZNA 3X1UA 1M1AB 1T3UA 3UTAB 3RELC 5DNNA 1P3AC 4H9QB 4HGAC 5BS7C 4J8UD 4G92C 2ZM5A 4H9OA 3KUYC 4ZUXA 1KX5A 3TU4B 3MVDC 4NE5A 3H0LC 3AL0C 1ZLAA 3AZFD 3W98B 5KDMA 3AZMD 2F8NG 3W97A 3LZ0A 5C3IB 3A6ND 5B0ZA 3WA9B 1P3FA 4YM6B 3MGQB 3AN2C 2RIQA 3AZIA 3X1VB 4H9PB 1F66D 2BYMA 3KWQD 3UTBD 3AZHB 4J8VA 2CV5A 3UT9D 3EPKA 5B1LD 1P3GB 5G49B 1M19D 1B67A 3REID 3H0RC 5CHLB 1P3ID 2F8NB 4XUJA 3AZED 3AV2A 4M6BA 4R8PC 4CSRA 3REKC 3B0CT 4XZQA 5E5AC 1AOIA 1F1EA 5B33D 1U35B 2PYOB 2NZDA 2UWXA 4H9RA 5AVBA 5B31A 3W96D 4YS3C 2NQBB 2RVQC 5GT3D 1P3MD 1P3BC 1M18B 1JFIB 3AFAD 5B32A 3LJAA 1EQZC 3VH6T 1KX3B 3AV1C 1S32D 1Z2CB 5B2JA 1P3OD 5CPKB 5B1MD 3X1UB 5B40C 5B24C 1F66B 3KWQB 5DNNB 5AV9C 4YM6C 4Z2MG 3MGRA 3C1CA 3REJC 3AZJB 3X1TA 4WU8D 4AWLB 5AY8D 4KGCA 2AROC 5B1LB 5BO0B 4ZUXB 2FJ7C 5AVCA 3B6FC 5AV5D 1KX4A 2YFVA 3AZEB 4QLCA 3LELD 3EG5B 3VH5T 1M1AA 4G91B 5DNMB 3UTAA 3X1SD 3WAAC 5GT3B 4LD9B 4H9QA 5JRGD 1P3FB 1U35C 3EPHA 5GXQB 1P3PD 4KHAB 3TU4A 2Y2MA 3AFAB 3O62B 4Z66C 3W98A 4H9NB 5JA4B 5GT0C 4DRBA 3VH5A 2Y2QA 4XUJB 5CPJC 4J8XA 5AV8B 2G5HC 3WA9A 3MGQA 1AOIB 2NZDB 3X1VA 4H9PA 3AN2D 2L5AA 2ZY2A 4KUDC 3AZNC 5B2IB 3KSYA 3X1UC 2G5IC 4WU8B 3KXBD 3AZHA 5AY8B 1BH8B 5DNNC 2HUEC 4NE6A 4X23B 5G49A 1P3GA 3NQUB 4ZUXC 5AV6A 1KX5C 5F99B 3C1BB 2JE5A 2BYKA 2PYOA 3EPLA 1ZLAC 1BH9B 5CPID 2NQBA 3W97C 5CP6B 3LZ0C 2RVQD 3WTPD 1M18A 1JFIA 5B0ZC 1P3BD 1P3FC 3AZIC 3X1TB 3AZKB 3AZFA 5AVCB 2BG1A 3B6GC 4J8VC 2CV5C 1P3LB 1WWSA 1TZYD 2YFWB 3W99D 4J8WB 4WU9B 1KX3A 1ULYA 3A6NA 5CPKA 4XUJC 3AZLB 3AV2C 5GSUD 1F66A 3WKJC 3KWQA 5B40D 4XZQC 3AZJA 3MGSB 5B24D 3UTBA 2NZDC 5AVBC 3KXBB 5B31C 5B1LA 5BO0A 2W8SA 4E45A 3AYWB 2AROD 3MNND 3B6FD 3AZEA 4CAYB 5B0YB 5B32C 3LJAC 5DNMA 4J8XB 5GT3A 3AZGB 4LD9A 1P3MA 1P34D 2Y2GA 3WTPB 5B2JC 5GXQA 3H0MC 4KHAA 4Z5TD 5BT1D 3AFAA 3O62A 3MGRC 3C1CC 3B0DC 4WJ3C 4H9NA 4Z66D 5JA4A 1TZYB 2XD1A 3W99B 4KGCC 4JJNB 4ZBJB 5AV6B 3NQJB 5AVCC 5GT0D 1S32A 2XD5A 5AV8A 2BYKB 2HIOD 5CPJD 1KX4C 5GSUB 4QLCC 3REHD 3V9RB 4J8UB 5B2IA 1M1AC 3UTAC 4WU8A 4KUDD 5AY8A 1BH8A 1HQ3D 1P3KD 4UUZB 4X23A 3MGPD 3NQUA 5F99A 3AZFB 3KFUG 3TU4C 3C1BA 3AZMB 1KX5D 1BH9A 3W98C 3A6NB 5JRGA 3LZ1D 1P34B 4EO5B 5CP6A 5C3IC 3W97D 3WA9C 1P3PA 3LZ0D 3MGQC 3UTBB 3B0BA 5B0ZD 3X1VC 4WZSB 3B0CW 3UT9B 3AZKA 2ZY3A 1M19B 3VH6A 3AZHC 3REIB 1P3IB 1P3LA 4J8WA 2YFWA 3IP4C 4H9SA 4WU9A 3B6GD 4J8VD 3A1IA 1P3GC 4E44A 2HIOB 5B33B 5AV6C 1ID3D 3AZLA 3W96B 3REHB 3AV2D 2PYOC 1N1JB 3MGSA 1P3MB 3WKJD 3KXBA 3RELD 1P3AD 4XZQD 1HQ3B 1P3KB 2NQBC 5AVBD 5B31D 3KUYD 3AYWA 1M18C 2F2AC 3MVDD 2IO5B 4CAYA 5B0YA 5FUGB 3AZFC 5CPIA 1S32B 5B32D 3LJAD 1P3OB 3AZGA 3LZ1B 1KX3C 5B1MB 3WTPA 3A6NC 5CPKC 1F66C 3KWQC 3AZJC 1PZRA 3UTBC 5AV5B 3MGRD 3C1CD 1TZYA 4AWLC 3W99A 5B1LC 4JJNA 3NQJA 5BNXA 3LELB 2Y2JA 1ID3B 3AZEC 4R8PD 2Y2HA 5GSUA 3REKD 3X1SB 5E5AD 3V9RA 5JRGB 4J8UA 2ZY4A 3RELB 4G91C 5DNMC 4HGAB 4YS3D 4G92B 1P3AB 5GT3C 4LD9C 1M1AD 1P3PB 4DQYB 3UTAD 3KUYB 4UUZA 3MNNA 2CWEA 5GXQC 3MVDB 3AZMA 1BFMA 3AFAC 3O62C 1EQZD 2VQRA 3AV1D 2Y2NA 1P34A 1S32C 3AN2B 5AV8C 1AOIC 3WTPE 4Z5TA 4YM6D 5AV9D 3MGQD 3REJD 3UT9A 2FFFB 5B2IC 1M19A 4WU8C 3REIA 1P3IA 5AY8C 4WNNB 2FJ7D 3AZHD 4X23C 2Y2IA 2HIOA 1TAFA 2Y2LA 5B33A 4R8PB 5F99C 3REKB 3C1BC 5CPIB 2F8ND 3W96A 3REHA 1HTAA 1N1JA 4YS3B 4NE3A 3WAAD 1A7WA 2PYOD 1HQ3A 1U35D 5JRGC 1P3KA 4Z2MH 1P3BB 3MGPA 5CP6C 2NQBD 1P3PC 1M18D 3X1TC 5FUGA 1EQZB 3AZKC 5BNXB 1P3LC 1P3OA 3AV1B 4J8WC 3LZ1A 4H9SC 4WU9C 5B1MA 3EPJA 2DF4C 1KX3D 5B40B 1WWIA 5B24B 3AZLC 5AV9B 5CPKD 3REJB 3AZND 3X1UD 2Y2KA 4WV4B 3MGSC 3KXBC 5AV5A 5DNND 3AZJD 2AROB 3MNNB 2FJ7B 3B6FB 3B6GA 3AYWC 2LY8A 1H3OB 4ZUXD 3LELA 3R45B 1ID3A 2Y2PA 3X1SA 5B0YC 1ZLAD 3WKJA 3RELA 3WAAB 5CPIC 1P3AA 5BS7A 4J8XC 2JCHA 3AZGC 5DNMD 3KUYA 4LD9D 4Z5TB 3WTPC 1P3FD 5BNVA 3AZID 3MVDA 5GXQD 4Z66B 5GT0B 2CV5D 3O62D 1TZYC 5CPJB 1TAFB 3W99C 1B6WA 4ZBJC 4JJNC 3AN2A 4XUJD 3A1KA 3VH6W 5AV8D 5GSUC 4KUDB 3AZNB 1AOID 2DQNC 4J8UC 2NZDD 3MGPB 2HUEB 2ZY5A 5B2ID 4WNNA 4H9OB 2JSSA 3MNNC 1KX5B 4X23D 4R8PA 3REKA 5E5AA 3AZMC 1ZLAB 5F99D 3C1BD 5KDMB 4YS3A 3FDDA 1KU5A 3W97B 1P3BA 3LZ0B 1P34C 4EO5C 5B2JD 5B0ZB 3AZIB 5B31G 5CP6D 3VH5W 2BYMB 4Z5TC 5BT1C 3UT9C 1EQZA 1Q9CA 3B6GB 4J8VB 2CV5B 3X1TD 1M19C 2F8NH 3REIC 3AZKD 1P3IC 4KGCD 3AV1A 5AVCD 2J8PA 5B32G 1P3LD 4J8WD 4WU9D 2HIOC 1KX4D 5B40A 3AV2B 5B24A 5B33C 3WKJB 4CSRB 4QLCD 4YM6A 5AV9A 4XZQB 3REJA 3W96C 3REHC 3AZLD 4H9RB 5AVBB 4DRAA 1P3MC 5B31B 2AROA 3MGSD 1HQ3C 1P3KC 2FJ7A 5BNVB 3F6TA 3B6FA 3MGPC 1H3OA 3R45A 3TU4D 3AYWD 2IO5C 4NFTA 3P5JB 2F8NA 5B32B 3LJAB 3W98D 4UPKA 3WAAA 5B0YD 2Y2OA 1U35A 1P3OC 1W2EA 3LZ1C 5B1MC 5B2JB 4J8XD 3AZGD 3WA9D 2F8NK 3X1VD 3MGRB 3C1CB 4Z66A 3B0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 A;  5AV5 C;  4KGC B;  5CPJ A;  1P3G D;  5E5A B;  1KX4 B;  2YFV B;  3LEL C;  4JJN D;  5AV6 D;  1ID3 C;  1R4V A;  4QLC B;  4KUD A;  3X1S C;  3AZN A;  3X1U A;  1M1A B;  3UTA B;  3REL C;  5DNN A;  1P3A C;  4H9Q B;  4HGA C;  5BS7 C;  4J8U D;  4G92 C;  4H9O A;  3KUY C;  4ZUX A;  1KX5 A;  3TU4 B;  3MVD C;  4NE5 A;  1ZLA A;  3AZF D;  3W98 B;  5KDM A;  3AZM D;  2F8N G;  3W97 A;  3LZ0 A;  5C3I B;  3A6N D;  5B0Z A;  3WA9 B;  1P3F A;  4YM6 B;  3MGQ B;  3AN2 C;  3AZI A;  3X1V B;  4H9P B;  1F66 D;  2BYM A;  3KWQ D;  3UTB D;  3AZH B;  4J8V A;  2CV5 A;  3UT9 D;  5B1L D;  1P3G B;  5G49 B;  1M19 D;  1B67 A;  3REI D;  1P3I D;  5CHL B;  2F8N B;  4XUJ A;  3AZE D;  3AV2 A;  4M6B A;  4R8P C;  4CSR A;  3REK C;  3B0C T;  5E5A C;  4XZQ A;  1AOI A;  1F1E A;  5B33 D;  1U35 B;  2PYO B;  2NZD A;  4H9R A;  5AVB A;  5B31 A;  3W96 D;  4YS3 C;  2NQB B;  2RVQ C;  5GT3 D;  1P3M D;  1P3B C;  1M18 B;  1JFI B;  3AFA D;  5B32 A;  3LJA A;  1EQZ C;  3VH6 T;  1KX3 B;  3AV1 C;  1S32 D;  5B2J A;  1P3O D;  5CPK B;  5B1M D;  3X1U B;  5B40 C;  5B24 C;  1F66 B;  3KWQ B;  4YM6 C;  5DNN B;  5AV9 C;  4Z2M G;  3MGR A;  3C1C A;  3REJ C;  3AZJ B;  3X1T A;  4WU8 D;  4AWL B;  5AY8 D;  4KGC A;  2ARO C;  5B1L B;  5BO0 B;  4ZUX B;  2FJ7 C;  5AVC A;  3B6F C;  5AV5 D;  1KX4 A;  2YFV A;  3AZE B;  4QLC A;  3LEL D;  3VH5 T;  1M1A A;  4G91 B;  5DNM B;  3UTA A;  3X1S D;  3WAA C;  5GT3 B;  4LD9 B;  4H9Q A;  5JRG D;  1P3F B;  1U35 C;  5GXQ B;  1P3P D;  4KHA B;  3TU4 A;  3AFA B;  3O62 B;  4Z66 C;  3W98 A;  4H9N B;  5JA4 B;  5GT0 C;  4DRB A;  3VH5 A;  4XUJ B;  5CPJ C;  4J8X A;  5AV8 B;  3WA9 A;  3MGQ A;  1AOI B;  2NZD B;  3X1V A;  4H9P A;  3AN2 D;  2L5A A;  4KUD C;  3AZN C;  5B2I B;  3KSY A;  3X1U C;  3AZH A;  4WU8 B;  3KXB D;  5AY8 B;  1BH8 B;  5DNN C;  2HUE C;  4NE6 A;  4X23 B;  5G49 A;  1P3G A;  3NQU B;  4ZUX C;  5AV6 A;  1KX5 C;  5F99 B;  3C1B B;  2BYK A;  2PYO A;  1ZLA C;  1BH9 B;  5CPI D;  2NQB A;  3W97 C;  5CP6 B;  3LZ0 C;  2RVQ D;  3WTP D;  1M18 A;  1JFI A;  5B0Z C;  1P3B D;  1P3F C;  3AZI C;  3X1T B;  3AZK B;  3AZF A;  5AVC B;  3B6G C;  4J8V C;  2CV5 C;  1P3L B;  1WWS A;  1TZY D;  2YFW B;  3W99 D;  4J8W B;  4WU9 B;  1KX3 A;  1ULY A;  3A6N A;  5CPK A;  4XUJ C;  3AZL B;  3AV2 C;  5GSU D;  1F66 A;  3WKJ C;  3KWQ A;  5B40 D;  4XZQ C;  3AZJ A;  3MGS B;  5B24 D;  3UTB A;  2NZD C;  5AVB C;  3KXB B;  5B31 C;  5B1L A;  5BO0 A;  4E45 A;  3AYW B;  2ARO D;  3MNN D;  3B6F D;  3AZE A;  4CAY B;  5B0Y B;  5B32 C;  3LJA C;  5DNM A;  4J8X B;  5GT3 A;  3AZG B;  4LD9 A;  1P3M A;  1P34 D;  3WTP B;  5B2J C;  5GXQ A;  4KHA A;  4Z5T D;  5BT1 D;  3AFA A;  3O62 A;  3MGR C;  3C1C C;  3B0D C;  4H9N A;  4Z66 D;  5JA4 A;  1TZY B;  3W99 B;  4KGC C;  4JJN B;  4ZBJ B;  5AV6 B;  3NQJ B;  5AVC C;  5GT0 D;  1S32 A;  5AV8 A;  2BYK B;  2HIO D;  5CPJ D;  1KX4 C;  5GSU B;  4QLC C;  3REH D;  3V9R B;  4J8U B;  5B2I A;  1M1A C;  3UTA C;  4WU8 A;  4KUD D;  5AY8 A;  1BH8 A;  1HQ3 D;  1P3K D;  4UUZ B;  4X23 A;  3MGP D;  3NQU A;  5F99 A;  3AZF B;  3TU4 C;  3C1B A;  3AZM B;  1KX5 D;  1BH9 A;  3W98 C;  3A6N B;  5JRG A;  3LZ1 D;  1P34 B;  4EO5 B;  5CP6 A;  5C3I C;  3W97 D;  3WA9 C;  1P3P A;  3LZ0 D;  3MGQ C;  3UTB B;  3B0B A;  5B0Z D;  3X1V C;  4WZS B;  3B0C W;  3UT9 B;  3AZK A;  1M19 B;  3VH6 A;  3AZH C;  3REI B;  1P3I B;  1P3L A;  4J8W A;  2YFW A;  4H9S A;  4WU9 A;  3B6G D;  4J8V D;  1P3G C;  4E44 A;  2HIO B;  5B33 B;  5AV6 C;  1ID3 D;  3AZL A;  3W96 B;  3REH B;  3AV2 D;  2PYO C;  1N1J B;  3MGS A;  1P3M B;  3WKJ D;  3KXB A;  3REL D;  1P3A D;  4XZQ D;  1HQ3 B;  1P3K B;  2NQB C;  5AVB D;  5B31 D;  3KUY D;  3AYW A;  1M18 C;  3MVD D;  2IO5 B;  4CAY A;  5B0Y A;  5FUG B;  3AZF C;  5CPI A;  1S32 B;  5B32 D;  3LJA D;  1P3O B;  3AZG A;  3LZ1 B;  1KX3 C;  5B1M B;  3WTP A;  3A6N C;  5CPK C;  1F66 C;  3KWQ C;  3AZJ C;  3UTB C;  5AV5 B;  3MGR D;  3C1C D;  1TZY A;  4AWL C;  3W99 A;  5B1L C;  4JJN A;  3NQJ A;  5BNX A;  3LEL B;  1ID3 B;  3AZE C;  4R8P D;  5GSU A;  3REK D;  3X1S B;  5E5A D;  3V9R A;  5JRG B;  4J8U A;  3REL B;  4G91 C;  5DNM C;  4HGA B;  4YS3 D;  4G92 B;  1P3A B;  5GT3 C;  4LD9 C;  1M1A D;  1P3P B;  3UTA D;  3KUY B;  4UUZ A;  3MNN A;  2CWE A;  5GXQ C;  3MVD B;  3AZM A;  1BFM A;  3AFA C;  3O62 C;  1EQZ D;  3AV1 D;  1P34 A;  1S32 C;  3AN2 B;  5AV8 C;  1AOI C;  3WTP E;  4Z5T A;  4YM6 D;  5AV9 D;  3MGQ D;  3REJ D;  3UT9 A;  5B2I C;  1M19 A;  4WU8 C;  3REI A;  1P3I A;  5AY8 C;  4WNN B;  2FJ7 D;  3AZH D;  4X23 C;  2HIO A;  1TAF A;  5B33 A;  4R8P B;  5F99 C;  3REK B;  3C1B C;  5CPI B;  2F8N D;  3W96 A;  3REH A;  1HTA A;  1N1J A;  4YS3 B;  4NE3 A;  3WAA D;  1A7W A;  2PYO D;  1HQ3 A;  1U35 D;  5JRG C;  1P3K A;  4Z2M H;  1P3B B;  3MGP A;  5CP6 C;  2NQB D;  1P3P C;  1M18 D;  3X1T C;  5FUG A;  1EQZ B;  3AZK C;  5BNX B;  1P3L C;  1P3O A;  3AV1 B;  4J8W C;  3LZ1 A;  4H9S C;  4WU9 C;  5B1M A;  1KX3 D;  5B40 B;  1WWI A;  5B24 B;  3AZL C;  5AV9 B;  5CPK D;  3REJ B;  3AZN D;  3X1U D;  4WV4 B;  3MGS C;  3KXB C;  5AV5 A;  5DNN D;  3AZJ D;  2ARO B;  3MNN B;  2FJ7 B;  3B6F B;  3B6G A;  3AYW C;  2LY8 A;  1H3O B;  4ZUX D;  3LEL A;  3R45 B;  1ID3 A;  3X1S A;  5B0Y C;  1ZLA D;  3WKJ A;  3REL A;  3WAA B;  5CPI C;  1P3A A;  5BS7 A;  4J8X C;  3AZG C;  5DNM D;  3KUY A;  4LD9 D;  4Z5T B;  3WTP C;  1P3F D;  5BNV A;  3AZI D;  3MVD A;  5GXQ D;  4Z66 B;  5GT0 B;  2CV5 D;  3O62 D;  1TZY C;  5CPJ B;  1TAF B;  3W99 C;  1B6W A;  4ZBJ C;  4JJN C;  3AN2 A;  4XUJ D;  3VH6 W;  5AV8 D;  5GSU C;  4KUD B;  3AZN B;  1AOI D;  4J8U C;  2NZD D;  3MGP B;  2HUE B;  5B2I D;  4WNN A;  4H9O B;  2JSS A;  3MNN C;  1KX5 B;  4X23 D;  4R8P A;  3REK A;  5E5A A;  3AZM C;  1ZLA B;  5F99 D;  3C1B D;  5KDM B;  4YS3 A;  3W97 B;  1KU5 A;  1P3B A;  3LZ0 B;  1P34 C;  4EO5 C;  5B2J D;  5B0Z B;  3AZI B;  5B31 G;  5CP6 D;  3VH5 W;  2BYM B;  4Z5T C;  5BT1 C;  3UT9 C;  1EQZ A;  1Q9C A;  3B6G B;  4J8V B;  2CV5 B;  3X1T D;  1M19 C;  2F8N H;  3REI C;  3AZK D;  1P3I C;  4KGC D;  3AV1 A;  5AVC D;  5B32 G;  1P3L D;  4J8W D;  4WU9 D;  2HIO C;  1KX4 D;  5B40 A;  3AV2 B;  5B24 A;  5B33 C;  3WKJ B;  4CSR B;  4QLC D;  4YM6 A;  5AV9 A;  4XZQ B;  3REJ A;  3W96 C;  3REH C;  3AZL D;  4H9R B;  5AVB B;  4DRA A;  1P3M C;  5B31 B;  2ARO A;  3MGS D;  1HQ3 C;  1P3K C;  2FJ7 A;  5BNV B;  3B6F A;  3MGP C;  1H3O A;  3R45 A;  3TU4 D;  3AYW D;  2IO5 C;  4NFT A;  2F8N A;  5B32 B;  3LJA B;  3W98 D;  3WAA A;  5B0Y D;  1U35 A;  1P3O C;  3LZ1 C;  5B1M C;  5B2J B;  4J8X D;  3AZG D;  3WA9 D;  2F8N K;  3X1V D;  3MGR B;  3C1C B;  4Z66 A;  3B0D B; 
#chains in the Genus database with same CATH topology
 5GT0 A;  5AV5 C;  4KGC B;  5CPJ A;  1P3G D;  5E5A B;  1KX4 B;  2YFV B;  3LEL C;  4JJN D;  5AV6 D;  1ID3 C;  1R4V A;  4QLC B;  4KUD A;  3X1S C;  3AZN A;  3X1U A;  1M1A B;  1T3U A;  3UTA B;  3REL C;  5DNN A;  1P3A C;  4H9Q B;  4HGA C;  5BS7 C;  4J8U D;  4G92 C;  2ZM5 A;  4H9O A;  3KUY C;  4ZUX A;  1KX5 A;  3TU4 B;  3MVD C;  4NE5 A;  3H0L C;  3AL0 C;  1ZLA A;  3AZF D;  3W98 B;  5KDM A;  3AZM D;  2F8N G;  3W97 A;  3LZ0 A;  5C3I B;  3A6N D;  5B0Z A;  3WA9 B;  1P3F A;  4YM6 B;  3MGQ B;  3AN2 C;  2RIQ A;  3AZI A;  3X1V B;  4H9P B;  1F66 D;  2BYM A;  3KWQ D;  3UTB D;  3AZH B;  4J8V A;  2CV5 A;  3UT9 D;  3EPK A;  5B1L D;  1P3G B;  5G49 B;  1M19 D;  1B67 A;  3REI D;  3H0R C;  5CHL B;  1P3I D;  2F8N B;  4XUJ A;  3AZE D;  3AV2 A;  4M6B A;  4R8P C;  4CSR A;  3REK C;  3B0C T;  4XZQ A;  5E5A C;  1AOI A;  1F1E A;  5B33 D;  1U35 B;  2PYO B;  2NZD A;  2UWX A;  4H9R A;  5AVB A;  5B31 A;  3W96 D;  4YS3 C;  2NQB B;  2RVQ C;  5GT3 D;  1P3M D;  1P3B C;  1M18 B;  1JFI B;  3AFA D;  5B32 A;  3LJA A;  1EQZ C;  3VH6 T;  1KX3 B;  3AV1 C;  1S32 D;  1Z2C B;  5B2J A;  1P3O D;  5CPK B;  5B1M D;  3X1U B;  5B40 C;  5B24 C;  1F66 B;  3KWQ B;  5DNN B;  5AV9 C;  4YM6 C;  4Z2M G;  3MGR A;  3C1C A;  3REJ C;  3AZJ B;  3X1T A;  4WU8 D;  4AWL B;  5AY8 D;  4KGC A;  2ARO C;  5B1L B;  5BO0 B;  4ZUX B;  2FJ7 C;  5AVC A;  3B6F C;  5AV5 D;  1KX4 A;  2YFV A;  3AZE B;  4QLC A;  3LEL D;  3EG5 B;  3VH5 T;  1M1A A;  4G91 B;  5DNM B;  3UTA A;  3X1S D;  3WAA C;  5GT3 B;  4LD9 B;  4H9Q A;  5JRG D;  1P3F B;  1U35 C;  3EPH A;  5GXQ B;  1P3P D;  4KHA B;  3TU4 A;  2Y2M A;  3AFA B;  3O62 B;  4Z66 C;  3W98 A;  4H9N B;  5JA4 B;  5GT0 C;  4DRB A;  3VH5 A;  2Y2Q A;  4XUJ B;  5CPJ C;  4J8X A;  5AV8 B;  2G5H C;  3WA9 A;  3MGQ A;  1AOI B;  2NZD B;  3X1V A;  4H9P A;  3AN2 D;  2L5A A;  2ZY2 A;  4KUD C;  3AZN C;  5B2I B;  3KSY A;  3X1U C;  2G5I C;  4WU8 B;  3KXB D;  3AZH A;  5AY8 B;  1BH8 B;  5DNN C;  2HUE C;  4NE6 A;  4X23 B;  5G49 A;  1P3G A;  3NQU B;  4ZUX C;  5AV6 A;  1KX5 C;  5F99 B;  3C1B B;  2JE5 A;  2BYK A;  2PYO A;  3EPL A;  1ZLA C;  1BH9 B;  5CPI D;  2NQB A;  3W97 C;  5CP6 B;  3LZ0 C;  2RVQ D;  3WTP D;  1M18 A;  1JFI A;  5B0Z C;  1P3B D;  1P3F C;  3AZI C;  3X1T B;  3AZK B;  3AZF A;  5AVC B;  2BG1 A;  3B6G C;  4J8V C;  2CV5 C;  1P3L B;  1WWS A;  1TZY D;  2YFW B;  3W99 D;  4J8W B;  4WU9 B;  1KX3 A;  1ULY A;  3A6N A;  5CPK A;  4XUJ C;  3AZL B;  3AV2 C;  5GSU D;  1F66 A;  3WKJ C;  3KWQ A;  5B40 D;  4XZQ C;  3AZJ A;  3MGS B;  5B24 D;  3UTB A;  2NZD C;  5AVB C;  3KXB B;  5B31 C;  5B1L A;  5BO0 A;  2W8S A;  4E45 A;  3AYW B;  2ARO D;  3MNN D;  3B6F D;  3AZE A;  4CAY B;  5B0Y B;  5B32 C;  3LJA C;  5DNM A;  4J8X B;  5GT3 A;  3AZG B;  4LD9 A;  1P3M A;  1P34 D;  2Y2G A;  3WTP B;  5B2J C;  5GXQ A;  3H0M C;  4KHA A;  4Z5T D;  5BT1 D;  3AFA A;  3O62 A;  3MGR C;  3C1C C;  3B0D C;  4WJ3 C;  4H9N A;  4Z66 D;  5JA4 A;  1TZY B;  2XD1 A;  3W99 B;  4KGC C;  4JJN B;  4ZBJ B;  5AV6 B;  3NQJ B;  5AVC C;  5GT0 D;  1S32 A;  2XD5 A;  5AV8 A;  2BYK B;  2HIO D;  5CPJ D;  1KX4 C;  5GSU B;  4QLC C;  3REH D;  3V9R B;  4J8U B;  5B2I A;  1M1A C;  3UTA C;  4WU8 A;  4KUD D;  5AY8 A;  1BH8 A;  1HQ3 D;  1P3K D;  4UUZ B;  4X23 A;  3MGP D;  3NQU A;  5F99 A;  3AZF B;  3KFU G;  3TU4 C;  3C1B A;  3AZM B;  1KX5 D;  1BH9 A;  3W98 C;  3A6N B;  5JRG A;  3LZ1 D;  1P34 B;  4EO5 B;  5CP6 A;  5C3I C;  3W97 D;  3WA9 C;  1P3P A;  3LZ0 D;  3MGQ C;  3UTB B;  3B0B A;  5B0Z D;  3X1V C;  4WZS B;  3B0C W;  3UT9 B;  3AZK A;  2ZY3 A;  1M19 B;  3VH6 A;  3AZH C;  3REI B;  1P3I B;  1P3L A;  4J8W A;  2YFW A;  3IP4 C;  4H9S A;  4WU9 A;  3B6G D;  4J8V D;  3A1I A;  1P3G C;  4E44 A;  2HIO B;  5B33 B;  5AV6 C;  1ID3 D;  3AZL A;  3W96 B;  3REH B;  3AV2 D;  2PYO C;  1N1J B;  3MGS A;  1P3M B;  3WKJ D;  3KXB A;  3REL D;  1P3A D;  4XZQ D;  1HQ3 B;  1P3K B;  2NQB C;  5AVB D;  5B31 D;  3KUY D;  3AYW A;  1M18 C;  2F2A C;  3MVD D;  2IO5 B;  4CAY A;  5B0Y A;  5FUG B;  3AZF C;  5CPI A;  1S32 B;  5B32 D;  3LJA D;  1P3O B;  3AZG A;  3LZ1 B;  1KX3 C;  5B1M B;  3WTP A;  3A6N C;  5CPK C;  1F66 C;  3KWQ C;  3AZJ C;  1PZR A;  3UTB C;  5AV5 B;  3MGR D;  3C1C D;  1TZY A;  4AWL C;  3W99 A;  5B1L C;  4JJN A;  3NQJ A;  5BNX A;  3LEL B;  2Y2J A;  1ID3 B;  3AZE C;  4R8P D;  2Y2H A;  5GSU A;  3REK D;  3X1S B;  5E5A D;  3V9R A;  5JRG B;  4J8U A;  2ZY4 A;  3REL B;  4G91 C;  5DNM C;  4HGA B;  4YS3 D;  4G92 B;  1P3A B;  5GT3 C;  4LD9 C;  1M1A D;  1P3P B;  4DQY B;  3UTA D;  3KUY B;  4UUZ A;  3MNN A;  2CWE A;  5GXQ C;  3MVD B;  3AZM A;  1BFM A;  3AFA C;  3O62 C;  1EQZ D;  2VQR A;  3AV1 D;  2Y2N A;  1P34 A;  1S32 C;  3AN2 B;  5AV8 C;  1AOI C;  3WTP E;  4Z5T A;  4YM6 D;  5AV9 D;  3MGQ D;  3REJ D;  3UT9 A;  2FFF B;  5B2I C;  1M19 A;  4WU8 C;  3REI A;  1P3I A;  5AY8 C;  4WNN B;  2FJ7 D;  3AZH D;  4X23 C;  2Y2I A;  2HIO A;  1TAF A;  2Y2L A;  5B33 A;  4R8P B;  5F99 C;  3REK B;  3C1B C;  5CPI B;  2F8N D;  3W96 A;  3REH A;  1HTA A;  1N1J A;  4YS3 B;  4NE3 A;  3WAA D;  1A7W A;  2PYO D;  1HQ3 A;  1U35 D;  5JRG C;  1P3K A;  4Z2M H;  1P3B B;  3MGP A;  5CP6 C;  2NQB D;  1P3P C;  1M18 D;  3X1T C;  5FUG A;  1EQZ B;  3AZK C;  5BNX B;  1P3L C;  1P3O A;  3AV1 B;  4J8W C;  3LZ1 A;  4H9S C;  4WU9 C;  5B1M A;  3EPJ A;  2DF4 C;  1KX3 D;  5B40 B;  1WWI A;  5B24 B;  3AZL C;  5AV9 B;  5CPK D;  3REJ B;  3AZN D;  3X1U D;  2Y2K A;  4WV4 B;  3MGS C;  3KXB C;  5AV5 A;  5DNN D;  3AZJ D;  2ARO B;  3MNN B;  2FJ7 B;  3B6F B;  3B6G A;  3AYW C;  2LY8 A;  1H3O B;  4ZUX D;  3LEL A;  3R45 B;  1ID3 A;  2Y2P A;  3X1S A;  5B0Y C;  1ZLA D;  3WKJ A;  3REL A;  3WAA B;  5CPI C;  1P3A A;  5BS7 A;  4J8X C;  2JCH A;  3AZG C;  5DNM D;  3KUY A;  4LD9 D;  4Z5T B;  3WTP C;  1P3F D;  5BNV A;  3AZI D;  3MVD A;  5GXQ D;  4Z66 B;  5GT0 B;  2CV5 D;  3O62 D;  1TZY C;  5CPJ B;  1TAF B;  3W99 C;  1B6W A;  4ZBJ C;  4JJN C;  3AN2 A;  4XUJ D;  3A1K A;  3VH6 W;  5AV8 D;  5GSU C;  4KUD B;  3AZN B;  1AOI D;  2DQN C;  4J8U C;  2NZD D;  3MGP B;  2HUE B;  2ZY5 A;  5B2I D;  4WNN A;  4H9O B;  2JSS A;  3MNN C;  1KX5 B;  4X23 D;  4R8P A;  3REK A;  5E5A A;  3AZM C;  1ZLA B;  5F99 D;  3C1B D;  5KDM B;  4YS3 A;  3FDD A;  1KU5 A;  3W97 B;  1P3B A;  3LZ0 B;  1P34 C;  4EO5 C;  5B2J D;  5B0Z B;  3AZI B;  5B31 G;  5CP6 D;  3VH5 W;  2BYM B;  4Z5T C;  5BT1 C;  3UT9 C;  1EQZ A;  1Q9C A;  3B6G B;  4J8V B;  2CV5 B;  3X1T D;  1M19 C;  2F8N H;  3REI C;  3AZK D;  1P3I C;  4KGC D;  3AV1 A;  5AVC D;  2J8P A;  5B32 G;  1P3L D;  4J8W D;  4WU9 D;  2HIO C;  1KX4 D;  5B40 A;  3AV2 B;  5B24 A;  5B33 C;  3WKJ B;  4CSR B;  4QLC D;  4YM6 A;  5AV9 A;  4XZQ B;  3REJ A;  3W96 C;  3REH C;  3AZL D;  4H9R B;  5AVB B;  4DRA A;  1P3M C;  5B31 B;  2ARO A;  3MGS D;  1HQ3 C;  1P3K C;  2FJ7 A;  5BNV B;  3F6T A;  3B6F A;  3MGP C;  1H3O A;  3R45 A;  3TU4 D;  3AYW D;  2IO5 C;  4NFT A;  3P5J B;  2F8N A;  5B32 B;  3LJA B;  3W98 D;  4UPK A;  3WAA A;  5B0Y D;  2Y2O A;  1U35 A;  1P3O C;  1W2E A;  3LZ1 C;  5B1M C;  5B2J B;  4J8X D;  3AZG D;  3WA9 D;  2F8N K;  3X1V D;  3MGR B;  3C1C B;  4Z66 A;  3B0D B; 
#chains in the Genus database with same CATH homology
 5GT0 A;  5AV5 C;  4KGC B;  5CPJ A;  1P3G D;  5E5A B;  1KX4 B;  2YFV B;  3LEL C;  4JJN D;  5AV6 D;  1ID3 C;  1R4V A;  4QLC B;  4KUD A;  3X1S C;  3AZN A;  3X1U A;  1M1A B;  1T3U A;  3UTA B;  3REL C;  5DNN A;  1P3A C;  4H9Q B;  4HGA C;  5BS7 C;  4J8U D;  4G92 C;  2ZM5 A;  4H9O A;  3KUY C;  4ZUX A;  1KX5 A;  3TU4 B;  3MVD C;  4NE5 A;  3H0L C;  3AL0 C;  1ZLA A;  3AZF D;  3W98 B;  5KDM A;  3AZM D;  2F8N G;  3W97 A;  3LZ0 A;  5C3I B;  3A6N D;  5B0Z A;  3WA9 B;  1P3F A;  4YM6 B;  3MGQ B;  3AN2 C;  2RIQ A;  3AZI A;  3X1V B;  4H9P B;  1F66 D;  2BYM A;  3KWQ D;  3UTB D;  3AZH B;  4J8V A;  2CV5 A;  3UT9 D;  3EPK A;  5B1L D;  1P3G B;  5G49 B;  1M19 D;  1B67 A;  3REI D;  3H0R C;  5CHL B;  1P3I D;  2F8N B;  4XUJ A;  3AZE D;  3AV2 A;  4M6B A;  4R8P C;  4CSR A;  3REK C;  3B0C T;  4XZQ A;  5E5A C;  1AOI A;  1F1E A;  5B33 D;  1U35 B;  2PYO B;  2NZD A;  2UWX A;  4H9R A;  5AVB A;  5B31 A;  3W96 D;  4YS3 C;  2NQB B;  2RVQ C;  5GT3 D;  1P3M D;  1P3B C;  1M18 B;  1JFI B;  3AFA D;  5B32 A;  3LJA A;  1EQZ C;  3VH6 T;  1KX3 B;  3AV1 C;  1S32 D;  1Z2C B;  5B2J A;  1P3O D;  5CPK B;  5B1M D;  3X1U B;  5B40 C;  5B24 C;  1F66 B;  3KWQ B;  5DNN B;  5AV9 C;  4YM6 C;  4Z2M G;  3MGR A;  3C1C A;  3REJ C;  3AZJ B;  3X1T A;  4WU8 D;  4AWL B;  5AY8 D;  4KGC A;  2ARO C;  5B1L B;  5BO0 B;  4ZUX B;  2FJ7 C;  5AVC A;  3B6F C;  5AV5 D;  1KX4 A;  2YFV A;  3AZE B;  4QLC A;  3LEL D;  3EG5 B;  3VH5 T;  1M1A A;  4G91 B;  5DNM B;  3UTA A;  3X1S D;  3WAA C;  5GT3 B;  4LD9 B;  4H9Q A;  5JRG D;  1P3F B;  1U35 C;  3EPH A;  5GXQ B;  1P3P D;  4KHA B;  3TU4 A;  2Y2M A;  3AFA B;  3O62 B;  4Z66 C;  3W98 A;  4H9N B;  5JA4 B;  5GT0 C;  4DRB A;  3VH5 A;  2Y2Q A;  4XUJ B;  5CPJ C;  4J8X A;  5AV8 B;  2G5H C;  3WA9 A;  3MGQ A;  1AOI B;  2NZD B;  3X1V A;  4H9P A;  3AN2 D;  2L5A A;  2ZY2 A;  4KUD C;  3AZN C;  5B2I B;  3KSY A;  3X1U C;  2G5I C;  4WU8 B;  3KXB D;  3AZH A;  5AY8 B;  1BH8 B;  5DNN C;  2HUE C;  4NE6 A;  4X23 B;  5G49 A;  1P3G A;  3NQU B;  4ZUX C;  5AV6 A;  1KX5 C;  5F99 B;  3C1B B;  2JE5 A;  2BYK A;  2PYO A;  3EPL A;  1ZLA C;  1BH9 B;  5CPI D;  2NQB A;  3W97 C;  5CP6 B;  3LZ0 C;  2RVQ D;  3WTP D;  1M18 A;  1JFI A;  5B0Z C;  1P3B D;  1P3F C;  3AZI C;  3X1T B;  3AZK B;  3AZF A;  5AVC B;  2BG1 A;  3B6G C;  4J8V C;  2CV5 C;  1P3L B;  1WWS A;  1TZY D;  2YFW B;  3W99 D;  4J8W B;  4WU9 B;  1KX3 A;  1ULY A;  3A6N A;  5CPK A;  4XUJ C;  3AZL B;  3AV2 C;  5GSU D;  1F66 A;  3WKJ C;  3KWQ A;  5B40 D;  4XZQ C;  3AZJ A;  3MGS B;  5B24 D;  3UTB A;  2NZD C;  5AVB C;  3KXB B;  5B31 C;  5B1L A;  5BO0 A;  2W8S A;  4E45 A;  3AYW B;  2ARO D;  3MNN D;  3B6F D;  3AZE A;  4CAY B;  5B0Y B;  5B32 C;  3LJA C;  5DNM A;  4J8X B;  5GT3 A;  3AZG B;  4LD9 A;  1P3M A;  1P34 D;  2Y2G A;  3WTP B;  5B2J C;  5GXQ A;  3H0M C;  4KHA A;  4Z5T D;  5BT1 D;  3AFA A;  3O62 A;  3MGR C;  3C1C C;  3B0D C;  4WJ3 C;  4H9N A;  4Z66 D;  5JA4 A;  1TZY B;  2XD1 A;  3W99 B;  4KGC C;  4JJN B;  4ZBJ B;  5AV6 B;  3NQJ B;  5AVC C;  5GT0 D;  1S32 A;  2XD5 A;  5AV8 A;  2BYK B;  2HIO D;  5CPJ D;  1KX4 C;  5GSU B;  4QLC C;  3REH D;  3V9R B;  4J8U B;  5B2I A;  1M1A C;  3UTA C;  4WU8 A;  4KUD D;  5AY8 A;  1BH8 A;  1HQ3 D;  1P3K D;  4UUZ B;  4X23 A;  3MGP D;  3NQU A;  5F99 A;  3AZF B;  3KFU G;  3TU4 C;  3C1B A;  3AZM B;  1KX5 D;  1BH9 A;  3W98 C;  3A6N B;  5JRG A;  3LZ1 D;  1P34 B;  4EO5 B;  5CP6 A;  5C3I C;  3W97 D;  3WA9 C;  1P3P A;  3LZ0 D;  3MGQ C;  3UTB B;  3B0B A;  5B0Z D;  3X1V C;  4WZS B;  3B0C W;  3UT9 B;  3AZK A;  2ZY3 A;  1M19 B;  3VH6 A;  3AZH C;  3REI B;  1P3I B;  1P3L A;  4J8W A;  2YFW A;  3IP4 C;  4H9S A;  4WU9 A;  3B6G D;  4J8V D;  3A1I A;  1P3G C;  4E44 A;  2HIO B;  5B33 B;  5AV6 C;  1ID3 D;  3AZL A;  3W96 B;  3REH B;  3AV2 D;  2PYO C;  1N1J B;  3MGS A;  1P3M B;  3WKJ D;  3KXB A;  3REL D;  1P3A D;  4XZQ D;  1HQ3 B;  1P3K B;  2NQB C;  5AVB D;  5B31 D;  3KUY D;  3AYW A;  1M18 C;  2F2A C;  3MVD D;  2IO5 B;  4CAY A;  5B0Y A;  5FUG B;  3AZF C;  5CPI A;  1S32 B;  5B32 D;  3LJA D;  1P3O B;  3AZG A;  3LZ1 B;  1KX3 C;  5B1M B;  3WTP A;  3A6N C;  5CPK C;  1F66 C;  3KWQ C;  3AZJ C;  1PZR A;  3UTB C;  5AV5 B;  3MGR D;  3C1C D;  1TZY A;  4AWL C;  3W99 A;  5B1L C;  4JJN A;  3NQJ A;  5BNX A;  3LEL B;  2Y2J A;  1ID3 B;  3AZE C;  4R8P D;  2Y2H A;  5GSU A;  3REK D;  3X1S B;  5E5A D;  3V9R A;  5JRG B;  4J8U A;  2ZY4 A;  3REL B;  4G91 C;  5DNM C;  4HGA B;  4YS3 D;  4G92 B;  1P3A B;  5GT3 C;  4LD9 C;  1M1A D;  1P3P B;  4DQY B;  3UTA D;  3KUY B;  4UUZ A;  3MNN A;  2CWE A;  5GXQ C;  3MVD B;  3AZM A;  1BFM A;  3AFA C;  3O62 C;  1EQZ D;  2VQR A;  3AV1 D;  2Y2N A;  1P34 A;  1S32 C;  3AN2 B;  5AV8 C;  1AOI C;  3WTP E;  4Z5T A;  4YM6 D;  5AV9 D;  3MGQ D;  3REJ D;  3UT9 A;  2FFF B;  5B2I C;  1M19 A;  4WU8 C;  3REI A;  1P3I A;  5AY8 C;  4WNN B;  2FJ7 D;  3AZH D;  4X23 C;  2Y2I A;  2HIO A;  1TAF A;  2Y2L A;  5B33 A;  4R8P B;  5F99 C;  3REK B;  3C1B C;  5CPI B;  2F8N D;  3W96 A;  3REH A;  1HTA A;  1N1J A;  4YS3 B;  4NE3 A;  3WAA D;  1A7W A;  2PYO D;  1HQ3 A;  1U35 D;  5JRG C;  1P3K A;  4Z2M H;  1P3B B;  3MGP A;  5CP6 C;  2NQB D;  1P3P C;  1M18 D;  3X1T C;  5FUG A;  1EQZ B;  3AZK C;  5BNX B;  1P3L C;  1P3O A;  3AV1 B;  4J8W C;  3LZ1 A;  4H9S C;  4WU9 C;  5B1M A;  3EPJ A;  2DF4 C;  1KX3 D;  5B40 B;  1WWI A;  5B24 B;  3AZL C;  5AV9 B;  5CPK D;  3REJ B;  3AZN D;  3X1U D;  2Y2K A;  4WV4 B;  3MGS C;  3KXB C;  5AV5 A;  5DNN D;  3AZJ D;  2ARO B;  3MNN B;  2FJ7 B;  3B6F B;  3B6G A;  3AYW C;  2LY8 A;  1H3O B;  4ZUX D;  3LEL A;  3R45 B;  1ID3 A;  2Y2P A;  3X1S A;  5B0Y C;  1ZLA D;  3WKJ A;  3REL A;  3WAA B;  5CPI C;  1P3A A;  5BS7 A;  4J8X C;  2JCH A;  3AZG C;  5DNM D;  3KUY A;  4LD9 D;  4Z5T B;  3WTP C;  1P3F D;  5BNV A;  3AZI D;  3MVD A;  5GXQ D;  4Z66 B;  5GT0 B;  2CV5 D;  3O62 D;  1TZY C;  5CPJ B;  1TAF B;  3W99 C;  1B6W A;  4ZBJ C;  4JJN C;  3AN2 A;  4XUJ D;  3A1K A;  3VH6 W;  5AV8 D;  5GSU C;  4KUD B;  3AZN B;  1AOI D;  2DQN C;  4J8U C;  2NZD D;  3MGP B;  2HUE B;  2ZY5 A;  5B2I D;  4WNN A;  4H9O B;  2JSS A;  3MNN C;  1KX5 B;  4X23 D;  4R8P A;  3REK A;  5E5A A;  3AZM C;  1ZLA B;  5F99 D;  3C1B D;  5KDM B;  4YS3 A;  3FDD A;  1KU5 A;  3W97 B;  1P3B A;  3LZ0 B;  1P34 C;  4EO5 C;  5B2J D;  5B0Z B;  3AZI B;  5B31 G;  5CP6 D;  3VH5 W;  2BYM B;  4Z5T C;  5BT1 C;  3UT9 C;  1EQZ A;  1Q9C A;  3B6G B;  4J8V B;  2CV5 B;  3X1T D;  1M19 C;  2F8N H;  3REI C;  3AZK D;  1P3I C;  4KGC D;  3AV1 A;  5AVC D;  2J8P A;  5B32 G;  1P3L D;  4J8W D;  4WU9 D;  2HIO C;  1KX4 D;  5B40 A;  3AV2 B;  5B24 A;  5B33 C;  3WKJ B;  4CSR B;  4QLC D;  4YM6 A;  5AV9 A;  4XZQ B;  3REJ A;  3W96 C;  3REH C;  3AZL D;  4H9R B;  5AVB B;  4DRA A;  1P3M C;  5B31 B;  2ARO A;  3MGS D;  1HQ3 C;  1P3K C;  2FJ7 A;  5BNV B;  3F6T A;  3B6F A;  3MGP C;  1H3O A;  3R45 A;  3TU4 D;  3AYW D;  2IO5 C;  4NFT A;  3P5J B;  2F8N A;  5B32 B;  3LJA B;  3W98 D;  4UPK A;  3WAA A;  5B0Y D;  2Y2O A;  1U35 A;  1P3O C;  1W2E A;  3LZ1 C;  5B1M C;  5B2J B;  4J8X D;  3AZG D;  3WA9 D;  2F8N K;  3X1V D;  3MGR B;  3C1C B;  4Z66 A;  3B0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...