3LJAD

Using soft x-rays for a detailed picture of divalent metal binding in the nucleosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ljaD00
3AZKA 5AV6B 3X1SD 3W98C 3VH5T 4WNNA 5AV5B 5AV8C 3AZMB 4G92B 4XZQC 5GSUC 4J8XB 5AV9D 3MNNA 3AZHC 3X1TA 1P3IA 4WU8B 5B2JD 5CPKA 1F66D 2HIOD 5GXQA 5AY8A 5GT0A 2HUEC 4KUDC 5JA4B 4J8UA 3MGQB 3A6ND 1P3MA 4Z5TD 3R45A 3AZIA 3KWQB 2CWEA 3REKC 3RELB 3W99D 3LJAC 1P3BD 3C1BB 5AVBB 5B0YD 5BT1D 3REIA 1P3KD 3W96B 4XUJD 5B33B 4J8WD 3B6GD 3X1SC 1M19D 3AZNB 5DNNC 1ZLAB 5CP6B 3AZJB 2JSSA 3TU4D 5CPJA 2BYKB 3AZGA 3WTPB 4WU9B 5B2JC 1F66C 3WA9A 5E5AA 3LZ1A 2HIOC 5AVCA 1P3PA 4R8PD 3X1VB 5B31D 3LELA 1EQZA 3KUYD 3B6FB 1HQ3A 4Z5TC 5DNMA 4KGCB 4X23B 3W99C 5B0ZA 1KX4D 3O62A 3LZ0B 4CAYA 5AV9B 5BT1C 4Z2MH 4ZUXD 5B0YC 2NQBA 1P3KC 4XUJC 3KXBB 5GXQB 4J8WC 1S32D 3B6GC 5AY8B 1P3FA 1KX3B 4LD9A 2AROD 3MGSA 4CSRA 4EO5C 1P3GA 5B1MA 3TU4C 5B40B 3REJA 2FJ7A 3UTAA 3NQUA 2CV5A 5F99C 3REHD 1P3AC 2NZDA 1BH9B 4H9SC 4R8PC 4YM6D 1P3BB 5B1LA 3AV1A 1M1AA 5B31C 3KUYC 3AZFD 1ID3D 3AZGB 3AZEB 3MGPD 1BFMA 3MGRB 5AVCB 1KX4C 3AZLA 4QLCD 5B2IC 4ZUXC 3MVDB 4J8XA 5BO0B 1S32C 4J8VB 3C1CA 1EQZB 4WU8A 3VH5A 1HQ3B 2IO5C 4M6BA 3W97D 5C3IC 4G91C 5AV8D 4CAYB 4YS3C 5JA4A 3AV2D 1WWSA 3MGQA 5CPID 3B0CT 3KWQA 1P3OB 4JJNC 4YM6C 3RELA 2F8ND 3WAAB 5B32C 1TZYD 3C1BA 5AVBA 1JFIB 5B24B 3REJB 3W96A 5B33A 3UTAB 3AZFC 1ID3C 4DRAA 3MGPC 3B0DC 1P3LC 1ZLAA 4H9PB 5CP6A 3AZJA 3AFAA 2NZDB 3WTPE 2BYKA 3UT9D 3LJAD 3AV1B 1AOID 3W97C 5AV6C 1N1JB 3WKJB 5DNND 5BS7A 3X1VA 3AZLB 1U35B 3AN2D 3AV2C 3B6FA 3X1UD 4AWLB 1TAFA 5CPIC 4Z66D 3C1CB 1KX5D 4KGCA 1P34B 4X23A 1M18B 1TZYC 3LZ0A 5AV9A 3AZKD 2F8NH 3KXBA 4ZBJC 5JRGC 1KX3A 3W98B 5B40A 3UTBD 3MNND 3UT9C 3X1TD 1P3ID 4XZQB 5GSUB 1ULYA 5CPKD 3A6NA 1AOIC 3AZHB 1BH9A 4Z2MG 1P3BA 5GT0D 4J8UD 4H9RB 3AZNC 3AFAB 1P3MD 3AN2C 3B6GA 2HUEB 3AZID 1M19A 4KUDB 3X1UC 5F99D 3AZEA 4Z66C 1KX5C 3TU4A 3REID 4WU9C 1P3AD 3REKB 3MGRA 3AYWD 3MVDA 3AZKC 5BO0A 4J8VA 5CPJD 3X1SB 3VH6T 1TAFB 3UTBC 3MNNC 3X1TC 1P3IC 5CPKC 3WA9D 5KDMA 5B2ID 5E5AD 1P3PD 5B2JB 1F66B 2HIOB 5GXQC 1P3OA 3LELD 5AY8C 5GT0C 4J8UC 3WAAA 1BH8B 1P3MC 1JFIA 5DNMD 5B24A 3AZIC 2AROA 3A6NB 4DRBA 4YS3D 4Z5TB 5B0ZD 3O62D 2NQBD 3REIC 4H9PA 1WWIA 4NE3A 3AYWC 2PYOD 3W99B 4JJND 5B0YB 2RVQD 3V9RA 5GT3D 1P3FD 3REHA 3MGSD 4LD9D 5B32D 4H9OA 1P3KB 5FUGA 4XUJB 5BNXB 1P3GD 4J8WB 3B6GB 5B1MD 5CPJC 1M19B 4EO5B 5G49B 4E45A 2FJ7D 2CV5D 1R4VA 3AZGC 3B0CW 3TU4B 2LY8A 1N1JA 3WKJA 1P3LD 3AZFA 1U35A 3WA9C 5E5AC 3LZ1C 5AVCC 1P3PC 5B1LD 4HGAB 1P34A 1M1AD 3LELC 4QLCA 1EQZC 4R8PB 4NE5A 4WZSB 1M18A 5AV6D 5B31B 5DNMC 3KUYB 3B0BA 1HTAA 5KDMB 5AV5D 5B0ZC 3W98A 3O62C 3AZMD 2NQBC 2PYOC 5AV8A 1KX4B 2RVQC 5GT3C 4ZUXB 1P3FC 3VH5W 4XZQA 1H3OB 5GSUA 3MGSC 4LD9C 1P3GC 1S32B 3AZHA 5B1MC 2AROB 5JRGD 2FJ7C 2IO5B 2CV5C 2F8NG 4H9RA 5C3IB 3MGQD 4G91B 2NZDC 3V9RB 3KWQD 4NE6A 3REHB 4KUDA 4H9OB 3RELD 5FUGB 5B1LC 3C1BD 5AVBD 1M1AC 3REKA 4YM6B 3W96D 5B33D 5B32B 3LJAA 2L5AA 3AZND 3AZFB 1ID3B 1ZLAD 5CP6D 5AV5C 3X1SA 3AZMC 3AZLC 3MGPB 4G92C 3B0DB 5DNNA 1P3LB 4J8XC 3WTPD 4AWLC 4QLCB 4WU9D 1M1AB 4WU8C 2BYMB 3VH6A 5B2JA 1F66A 3W97B 2HIOA 3X1VD 3B6FD 1F1EA 1BH8A 3MGQC 2YFVB 5AV8B 4KGCD 4H9QB 3KWQC 3AV2B 4NFTA 4X23D 3RELC 2YFWB 4Z5TA 5CPIB 3LZ0D 5AVBC 3C1BC 3UTBA 2F8NB 3W96C 3VH6W 3KXBD 5B33C 3W99A 5GXQD 1TZYB 4KHAB 5AY8D 5B0YA 1KX3D 1Q9CA 1P3KA 4XUJA 5BNXA 3NQJA 4J8WA 5CP6C 4ZBJB 3AFAC 5JRGB 3AZJC 5B40D 1ZLAC 5G49A 3WTPC 3UT9B 3LJAB 5F99A 1AOIB 5BNVB 1P3AA 5BS7C 3AYWA 5CHLB 3X1VC 4WV4B 4H9SA 4R8PA 3B6FC 4H9NB 5DNNB 3KSYA 3AZGD 5B31A 3AZED 3KUYA 4KGCC 3AN2B 5B31G 4X23C 3X1UB 3MGRD 3LZ1D 5AVCD 3LZ0C 4Z66B 5AV9C 3MVDD 1KX5B 3KXBC 1KX4A 4J8VD 5B2IA 4ZUXA 3AZKB 1KX3C 1EQZD 1H3OA 1HQ3D 1S32A 5B40C 4WNNB 1KU5A 4UUZA 3A6NC 3UTBB 3MNNB 3X1TB 1P3IB 5CPKB 4YS3A 1P3OD 1P3BC 3NQJB 3WAAD 2PYOA 4JJNA 4YM6A 5GT0B 5GT3A 5B24D 3REJD 4J8UB 3UTAD 1M19C 5B32A 5B32G 1P3MB 3AZEC 2F8NK 3R45B 3AZIB 1ID3A 3MGRC 2NZDD 5F99B 3MVDC 3MGPA 1B67A 3REIB 1P3LA 1P3AB 3AYWB 3AV1D 4J8VC 4HGAC 1HQ3C 5CPJB 2BYMA 3WKJD 3W97A 3AZLD 1U35D 5AV6A 4J8XD 2YFVA 3WA9B 4H9QA 5B2IB 5AV5A 5E5AB 3LZ1B 3C1CD 3AV2A 3AZMA 1B6WA 4WU8D 1P34D 2YFWA 1P3OC 1P3PB 3WAAC 1M18D 5CPIA 3LELB 5B24C 3REJC 2F8NA 2AROC 3UTAC 1TZYA 4KHAA 4UUZB 1A7WA 3W98D 5DNMB 5JRGA 4YS3B 5B0ZB 3O62B 2NQBB 3REHC 4XZQD 5GSUD 2PYOB 3AV1C 4JJNB 3AZHD 3UT9A 1P3FB 5GT3B 4LD9B 3MGSB 4CSRB 4E44A 1P3GB 1AOIA 5B1MB 3WKJC 5BNVA 3AZJD 3AFAD 2FJ7B 3NQUB 1U35C 2CV5B 4H9NA 4KUDD 3AZNA 3C1CC 3AN2A 1P34C 4QLCC 3X1UA 3REKD 1M18C 4Z66A 1KX5A 5B1LB 3WTPA 4WU9A
chains in the Genus database with same CATH superfamily
3AZKA 5AV6B 3H0RC 3X1SD 3W98C 3VH5T 4WNNA 5AV5B 5AV8C 3AZMB 4G92B 2J8PA 4XZQC 5GSUC 4J8XB 5AV9D 2FFFB 3MNNA 3AZHC 2F2AC 3X1TA 1P3IA 4WU8B 5B2JD 5CPKA 1F66D 2HIOD 5GXQA 5AY8A 5GT0A 2HUEC 3A1IA 4KUDC 5JA4B 4J8UA 3MGQB 3A6ND 1P3MA 4Z5TD 3R45A 3AZIA 3KWQB 2CWEA 3REKC 3RELB 3W99D 3LJAC 1P3BD 3C1BB 5AVBB 5B0YD 5BT1D 3REIA 1P3KD 3W96B 4XUJD 5B33B 4J8WD 3B6GD 2ZY3A 3X1SC 1M19D 3AZNB 5DNNC 3P5JB 1ZLAB 5CP6B 3AZJB 2JSSA 3TU4D 5CPJA 2Y2NA 2BYKB 3AZGA 3WTPB 4WU9B 5B2JC 1F66C 3WA9A 5E5AA 3LZ1A 2HIOC 5AVCA 1P3PA 4R8PD 3X1VB 5B31D 3LELA 1EQZA 3KUYD 3B6FB 1HQ3A 4Z5TC 5DNMA 4KGCB 4X23B 2DF4C 2JE5A 3W99C 5B0ZA 1KX4D 3O62A 3LZ0B 4CAYA 5AV9B 5BT1C 4Z2MH 4ZUXD 5B0YC 2NQBA 1P3KC 4XUJC 3KXBB 5GXQB 4J8WC 1S32D 3B6GC 5AY8B 1P3FA 1KX3B 4LD9A 2AROD 3MGSA 4CSRA 4EO5C 1P3GA 5B1MA 3TU4C 5B40B 3REJA 2FJ7A 3UTAA 3NQUA 2CV5A 5F99C 3REHD 1P3AC 2NZDA 1BH9B 3EPLA 4H9SC 4R8PC 4YM6D 1P3BB 5B1LA 3AV1A 1M1AA 5B31C 3KUYC 2Y2PA 3AZFD 1ID3D 3AZGB 3AZEB 3MGPD 1BFMA 3MGRB 5AVCB 1KX4C 3AZLA 4QLCD 5B2IC 4ZUXC 3MVDB 4J8XA 5BO0B 1S32C 4J8VB 3C1CA 1EQZB 4WU8A 3VH5A 1HQ3B 3H0MC 3F6TA 2IO5C 4M6BA 3W97D 5C3IC 4G91C 5AV8D 4CAYB 4YS3C 5JA4A 3AV2D 1WWSA 3MGQA 1W2EA 5CPID 3B0CT 3KWQA 1P3OB 4JJNC 4YM6C 3RELA 2F8ND 3WAAB 5B32C 1TZYD 3C1BA 5AVBA 1JFIB 5B24B 3REJB 3W96A 5B33A 3UTAB 3AZFC 1ID3C 4DRAA 3MGPC 3B0DC 2JCHA 1P3LC 1ZLAA 4H9PB 5CP6A 3AZJA 3AFAA 2NZDB 3WTPE 2BYKA 2Y2OA 3UT9D 3LJAD 3AV1B 1AOID 3W97C 2VQRA 4UPKA 5AV6C 1N1JB 3WKJB 5DNND 5BS7A 3X1VA 3AZLB 1U35B 4DQYB 3AN2D 3AV2C 3B6FA 1Z2CB 2W8SA 3X1UD 4AWLB 1TAFA 5CPIC 4Z66D 3C1CB 1KX5D 4KGCA 1P34B 2DQNC 4X23A 1M18B 1TZYC 3LZ0A 5AV9A 3AZKD 2F8NH 3KXBA 4ZBJC 5JRGC 1KX3A 2ZY5A 3W98B 2XD5A 5B40A 3UTBD 3MNND 3UT9C 3X1TD 1P3ID 4XZQB 5GSUB 1ULYA 5CPKD 3A6NA 1AOIC 3AZHB 1BH9A 4Z2MG 1P3BA 5GT0D 4J8UD 4H9RB 3AZNC 3AFAB 1P3MD 3AN2C 3B6GA 2HUEB 3AZID 1M19A 4KUDB 3X1UC 5F99D 3AZEA 4Z66C 2UWXA 3EPKA 1KX5C 3TU4A 3REID 4WU9C 1P3AD 3REKB 3MGRA 3AYWD 2ZY2A 3MVDA 3AZKC 1T3UA 5BO0A 4J8VA 5CPJD 3X1SB 3VH6T 1TAFB 3UTBC 3MNNC 3X1TC 3IP4C 1P3IC 5CPKC 3WA9D 5KDMA 5B2ID 5E5AD 1P3PD 5B2JB 1F66B 2HIOB 5GXQC 1P3OA 3LELD 5AY8C 5GT0C 4J8UC 3WAAA 1BH8B 1P3MC 1JFIA 2RIQA 5DNMD 5B24A 3AZIC 2AROA 3A6NB 4DRBA 4YS3D 2Y2QA 4Z5TB 5B0ZD 3O62D 2NQBD 3REIC 4H9PA 1WWIA 4NE3A 3AYWC 2PYOD 3W99B 4JJND 5B0YB 2RVQD 3V9RA 5GT3D 1P3FD 3REHA 3MGSD 4LD9D 5B32D 4H9OA 1P3KB 5FUGA 4XUJB 5BNXB 1P3GD 4J8WB 3B6GB 5B1MD 5CPJC 1M19B 4EO5B 5G49B 4E45A 2FJ7D 2CV5D 1R4VA 2Y2JA 3AZGC 3B0CW 3TU4B 2LY8A 1N1JA 3WKJA 1P3LD 3AZFA 1U35A 3WA9C 5E5AC 3LZ1C 5AVCC 1P3PC 5B1LD 4HGAB 1P34A 1M1AD 3LELC 4QLCA 1EQZC 4R8PB 4NE5A 4WZSB 1M18A 5AV6D 5B31B 5DNMC 3KUYB 3B0BA 1HTAA 5KDMB 5AV5D 5B0ZC 3W98A 3O62C 3AZMD 2NQBC 2PYOC 5AV8A 1KX4B 2RVQC 5GT3C 4ZUXB 1P3FC 3VH5W 4XZQA 1H3OB 5GSUA 3MGSC 4LD9C 1P3GC 1S32B 3AZHA 5B1MC 2AROB 5JRGD 2FJ7C 2IO5B 2CV5C 2F8NG 4H9RA 5C3IB 3EPJA 3MGQD 4G91B 2BG1A 2Y2KA 2NZDC 3V9RB 3KWQD 4NE6A 3REHB 4KUDA 4H9OB 3RELD 3EPHA 5FUGB 5B1LC 3C1BD 5AVBD 1M1AC 3REKA 4YM6B 3W96D 5B33D 5B32B 3LJAA 2L5AA 3AZND 3AZFB 1ID3B 1ZLAD 5CP6D 5AV5C 3X1SA 3AZMC 3AZLC 3MGPB 4G92C 3B0DB 5DNNA 1P3LB 4J8XC 2ZY4A 3H0LC 3WTPD 4AWLC 4QLCB 4WU9D 1M1AB 4WU8C 2BYMB 3VH6A 5B2JA 1F66A 3W97B 2HIOA 3X1VD 2XD1A 1F1EA 3B6FD 1BH8A 2Y2MA 3MGQC 2YFVB 5AV8B 4KGCD 4H9QB 3KWQC 3AV2B 4NFTA 4X23D 3RELC 2YFWB 4Z5TA 5CPIB 3LZ0D 5AVBC 3C1BC 3UTBA 2F8NB 3W96C 3VH6W 3KXBD 5B33C 3W99A 5GXQD 1TZYB 4KHAB 5AY8D 5B0YA 1KX3D 1Q9CA 1P3KA 4XUJA 5BNXA 3NQJA 4J8WA 5CP6C 4ZBJB 3AFAC 5JRGB 3AZJC 5B40D 1ZLAC 2Y2HA 5G49A 3WTPC 3UT9B 4WJ3C 2G5IC 3LJAB 5F99A 1AOIB 3AL0C 5BNVB 1P3AA 5BS7C 3AYWA 5CHLB 3X1VC 4WV4B 4H9SA 4R8PA 3B6FC 4H9NB 5DNNB 3KSYA 3A1KA 3AZGD 5B31A 3AZED 3KUYA 4KGCC 3AN2B 5B31G 4X23C 3X1UB 3MGRD 2Y2GA 2Y2LA 5AVCD 3LZ1D 3LZ0C 4Z66B 5AV9C 3MVDD 1KX5B 3KXBC 1KX4A 4J8VD 5B2IA 4ZUXA 3AZKB 1KX3C 1EQZD 1H3OA 1HQ3D 1PZRA 1S32A 5B40C 4WNNB 1KU5A 4UUZA 3A6NC 3UTBB 3MNNB 3X1TB 1P3IB 5CPKB 4YS3A 1P3OD 1P3BC 2Y2IA 3NQJB 3WAAD 2PYOA 4JJNA 4YM6A 5GT0B 5GT3A 5B24D 3REJD 4J8UB 3UTAD 1M19C 5B32A 5B32G 1P3MB 3AZEC 2F8NK 3R45B 3AZIB 1ID3A 3MGRC 2NZDD 3KFUG 5F99B 3MVDC 3MGPA 1B67A 3REIB 1P3LA 1P3AB 3AYWB 3AV1D 2ZM5A 4J8VC 4HGAC 1HQ3C 5CPJB 2BYMA 3WKJD 3W97A 3AZLD 1U35D 5AV6A 4J8XD 2YFVA 3WA9B 4H9QA 5B2IB 5AV5A 5E5AB 3LZ1B 3C1CD 3AV2A 3AZMA 1B6WA 4WU8D 1P34D 2YFWA 1P3OC 1P3PB 3WAAC 1M18D 5CPIA 3LELB 5B24C 3REJC 2F8NA 2AROC 3UTAC 1TZYA 4KHAA 4UUZB 1A7WA 3W98D 5DNMB 5JRGA 4YS3B 5B0ZB 3O62B 2NQBB 3REHC 4XZQD 5GSUD 2PYOB 3AV1C 3FDDA 4JJNB 2G5HC 3UT9A 3AZHD 5GT3B 1P3FB 4LD9B 3MGSB 4CSRB 4E44A 1P3GB 1AOIA 5B1MB 3WKJC 5BNVA 3AZJD 3AFAD 2FJ7B 3NQUB 1U35C 2CV5B 4H9NA 4KUDD 3AZNA 3EG5B 3C1CC 3AN2A 1P34C 4QLCC 3X1UA 3REKD 1M18C 4Z66A 1KX5A 5B1LB 3WTPA 4WU9A
chains in the Genus database with same CATH topology
3AZKA 5AV6B 3H0RC 3X1SD 3W98C 3VH5T 4WNNA 5AV5B 5AV8C 3AZMB 4G92B 2J8PA 4XZQC 5GSUC 4J8XB 5AV9D 2FFFB 3MNNA 3AZHC 2F2AC 3X1TA 1P3IA 4WU8B 5B2JD 5CPKA 1F66D 2HIOD 5GXQA 5AY8A 5GT0A 2HUEC 3A1IA 4KUDC 5JA4B 4J8UA 3MGQB 3A6ND 1P3MA 4Z5TD 3R45A 3AZIA 3KWQB 2CWEA 3REKC 3RELB 3W99D 3LJAC 1P3BD 3C1BB 5AVBB 5B0YD 5BT1D 3REIA 1P3KD 3W96B 4XUJD 5B33B 4J8WD 3B6GD 2ZY3A 3X1SC 1M19D 3AZNB 5DNNC 3P5JB 1ZLAB 5CP6B 3AZJB 2JSSA 3TU4D 5CPJA 2Y2NA 2BYKB 3AZGA 3WTPB 4WU9B 5B2JC 1F66C 3WA9A 5E5AA 3LZ1A 2HIOC 5AVCA 1P3PA 4R8PD 3X1VB 5B31D 3LELA 1EQZA 3KUYD 3B6FB 1HQ3A 4Z5TC 5DNMA 4KGCB 4X23B 2DF4C 2JE5A 3W99C 5B0ZA 1KX4D 3O62A 3LZ0B 4CAYA 5AV9B 5BT1C 4Z2MH 4ZUXD 5B0YC 2NQBA 1P3KC 4XUJC 3KXBB 5GXQB 4J8WC 1S32D 3B6GC 5AY8B 1P3FA 1KX3B 4LD9A 2AROD 3MGSA 4CSRA 4EO5C 1P3GA 5B1MA 3TU4C 5B40B 3REJA 2FJ7A 3UTAA 3NQUA 2CV5A 5F99C 3REHD 1P3AC 2NZDA 1BH9B 3EPLA 4H9SC 4R8PC 4YM6D 1P3BB 5B1LA 3AV1A 1M1AA 5B31C 3KUYC 2Y2PA 3AZFD 1ID3D 3AZGB 3AZEB 3MGPD 1BFMA 3MGRB 5AVCB 1KX4C 3AZLA 4QLCD 5B2IC 4ZUXC 3MVDB 4J8XA 5BO0B 1S32C 4J8VB 3C1CA 1EQZB 4WU8A 3VH5A 1HQ3B 3H0MC 3F6TA 2IO5C 4M6BA 3W97D 5C3IC 4G91C 5AV8D 4CAYB 4YS3C 5JA4A 3AV2D 1WWSA 3MGQA 1W2EA 5CPID 3B0CT 3KWQA 1P3OB 4JJNC 4YM6C 3RELA 2F8ND 3WAAB 5B32C 1TZYD 3C1BA 5AVBA 1JFIB 5B24B 3REJB 3W96A 5B33A 3UTAB 3AZFC 1ID3C 4DRAA 3MGPC 3B0DC 2JCHA 1P3LC 1ZLAA 4H9PB 5CP6A 3AZJA 3AFAA 2NZDB 3WTPE 2BYKA 2Y2OA 3UT9D 3LJAD 3AV1B 1AOID 3W97C 2VQRA 4UPKA 5AV6C 1N1JB 3WKJB 5DNND 5BS7A 3X1VA 3AZLB 1U35B 4DQYB 3AN2D 3AV2C 3B6FA 1Z2CB 2W8SA 3X1UD 4AWLB 1TAFA 5CPIC 4Z66D 3C1CB 1KX5D 4KGCA 1P34B 2DQNC 4X23A 1M18B 1TZYC 3LZ0A 5AV9A 3AZKD 2F8NH 3KXBA 4ZBJC 5JRGC 1KX3A 2ZY5A 3W98B 2XD5A 5B40A 3UTBD 3MNND 3UT9C 3X1TD 1P3ID 4XZQB 5GSUB 1ULYA 5CPKD 3A6NA 1AOIC 3AZHB 1BH9A 4Z2MG 1P3BA 5GT0D 4J8UD 4H9RB 3AZNC 3AFAB 1P3MD 3AN2C 3B6GA 2HUEB 3AZID 1M19A 4KUDB 3X1UC 5F99D 3AZEA 4Z66C 2UWXA 3EPKA 1KX5C 3TU4A 3REID 4WU9C 1P3AD 3REKB 3MGRA 3AYWD 2ZY2A 3MVDA 3AZKC 1T3UA 5BO0A 4J8VA 5CPJD 3X1SB 3VH6T 1TAFB 3UTBC 3MNNC 3X1TC 3IP4C 1P3IC 5CPKC 3WA9D 5KDMA 5B2ID 5E5AD 1P3PD 5B2JB 1F66B 2HIOB 5GXQC 1P3OA 3LELD 5AY8C 5GT0C 4J8UC 3WAAA 1BH8B 1P3MC 1JFIA 2RIQA 5DNMD 5B24A 3AZIC 2AROA 3A6NB 4DRBA 4YS3D 2Y2QA 4Z5TB 5B0ZD 3O62D 2NQBD 3REIC 4H9PA 1WWIA 4NE3A 3AYWC 2PYOD 3W99B 4JJND 5B0YB 2RVQD 3V9RA 5GT3D 1P3FD 3REHA 3MGSD 4LD9D 5B32D 4H9OA 1P3KB 5FUGA 4XUJB 5BNXB 1P3GD 4J8WB 3B6GB 5B1MD 5CPJC 1M19B 4EO5B 5G49B 4E45A 2FJ7D 2CV5D 1R4VA 2Y2JA 3AZGC 3B0CW 3TU4B 2LY8A 1N1JA 3WKJA 1P3LD 3AZFA 1U35A 3WA9C 5E5AC 3LZ1C 5AVCC 1P3PC 5B1LD 4HGAB 1P34A 1M1AD 3LELC 4QLCA 1EQZC 4R8PB 4NE5A 4WZSB 1M18A 5AV6D 5B31B 5DNMC 3KUYB 3B0BA 1HTAA 5KDMB 5AV5D 5B0ZC 3W98A 3O62C 3AZMD 2NQBC 2PYOC 5AV8A 1KX4B 2RVQC 5GT3C 4ZUXB 1P3FC 3VH5W 4XZQA 1H3OB 5GSUA 3MGSC 4LD9C 1P3GC 1S32B 3AZHA 5B1MC 2AROB 5JRGD 2FJ7C 2IO5B 2CV5C 2F8NG 4H9RA 5C3IB 3EPJA 3MGQD 4G91B 2BG1A 2Y2KA 2NZDC 3V9RB 3KWQD 4NE6A 3REHB 4KUDA 4H9OB 3RELD 3EPHA 5FUGB 5B1LC 3C1BD 5AVBD 1M1AC 3REKA 4YM6B 3W96D 5B33D 5B32B 3LJAA 2L5AA 3AZND 3AZFB 1ID3B 1ZLAD 5CP6D 5AV5C 3X1SA 3AZMC 3AZLC 3MGPB 4G92C 3B0DB 5DNNA 1P3LB 4J8XC 2ZY4A 3H0LC 3WTPD 4AWLC 4QLCB 4WU9D 1M1AB 4WU8C 2BYMB 3VH6A 5B2JA 1F66A 3W97B 2HIOA 3X1VD 2XD1A 1F1EA 3B6FD 1BH8A 2Y2MA 3MGQC 2YFVB 5AV8B 4KGCD 4H9QB 3KWQC 3AV2B 4NFTA 4X23D 3RELC 2YFWB 4Z5TA 5CPIB 3LZ0D 5AVBC 3C1BC 3UTBA 2F8NB 3W96C 3VH6W 3KXBD 5B33C 3W99A 5GXQD 1TZYB 4KHAB 5AY8D 5B0YA 1KX3D 1Q9CA 1P3KA 4XUJA 5BNXA 3NQJA 4J8WA 5CP6C 4ZBJB 3AFAC 5JRGB 3AZJC 5B40D 1ZLAC 2Y2HA 5G49A 3WTPC 3UT9B 4WJ3C 2G5IC 3LJAB 5F99A 1AOIB 3AL0C 5BNVB 1P3AA 5BS7C 3AYWA 5CHLB 3X1VC 4WV4B 4H9SA 4R8PA 3B6FC 4H9NB 5DNNB 3KSYA 3A1KA 3AZGD 5B31A 3AZED 3KUYA 4KGCC 3AN2B 5B31G 4X23C 3X1UB 3MGRD 2Y2GA 2Y2LA 5AVCD 3LZ1D 3LZ0C 4Z66B 5AV9C 3MVDD 1KX5B 3KXBC 1KX4A 4J8VD 5B2IA 4ZUXA 3AZKB 1KX3C 1EQZD 1H3OA 1HQ3D 1PZRA 1S32A 5B40C 4WNNB 1KU5A 4UUZA 3A6NC 3UTBB 3MNNB 3X1TB 1P3IB 5CPKB 4YS3A 1P3OD 1P3BC 2Y2IA 3NQJB 3WAAD 2PYOA 4JJNA 4YM6A 5GT0B 5GT3A 5B24D 3REJD 4J8UB 3UTAD 1M19C 5B32A 5B32G 1P3MB 3AZEC 2F8NK 3R45B 3AZIB 1ID3A 3MGRC 2NZDD 3KFUG 5F99B 3MVDC 3MGPA 1B67A 3REIB 1P3LA 1P3AB 3AYWB 3AV1D 2ZM5A 4J8VC 4HGAC 1HQ3C 5CPJB 2BYMA 3WKJD 3W97A 3AZLD 1U35D 5AV6A 4J8XD 2YFVA 3WA9B 4H9QA 5B2IB 5AV5A 5E5AB 3LZ1B 3C1CD 3AV2A 3AZMA 1B6WA 4WU8D 1P34D 2YFWA 1P3OC 1P3PB 3WAAC 1M18D 5CPIA 3LELB 5B24C 3REJC 2F8NA 2AROC 3UTAC 1TZYA 4KHAA 4UUZB 1A7WA 3W98D 5DNMB 5JRGA 4YS3B 5B0ZB 3O62B 2NQBB 3REHC 4XZQD 5GSUD 2PYOB 3AV1C 3FDDA 4JJNB 2G5HC 3UT9A 3AZHD 5GT3B 1P3FB 4LD9B 3MGSB 4CSRB 4E44A 1P3GB 1AOIA 5B1MB 3WKJC 5BNVA 3AZJD 3AFAD 2FJ7B 3NQUB 1U35C 2CV5B 4H9NA 4KUDD 3AZNA 3EG5B 3C1CC 3AN2A 1P34C 4QLCC 3X1UA 3REKD 1M18C 4Z66A 1KX5A 5B1LB 3WTPA 4WU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK A;  5AV6 B;  3X1S D;  3W98 C;  3VH5 T;  4WNN A;  5AV5 B;  5AV8 C;  3AZM B;  4G92 B;  4XZQ C;  5GSU C;  4J8X B;  5AV9 D;  3MNN A;  3AZH C;  3X1T A;  1P3I A;  4WU8 B;  5B2J D;  5CPK A;  1F66 D;  2HIO D;  5GXQ A;  5AY8 A;  5GT0 A;  2HUE C;  4KUD C;  5JA4 B;  4J8U A;  3MGQ B;  3A6N D;  1P3M A;  4Z5T D;  3R45 A;  3AZI A;  3KWQ B;  2CWE A;  3REK C;  3REL B;  3W99 D;  3LJA C;  1P3B D;  3C1B B;  5AVB B;  5B0Y D;  5BT1 D;  3REI A;  1P3K D;  3W96 B;  4XUJ D;  5B33 B;  4J8W D;  3B6G D;  3X1S C;  1M19 D;  3AZN B;  5DNN C;  1ZLA B;  5CP6 B;  3AZJ B;  2JSS A;  3TU4 D;  5CPJ A;  2BYK B;  3AZG A;  3WTP B;  4WU9 B;  5B2J C;  1F66 C;  3WA9 A;  5E5A A;  3LZ1 A;  2HIO C;  5AVC A;  1P3P A;  4R8P D;  3X1V B;  5B31 D;  3LEL A;  1EQZ A;  3KUY D;  3B6F B;  1HQ3 A;  4Z5T C;  5DNM A;  4KGC B;  4X23 B;  3W99 C;  5B0Z A;  1KX4 D;  3O62 A;  3LZ0 B;  4CAY A;  5AV9 B;  5BT1 C;  4Z2M H;  4ZUX D;  5B0Y C;  2NQB A;  1P3K C;  4XUJ C;  3KXB B;  5GXQ B;  4J8W C;  1S32 D;  3B6G C;  5AY8 B;  1P3F A;  1KX3 B;  4LD9 A;  2ARO D;  3MGS A;  4CSR A;  4EO5 C;  1P3G A;  5B1M A;  3TU4 C;  5B40 B;  3REJ A;  2FJ7 A;  3UTA A;  3NQU A;  2CV5 A;  5F99 C;  3REH D;  1P3A C;  2NZD A;  1BH9 B;  4H9S C;  4R8P C;  4YM6 D;  1P3B B;  5B1L A;  3AV1 A;  1M1A A;  5B31 C;  3KUY C;  3AZF D;  1ID3 D;  3AZG B;  3AZE B;  3MGP D;  1BFM A;  3MGR B;  5AVC B;  1KX4 C;  3AZL A;  4QLC D;  5B2I C;  4ZUX C;  3MVD B;  4J8X A;  5BO0 B;  1S32 C;  4J8V B;  3C1C A;  1EQZ B;  4WU8 A;  3VH5 A;  1HQ3 B;  2IO5 C;  4M6B A;  3W97 D;  5C3I C;  4G91 C;  5AV8 D;  4CAY B;  4YS3 C;  5JA4 A;  3AV2 D;  1WWS A;  3MGQ A;  5CPI D;  3B0C T;  3KWQ A;  1P3O B;  4JJN C;  4YM6 C;  3REL A;  2F8N D;  3WAA B;  5B32 C;  1TZY D;  3C1B A;  5AVB A;  1JFI B;  5B24 B;  3REJ B;  3W96 A;  5B33 A;  3UTA B;  3AZF C;  1ID3 C;  4DRA A;  3MGP C;  3B0D C;  1P3L C;  1ZLA A;  4H9P B;  5CP6 A;  3AZJ A;  3AFA A;  2NZD B;  3WTP E;  2BYK A;  3UT9 D;  3LJA D;  3AV1 B;  1AOI D;  3W97 C;  5AV6 C;  1N1J B;  3WKJ B;  5DNN D;  5BS7 A;  3X1V A;  3AZL B;  1U35 B;  3AN2 D;  3AV2 C;  3B6F A;  3X1U D;  4AWL B;  1TAF A;  5CPI C;  4Z66 D;  3C1C B;  1KX5 D;  4KGC A;  1P34 B;  4X23 A;  1M18 B;  1TZY C;  3LZ0 A;  5AV9 A;  3AZK D;  2F8N H;  3KXB A;  4ZBJ C;  5JRG C;  1KX3 A;  3W98 B;  5B40 A;  3UTB D;  3MNN D;  3UT9 C;  3X1T D;  1P3I D;  4XZQ B;  5GSU B;  1ULY A;  5CPK D;  3A6N A;  1AOI C;  3AZH B;  1BH9 A;  4Z2M G;  1P3B A;  5GT0 D;  4J8U D;  4H9R B;  3AZN C;  3AFA B;  1P3M D;  3AN2 C;  3B6G A;  2HUE B;  3AZI D;  1M19 A;  4KUD B;  3X1U C;  5F99 D;  3AZE A;  4Z66 C;  1KX5 C;  3TU4 A;  3REI D;  4WU9 C;  1P3A D;  3REK B;  3MGR A;  3AYW D;  3MVD A;  3AZK C;  5BO0 A;  4J8V A;  5CPJ D;  3X1S B;  3VH6 T;  1TAF B;  3UTB C;  3MNN C;  3X1T C;  1P3I C;  5CPK C;  3WA9 D;  5KDM A;  5B2I D;  5E5A D;  1P3P D;  5B2J B;  1F66 B;  2HIO B;  5GXQ C;  1P3O A;  3LEL D;  5AY8 C;  5GT0 C;  4J8U C;  3WAA A;  1BH8 B;  1P3M C;  1JFI A;  5DNM D;  5B24 A;  3AZI C;  2ARO A;  3A6N B;  4DRB A;  4YS3 D;  4Z5T B;  5B0Z D;  3O62 D;  2NQB D;  3REI C;  4H9P A;  1WWI A;  4NE3 A;  3AYW C;  2PYO D;  3W99 B;  4JJN D;  5B0Y B;  2RVQ D;  3V9R A;  5GT3 D;  1P3F D;  3REH A;  3MGS D;  4LD9 D;  5B32 D;  4H9O A;  1P3K B;  5FUG A;  4XUJ B;  5BNX B;  1P3G D;  4J8W B;  3B6G B;  5B1M D;  5CPJ C;  1M19 B;  4EO5 B;  5G49 B;  4E45 A;  2FJ7 D;  2CV5 D;  1R4V A;  3AZG C;  3B0C W;  3TU4 B;  2LY8 A;  1N1J A;  3WKJ A;  1P3L D;  3AZF A;  1U35 A;  3WA9 C;  5E5A C;  3LZ1 C;  5AVC C;  1P3P C;  5B1L D;  4HGA B;  1P34 A;  1M1A D;  3LEL C;  4QLC A;  1EQZ C;  4R8P B;  4NE5 A;  4WZS B;  1M18 A;  5AV6 D;  5B31 B;  5DNM C;  3KUY B;  3B0B A;  1HTA A;  5KDM B;  5AV5 D;  5B0Z C;  3W98 A;  3O62 C;  3AZM D;  2NQB C;  2PYO C;  5AV8 A;  1KX4 B;  2RVQ C;  5GT3 C;  4ZUX B;  1P3F C;  3VH5 W;  4XZQ A;  1H3O B;  5GSU A;  3MGS C;  4LD9 C;  1P3G C;  1S32 B;  3AZH A;  5B1M C;  2ARO B;  5JRG D;  2FJ7 C;  2IO5 B;  2CV5 C;  2F8N G;  4H9R A;  5C3I B;  3MGQ D;  4G91 B;  2NZD C;  3V9R B;  3KWQ D;  4NE6 A;  3REH B;  4KUD A;  4H9O B;  3REL D;  5FUG B;  5B1L C;  3C1B D;  5AVB D;  1M1A C;  3REK A;  4YM6 B;  3W96 D;  5B33 D;  5B32 B;  3LJA A;  2L5A A;  3AZN D;  3AZF B;  1ID3 B;  1ZLA D;  5CP6 D;  5AV5 C;  3X1S A;  3AZM C;  3AZL C;  3MGP B;  4G92 C;  3B0D B;  5DNN A;  1P3L B;  4J8X C;  3WTP D;  4AWL C;  4QLC B;  4WU9 D;  1M1A B;  4WU8 C;  2BYM B;  3VH6 A;  5B2J A;  1F66 A;  3W97 B;  2HIO A;  3X1V D;  3B6F D;  1F1E A;  1BH8 A;  3MGQ C;  2YFV B;  5AV8 B;  4KGC D;  4H9Q B;  3KWQ C;  3AV2 B;  4NFT A;  4X23 D;  3REL C;  2YFW B;  4Z5T A;  5CPI B;  3LZ0 D;  5AVB C;  3C1B C;  3UTB A;  2F8N B;  3W96 C;  3VH6 W;  3KXB D;  5B33 C;  3W99 A;  5GXQ D;  1TZY B;  4KHA B;  5AY8 D;  5B0Y A;  1KX3 D;  1Q9C A;  1P3K A;  4XUJ A;  5BNX A;  3NQJ A;  4J8W A;  5CP6 C;  4ZBJ B;  3AFA C;  5JRG B;  3AZJ C;  5B40 D;  1ZLA C;  5G49 A;  3WTP C;  3UT9 B;  3LJA B;  5F99 A;  1AOI B;  5BNV B;  1P3A A;  5BS7 C;  3AYW A;  5CHL B;  3X1V C;  4WV4 B;  4H9S A;  4R8P A;  3B6F C;  4H9N B;  5DNN B;  3KSY A;  3AZG D;  5B31 A;  3AZE D;  3KUY A;  4KGC C;  3AN2 B;  5B31 G;  4X23 C;  3X1U B;  3MGR D;  3LZ1 D;  5AVC D;  3LZ0 C;  4Z66 B;  5AV9 C;  3MVD D;  1KX5 B;  3KXB C;  1KX4 A;  4J8V D;  5B2I A;  4ZUX A;  3AZK B;  1KX3 C;  1EQZ D;  1H3O A;  1HQ3 D;  1S32 A;  5B40 C;  4WNN B;  1KU5 A;  4UUZ A;  3A6N C;  3UTB B;  3MNN B;  3X1T B;  1P3I B;  5CPK B;  4YS3 A;  1P3O D;  1P3B C;  3NQJ B;  3WAA D;  2PYO A;  4JJN A;  4YM6 A;  5GT0 B;  5GT3 A;  5B24 D;  3REJ D;  4J8U B;  3UTA D;  1M19 C;  5B32 A;  5B32 G;  1P3M B;  3AZE C;  2F8N K;  3R45 B;  3AZI B;  1ID3 A;  3MGR C;  2NZD D;  5F99 B;  3MVD C;  3MGP A;  1B67 A;  3REI B;  1P3L A;  1P3A B;  3AYW B;  3AV1 D;  4J8V C;  4HGA C;  1HQ3 C;  5CPJ B;  2BYM A;  3WKJ D;  3W97 A;  3AZL D;  1U35 D;  5AV6 A;  4J8X D;  2YFV A;  3WA9 B;  4H9Q A;  5B2I B;  5AV5 A;  5E5A B;  3LZ1 B;  3C1C D;  3AV2 A;  3AZM A;  1B6W A;  4WU8 D;  1P34 D;  2YFW A;  1P3O C;  1P3P B;  3WAA C;  1M18 D;  5CPI A;  3LEL B;  5B24 C;  3REJ C;  2F8N A;  2ARO C;  3UTA C;  1TZY A;  4KHA A;  4UUZ B;  1A7W A;  3W98 D;  5DNM B;  5JRG A;  4YS3 B;  5B0Z B;  3O62 B;  2NQB B;  3REH C;  4XZQ D;  5GSU D;  2PYO B;  3AV1 C;  4JJN B;  3AZH D;  3UT9 A;  1P3F B;  5GT3 B;  4LD9 B;  3MGS B;  4CSR B;  4E44 A;  1P3G B;  1AOI A;  5B1M B;  3WKJ C;  5BNV A;  3AZJ D;  3AFA D;  2FJ7 B;  3NQU B;  1U35 C;  2CV5 B;  4H9N A;  4KUD D;  3AZN A;  3C1C C;  3AN2 A;  1P34 C;  4QLC C;  3X1U A;  3REK D;  1M18 C;  4Z66 A;  1KX5 A;  5B1L B;  3WTP A;  4WU9 A; 
#chains in the Genus database with same CATH topology
 3AZK A;  5AV6 B;  3H0R C;  3X1S D;  3W98 C;  3VH5 T;  4WNN A;  5AV5 B;  5AV8 C;  3AZM B;  4G92 B;  2J8P A;  4XZQ C;  5GSU C;  4J8X B;  5AV9 D;  2FFF B;  3MNN A;  3AZH C;  2F2A C;  3X1T A;  1P3I A;  4WU8 B;  5B2J D;  5CPK A;  1F66 D;  2HIO D;  5GXQ A;  5AY8 A;  5GT0 A;  2HUE C;  3A1I A;  4KUD C;  5JA4 B;  4J8U A;  3MGQ B;  3A6N D;  1P3M A;  4Z5T D;  3R45 A;  3AZI A;  3KWQ B;  2CWE A;  3REK C;  3REL B;  3W99 D;  3LJA C;  1P3B D;  3C1B B;  5AVB B;  5B0Y D;  5BT1 D;  3REI A;  1P3K D;  3W96 B;  4XUJ D;  5B33 B;  4J8W D;  3B6G D;  2ZY3 A;  3X1S C;  1M19 D;  3AZN B;  5DNN C;  3P5J B;  1ZLA B;  5CP6 B;  3AZJ B;  2JSS A;  3TU4 D;  5CPJ A;  2Y2N A;  2BYK B;  3AZG A;  3WTP B;  4WU9 B;  5B2J C;  1F66 C;  3WA9 A;  5E5A A;  3LZ1 A;  2HIO C;  5AVC A;  1P3P A;  4R8P D;  3X1V B;  5B31 D;  3LEL A;  1EQZ A;  3KUY D;  3B6F B;  1HQ3 A;  4Z5T C;  5DNM A;  4KGC B;  4X23 B;  2DF4 C;  2JE5 A;  3W99 C;  5B0Z A;  1KX4 D;  3O62 A;  3LZ0 B;  4CAY A;  5AV9 B;  5BT1 C;  4Z2M H;  4ZUX D;  5B0Y C;  2NQB A;  1P3K C;  4XUJ C;  3KXB B;  5GXQ B;  4J8W C;  1S32 D;  3B6G C;  5AY8 B;  1P3F A;  1KX3 B;  4LD9 A;  2ARO D;  3MGS A;  4CSR A;  4EO5 C;  1P3G A;  5B1M A;  3TU4 C;  5B40 B;  3REJ A;  2FJ7 A;  3UTA A;  3NQU A;  2CV5 A;  5F99 C;  3REH D;  1P3A C;  2NZD A;  1BH9 B;  3EPL A;  4H9S C;  4R8P C;  4YM6 D;  1P3B B;  5B1L A;  3AV1 A;  1M1A A;  5B31 C;  3KUY C;  2Y2P A;  3AZF D;  1ID3 D;  3AZG B;  3AZE B;  3MGP D;  1BFM A;  3MGR B;  5AVC B;  1KX4 C;  3AZL A;  4QLC D;  5B2I C;  4ZUX C;  3MVD B;  4J8X A;  5BO0 B;  1S32 C;  4J8V B;  3C1C A;  1EQZ B;  4WU8 A;  3VH5 A;  1HQ3 B;  3H0M C;  3F6T A;  2IO5 C;  4M6B A;  3W97 D;  5C3I C;  4G91 C;  5AV8 D;  4CAY B;  4YS3 C;  5JA4 A;  3AV2 D;  1WWS A;  3MGQ A;  1W2E A;  5CPI D;  3B0C T;  3KWQ A;  1P3O B;  4JJN C;  4YM6 C;  3REL A;  2F8N D;  3WAA B;  5B32 C;  1TZY D;  3C1B A;  5AVB A;  1JFI B;  5B24 B;  3REJ B;  3W96 A;  5B33 A;  3UTA B;  3AZF C;  1ID3 C;  4DRA A;  3MGP C;  3B0D C;  2JCH A;  1P3L C;  1ZLA A;  4H9P B;  5CP6 A;  3AZJ A;  3AFA A;  2NZD B;  3WTP E;  2BYK A;  2Y2O A;  3UT9 D;  3LJA D;  3AV1 B;  1AOI D;  3W97 C;  2VQR A;  4UPK A;  5AV6 C;  1N1J B;  3WKJ B;  5DNN D;  5BS7 A;  3X1V A;  3AZL B;  1U35 B;  4DQY B;  3AN2 D;  3AV2 C;  3B6F A;  1Z2C B;  2W8S A;  3X1U D;  4AWL B;  1TAF A;  5CPI C;  4Z66 D;  3C1C B;  1KX5 D;  4KGC A;  1P34 B;  2DQN C;  4X23 A;  1M18 B;  1TZY C;  3LZ0 A;  5AV9 A;  3AZK D;  2F8N H;  3KXB A;  4ZBJ C;  5JRG C;  1KX3 A;  2ZY5 A;  3W98 B;  2XD5 A;  5B40 A;  3UTB D;  3MNN D;  3UT9 C;  3X1T D;  1P3I D;  4XZQ B;  5GSU B;  1ULY A;  5CPK D;  3A6N A;  1AOI C;  3AZH B;  1BH9 A;  4Z2M G;  1P3B A;  5GT0 D;  4J8U D;  4H9R B;  3AZN C;  3AFA B;  1P3M D;  3AN2 C;  3B6G A;  2HUE B;  3AZI D;  1M19 A;  4KUD B;  3X1U C;  5F99 D;  3AZE A;  4Z66 C;  2UWX A;  3EPK A;  1KX5 C;  3TU4 A;  3REI D;  4WU9 C;  1P3A D;  3REK B;  3MGR A;  3AYW D;  2ZY2 A;  3MVD A;  3AZK C;  1T3U A;  5BO0 A;  4J8V A;  5CPJ D;  3X1S B;  3VH6 T;  1TAF B;  3UTB C;  3MNN C;  3X1T C;  3IP4 C;  1P3I C;  5CPK C;  3WA9 D;  5KDM A;  5B2I D;  5E5A D;  1P3P D;  5B2J B;  1F66 B;  2HIO B;  5GXQ C;  1P3O A;  3LEL D;  5AY8 C;  5GT0 C;  4J8U C;  3WAA A;  1BH8 B;  1P3M C;  1JFI A;  2RIQ A;  5DNM D;  5B24 A;  3AZI C;  2ARO A;  3A6N B;  4DRB A;  4YS3 D;  2Y2Q A;  4Z5T B;  5B0Z D;  3O62 D;  2NQB D;  3REI C;  4H9P A;  1WWI A;  4NE3 A;  3AYW C;  2PYO D;  3W99 B;  4JJN D;  5B0Y B;  2RVQ D;  3V9R A;  5GT3 D;  1P3F D;  3REH A;  3MGS D;  4LD9 D;  5B32 D;  4H9O A;  1P3K B;  5FUG A;  4XUJ B;  5BNX B;  1P3G D;  4J8W B;  3B6G B;  5B1M D;  5CPJ C;  1M19 B;  4EO5 B;  5G49 B;  4E45 A;  2FJ7 D;  2CV5 D;  1R4V A;  2Y2J A;  3AZG C;  3B0C W;  3TU4 B;  2LY8 A;  1N1J A;  3WKJ A;  1P3L D;  3AZF A;  1U35 A;  3WA9 C;  5E5A C;  3LZ1 C;  5AVC C;  1P3P C;  5B1L D;  4HGA B;  1P34 A;  1M1A D;  3LEL C;  4QLC A;  1EQZ C;  4R8P B;  4NE5 A;  4WZS B;  1M18 A;  5AV6 D;  5B31 B;  5DNM C;  3KUY B;  3B0B A;  1HTA A;  5KDM B;  5AV5 D;  5B0Z C;  3W98 A;  3O62 C;  3AZM D;  2NQB C;  2PYO C;  5AV8 A;  1KX4 B;  2RVQ C;  5GT3 C;  4ZUX B;  1P3F C;  3VH5 W;  4XZQ A;  1H3O B;  5GSU A;  3MGS C;  4LD9 C;  1P3G C;  1S32 B;  3AZH A;  5B1M C;  2ARO B;  5JRG D;  2FJ7 C;  2IO5 B;  2CV5 C;  2F8N G;  4H9R A;  5C3I B;  3EPJ A;  3MGQ D;  4G91 B;  2BG1 A;  2Y2K A;  2NZD C;  3V9R B;  3KWQ D;  4NE6 A;  3REH B;  4KUD A;  4H9O B;  3REL D;  3EPH A;  5FUG B;  5B1L C;  3C1B D;  5AVB D;  1M1A C;  3REK A;  4YM6 B;  3W96 D;  5B33 D;  5B32 B;  3LJA A;  2L5A A;  3AZN D;  3AZF B;  1ID3 B;  1ZLA D;  5CP6 D;  5AV5 C;  3X1S A;  3AZM C;  3AZL C;  3MGP B;  4G92 C;  3B0D B;  5DNN A;  1P3L B;  4J8X C;  2ZY4 A;  3H0L C;  3WTP D;  4AWL C;  4QLC B;  4WU9 D;  1M1A B;  4WU8 C;  2BYM B;  3VH6 A;  5B2J A;  1F66 A;  3W97 B;  2HIO A;  3X1V D;  2XD1 A;  1F1E A;  3B6F D;  1BH8 A;  2Y2M A;  3MGQ C;  2YFV B;  5AV8 B;  4KGC D;  4H9Q B;  3KWQ C;  3AV2 B;  4NFT A;  4X23 D;  3REL C;  2YFW B;  4Z5T A;  5CPI B;  3LZ0 D;  5AVB C;  3C1B C;  3UTB A;  2F8N B;  3W96 C;  3VH6 W;  3KXB D;  5B33 C;  3W99 A;  5GXQ D;  1TZY B;  4KHA B;  5AY8 D;  5B0Y A;  1KX3 D;  1Q9C A;  1P3K A;  4XUJ A;  5BNX A;  3NQJ A;  4J8W A;  5CP6 C;  4ZBJ B;  3AFA C;  5JRG B;  3AZJ C;  5B40 D;  1ZLA C;  2Y2H A;  5G49 A;  3WTP C;  3UT9 B;  4WJ3 C;  2G5I C;  3LJA B;  5F99 A;  1AOI B;  3AL0 C;  5BNV B;  1P3A A;  5BS7 C;  3AYW A;  5CHL B;  3X1V C;  4WV4 B;  4H9S A;  4R8P A;  3B6F C;  4H9N B;  5DNN B;  3KSY A;  3A1K A;  3AZG D;  5B31 A;  3AZE D;  3KUY A;  4KGC C;  3AN2 B;  5B31 G;  4X23 C;  3X1U B;  3MGR D;  2Y2G A;  2Y2L A;  5AVC D;  3LZ1 D;  3LZ0 C;  4Z66 B;  5AV9 C;  3MVD D;  1KX5 B;  3KXB C;  1KX4 A;  4J8V D;  5B2I A;  4ZUX A;  3AZK B;  1KX3 C;  1EQZ D;  1H3O A;  1HQ3 D;  1PZR A;  1S32 A;  5B40 C;  4WNN B;  1KU5 A;  4UUZ A;  3A6N C;  3UTB B;  3MNN B;  3X1T B;  1P3I B;  5CPK B;  4YS3 A;  1P3O D;  1P3B C;  2Y2I A;  3NQJ B;  3WAA D;  2PYO A;  4JJN A;  4YM6 A;  5GT0 B;  5GT3 A;  5B24 D;  3REJ D;  4J8U B;  3UTA D;  1M19 C;  5B32 A;  5B32 G;  1P3M B;  3AZE C;  2F8N K;  3R45 B;  3AZI B;  1ID3 A;  3MGR C;  2NZD D;  3KFU G;  5F99 B;  3MVD C;  3MGP A;  1B67 A;  3REI B;  1P3L A;  1P3A B;  3AYW B;  3AV1 D;  2ZM5 A;  4J8V C;  4HGA C;  1HQ3 C;  5CPJ B;  2BYM A;  3WKJ D;  3W97 A;  3AZL D;  1U35 D;  5AV6 A;  4J8X D;  2YFV A;  3WA9 B;  4H9Q A;  5B2I B;  5AV5 A;  5E5A B;  3LZ1 B;  3C1C D;  3AV2 A;  3AZM A;  1B6W A;  4WU8 D;  1P34 D;  2YFW A;  1P3O C;  1P3P B;  3WAA C;  1M18 D;  5CPI A;  3LEL B;  5B24 C;  3REJ C;  2F8N A;  2ARO C;  3UTA C;  1TZY A;  4KHA A;  4UUZ B;  1A7W A;  3W98 D;  5DNM B;  5JRG A;  4YS3 B;  5B0Z B;  3O62 B;  2NQB B;  3REH C;  4XZQ D;  5GSU D;  2PYO B;  3AV1 C;  3FDD A;  4JJN B;  2G5H C;  3UT9 A;  3AZH D;  5GT3 B;  1P3F B;  4LD9 B;  3MGS B;  4CSR B;  4E44 A;  1P3G B;  1AOI A;  5B1M B;  3WKJ C;  5BNV A;  3AZJ D;  3AFA D;  2FJ7 B;  3NQU B;  1U35 C;  2CV5 B;  4H9N A;  4KUD D;  3AZN A;  3EG5 B;  3C1C C;  3AN2 A;  1P34 C;  4QLC C;  3X1U A;  3REK D;  1M18 C;  4Z66 A;  1KX5 A;  5B1L B;  3WTP A;  4WU9 A; 
#chains in the Genus database with same CATH homology
 3AZK A;  5AV6 B;  3H0R C;  3X1S D;  3W98 C;  3VH5 T;  4WNN A;  5AV5 B;  5AV8 C;  3AZM B;  4G92 B;  2J8P A;  4XZQ C;  5GSU C;  4J8X B;  5AV9 D;  2FFF B;  3MNN A;  3AZH C;  2F2A C;  3X1T A;  1P3I A;  4WU8 B;  5B2J D;  5CPK A;  1F66 D;  2HIO D;  5GXQ A;  5AY8 A;  5GT0 A;  2HUE C;  3A1I A;  4KUD C;  5JA4 B;  4J8U A;  3MGQ B;  3A6N D;  1P3M A;  4Z5T D;  3R45 A;  3AZI A;  3KWQ B;  2CWE A;  3REK C;  3REL B;  3W99 D;  3LJA C;  1P3B D;  3C1B B;  5AVB B;  5B0Y D;  5BT1 D;  3REI A;  1P3K D;  3W96 B;  4XUJ D;  5B33 B;  4J8W D;  3B6G D;  2ZY3 A;  3X1S C;  1M19 D;  3AZN B;  5DNN C;  3P5J B;  1ZLA B;  5CP6 B;  3AZJ B;  2JSS A;  3TU4 D;  5CPJ A;  2Y2N A;  2BYK B;  3AZG A;  3WTP B;  4WU9 B;  5B2J C;  1F66 C;  3WA9 A;  5E5A A;  3LZ1 A;  2HIO C;  5AVC A;  1P3P A;  4R8P D;  3X1V B;  5B31 D;  3LEL A;  1EQZ A;  3KUY D;  3B6F B;  1HQ3 A;  4Z5T C;  5DNM A;  4KGC B;  4X23 B;  2DF4 C;  2JE5 A;  3W99 C;  5B0Z A;  1KX4 D;  3O62 A;  3LZ0 B;  4CAY A;  5AV9 B;  5BT1 C;  4Z2M H;  4ZUX D;  5B0Y C;  2NQB A;  1P3K C;  4XUJ C;  3KXB B;  5GXQ B;  4J8W C;  1S32 D;  3B6G C;  5AY8 B;  1P3F A;  1KX3 B;  4LD9 A;  2ARO D;  3MGS A;  4CSR A;  4EO5 C;  1P3G A;  5B1M A;  3TU4 C;  5B40 B;  3REJ A;  2FJ7 A;  3UTA A;  3NQU A;  2CV5 A;  5F99 C;  3REH D;  1P3A C;  2NZD A;  1BH9 B;  3EPL A;  4H9S C;  4R8P C;  4YM6 D;  1P3B B;  5B1L A;  3AV1 A;  1M1A A;  5B31 C;  3KUY C;  2Y2P A;  3AZF D;  1ID3 D;  3AZG B;  3AZE B;  3MGP D;  1BFM A;  3MGR B;  5AVC B;  1KX4 C;  3AZL A;  4QLC D;  5B2I C;  4ZUX C;  3MVD B;  4J8X A;  5BO0 B;  1S32 C;  4J8V B;  3C1C A;  1EQZ B;  4WU8 A;  3VH5 A;  1HQ3 B;  3H0M C;  3F6T A;  2IO5 C;  4M6B A;  3W97 D;  5C3I C;  4G91 C;  5AV8 D;  4CAY B;  4YS3 C;  5JA4 A;  3AV2 D;  1WWS A;  3MGQ A;  1W2E A;  5CPI D;  3B0C T;  3KWQ A;  1P3O B;  4JJN C;  4YM6 C;  3REL A;  2F8N D;  3WAA B;  5B32 C;  1TZY D;  3C1B A;  5AVB A;  1JFI B;  5B24 B;  3REJ B;  3W96 A;  5B33 A;  3UTA B;  3AZF C;  1ID3 C;  4DRA A;  3MGP C;  3B0D C;  2JCH A;  1P3L C;  1ZLA A;  4H9P B;  5CP6 A;  3AZJ A;  3AFA A;  2NZD B;  3WTP E;  2BYK A;  2Y2O A;  3UT9 D;  3LJA D;  3AV1 B;  1AOI D;  3W97 C;  2VQR A;  4UPK A;  5AV6 C;  1N1J B;  3WKJ B;  5DNN D;  5BS7 A;  3X1V A;  3AZL B;  1U35 B;  4DQY B;  3AN2 D;  3AV2 C;  3B6F A;  1Z2C B;  2W8S A;  3X1U D;  4AWL B;  1TAF A;  5CPI C;  4Z66 D;  3C1C B;  1KX5 D;  4KGC A;  1P34 B;  2DQN C;  4X23 A;  1M18 B;  1TZY C;  3LZ0 A;  5AV9 A;  3AZK D;  2F8N H;  3KXB A;  4ZBJ C;  5JRG C;  1KX3 A;  2ZY5 A;  3W98 B;  2XD5 A;  5B40 A;  3UTB D;  3MNN D;  3UT9 C;  3X1T D;  1P3I D;  4XZQ B;  5GSU B;  1ULY A;  5CPK D;  3A6N A;  1AOI C;  3AZH B;  1BH9 A;  4Z2M G;  1P3B A;  5GT0 D;  4J8U D;  4H9R B;  3AZN C;  3AFA B;  1P3M D;  3AN2 C;  3B6G A;  2HUE B;  3AZI D;  1M19 A;  4KUD B;  3X1U C;  5F99 D;  3AZE A;  4Z66 C;  2UWX A;  3EPK A;  1KX5 C;  3TU4 A;  3REI D;  4WU9 C;  1P3A D;  3REK B;  3MGR A;  3AYW D;  2ZY2 A;  3MVD A;  3AZK C;  1T3U A;  5BO0 A;  4J8V A;  5CPJ D;  3X1S B;  3VH6 T;  1TAF B;  3UTB C;  3MNN C;  3X1T C;  3IP4 C;  1P3I C;  5CPK C;  3WA9 D;  5KDM A;  5B2I D;  5E5A D;  1P3P D;  5B2J B;  1F66 B;  2HIO B;  5GXQ C;  1P3O A;  3LEL D;  5AY8 C;  5GT0 C;  4J8U C;  3WAA A;  1BH8 B;  1P3M C;  1JFI A;  2RIQ A;  5DNM D;  5B24 A;  3AZI C;  2ARO A;  3A6N B;  4DRB A;  4YS3 D;  2Y2Q A;  4Z5T B;  5B0Z D;  3O62 D;  2NQB D;  3REI C;  4H9P A;  1WWI A;  4NE3 A;  3AYW C;  2PYO D;  3W99 B;  4JJN D;  5B0Y B;  2RVQ D;  3V9R A;  5GT3 D;  1P3F D;  3REH A;  3MGS D;  4LD9 D;  5B32 D;  4H9O A;  1P3K B;  5FUG A;  4XUJ B;  5BNX B;  1P3G D;  4J8W B;  3B6G B;  5B1M D;  5CPJ C;  1M19 B;  4EO5 B;  5G49 B;  4E45 A;  2FJ7 D;  2CV5 D;  1R4V A;  2Y2J A;  3AZG C;  3B0C W;  3TU4 B;  2LY8 A;  1N1J A;  3WKJ A;  1P3L D;  3AZF A;  1U35 A;  3WA9 C;  5E5A C;  3LZ1 C;  5AVC C;  1P3P C;  5B1L D;  4HGA B;  1P34 A;  1M1A D;  3LEL C;  4QLC A;  1EQZ C;  4R8P B;  4NE5 A;  4WZS B;  1M18 A;  5AV6 D;  5B31 B;  5DNM C;  3KUY B;  3B0B A;  1HTA A;  5KDM B;  5AV5 D;  5B0Z C;  3W98 A;  3O62 C;  3AZM D;  2NQB C;  2PYO C;  5AV8 A;  1KX4 B;  2RVQ C;  5GT3 C;  4ZUX B;  1P3F C;  3VH5 W;  4XZQ A;  1H3O B;  5GSU A;  3MGS C;  4LD9 C;  1P3G C;  1S32 B;  3AZH A;  5B1M C;  2ARO B;  5JRG D;  2FJ7 C;  2IO5 B;  2CV5 C;  2F8N G;  4H9R A;  5C3I B;  3EPJ A;  3MGQ D;  4G91 B;  2BG1 A;  2Y2K A;  2NZD C;  3V9R B;  3KWQ D;  4NE6 A;  3REH B;  4KUD A;  4H9O B;  3REL D;  3EPH A;  5FUG B;  5B1L C;  3C1B D;  5AVB D;  1M1A C;  3REK A;  4YM6 B;  3W96 D;  5B33 D;  5B32 B;  3LJA A;  2L5A A;  3AZN D;  3AZF B;  1ID3 B;  1ZLA D;  5CP6 D;  5AV5 C;  3X1S A;  3AZM C;  3AZL C;  3MGP B;  4G92 C;  3B0D B;  5DNN A;  1P3L B;  4J8X C;  2ZY4 A;  3H0L C;  3WTP D;  4AWL C;  4QLC B;  4WU9 D;  1M1A B;  4WU8 C;  2BYM B;  3VH6 A;  5B2J A;  1F66 A;  3W97 B;  2HIO A;  3X1V D;  2XD1 A;  1F1E A;  3B6F D;  1BH8 A;  2Y2M A;  3MGQ C;  2YFV B;  5AV8 B;  4KGC D;  4H9Q B;  3KWQ C;  3AV2 B;  4NFT A;  4X23 D;  3REL C;  2YFW B;  4Z5T A;  5CPI B;  3LZ0 D;  5AVB C;  3C1B C;  3UTB A;  2F8N B;  3W96 C;  3VH6 W;  3KXB D;  5B33 C;  3W99 A;  5GXQ D;  1TZY B;  4KHA B;  5AY8 D;  5B0Y A;  1KX3 D;  1Q9C A;  1P3K A;  4XUJ A;  5BNX A;  3NQJ A;  4J8W A;  5CP6 C;  4ZBJ B;  3AFA C;  5JRG B;  3AZJ C;  5B40 D;  1ZLA C;  2Y2H A;  5G49 A;  3WTP C;  3UT9 B;  4WJ3 C;  2G5I C;  3LJA B;  5F99 A;  1AOI B;  3AL0 C;  5BNV B;  1P3A A;  5BS7 C;  3AYW A;  5CHL B;  3X1V C;  4WV4 B;  4H9S A;  4R8P A;  3B6F C;  4H9N B;  5DNN B;  3KSY A;  3A1K A;  3AZG D;  5B31 A;  3AZE D;  3KUY A;  4KGC C;  3AN2 B;  5B31 G;  4X23 C;  3X1U B;  3MGR D;  2Y2G A;  2Y2L A;  5AVC D;  3LZ1 D;  3LZ0 C;  4Z66 B;  5AV9 C;  3MVD D;  1KX5 B;  3KXB C;  1KX4 A;  4J8V D;  5B2I A;  4ZUX A;  3AZK B;  1KX3 C;  1EQZ D;  1H3O A;  1HQ3 D;  1PZR A;  1S32 A;  5B40 C;  4WNN B;  1KU5 A;  4UUZ A;  3A6N C;  3UTB B;  3MNN B;  3X1T B;  1P3I B;  5CPK B;  4YS3 A;  1P3O D;  1P3B C;  2Y2I A;  3NQJ B;  3WAA D;  2PYO A;  4JJN A;  4YM6 A;  5GT0 B;  5GT3 A;  5B24 D;  3REJ D;  4J8U B;  3UTA D;  1M19 C;  5B32 A;  5B32 G;  1P3M B;  3AZE C;  2F8N K;  3R45 B;  3AZI B;  1ID3 A;  3MGR C;  2NZD D;  3KFU G;  5F99 B;  3MVD C;  3MGP A;  1B67 A;  3REI B;  1P3L A;  1P3A B;  3AYW B;  3AV1 D;  2ZM5 A;  4J8V C;  4HGA C;  1HQ3 C;  5CPJ B;  2BYM A;  3WKJ D;  3W97 A;  3AZL D;  1U35 D;  5AV6 A;  4J8X D;  2YFV A;  3WA9 B;  4H9Q A;  5B2I B;  5AV5 A;  5E5A B;  3LZ1 B;  3C1C D;  3AV2 A;  3AZM A;  1B6W A;  4WU8 D;  1P34 D;  2YFW A;  1P3O C;  1P3P B;  3WAA C;  1M18 D;  5CPI A;  3LEL B;  5B24 C;  3REJ C;  2F8N A;  2ARO C;  3UTA C;  1TZY A;  4KHA A;  4UUZ B;  1A7W A;  3W98 D;  5DNM B;  5JRG A;  4YS3 B;  5B0Z B;  3O62 B;  2NQB B;  3REH C;  4XZQ D;  5GSU D;  2PYO B;  3AV1 C;  3FDD A;  4JJN B;  2G5H C;  3UT9 A;  3AZH D;  5GT3 B;  1P3F B;  4LD9 B;  3MGS B;  4CSR B;  4E44 A;  1P3G B;  1AOI A;  5B1M B;  3WKJ C;  5BNV A;  3AZJ D;  3AFA D;  2FJ7 B;  3NQU B;  1U35 C;  2CV5 B;  4H9N A;  4KUD D;  3AZN A;  3EG5 B;  3C1C C;  3AN2 A;  1P34 C;  4QLC C;  3X1U A;  3REK D;  1M18 C;  4Z66 A;  1KX5 A;  5B1L B;  3WTP A;  4WU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...