3LJAD

Using soft x-rays for a detailed picture of divalent metal binding in the nucleosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ljaD00
3W96A 3REJD 4G92C 4WV4B 5AV9A 3LZ0B 3MGSC 5B1LA 3B6FB 3AZNA 1BFMA 3KUYA 2BYKA 4XZQC 3AV1C 3RELA 3AYWB 4J8XB 3UTAC 2PYOC 1EQZB 5AVCD 3AN2A 3AZLB 4QLCC 5BT1D 4YM6D 4J8UA 2NZDB 3W98A 5BNXB 3MVDB 1M18B 5AVBB 5DNMC 3MGQB 3REIB 5BNVA 3REJC 4UUZA 5C3IB 3C1CD 1TAFA 3REHA 3LELB 5GXQD 3B0CW 2CV5C 4ZUXC 5AY8B 4Z2MH 3AZKD 4H9OB 5B1MA 3WTPE 4WU8A 3B0DC 1S32D 5FUGA 5AVCC 1ZLAA 1P3ID 3LZ1D 5F99B 2NQBA 5CPIA 4CAYB 5B0ZD 5JRGB 5B31A 3MGRA 5KDMA 5DNNA 3LZ0D 3C1CC 3REKA 1P3FB 5B0YB 4R8PB 5GXQC 3B6GB 1M1AB 3AYWD 4J8XD 3WA9A 3X1VB 3C1BC 1P3PB 1U35A 1EQZD 3AFAB 3UTBA 4JJNA 3AZLD 1P3IC 3LZ1C 3AZJA 5B2IA 2NZDD 3MVDD 4WU9B 5AV8A 1M18D 5AVBD 5CPKB 3WAAA 4Z66A 3VH5A 5B33A 3REID 1HQ3A 4XUJB 3LZ0C 3AZMB 3B6FC 3W97B 4H9RA 1H3OB 2YFWA 3LELD 4YS3A 1P34C 5CHLB 5AY8D 1P3AB 3W96B 3AYWC 4J8XC 3AZNB 1B6WA 1EQZC 5CP6A 5B2JC 3AZLC 5F99D 1KX4C 2NZDC 3MVDC 5AVBC 5JRGD 3MGQC 1ID3A 3REIC 4H9QA 3KXBA 3AZFA 4WZSB 5C3IC 5DNMB 3MGPA 3B0CT 3X1TA 3W99C 1P3FD 5B0YD 4R8PD 3LELC 1ULYA 2CWEA 3B6GD 4NE6A 5AV6C 1P3BB 1M1AD 5AY8C 5BNVB 3X1VD 1P3PD 3AFAD 2CV5B 4ZUXB 3WKJA 2F8NH 5E5AB 1AOIA 2F8NG 4WU9D 5GSUA 3B0DB 5CPKD 5JRGC 5G49A 1P3MD 4XUJD 3O62A 3AZMD 3VH5T 2AROB 1P3FC 5B0YC 4R8PC 2HIOB 1P3AD 3W96D 2BYMA 4LD9A 1P3LA 3X1SB 3AZGA 1P3GB 3X1VC 1WWIA 3AZND 3REKB 3AFAC 4DRAA 1N1JB 3KWQC 3UTAD 4H9PA 2PYOD 4WU9C 1B67A 3NQUA 1U35B 1F1EA 1JFIA 4EO5B 5B32A 4XUJC 3AZJB 5B2IB 3AZMC 3TU4A 5DNMD 4H9SA 3W97C 2F8NB 4Z66B 1M19A 1P3BD 3W96C 3VH6W 1BH9B 1P3AC 5JA4B 1HQ3B 5AV9C 3AZNC 1P34B 2CV5D 4ZUXD 3X1UA 3KUYC 5B40A 5E5AD 3RELC 5B2JB 3WTPB 1KX4B 4Z5TA 3A6NB 3LJAA 4J8UC 3W98C 2AROD 3MNNA 3MGSA 2HIOD 1P3BC 3X1SD 4H9QB 4XZQA 1P3GD 1P3OB 1KX3B 3NQJB 3AV1A 3W99B 5AV5A 5AV6B 3X1TB 3R45A 3REHC 5E5AC 3C1BD 4QLCA 5B24A 5B1MC 5GT3B 3AV2B 5GT0A 2NQBC 2JSSA 5CPIC 3AZJD 4H9NA 4J8VA 5GSUB 2AROC 2F8ND 1F66A 4Z66D 4NE3A 1BH8B 1KU5A 2HIOC 3B6FD 3MGRC 1WWSA 3X1SC 1HQ3D 1P3GC 4KGCB 3REKC 1P34D 2FJ7B 3AZIA 1P3KB 5AVCA 4KHAA 5B2JD 3WTPD 3KWQB 4X23B 4YM6A 1R4VA 1U35C 1KX4D 1KX5A 4H9PB 4EO5C 3A6ND 3AZJC 3V9RA 5B2IC 3MGQD 1TZYA 4M6BA 4WNNB 4Z66C 3NQUB 1KX3D 1P3OD 5BO0A 1HQ3C 5GXQA 3W99D 5AV6D 3AZKA 1M19B 5AV9B 4DRBA 1S32A 5B1LB 1P3IA 3KUYB 5GT3D 3WTPC 2BYKB 3AV2D 3X1UB 3RELB 2F8NK 5B31G 5CPJA 5B0ZA 3A6NC 5BS7C 3AN2B 4G91B 3B0BA 1ID3C 1KX3C 4Z5TB 3KXBC 4J8UB 3AZFC 1P3OC 3W98B 4KGCD 3AYWA 3MGPC 4J8XA 2FJ7D 3X1TC 2HUEC 1P3KD 4UUZB 3AZLA 1TAFB 3REHB 3KWQD 5GT3C 4X23D 5AV5B 3AV2C 5BNXA 3MVDA 1M18A 5AVBA 3WKJC 5B1MB 3REIA 4E44A 4WU8B 5GSUC 5FUGB 1ZLAB 1HTAA 2NQBB 5CPIB 3W97D 3LELA 4KGCC 4J8VB 3O62C 5AY8A 3UT9A 2FJ7C 5B31B 4H9OA 3MGRB 1P3KC 5KDMB 1F66B 5DNNB 5AV9D 5B1LD 4LD9C 3AZGC 5F99A 3KUYD 4CAYA 4KUDA 4X23C 3X1UD 3RELD 2L5AA 3AZIB 3WA9B 3AZEA 3AZHA 2YFVA 3AN2D 3UTBB 4JJNB 1KX5B 1P3FA 4Z5TD 4J8UD 3W98D 3B6GA 5AV8B 1M1AA 3TU4C 3WAAB 4H9SC 5B33B 1TZYB 4CSRA 1M19C 1P3PA 3AFAA 5B1LC 4H9RB 3REHD 4J8WA 2YFWB 5AV5D 4YS3B 3X1UC 5CPKA 5B40C 5B1MD 4WU8D 1P3MA 3VH6A 4XUJA 5CP6B 3AN2C 1ZLAD 4G91C 2NQBD 5CPID 2LY8A 2RVQC 3KSYA 4Z5TC 5CPJB 4J8VD 1P3AA 5B31D 1ID3B 3MGRD 3MNNC 1F66D 3KXBB 3AZFB 5DNND 3REKD 3MGPB 3UTAA 2HUEB 2PYOA 5AV5C 4HGAC 3AZID 3WA9D 4E45A 5B32G 4ZBJB 5B24C 4WU8C 1U35D 3UTBD 4JJND 1ZLAC 3WKJB 5DNMA 5GT0C 1AOIB 5B2ID 1KX5D 3REJA 5AV8D 4J8VC 1P3BA 3WAAD 5B33D 1TZYD 5B31C 5G49B 4NFTA 1Q9CA 1F66C 5DNNC 2CV5A 4ZUXA 3O62B 4AWLB 5E5AA 3UT9B 4YS3D 4Z2MG 2BYMB 3AZIC 1P3LB 4LD9B 3AZGB 3WA9C 5BT1C 5CP6D 3UTBC 4JJNC 4KUDB 4YM6C 2AROA 1KX5C 5CPJD 3AZEB 2HIOA 3VH6T 5AV8C 3AZHB 3WAAC 3C1CA 3X1SA 2YFVB 5B33C 1TZYC 1P3GA 1ID3D 1JFIB 3KXBD 3AZFD 5B32B 3TU4B 1N1JA 3MGPD 3X1TD 3VH5W 3C1BA 4YS3C 3AZKC 4CSRB 3LZ1A 1S32C 5CP6C 1A7WA 4J8WB 3WKJD 5B40B 1AOID 2F8NA 5GSUD 5CPJC 5B0ZC 1BH9A 3LZ0A 3B6FA 5JA4A 1P3MB 2IO5B 1P34A 3LJAB 3O62D 4G92B 3MNNB 3MGSB 3UT9D 1EQZA 5B2JA 3WTPA 1P3LD 3AZGD 4XZQB 4LD9D 3AV1B 1KX4A 4NE5A 4ZBJC 3UTAB 2NZDA 4HGAB 3R45B 3A6NA 4KUDD 2PYOB 5BS7A 3MGQA 1AOIC 1M18C 4QLCB 5B24B 3AZED 3AZHD 1KX3A 1P3OA 5GT0B 3NQJA 3W99A 5B32D 4H9NB 5AV6A 3TU4D 3REJB 4AWLC 1M19D 3UT9C 5GT3A 1P3LC 3AV2A 5F99C 4J8WD 4KUDC 5B40D 5JRGA 5AVCB 4KHAB 1BH8A 3AZEC 3AZHC 4YM6B 4KGCA 2RVQD 5B0YA 4R8PA 5B32C 3LJAD 2FJ7A 3V9RB 1P3KA 3B6GC 3MNND 3MGSD 3X1VA 1M1AC 3C1CB 3KWQA 4XZQD 4X23A 5BO0B 3AV1D 5GXQB 1P3PC 3AZKB 4WU9A 4J8WC 3C1BB 1S32B 5CPKC 4QLCD 5B24D 4WNNA 1P3IB 3LZ1B 3AZMA 3W97A 1P3MC 5GT0D 2IO5C 1H3OA 5B0ZB 3LJAC
chains in the Genus database with same CATH superfamily
3W96A 3REJD 4G92C 4WV4B 5AV9A 3LZ0B 3MGSC 5B1LA 3B6FB 3AZNA 1BFMA 3KUYA 2BYKA 4XZQC 3AV1C 3RELA 3AYWB 4J8XB 3UTAC 2PYOC 1EQZB 5AVCD 3AN2A 3AZLB 4QLCC 5BT1D 2F2AC 4YM6D 4J8UA 3W98A 2NZDB 5BNXB 3MVDB 1M18B 5AVBB 5DNMC 3MGQB 3REIB 5BNVA 3REJC 4UUZA 5C3IB 3C1CD 1TAFA 3REHA 3LELB 5GXQD 3B0CW 2Y2OA 2CV5C 4ZUXC 5AY8B 4Z2MH 3AZKD 4H9OB 5B1MA 3WTPE 2JCHA 4WU8A 3B0DC 1S32D 5FUGA 5AVCC 1ZLAA 1P3ID 3LZ1D 5F99B 2NQBA 5CPIA 4CAYB 5B0ZD 2XD1A 5JRGB 5B31A 3MGRA 5KDMA 5DNNA 3LZ0D 3C1CC 3REKA 1P3FB 5B0YB 4R8PB 5GXQC 3B6GB 1M1AB 3AYWD 4J8XD 2J8PA 3WA9A 3X1VB 3C1BC 1P3PB 1U35A 1EQZD 3AFAB 3UTBA 4JJNA 3AZLD 1P3IC 3LZ1C 2FFFB 3AZJA 5B2IA 2NZDD 3MVDD 4WU9B 5AV8A 1M18D 5AVBD 5CPKB 3WAAA 4Z66A 3VH5A 2Y2IA 5B33A 3REID 1HQ3A 4XUJB 3LZ0C 3AZMB 3B6FC 3W97B 4H9RA 1H3OB 2YFWA 3LELD 4YS3A 1P34C 5CHLB 5AY8D 1P3AB 3W96B 3AYWC 4J8XC 3AZNB 1B6WA 1EQZC 5CP6A 5B2JC 3AZLC 5F99D 1KX4C 2NZDC 3MVDC 5AVBC 5JRGD 3MGQC 1ID3A 3REIC 4H9QA 3KXBA 3AZFA 4WZSB 5C3IC 5DNMB 3MGPA 3B0CT 3X1TA 3W99C 3F6TA 1P3FD 5B0YD 4R8PD 3LELC 1ULYA 2CWEA 3B6GD 4NE6A 5AV6C 3EPKA 1P3BB 5AY8C 5BNVB 1M1AD 3X1VD 1P3PD 3AFAD 2CV5B 4ZUXB 2UWXA 3WKJA 2F8NH 5E5AB 1AOIA 2F8NG 4WU9D 5GSUA 3B0DB 5CPKD 5JRGC 5G49A 1P3MD 4XUJD 3O62A 3AZMD 3VH5T 2AROB 1P3FC 5B0YC 4R8PC 2HIOB 1P3AD 3W96D 2BYMA 4LD9A 1P3LA 3X1SB 3AZGA 1P3GB 3X1VC 1WWIA 2DQNC 3REKB 3AZND 3AFAC 1Z2CB 4DRAA 1N1JB 3KWQC 3UTAD 4H9PA 2PYOD 4WU9C 1B67A 3NQUA 1U35B 2Y2KA 1F1EA 1JFIA 1PZRA 4EO5B 5B32A 4XUJC 3AZJB 2Y2NA 5B2IB 3AZMC 3TU4A 5DNMD 4H9SA 3W97C 2F8NB 4Z66B 1M19A 1P3BD 3W96C 3VH6W 1BH9B 1P3AC 5JA4B 3A1KA 1HQ3B 5AV9C 2G5IC 3AZNC 1P34B 2CV5D 4ZUXD 3X1UA 3KUYC 5B40A 5E5AD 3RELC 3A1IA 5B2JB 3WTPB 3EPLA 1KX4B 4Z5TA 2XD5A 3A6NB 3LJAA 4J8UC 3W98C 2AROD 3MNNA 3MGSA 2HIOD 1P3BC 3KFUG 3X1SD 4H9QB 4XZQA 1P3GD 1P3OB 1KX3B 3NQJB 3AV1A 3W99B 5AV5A 5AV6B 3X1TB 3R45A 3REHC 2Y2QA 5E5AC 3C1BD 4QLCA 5B24A 5B1MC 5GT3B 3AV2B 5GT0A 2NQBC 2JSSA 5CPIC 3IP4C 3AZJD 4H9NA 4J8VA 5GSUB 2AROC 2F8ND 1F66A 4NE3A 1BH8B 4Z66D 3AL0C 1KU5A 2HIOC 2JE5A 3B6FD 3MGRC 1WWSA 3X1SC 1HQ3D 1P3GC 4KGCB 3REKC 1P34D 2FJ7B 3AZIA 1P3KB 5AVCA 4KHAA 5B2JD 3WTPD 3KWQB 4X23B 4YM6A 1R4VA 1U35C 1KX4D 1KX5A 4H9PB 4EO5C 3A6ND 3AZJC 3V9RA 5B2IC 3MGQD 1TZYA 4M6BA 4WNNB 4Z66C 3NQUB 1KX3D 1P3OD 5BO0A 1HQ3C 5GXQA 3W99D 5AV6D 3AZKA 1M19B 3EG5B 5AV9B 4DRBA 1S32A 5B1LB 1P3IA 3KUYB 5GT3D 3WTPC 2BYKB 3AV2D 3X1UB 3RELB 2F8NK 3H0MC 5B31G 5CPJA 5B0ZA 3A6NC 5BS7C 3AN2B 4G91B 3B0BA 1ID3C 4DQYB 1KX3C 4Z5TB 3KXBC 4J8UB 3AZFC 1P3OC 3W98B 4KGCD 3AYWA 3MGPC 4J8XA 2FJ7D 3X1TC 2HUEC 1P3KD 4UUZB 3AZLA 1TAFB 3REHB 3KWQD 5GT3C 4X23D 5AV5B 3AV2C 5BNXA 3MVDA 1M18A 5AVBA 3WKJC 5B1MB 3REIA 4E44A 4WU8B 5GSUC 5FUGB 1ZLAB 1HTAA 2NQBB 5CPIB 3EPJA 3W97D 3LELA 4KGCC 2ZY2A 4J8VB 3O62C 5AY8A 2Y2LA 3UT9A 2FJ7C 5B31B 4H9OA 3MGRB 1P3KC 5KDMB 1F66B 5DNNB 5AV9D 5B1LD 4LD9C 3AZGC 5F99A 3KUYD 4CAYA 4KUDA 4X23C 1W2EA 3X1UD 1T3UA 2L5AA 3RELD 3AZIB 3WA9B 3AZEA 3AZHA 2YFVA 3AN2D 3UTBB 4JJNB 1KX5B 1P3FA 4Z5TD 4J8UD 3W98D 3B6GA 5AV8B 2ZY3A 1M1AA 3TU4C 3WAAB 4H9SC 5B33B 1TZYB 4CSRA 1M19C 2ZM5A 1P3PA 3AFAA 5B1LC 4H9RB 3REHD 4J8WA 2YFWB 5AV5D 4YS3B 3X1UC 5CPKA 5B40C 5B1MD 2BG1A 4WU8D 1P3MA 2ZY5A 3VH6A 4XUJA 5CP6B 3AN2C 1ZLAD 4G91C 2NQBD 5CPID 2LY8A 3P5JB 2RVQC 3KSYA 4Z5TC 5CPJB 4J8VD 1P3AA 2VQRA 2Y2JA 5B31D 1ID3B 3MGRD 3MNNC 1F66D 3KXBB 3AZFB 5DNND 3REKD 3MGPB 3UTAA 2HUEB 2PYOA 5AV5C 4HGAC 2ZY4A 3AZID 3WA9D 4E45A 5B32G 4ZBJB 5B24C 4WU8C 1U35D 3UTBD 4JJND 1ZLAC 3WKJB 5DNMA 5GT0C 1AOIB 5B2ID 1KX5D 3REJA 5AV8D 4J8VC 2Y2MA 1P3BA 3WAAD 5B33D 1TZYD 5B31C 5G49B 4NFTA 1Q9CA 1F66C 2Y2GA 5DNNC 2CV5A 4ZUXA 3O62B 4AWLB 5E5AA 3UT9B 4YS3D 4Z2MG 2BYMB 3AZIC 1P3LB 4LD9B 3AZGB 3WA9C 5BT1C 5CP6D 3UTBC 4JJNC 4KUDB 4YM6C 2AROA 1KX5C 5CPJD 3AZEB 2HIOA 3VH6T 5AV8C 3AZHB 3WAAC 3C1CA 3X1SA 2YFVB 5B33C 1TZYC 1P3GA 1ID3D 1JFIB 3KXBD 3AZFD 5B32B 3TU4B 1N1JA 3MGPD 3X1TD 3VH5W 3C1BA 4YS3C 3AZKC 4CSRB 3LZ1A 1S32C 2DF4C 3H0RC 5CP6C 1A7WA 4J8WB 3WKJD 5B40B 1AOID 2F8NA 5GSUD 5CPJC 5B0ZC 1BH9A 3LZ0A 3B6FA 5JA4A 1P3MB 2G5HC 2IO5B 1P34A 3LJAB 3O62D 2Y2PA 4G92B 3MNNB 3MGSB 3UT9D 1EQZA 5B2JA 3WTPA 1P3LD 3AZGD 4XZQB 4LD9D 3AV1B 1KX4A 4NE5A 4ZBJC 3UTAB 2NZDA 4HGAB 3R45B 3A6NA 4KUDD 2PYOB 3H0LC 5BS7A 3MGQA 1AOIC 1M18C 4QLCB 5B24B 3AZED 3AZHD 1KX3A 1P3OA 5GT0B 3NQJA 3W99A 5B32D 4H9NB 5AV6A 3TU4D 3REJB 4AWLC 4WJ3C 1M19D 3UT9C 5GT3A 1P3LC 3AV2A 5F99C 4J8WD 4KUDC 5B40D 5JRGA 5AVCB 4KHAB 1BH8A 3AZEC 3AZHC 4YM6B 4KGCA 2RVQD 3FDDA 5B0YA 4R8PA 5B32C 3LJAD 2FJ7A 3V9RB 1P3KA 3B6GC 3MNND 3MGSD 3X1VA 2RIQA 4UPKA 3C1CB 1M1AC 3KWQA 4XZQD 4X23A 5BO0B 3AV1D 5GXQB 1P3PC 2W8SA 3AZKB 4WU9A 4J8WC 3C1BB 1S32B 5CPKC 4QLCD 5B24D 4WNNA 1P3IB 3LZ1B 3EPHA 3AZMA 3W97A 1P3MC 5GT0D 2Y2HA 2IO5C 1H3OA 5B0ZB 3LJAC
chains in the Genus database with same CATH topology
3W96A 3REJD 4G92C 4WV4B 5AV9A 3LZ0B 3MGSC 5B1LA 3B6FB 3AZNA 1BFMA 3KUYA 2BYKA 4XZQC 3AV1C 3RELA 3AYWB 4J8XB 3UTAC 2PYOC 1EQZB 5AVCD 3AN2A 3AZLB 4QLCC 5BT1D 2F2AC 4YM6D 4J8UA 3W98A 2NZDB 5BNXB 3MVDB 1M18B 5AVBB 5DNMC 3MGQB 3REIB 5BNVA 3REJC 4UUZA 5C3IB 3C1CD 1TAFA 3REHA 3LELB 5GXQD 3B0CW 2Y2OA 2CV5C 4ZUXC 5AY8B 4Z2MH 3AZKD 4H9OB 5B1MA 3WTPE 2JCHA 4WU8A 3B0DC 1S32D 5FUGA 5AVCC 1ZLAA 1P3ID 3LZ1D 5F99B 2NQBA 5CPIA 4CAYB 5B0ZD 2XD1A 5JRGB 5B31A 3MGRA 5KDMA 5DNNA 3LZ0D 3C1CC 3REKA 1P3FB 5B0YB 4R8PB 5GXQC 3B6GB 1M1AB 3AYWD 4J8XD 2J8PA 3WA9A 3X1VB 3C1BC 1P3PB 1U35A 1EQZD 3AFAB 3UTBA 4JJNA 3AZLD 1P3IC 3LZ1C 2FFFB 3AZJA 5B2IA 2NZDD 3MVDD 4WU9B 5AV8A 1M18D 5AVBD 5CPKB 3WAAA 4Z66A 3VH5A 2Y2IA 5B33A 3REID 1HQ3A 4XUJB 3LZ0C 3AZMB 3B6FC 3W97B 4H9RA 1H3OB 2YFWA 3LELD 4YS3A 1P34C 5CHLB 5AY8D 1P3AB 3W96B 3AYWC 4J8XC 3AZNB 1B6WA 1EQZC 5CP6A 5B2JC 3AZLC 5F99D 1KX4C 2NZDC 3MVDC 5AVBC 5JRGD 3MGQC 1ID3A 3REIC 4H9QA 3KXBA 3AZFA 4WZSB 5C3IC 5DNMB 3MGPA 3B0CT 3X1TA 3W99C 3F6TA 1P3FD 5B0YD 4R8PD 3LELC 1ULYA 2CWEA 3B6GD 4NE6A 5AV6C 3EPKA 1P3BB 5AY8C 5BNVB 1M1AD 3X1VD 1P3PD 3AFAD 2CV5B 4ZUXB 2UWXA 3WKJA 2F8NH 5E5AB 1AOIA 2F8NG 4WU9D 5GSUA 3B0DB 5CPKD 5JRGC 5G49A 1P3MD 4XUJD 3O62A 3AZMD 3VH5T 2AROB 1P3FC 5B0YC 4R8PC 2HIOB 1P3AD 3W96D 2BYMA 4LD9A 1P3LA 3X1SB 3AZGA 1P3GB 3X1VC 1WWIA 2DQNC 3REKB 3AZND 3AFAC 1Z2CB 4DRAA 1N1JB 3KWQC 3UTAD 4H9PA 2PYOD 4WU9C 1B67A 3NQUA 1U35B 2Y2KA 1F1EA 1JFIA 1PZRA 4EO5B 5B32A 4XUJC 3AZJB 2Y2NA 5B2IB 3AZMC 3TU4A 5DNMD 4H9SA 3W97C 2F8NB 4Z66B 1M19A 1P3BD 3W96C 3VH6W 1BH9B 1P3AC 5JA4B 3A1KA 1HQ3B 5AV9C 2G5IC 3AZNC 1P34B 2CV5D 4ZUXD 3X1UA 3KUYC 5B40A 5E5AD 3RELC 3A1IA 5B2JB 3WTPB 3EPLA 1KX4B 4Z5TA 2XD5A 3A6NB 3LJAA 4J8UC 3W98C 2AROD 3MNNA 3MGSA 2HIOD 1P3BC 3KFUG 3X1SD 4H9QB 4XZQA 1P3GD 1P3OB 1KX3B 3NQJB 3AV1A 3W99B 5AV5A 5AV6B 3X1TB 3R45A 3REHC 2Y2QA 5E5AC 3C1BD 4QLCA 5B24A 5B1MC 5GT3B 3AV2B 5GT0A 2NQBC 2JSSA 5CPIC 3IP4C 3AZJD 4H9NA 4J8VA 5GSUB 2AROC 2F8ND 1F66A 4NE3A 1BH8B 4Z66D 3AL0C 1KU5A 2HIOC 2JE5A 3B6FD 3MGRC 1WWSA 3X1SC 1HQ3D 1P3GC 4KGCB 3REKC 1P34D 2FJ7B 3AZIA 1P3KB 5AVCA 4KHAA 5B2JD 3WTPD 3KWQB 4X23B 4YM6A 1R4VA 1U35C 1KX4D 1KX5A 4H9PB 4EO5C 3A6ND 3AZJC 3V9RA 5B2IC 3MGQD 1TZYA 4M6BA 4WNNB 4Z66C 3NQUB 1KX3D 1P3OD 5BO0A 1HQ3C 5GXQA 3W99D 5AV6D 3AZKA 1M19B 3EG5B 5AV9B 4DRBA 1S32A 5B1LB 1P3IA 3KUYB 5GT3D 3WTPC 2BYKB 3AV2D 3X1UB 3RELB 2F8NK 3H0MC 5B31G 5CPJA 5B0ZA 3A6NC 5BS7C 3AN2B 4G91B 3B0BA 1ID3C 4DQYB 1KX3C 4Z5TB 3KXBC 4J8UB 3AZFC 1P3OC 3W98B 4KGCD 3AYWA 3MGPC 4J8XA 2FJ7D 3X1TC 2HUEC 1P3KD 4UUZB 3AZLA 1TAFB 3REHB 3KWQD 5GT3C 4X23D 5AV5B 3AV2C 5BNXA 3MVDA 1M18A 5AVBA 3WKJC 5B1MB 3REIA 4E44A 4WU8B 5GSUC 5FUGB 1ZLAB 1HTAA 2NQBB 5CPIB 3EPJA 3W97D 3LELA 4KGCC 2ZY2A 4J8VB 3O62C 5AY8A 2Y2LA 3UT9A 2FJ7C 5B31B 4H9OA 3MGRB 1P3KC 5KDMB 1F66B 5DNNB 5AV9D 5B1LD 4LD9C 3AZGC 5F99A 3KUYD 4CAYA 4KUDA 4X23C 1W2EA 3X1UD 1T3UA 2L5AA 3RELD 3AZIB 3WA9B 3AZEA 3AZHA 2YFVA 3AN2D 3UTBB 4JJNB 1KX5B 1P3FA 4Z5TD 4J8UD 3W98D 3B6GA 5AV8B 2ZY3A 1M1AA 3TU4C 3WAAB 4H9SC 5B33B 1TZYB 4CSRA 1M19C 2ZM5A 1P3PA 3AFAA 5B1LC 4H9RB 3REHD 4J8WA 2YFWB 5AV5D 4YS3B 3X1UC 5CPKA 5B40C 5B1MD 2BG1A 4WU8D 1P3MA 2ZY5A 3VH6A 4XUJA 5CP6B 3AN2C 1ZLAD 4G91C 2NQBD 5CPID 2LY8A 3P5JB 2RVQC 3KSYA 4Z5TC 5CPJB 4J8VD 1P3AA 2VQRA 2Y2JA 5B31D 1ID3B 3MGRD 3MNNC 1F66D 3KXBB 3AZFB 5DNND 3REKD 3MGPB 3UTAA 2HUEB 2PYOA 5AV5C 4HGAC 2ZY4A 3AZID 3WA9D 4E45A 5B32G 4ZBJB 5B24C 4WU8C 1U35D 3UTBD 4JJND 1ZLAC 3WKJB 5DNMA 5GT0C 1AOIB 5B2ID 1KX5D 3REJA 5AV8D 4J8VC 2Y2MA 1P3BA 3WAAD 5B33D 1TZYD 5B31C 5G49B 4NFTA 1Q9CA 1F66C 2Y2GA 5DNNC 2CV5A 4ZUXA 3O62B 4AWLB 5E5AA 3UT9B 4YS3D 4Z2MG 2BYMB 3AZIC 1P3LB 4LD9B 3AZGB 3WA9C 5BT1C 5CP6D 3UTBC 4JJNC 4KUDB 4YM6C 2AROA 1KX5C 5CPJD 3AZEB 2HIOA 3VH6T 5AV8C 3AZHB 3WAAC 3C1CA 3X1SA 2YFVB 5B33C 1TZYC 1P3GA 1ID3D 1JFIB 3KXBD 3AZFD 5B32B 3TU4B 1N1JA 3MGPD 3X1TD 3VH5W 3C1BA 4YS3C 3AZKC 4CSRB 3LZ1A 1S32C 2DF4C 3H0RC 5CP6C 1A7WA 4J8WB 3WKJD 5B40B 1AOID 2F8NA 5GSUD 5CPJC 5B0ZC 1BH9A 3LZ0A 3B6FA 5JA4A 1P3MB 2G5HC 2IO5B 1P34A 3LJAB 3O62D 2Y2PA 4G92B 3MNNB 3MGSB 3UT9D 1EQZA 5B2JA 3WTPA 1P3LD 3AZGD 4XZQB 4LD9D 3AV1B 1KX4A 4NE5A 4ZBJC 3UTAB 2NZDA 4HGAB 3R45B 3A6NA 4KUDD 2PYOB 3H0LC 5BS7A 3MGQA 1AOIC 1M18C 4QLCB 5B24B 3AZED 3AZHD 1KX3A 1P3OA 5GT0B 3NQJA 3W99A 5B32D 4H9NB 5AV6A 3TU4D 3REJB 4AWLC 4WJ3C 1M19D 3UT9C 5GT3A 1P3LC 3AV2A 5F99C 4J8WD 4KUDC 5B40D 5JRGA 5AVCB 4KHAB 1BH8A 3AZEC 3AZHC 4YM6B 4KGCA 2RVQD 3FDDA 5B0YA 4R8PA 5B32C 3LJAD 2FJ7A 3V9RB 1P3KA 3B6GC 3MNND 3MGSD 3X1VA 2RIQA 4UPKA 3C1CB 1M1AC 3KWQA 4XZQD 4X23A 5BO0B 3AV1D 5GXQB 1P3PC 2W8SA 3AZKB 4WU9A 4J8WC 3C1BB 1S32B 5CPKC 4QLCD 5B24D 4WNNA 1P3IB 3LZ1B 3EPHA 3AZMA 3W97A 1P3MC 5GT0D 2Y2HA 2IO5C 1H3OA 5B0ZB 3LJAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W96 A;  3REJ D;  4G92 C;  4WV4 B;  5AV9 A;  3LZ0 B;  3MGS C;  5B1L A;  3B6F B;  3AZN A;  1BFM A;  3KUY A;  2BYK A;  4XZQ C;  3AV1 C;  3REL A;  3AYW B;  4J8X B;  3UTA C;  2PYO C;  1EQZ B;  5AVC D;  3AN2 A;  3AZL B;  4QLC C;  5BT1 D;  4YM6 D;  4J8U A;  2NZD B;  3W98 A;  5BNX B;  3MVD B;  1M18 B;  5AVB B;  5DNM C;  3MGQ B;  3REI B;  5BNV A;  3REJ C;  4UUZ A;  5C3I B;  3C1C D;  1TAF A;  3REH A;  3LEL B;  5GXQ D;  3B0C W;  2CV5 C;  4ZUX C;  5AY8 B;  4Z2M H;  3AZK D;  4H9O B;  5B1M A;  3WTP E;  4WU8 A;  3B0D C;  1S32 D;  5FUG A;  5AVC C;  1ZLA A;  1P3I D;  3LZ1 D;  5F99 B;  2NQB A;  5CPI A;  4CAY B;  5B0Z D;  5JRG B;  5B31 A;  3MGR A;  5KDM A;  5DNN A;  3LZ0 D;  3C1C C;  3REK A;  1P3F B;  5B0Y B;  4R8P B;  5GXQ C;  3B6G B;  1M1A B;  3AYW D;  4J8X D;  3WA9 A;  3X1V B;  3C1B C;  1P3P B;  1U35 A;  1EQZ D;  3AFA B;  3UTB A;  4JJN A;  3AZL D;  1P3I C;  3LZ1 C;  3AZJ A;  5B2I A;  2NZD D;  3MVD D;  4WU9 B;  5AV8 A;  1M18 D;  5AVB D;  5CPK B;  3WAA A;  4Z66 A;  3VH5 A;  5B33 A;  3REI D;  1HQ3 A;  4XUJ B;  3LZ0 C;  3AZM B;  3B6F C;  3W97 B;  4H9R A;  1H3O B;  2YFW A;  3LEL D;  4YS3 A;  1P34 C;  5CHL B;  5AY8 D;  1P3A B;  3W96 B;  3AYW C;  4J8X C;  3AZN B;  1B6W A;  1EQZ C;  5CP6 A;  5B2J C;  3AZL C;  5F99 D;  1KX4 C;  2NZD C;  3MVD C;  5AVB C;  5JRG D;  3MGQ C;  1ID3 A;  3REI C;  4H9Q A;  3KXB A;  3AZF A;  4WZS B;  5C3I C;  5DNM B;  3MGP A;  3B0C T;  3X1T A;  3W99 C;  1P3F D;  5B0Y D;  4R8P D;  3LEL C;  1ULY A;  2CWE A;  3B6G D;  4NE6 A;  5AV6 C;  1P3B B;  1M1A D;  5AY8 C;  5BNV B;  3X1V D;  1P3P D;  3AFA D;  2CV5 B;  4ZUX B;  3WKJ A;  2F8N H;  5E5A B;  1AOI A;  2F8N G;  4WU9 D;  5GSU A;  3B0D B;  5CPK D;  5JRG C;  5G49 A;  1P3M D;  4XUJ D;  3O62 A;  3AZM D;  3VH5 T;  2ARO B;  1P3F C;  5B0Y C;  4R8P C;  2HIO B;  1P3A D;  3W96 D;  2BYM A;  4LD9 A;  1P3L A;  3X1S B;  3AZG A;  1P3G B;  3X1V C;  1WWI A;  3AZN D;  3REK B;  3AFA C;  4DRA A;  1N1J B;  3KWQ C;  3UTA D;  4H9P A;  2PYO D;  4WU9 C;  1B67 A;  3NQU A;  1U35 B;  1F1E A;  1JFI A;  4EO5 B;  5B32 A;  4XUJ C;  3AZJ B;  5B2I B;  3AZM C;  3TU4 A;  5DNM D;  4H9S A;  3W97 C;  2F8N B;  4Z66 B;  1M19 A;  1P3B D;  3W96 C;  3VH6 W;  1BH9 B;  1P3A C;  5JA4 B;  1HQ3 B;  5AV9 C;  3AZN C;  1P34 B;  2CV5 D;  4ZUX D;  3X1U A;  3KUY C;  5B40 A;  5E5A D;  3REL C;  5B2J B;  3WTP B;  1KX4 B;  4Z5T A;  3A6N B;  3LJA A;  4J8U C;  3W98 C;  2ARO D;  3MNN A;  3MGS A;  2HIO D;  1P3B C;  3X1S D;  4H9Q B;  4XZQ A;  1P3G D;  1P3O B;  1KX3 B;  3NQJ B;  3AV1 A;  3W99 B;  5AV5 A;  5AV6 B;  3X1T B;  3R45 A;  3REH C;  5E5A C;  3C1B D;  4QLC A;  5B24 A;  5B1M C;  5GT3 B;  3AV2 B;  5GT0 A;  2NQB C;  2JSS A;  5CPI C;  3AZJ D;  4H9N A;  4J8V A;  5GSU B;  2ARO C;  2F8N D;  1F66 A;  4Z66 D;  4NE3 A;  1BH8 B;  1KU5 A;  2HIO C;  3B6F D;  3MGR C;  1WWS A;  3X1S C;  1HQ3 D;  1P3G C;  4KGC B;  3REK C;  1P34 D;  2FJ7 B;  3AZI A;  1P3K B;  5AVC A;  4KHA A;  5B2J D;  3WTP D;  3KWQ B;  4X23 B;  4YM6 A;  1R4V A;  1U35 C;  1KX4 D;  1KX5 A;  4H9P B;  4EO5 C;  3A6N D;  3AZJ C;  3V9R A;  5B2I C;  3MGQ D;  1TZY A;  4M6B A;  4WNN B;  4Z66 C;  3NQU B;  1KX3 D;  1P3O D;  5BO0 A;  1HQ3 C;  5GXQ A;  3W99 D;  5AV6 D;  3AZK A;  1M19 B;  5AV9 B;  4DRB A;  1S32 A;  5B1L B;  1P3I A;  3KUY B;  5GT3 D;  3WTP C;  2BYK B;  3AV2 D;  3X1U B;  3REL B;  2F8N K;  5B31 G;  5CPJ A;  5B0Z A;  3A6N C;  5BS7 C;  3AN2 B;  4G91 B;  3B0B A;  1ID3 C;  1KX3 C;  4Z5T B;  3KXB C;  4J8U B;  3AZF C;  1P3O C;  3W98 B;  4KGC D;  3AYW A;  3MGP C;  4J8X A;  2FJ7 D;  3X1T C;  2HUE C;  1P3K D;  4UUZ B;  3AZL A;  1TAF B;  3REH B;  3KWQ D;  5GT3 C;  4X23 D;  5AV5 B;  3AV2 C;  5BNX A;  3MVD A;  1M18 A;  5AVB A;  3WKJ C;  5B1M B;  3REI A;  4E44 A;  4WU8 B;  5GSU C;  5FUG B;  1ZLA B;  1HTA A;  2NQB B;  5CPI B;  3W97 D;  3LEL A;  4KGC C;  4J8V B;  3O62 C;  5AY8 A;  3UT9 A;  2FJ7 C;  5B31 B;  4H9O A;  3MGR B;  1P3K C;  5KDM B;  1F66 B;  5DNN B;  5AV9 D;  5B1L D;  4LD9 C;  3AZG C;  5F99 A;  3KUY D;  4CAY A;  4KUD A;  4X23 C;  3X1U D;  3REL D;  2L5A A;  3AZI B;  3WA9 B;  3AZE A;  3AZH A;  2YFV A;  3AN2 D;  3UTB B;  4JJN B;  1KX5 B;  1P3F A;  4Z5T D;  4J8U D;  3W98 D;  3B6G A;  5AV8 B;  1M1A A;  3TU4 C;  3WAA B;  4H9S C;  5B33 B;  1TZY B;  4CSR A;  1M19 C;  1P3P A;  3AFA A;  5B1L C;  4H9R B;  3REH D;  4J8W A;  2YFW B;  5AV5 D;  4YS3 B;  3X1U C;  5CPK A;  5B40 C;  5B1M D;  4WU8 D;  1P3M A;  3VH6 A;  4XUJ A;  5CP6 B;  3AN2 C;  1ZLA D;  4G91 C;  2NQB D;  5CPI D;  2LY8 A;  2RVQ C;  3KSY A;  4Z5T C;  5CPJ B;  4J8V D;  1P3A A;  5B31 D;  1ID3 B;  3MGR D;  3MNN C;  1F66 D;  3KXB B;  3AZF B;  5DNN D;  3REK D;  3MGP B;  3UTA A;  2HUE B;  2PYO A;  5AV5 C;  4HGA C;  3AZI D;  3WA9 D;  4E45 A;  5B32 G;  4ZBJ B;  5B24 C;  4WU8 C;  1U35 D;  3UTB D;  4JJN D;  1ZLA C;  3WKJ B;  5DNM A;  5GT0 C;  1AOI B;  5B2I D;  1KX5 D;  3REJ A;  5AV8 D;  4J8V C;  1P3B A;  3WAA D;  5B33 D;  1TZY D;  5B31 C;  5G49 B;  4NFT A;  1Q9C A;  1F66 C;  5DNN C;  2CV5 A;  4ZUX A;  3O62 B;  4AWL B;  5E5A A;  3UT9 B;  4YS3 D;  4Z2M G;  2BYM B;  3AZI C;  1P3L B;  4LD9 B;  3AZG B;  3WA9 C;  5BT1 C;  5CP6 D;  3UTB C;  4JJN C;  4KUD B;  4YM6 C;  2ARO A;  1KX5 C;  5CPJ D;  3AZE B;  2HIO A;  3VH6 T;  5AV8 C;  3AZH B;  3WAA C;  3C1C A;  3X1S A;  2YFV B;  5B33 C;  1TZY C;  1P3G A;  1ID3 D;  1JFI B;  3KXB D;  3AZF D;  5B32 B;  3TU4 B;  1N1J A;  3MGP D;  3X1T D;  3VH5 W;  3C1B A;  4YS3 C;  3AZK C;  4CSR B;  3LZ1 A;  1S32 C;  5CP6 C;  1A7W A;  4J8W B;  3WKJ D;  5B40 B;  1AOI D;  2F8N A;  5GSU D;  5CPJ C;  5B0Z C;  1BH9 A;  3LZ0 A;  3B6F A;  5JA4 A;  1P3M B;  2IO5 B;  1P34 A;  3LJA B;  3O62 D;  4G92 B;  3MNN B;  3MGS B;  3UT9 D;  1EQZ A;  5B2J A;  3WTP A;  1P3L D;  3AZG D;  4XZQ B;  4LD9 D;  3AV1 B;  1KX4 A;  4NE5 A;  4ZBJ C;  3UTA B;  2NZD A;  4HGA B;  3R45 B;  3A6N A;  4KUD D;  2PYO B;  5BS7 A;  3MGQ A;  1AOI C;  1M18 C;  4QLC B;  5B24 B;  3AZE D;  3AZH D;  1KX3 A;  1P3O A;  5GT0 B;  3NQJ A;  3W99 A;  5B32 D;  4H9N B;  5AV6 A;  3TU4 D;  3REJ B;  4AWL C;  1M19 D;  3UT9 C;  5GT3 A;  1P3L C;  3AV2 A;  5F99 C;  4J8W D;  4KUD C;  5B40 D;  5JRG A;  5AVC B;  4KHA B;  1BH8 A;  3AZE C;  3AZH C;  4YM6 B;  4KGC A;  2RVQ D;  5B0Y A;  4R8P A;  5B32 C;  3LJA D;  2FJ7 A;  3V9R B;  1P3K A;  3B6G C;  3MNN D;  3MGS D;  3X1V A;  1M1A C;  3C1C B;  3KWQ A;  4XZQ D;  4X23 A;  5BO0 B;  3AV1 D;  5GXQ B;  1P3P C;  3AZK B;  4WU9 A;  4J8W C;  3C1B B;  1S32 B;  5CPK C;  4QLC D;  5B24 D;  4WNN A;  1P3I B;  3LZ1 B;  3AZM A;  3W97 A;  1P3M C;  5GT0 D;  2IO5 C;  1H3O A;  5B0Z B;  3LJA C; 
#chains in the Genus database with same CATH topology
 3W96 A;  3REJ D;  4G92 C;  4WV4 B;  5AV9 A;  3LZ0 B;  3MGS C;  5B1L A;  3B6F B;  3AZN A;  1BFM A;  3KUY A;  2BYK A;  4XZQ C;  3AV1 C;  3REL A;  3AYW B;  4J8X B;  3UTA C;  2PYO C;  1EQZ B;  5AVC D;  3AN2 A;  3AZL B;  4QLC C;  5BT1 D;  2F2A C;  4YM6 D;  4J8U A;  3W98 A;  2NZD B;  5BNX B;  3MVD B;  1M18 B;  5AVB B;  5DNM C;  3MGQ B;  3REI B;  5BNV A;  3REJ C;  4UUZ A;  5C3I B;  3C1C D;  1TAF A;  3REH A;  3LEL B;  5GXQ D;  3B0C W;  2Y2O A;  2CV5 C;  4ZUX C;  5AY8 B;  4Z2M H;  3AZK D;  4H9O B;  5B1M A;  3WTP E;  2JCH A;  4WU8 A;  3B0D C;  1S32 D;  5FUG A;  5AVC C;  1ZLA A;  1P3I D;  3LZ1 D;  5F99 B;  2NQB A;  5CPI A;  4CAY B;  5B0Z D;  2XD1 A;  5JRG B;  5B31 A;  3MGR A;  5KDM A;  5DNN A;  3LZ0 D;  3C1C C;  3REK A;  1P3F B;  5B0Y B;  4R8P B;  5GXQ C;  3B6G B;  1M1A B;  3AYW D;  4J8X D;  2J8P A;  3WA9 A;  3X1V B;  3C1B C;  1P3P B;  1U35 A;  1EQZ D;  3AFA B;  3UTB A;  4JJN A;  3AZL D;  1P3I C;  3LZ1 C;  2FFF B;  3AZJ A;  5B2I A;  2NZD D;  3MVD D;  4WU9 B;  5AV8 A;  1M18 D;  5AVB D;  5CPK B;  3WAA A;  4Z66 A;  3VH5 A;  2Y2I A;  5B33 A;  3REI D;  1HQ3 A;  4XUJ B;  3LZ0 C;  3AZM B;  3B6F C;  3W97 B;  4H9R A;  1H3O B;  2YFW A;  3LEL D;  4YS3 A;  1P34 C;  5CHL B;  5AY8 D;  1P3A B;  3W96 B;  3AYW C;  4J8X C;  3AZN B;  1B6W A;  1EQZ C;  5CP6 A;  5B2J C;  3AZL C;  5F99 D;  1KX4 C;  2NZD C;  3MVD C;  5AVB C;  5JRG D;  3MGQ C;  1ID3 A;  3REI C;  4H9Q A;  3KXB A;  3AZF A;  4WZS B;  5C3I C;  5DNM B;  3MGP A;  3B0C T;  3X1T A;  3W99 C;  3F6T A;  1P3F D;  5B0Y D;  4R8P D;  3LEL C;  1ULY A;  2CWE A;  3B6G D;  4NE6 A;  5AV6 C;  3EPK A;  1P3B B;  5AY8 C;  5BNV B;  1M1A D;  3X1V D;  1P3P D;  3AFA D;  2CV5 B;  4ZUX B;  2UWX A;  3WKJ A;  2F8N H;  5E5A B;  1AOI A;  2F8N G;  4WU9 D;  5GSU A;  3B0D B;  5CPK D;  5JRG C;  5G49 A;  1P3M D;  4XUJ D;  3O62 A;  3AZM D;  3VH5 T;  2ARO B;  1P3F C;  5B0Y C;  4R8P C;  2HIO B;  1P3A D;  3W96 D;  2BYM A;  4LD9 A;  1P3L A;  3X1S B;  3AZG A;  1P3G B;  3X1V C;  1WWI A;  2DQN C;  3REK B;  3AZN D;  3AFA C;  1Z2C B;  4DRA A;  1N1J B;  3KWQ C;  3UTA D;  4H9P A;  2PYO D;  4WU9 C;  1B67 A;  3NQU A;  1U35 B;  2Y2K A;  1F1E A;  1JFI A;  1PZR A;  4EO5 B;  5B32 A;  4XUJ C;  3AZJ B;  2Y2N A;  5B2I B;  3AZM C;  3TU4 A;  5DNM D;  4H9S A;  3W97 C;  2F8N B;  4Z66 B;  1M19 A;  1P3B D;  3W96 C;  3VH6 W;  1BH9 B;  1P3A C;  5JA4 B;  3A1K A;  1HQ3 B;  5AV9 C;  2G5I C;  3AZN C;  1P34 B;  2CV5 D;  4ZUX D;  3X1U A;  3KUY C;  5B40 A;  5E5A D;  3REL C;  3A1I A;  5B2J B;  3WTP B;  3EPL A;  1KX4 B;  4Z5T A;  2XD5 A;  3A6N B;  3LJA A;  4J8U C;  3W98 C;  2ARO D;  3MNN A;  3MGS A;  2HIO D;  1P3B C;  3KFU G;  3X1S D;  4H9Q B;  4XZQ A;  1P3G D;  1P3O B;  1KX3 B;  3NQJ B;  3AV1 A;  3W99 B;  5AV5 A;  5AV6 B;  3X1T B;  3R45 A;  3REH C;  2Y2Q A;  5E5A C;  3C1B D;  4QLC A;  5B24 A;  5B1M C;  5GT3 B;  3AV2 B;  5GT0 A;  2NQB C;  2JSS A;  5CPI C;  3IP4 C;  3AZJ D;  4H9N A;  4J8V A;  5GSU B;  2ARO C;  2F8N D;  1F66 A;  4NE3 A;  1BH8 B;  4Z66 D;  3AL0 C;  1KU5 A;  2HIO C;  2JE5 A;  3B6F D;  3MGR C;  1WWS A;  3X1S C;  1HQ3 D;  1P3G C;  4KGC B;  3REK C;  1P34 D;  2FJ7 B;  3AZI A;  1P3K B;  5AVC A;  4KHA A;  5B2J D;  3WTP D;  3KWQ B;  4X23 B;  4YM6 A;  1R4V A;  1U35 C;  1KX4 D;  1KX5 A;  4H9P B;  4EO5 C;  3A6N D;  3AZJ C;  3V9R A;  5B2I C;  3MGQ D;  1TZY A;  4M6B A;  4WNN B;  4Z66 C;  3NQU B;  1KX3 D;  1P3O D;  5BO0 A;  1HQ3 C;  5GXQ A;  3W99 D;  5AV6 D;  3AZK A;  1M19 B;  3EG5 B;  5AV9 B;  4DRB A;  1S32 A;  5B1L B;  1P3I A;  3KUY B;  5GT3 D;  3WTP C;  2BYK B;  3AV2 D;  3X1U B;  3REL B;  2F8N K;  3H0M C;  5B31 G;  5CPJ A;  5B0Z A;  3A6N C;  5BS7 C;  3AN2 B;  4G91 B;  3B0B A;  1ID3 C;  4DQY B;  1KX3 C;  4Z5T B;  3KXB C;  4J8U B;  3AZF C;  1P3O C;  3W98 B;  4KGC D;  3AYW A;  3MGP C;  4J8X A;  2FJ7 D;  3X1T C;  2HUE C;  1P3K D;  4UUZ B;  3AZL A;  1TAF B;  3REH B;  3KWQ D;  5GT3 C;  4X23 D;  5AV5 B;  3AV2 C;  5BNX A;  3MVD A;  1M18 A;  5AVB A;  3WKJ C;  5B1M B;  3REI A;  4E44 A;  4WU8 B;  5GSU C;  5FUG B;  1ZLA B;  1HTA A;  2NQB B;  5CPI B;  3EPJ A;  3W97 D;  3LEL A;  4KGC C;  2ZY2 A;  4J8V B;  3O62 C;  5AY8 A;  2Y2L A;  3UT9 A;  2FJ7 C;  5B31 B;  4H9O A;  3MGR B;  1P3K C;  5KDM B;  1F66 B;  5DNN B;  5AV9 D;  5B1L D;  4LD9 C;  3AZG C;  5F99 A;  3KUY D;  4CAY A;  4KUD A;  4X23 C;  1W2E A;  3X1U D;  1T3U A;  2L5A A;  3REL D;  3AZI B;  3WA9 B;  3AZE A;  3AZH A;  2YFV A;  3AN2 D;  3UTB B;  4JJN B;  1KX5 B;  1P3F A;  4Z5T D;  4J8U D;  3W98 D;  3B6G A;  5AV8 B;  2ZY3 A;  1M1A A;  3TU4 C;  3WAA B;  4H9S C;  5B33 B;  1TZY B;  4CSR A;  1M19 C;  2ZM5 A;  1P3P A;  3AFA A;  5B1L C;  4H9R B;  3REH D;  4J8W A;  2YFW B;  5AV5 D;  4YS3 B;  3X1U C;  5CPK A;  5B40 C;  5B1M D;  2BG1 A;  4WU8 D;  1P3M A;  2ZY5 A;  3VH6 A;  4XUJ A;  5CP6 B;  3AN2 C;  1ZLA D;  4G91 C;  2NQB D;  5CPI D;  2LY8 A;  3P5J B;  2RVQ C;  3KSY A;  4Z5T C;  5CPJ B;  4J8V D;  1P3A A;  2VQR A;  2Y2J A;  5B31 D;  1ID3 B;  3MGR D;  3MNN C;  1F66 D;  3KXB B;  3AZF B;  5DNN D;  3REK D;  3MGP B;  3UTA A;  2HUE B;  2PYO A;  5AV5 C;  4HGA C;  2ZY4 A;  3AZI D;  3WA9 D;  4E45 A;  5B32 G;  4ZBJ B;  5B24 C;  4WU8 C;  1U35 D;  3UTB D;  4JJN D;  1ZLA C;  3WKJ B;  5DNM A;  5GT0 C;  1AOI B;  5B2I D;  1KX5 D;  3REJ A;  5AV8 D;  4J8V C;  2Y2M A;  1P3B A;  3WAA D;  5B33 D;  1TZY D;  5B31 C;  5G49 B;  4NFT A;  1Q9C A;  1F66 C;  2Y2G A;  5DNN C;  2CV5 A;  4ZUX A;  3O62 B;  4AWL B;  5E5A A;  3UT9 B;  4YS3 D;  4Z2M G;  2BYM B;  3AZI C;  1P3L B;  4LD9 B;  3AZG B;  3WA9 C;  5BT1 C;  5CP6 D;  3UTB C;  4JJN C;  4KUD B;  4YM6 C;  2ARO A;  1KX5 C;  5CPJ D;  3AZE B;  2HIO A;  3VH6 T;  5AV8 C;  3AZH B;  3WAA C;  3C1C A;  3X1S A;  2YFV B;  5B33 C;  1TZY C;  1P3G A;  1ID3 D;  1JFI B;  3KXB D;  3AZF D;  5B32 B;  3TU4 B;  1N1J A;  3MGP D;  3X1T D;  3VH5 W;  3C1B A;  4YS3 C;  3AZK C;  4CSR B;  3LZ1 A;  1S32 C;  2DF4 C;  3H0R C;  5CP6 C;  1A7W A;  4J8W B;  3WKJ D;  5B40 B;  1AOI D;  2F8N A;  5GSU D;  5CPJ C;  5B0Z C;  1BH9 A;  3LZ0 A;  3B6F A;  5JA4 A;  1P3M B;  2G5H C;  2IO5 B;  1P34 A;  3LJA B;  3O62 D;  2Y2P A;  4G92 B;  3MNN B;  3MGS B;  3UT9 D;  1EQZ A;  5B2J A;  3WTP A;  1P3L D;  3AZG D;  4XZQ B;  4LD9 D;  3AV1 B;  1KX4 A;  4NE5 A;  4ZBJ C;  3UTA B;  2NZD A;  4HGA B;  3R45 B;  3A6N A;  4KUD D;  2PYO B;  3H0L C;  5BS7 A;  3MGQ A;  1AOI C;  1M18 C;  4QLC B;  5B24 B;  3AZE D;  3AZH D;  1KX3 A;  1P3O A;  5GT0 B;  3NQJ A;  3W99 A;  5B32 D;  4H9N B;  5AV6 A;  3TU4 D;  3REJ B;  4AWL C;  4WJ3 C;  1M19 D;  3UT9 C;  5GT3 A;  1P3L C;  3AV2 A;  5F99 C;  4J8W D;  4KUD C;  5B40 D;  5JRG A;  5AVC B;  4KHA B;  1BH8 A;  3AZE C;  3AZH C;  4YM6 B;  4KGC A;  2RVQ D;  3FDD A;  5B0Y A;  4R8P A;  5B32 C;  3LJA D;  2FJ7 A;  3V9R B;  1P3K A;  3B6G C;  3MNN D;  3MGS D;  3X1V A;  2RIQ A;  4UPK A;  3C1C B;  1M1A C;  3KWQ A;  4XZQ D;  4X23 A;  5BO0 B;  3AV1 D;  5GXQ B;  1P3P C;  2W8S A;  3AZK B;  4WU9 A;  4J8W C;  3C1B B;  1S32 B;  5CPK C;  4QLC D;  5B24 D;  4WNN A;  1P3I B;  3LZ1 B;  3EPH A;  3AZM A;  3W97 A;  1P3M C;  5GT0 D;  2Y2H A;  2IO5 C;  1H3O A;  5B0Z B;  3LJA C; 
#chains in the Genus database with same CATH homology
 3W96 A;  3REJ D;  4G92 C;  4WV4 B;  5AV9 A;  3LZ0 B;  3MGS C;  5B1L A;  3B6F B;  3AZN A;  1BFM A;  3KUY A;  2BYK A;  4XZQ C;  3AV1 C;  3REL A;  3AYW B;  4J8X B;  3UTA C;  2PYO C;  1EQZ B;  5AVC D;  3AN2 A;  3AZL B;  4QLC C;  5BT1 D;  2F2A C;  4YM6 D;  4J8U A;  3W98 A;  2NZD B;  5BNX B;  3MVD B;  1M18 B;  5AVB B;  5DNM C;  3MGQ B;  3REI B;  5BNV A;  3REJ C;  4UUZ A;  5C3I B;  3C1C D;  1TAF A;  3REH A;  3LEL B;  5GXQ D;  3B0C W;  2Y2O A;  2CV5 C;  4ZUX C;  5AY8 B;  4Z2M H;  3AZK D;  4H9O B;  5B1M A;  3WTP E;  2JCH A;  4WU8 A;  3B0D C;  1S32 D;  5FUG A;  5AVC C;  1ZLA A;  1P3I D;  3LZ1 D;  5F99 B;  2NQB A;  5CPI A;  4CAY B;  5B0Z D;  2XD1 A;  5JRG B;  5B31 A;  3MGR A;  5KDM A;  5DNN A;  3LZ0 D;  3C1C C;  3REK A;  1P3F B;  5B0Y B;  4R8P B;  5GXQ C;  3B6G B;  1M1A B;  3AYW D;  4J8X D;  2J8P A;  3WA9 A;  3X1V B;  3C1B C;  1P3P B;  1U35 A;  1EQZ D;  3AFA B;  3UTB A;  4JJN A;  3AZL D;  1P3I C;  3LZ1 C;  2FFF B;  3AZJ A;  5B2I A;  2NZD D;  3MVD D;  4WU9 B;  5AV8 A;  1M18 D;  5AVB D;  5CPK B;  3WAA A;  4Z66 A;  3VH5 A;  2Y2I A;  5B33 A;  3REI D;  1HQ3 A;  4XUJ B;  3LZ0 C;  3AZM B;  3B6F C;  3W97 B;  4H9R A;  1H3O B;  2YFW A;  3LEL D;  4YS3 A;  1P34 C;  5CHL B;  5AY8 D;  1P3A B;  3W96 B;  3AYW C;  4J8X C;  3AZN B;  1B6W A;  1EQZ C;  5CP6 A;  5B2J C;  3AZL C;  5F99 D;  1KX4 C;  2NZD C;  3MVD C;  5AVB C;  5JRG D;  3MGQ C;  1ID3 A;  3REI C;  4H9Q A;  3KXB A;  3AZF A;  4WZS B;  5C3I C;  5DNM B;  3MGP A;  3B0C T;  3X1T A;  3W99 C;  3F6T A;  1P3F D;  5B0Y D;  4R8P D;  3LEL C;  1ULY A;  2CWE A;  3B6G D;  4NE6 A;  5AV6 C;  3EPK A;  1P3B B;  5AY8 C;  5BNV B;  1M1A D;  3X1V D;  1P3P D;  3AFA D;  2CV5 B;  4ZUX B;  2UWX A;  3WKJ A;  2F8N H;  5E5A B;  1AOI A;  2F8N G;  4WU9 D;  5GSU A;  3B0D B;  5CPK D;  5JRG C;  5G49 A;  1P3M D;  4XUJ D;  3O62 A;  3AZM D;  3VH5 T;  2ARO B;  1P3F C;  5B0Y C;  4R8P C;  2HIO B;  1P3A D;  3W96 D;  2BYM A;  4LD9 A;  1P3L A;  3X1S B;  3AZG A;  1P3G B;  3X1V C;  1WWI A;  2DQN C;  3REK B;  3AZN D;  3AFA C;  1Z2C B;  4DRA A;  1N1J B;  3KWQ C;  3UTA D;  4H9P A;  2PYO D;  4WU9 C;  1B67 A;  3NQU A;  1U35 B;  2Y2K A;  1F1E A;  1JFI A;  1PZR A;  4EO5 B;  5B32 A;  4XUJ C;  3AZJ B;  2Y2N A;  5B2I B;  3AZM C;  3TU4 A;  5DNM D;  4H9S A;  3W97 C;  2F8N B;  4Z66 B;  1M19 A;  1P3B D;  3W96 C;  3VH6 W;  1BH9 B;  1P3A C;  5JA4 B;  3A1K A;  1HQ3 B;  5AV9 C;  2G5I C;  3AZN C;  1P34 B;  2CV5 D;  4ZUX D;  3X1U A;  3KUY C;  5B40 A;  5E5A D;  3REL C;  3A1I A;  5B2J B;  3WTP B;  3EPL A;  1KX4 B;  4Z5T A;  2XD5 A;  3A6N B;  3LJA A;  4J8U C;  3W98 C;  2ARO D;  3MNN A;  3MGS A;  2HIO D;  1P3B C;  3KFU G;  3X1S D;  4H9Q B;  4XZQ A;  1P3G D;  1P3O B;  1KX3 B;  3NQJ B;  3AV1 A;  3W99 B;  5AV5 A;  5AV6 B;  3X1T B;  3R45 A;  3REH C;  2Y2Q A;  5E5A C;  3C1B D;  4QLC A;  5B24 A;  5B1M C;  5GT3 B;  3AV2 B;  5GT0 A;  2NQB C;  2JSS A;  5CPI C;  3IP4 C;  3AZJ D;  4H9N A;  4J8V A;  5GSU B;  2ARO C;  2F8N D;  1F66 A;  4NE3 A;  1BH8 B;  4Z66 D;  3AL0 C;  1KU5 A;  2HIO C;  2JE5 A;  3B6F D;  3MGR C;  1WWS A;  3X1S C;  1HQ3 D;  1P3G C;  4KGC B;  3REK C;  1P34 D;  2FJ7 B;  3AZI A;  1P3K B;  5AVC A;  4KHA A;  5B2J D;  3WTP D;  3KWQ B;  4X23 B;  4YM6 A;  1R4V A;  1U35 C;  1KX4 D;  1KX5 A;  4H9P B;  4EO5 C;  3A6N D;  3AZJ C;  3V9R A;  5B2I C;  3MGQ D;  1TZY A;  4M6B A;  4WNN B;  4Z66 C;  3NQU B;  1KX3 D;  1P3O D;  5BO0 A;  1HQ3 C;  5GXQ A;  3W99 D;  5AV6 D;  3AZK A;  1M19 B;  3EG5 B;  5AV9 B;  4DRB A;  1S32 A;  5B1L B;  1P3I A;  3KUY B;  5GT3 D;  3WTP C;  2BYK B;  3AV2 D;  3X1U B;  3REL B;  2F8N K;  3H0M C;  5B31 G;  5CPJ A;  5B0Z A;  3A6N C;  5BS7 C;  3AN2 B;  4G91 B;  3B0B A;  1ID3 C;  4DQY B;  1KX3 C;  4Z5T B;  3KXB C;  4J8U B;  3AZF C;  1P3O C;  3W98 B;  4KGC D;  3AYW A;  3MGP C;  4J8X A;  2FJ7 D;  3X1T C;  2HUE C;  1P3K D;  4UUZ B;  3AZL A;  1TAF B;  3REH B;  3KWQ D;  5GT3 C;  4X23 D;  5AV5 B;  3AV2 C;  5BNX A;  3MVD A;  1M18 A;  5AVB A;  3WKJ C;  5B1M B;  3REI A;  4E44 A;  4WU8 B;  5GSU C;  5FUG B;  1ZLA B;  1HTA A;  2NQB B;  5CPI B;  3EPJ A;  3W97 D;  3LEL A;  4KGC C;  2ZY2 A;  4J8V B;  3O62 C;  5AY8 A;  2Y2L A;  3UT9 A;  2FJ7 C;  5B31 B;  4H9O A;  3MGR B;  1P3K C;  5KDM B;  1F66 B;  5DNN B;  5AV9 D;  5B1L D;  4LD9 C;  3AZG C;  5F99 A;  3KUY D;  4CAY A;  4KUD A;  4X23 C;  1W2E A;  3X1U D;  1T3U A;  2L5A A;  3REL D;  3AZI B;  3WA9 B;  3AZE A;  3AZH A;  2YFV A;  3AN2 D;  3UTB B;  4JJN B;  1KX5 B;  1P3F A;  4Z5T D;  4J8U D;  3W98 D;  3B6G A;  5AV8 B;  2ZY3 A;  1M1A A;  3TU4 C;  3WAA B;  4H9S C;  5B33 B;  1TZY B;  4CSR A;  1M19 C;  2ZM5 A;  1P3P A;  3AFA A;  5B1L C;  4H9R B;  3REH D;  4J8W A;  2YFW B;  5AV5 D;  4YS3 B;  3X1U C;  5CPK A;  5B40 C;  5B1M D;  2BG1 A;  4WU8 D;  1P3M A;  2ZY5 A;  3VH6 A;  4XUJ A;  5CP6 B;  3AN2 C;  1ZLA D;  4G91 C;  2NQB D;  5CPI D;  2LY8 A;  3P5J B;  2RVQ C;  3KSY A;  4Z5T C;  5CPJ B;  4J8V D;  1P3A A;  2VQR A;  2Y2J A;  5B31 D;  1ID3 B;  3MGR D;  3MNN C;  1F66 D;  3KXB B;  3AZF B;  5DNN D;  3REK D;  3MGP B;  3UTA A;  2HUE B;  2PYO A;  5AV5 C;  4HGA C;  2ZY4 A;  3AZI D;  3WA9 D;  4E45 A;  5B32 G;  4ZBJ B;  5B24 C;  4WU8 C;  1U35 D;  3UTB D;  4JJN D;  1ZLA C;  3WKJ B;  5DNM A;  5GT0 C;  1AOI B;  5B2I D;  1KX5 D;  3REJ A;  5AV8 D;  4J8V C;  2Y2M A;  1P3B A;  3WAA D;  5B33 D;  1TZY D;  5B31 C;  5G49 B;  4NFT A;  1Q9C A;  1F66 C;  2Y2G A;  5DNN C;  2CV5 A;  4ZUX A;  3O62 B;  4AWL B;  5E5A A;  3UT9 B;  4YS3 D;  4Z2M G;  2BYM B;  3AZI C;  1P3L B;  4LD9 B;  3AZG B;  3WA9 C;  5BT1 C;  5CP6 D;  3UTB C;  4JJN C;  4KUD B;  4YM6 C;  2ARO A;  1KX5 C;  5CPJ D;  3AZE B;  2HIO A;  3VH6 T;  5AV8 C;  3AZH B;  3WAA C;  3C1C A;  3X1S A;  2YFV B;  5B33 C;  1TZY C;  1P3G A;  1ID3 D;  1JFI B;  3KXB D;  3AZF D;  5B32 B;  3TU4 B;  1N1J A;  3MGP D;  3X1T D;  3VH5 W;  3C1B A;  4YS3 C;  3AZK C;  4CSR B;  3LZ1 A;  1S32 C;  2DF4 C;  3H0R C;  5CP6 C;  1A7W A;  4J8W B;  3WKJ D;  5B40 B;  1AOI D;  2F8N A;  5GSU D;  5CPJ C;  5B0Z C;  1BH9 A;  3LZ0 A;  3B6F A;  5JA4 A;  1P3M B;  2G5H C;  2IO5 B;  1P34 A;  3LJA B;  3O62 D;  2Y2P A;  4G92 B;  3MNN B;  3MGS B;  3UT9 D;  1EQZ A;  5B2J A;  3WTP A;  1P3L D;  3AZG D;  4XZQ B;  4LD9 D;  3AV1 B;  1KX4 A;  4NE5 A;  4ZBJ C;  3UTA B;  2NZD A;  4HGA B;  3R45 B;  3A6N A;  4KUD D;  2PYO B;  3H0L C;  5BS7 A;  3MGQ A;  1AOI C;  1M18 C;  4QLC B;  5B24 B;  3AZE D;  3AZH D;  1KX3 A;  1P3O A;  5GT0 B;  3NQJ A;  3W99 A;  5B32 D;  4H9N B;  5AV6 A;  3TU4 D;  3REJ B;  4AWL C;  4WJ3 C;  1M19 D;  3UT9 C;  5GT3 A;  1P3L C;  3AV2 A;  5F99 C;  4J8W D;  4KUD C;  5B40 D;  5JRG A;  5AVC B;  4KHA B;  1BH8 A;  3AZE C;  3AZH C;  4YM6 B;  4KGC A;  2RVQ D;  3FDD A;  5B0Y A;  4R8P A;  5B32 C;  3LJA D;  2FJ7 A;  3V9R B;  1P3K A;  3B6G C;  3MNN D;  3MGS D;  3X1V A;  2RIQ A;  4UPK A;  3C1C B;  1M1A C;  3KWQ A;  4XZQ D;  4X23 A;  5BO0 B;  3AV1 D;  5GXQ B;  1P3P C;  2W8S A;  3AZK B;  4WU9 A;  4J8W C;  3C1B B;  1S32 B;  5CPK C;  4QLC D;  5B24 D;  4WNN A;  1P3I B;  3LZ1 B;  3EPH A;  3AZM A;  3W97 A;  1P3M C;  5GT0 D;  2Y2H A;  2IO5 C;  1H3O A;  5B0Z B;  3LJA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...