3LJOA

Bovine trypsin in complex with ub-thr 11
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ljoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ljoA02
3NWUA 2ZHWH 1UTKA 4FUIA 2HPQH 4GHQA 1GJ6A 5DP8A 5EU8A 1V3XA 1W0YH 3M5MA 4SGBE 3A7VA 5EQSA 3V13A 4ASHA 7ESTE 2FZZA 2Y7ZA 3D65E 4LOYH 4FVBA 1SFQB 1FN6A 1ELGA 3QLPH 4TPIZ 4DW2U 1F5LA 2WINI 4INHA 1GJ5H 1KXAA 2OC1A 1C5YB 2ZGXH 3PLKA 1O34A 4X0WU 3I29A 6CHAB 3A8AA 2GVFA 4AORA 1S81A 1A5IA 3A87A 3SNEA 5EQQA 1PYTC 1QB9A 3AW0A 1VITH 3MO3A 3A84A 1ZYOA 1EZQA 1NRQH 1HNEE 1XUKA 4ZKRU 4J1YA 3CS0A 4YZUA 3RXEA 2JKHA 1VJ9U 1YP9A 1V2TT 4CR5A 1UCYK 3SGAE 3F6UH 1CHGA 1WUNH 2GDDA 2FESH 2BDIA 1UVTH 2Q6DA 1C1PA 1IQNA 1O3MA 4UFDH 2GGVB 3SGBE 3SU4A 1SGNE 1T4VH 4IMZA 3LGVA 1O2OA 1S0QA 4YOJA 4AG1A 2F9OA 1G2MA 5EODA 3PTBA 3KQCA 2J9NA 4X2WA 4INLA 1LVMA 2HNTE 1AB9C 1OWKA 4ABGA 1S6FA 3MO9A 3FP7E 3H5CB 4MQAA 4K1EA 3IWMA 4JK6A 1A4WH 3RC6A 4XOJA 1UMAH 3U1IB 1UK3A 2GZ9A 5FX5A 1DWEH 5DK1A 2Y7XA 1S6HA 3SUEA 1GPZA 1Q2WA 3GCNA 3SUDA 1P11E 3RU4D 4CBOA 2YNAA 1TONA 1AVWA 1JWTA 3SN8A 3SJKA 4ZMAH 1E0FD 1CGJE 3P17H 2CXVA 1D3PB 1EXFA 1SGFA 1GMCG 3A7TA 1K1JA 1LPZB 5C1UA 1SGIB 1Y3YA 1O2XA 1GMDG 1IQEA 2PSYA 4TWWA 1HIAA 1JXPA 1C5WB 1SHHB 1EAUA 3F9EA 3A7ZA 1K1MA 4ABIA 3V3MA 1INCA 4ZKNU 2STBE 1G3CA 2ZFTA 1LVBA 3MH5A 1ZPBA 1VITF 1HDTH 1OWHA 1TRMA 1ETSH 4D9QA 1KXCA 3HKJB 4IS5A 3NZIA 5PTPA 1BRBE 1A1RA 2WYJA 5JBAS 3V7TA 5DO4H 3UQVA 3A82A 4I7YH 1MKXH 4YTAA 1UVOA 4YOGA 4JYVH 3BIUH 2J2UA 4F4OC 5C3NA 5BRRE 4NSVA 2V3HH 2Z3DA 1V2LT 4OGXA 1FZZA 1UCYH 1P10A 1Z8IB 3O8BA 1FJSA 1O2SA 2PWXA 2ZFPH 1MTUA 3UQOA 4UE7H 1RRKA 1AMHA 4X1SU 1C2FA 3M61U 2RCEA 1BRUP 3MU5A 1ESTA 1GHWH 1TGSZ 3LGYA 3ATMA 4ZHMU 3B8JA 3O8CA 5FBIA 2ZDMA 2ULLA 1GI4A 1HAOH 1F0TA 1GI3A 4D76A 1GHXH 2Z9GA 3P8OA 5EPNA 1VGCC 4HZHA 1SHYA 1MKWK 3E91A 4FU9A 4AB9A 4TY6A 4MPWA 2AIPA 1O2HA 1TGCA 2XNIA 1YBWA 2AFQB 1H8IH 3NK8A 1B7XB 4BAHB 3ODDA 1W8BH 1RGQA 1G36A 3UPEA 1S82A 1O33A 1W2KH 4PROA 1FPCH 2B0FA 1GI5A 3B23B 5DP3A 1BTWA 5HM9A 4DVAU 1P57B 4B2AA 4Z0KA 4K69A 3GYMA 2ANMH 2ZTZA 4UD9H 3TH4H 3GCOA 3K6ZA 2ZC9H 4VGCB 2WPHS 2PGQB 1ZLRA 4ZUHA 3ZZ4A 4A7IB 3BG8A 1PPEE 1Y5UT 1ZOMA 2ZKSA 3PWBA 1B0FA 3VEQB 2SGQE 2H5CA 1O2VA 1EASA 2FTMA 1KTTB 1ZTJA 1QIXB 5A8ZA 1YPLH 4XBCA 4X1RU 4Q7YA 1QL8A 1H9HE 2Z94A 8ESTE 1SQOA 1Y59T 2C8WB 1QURH 2Z6BD 1ID5H 2R9PA 3GISB 3LH1A 1TX8A 1TAWA 2G4UA 4GHTA 1P9SA 2ZGHA 1WYKA 3BEUA 4X8VH 1TPAE 1JIMA 1Z8GA 1W14U 2FI4E 1FY4A 2GD4B 4GAWA 1TNGA 3M3TA 1O2JA 5CE1A 2ANWA 3T27A 1F0RA 3M7QA 1MQ6A 2JH6D 1ESBA 2QXHA 1NS3A 4CREA 1O3LA 3A7YA 3O8DA 1DY9A 1S85A 1EX3A 4K3JA 1DANH 2P94A 3URCA 2TPIZ 1HXEH 1WCZA 4IMQA 1LPGB 1NTPA 1P02A 1IQJA 4J2YB 4CRBA 2FMJA 5C1YA 3GICB 5I46H 1MZDA 1P2NA 2ANYA 4FUFA 3H7OA 1XUGA 1E37B 1MBMA 2BD2A 2F9NA 2BQWB 3E1XB 1EAXA 4UFGH 1O3KA 2BZ6H 4JZIA 2NU1E 4CRCA 4OS2A 2FS9A 5DP6A 2XC5A 4FU8A 3RXTA 2BXUH 2ZTXA 3RMNH 1BQYA 1RTKA 1O3PB 2NU0E 2VVUA 2A5IA 4B1TA 2YNBA 3RLWH 1O0DH 1EPTB 5CHAB 1O3GA 4INKA 2THFB 2G5NA 4IGDA 2XWBI 4O3UA 3ZZBA 3OSYA 1EB1H 1G9IE 4CHAB 1LHFH 1DS2E 2FOBA 1FDPA 1RS0A 4Y79A 1NU7B 5I25A 1BJVA 1MBQA 2VIDA 3K2UA 3SNBA 2QV1A 6GCHF 1ELBA 1GBJA 4QT8C 2ODPA 5EG4A 3LC3A 4I8JA 2F9VA 1TGTA 4WMDA 1AE8H 3SO3A 8LPRA 1Q31A 1O2GH 2FOGA 2PLXA 1ZHRA 1MD7A 2UWOA 3BTME 4CRFA 1M9UA 3RP2A 2Q6GA 3AASA 2OC8A 3M3SA 1QRWA 2QYIA 2EEKA 1GHAF 2OD3B 1UTPA 1ARBA 1IQIA 1IOEA 1XMNB 4JCNA 2A4GA 1AWHB 1HAPH 5B6OA 3RXDA 1P2OA 1PPCE 3I77A 5AF9H 5AHGH 1W10U 2TGDA 4B75A 1BMAA 1FQ3A 1KXDA 2QAAA 3LGTA 2BVRH 1PQ5A 2Z9JA 1JOUB 2ZA5A 5FHTA 1KY9A 1T8NA 5T6GA 1KLTA 1TOMH 1GJBB 1ZHMA 1AY6H 3JZ1B 1CSOE 3KGPA 3QN7A 4FUJA 1T7CA 2WUCA 3TLOA 2AMDA 4Y8YA 2C3SA 3O8RA 3RXHA 4ABBA 1DXWA 1S84A 2UUYA 1GWAA 1PQ7A 4THNH 5FPTA 1VCPA 3LC5A 3NPSA 1ZRKA 1K2I1 1NFYA 1AD8H 4BANB 1MQ5A 4CRAA 3T62A 2TGTA 3RXUA 2NWNA 3KNXA 1G37A 4JZDH 3EGKH 2A7HA 1C2IA 2BLQA 1GL0E 1HJ9A 1Z8RA 2A5KA 5C2ZA 3F68H 3CP7A 4AN7A 1TE0A 2WPMS 8GCHG 3SNAA 1HGTH 5T6FA 1GJ9B 2Y6TA 1GI9B 1W12U 1TX6A 4DURA 3GDUA 4D7GA 1GBFA 3WY8A 3T26A 2H9HA 3MU8A 1HBTH 2AYWA 4K8BA 2P3TB 1K1OA 2BDBA 1O2PA 2VVVA 3SV2H 1FPHH 3RUOA 3S9AA 1UVPA 1P12E 1ELTA 2CGAA 2W26A 2WPKS 1TNIA 1Z71A 3A85A 2ZHFH 1ARCA 2ZU3A 6LPRA 1SGCA 1EJAA 1Y5AT 1IQGA 1DE7H 1LVYA 1MU8B 2SFAA 2W7SA 2Y5FA 3M3VA 4B73A 3FFGA 1HAHH 4DOQA 1AVGH 1O3NA 4ISOA 4MPUA 4UDWH 1PJPA 4WXVA 1AGJA 4AFQA 4NGAH 1WSSH 1V6DA 4FUHA 3E16B 3TH3H 3NCLA 5JYIA 1SOTA 1Z6JH 4X8UH 1UTJA 3ZV9A 3SNDA 3TH2H 3M35A 1AKSA 1LMWB 2FTLE 2ZGBH 1SI5H 2AERH 1O5CB 3SHAH 1GBIA 2QC2A 2G00A 1GBCA 2J34A 3ATWA 5LPFA 2DE8A 5JBCS 1DDJA 2FYQA 3BTFE 5FX6A 1GHZA 1FONA 4TPYA 1NPMA 3ZYDA 2XBVA 1TABE 1O5DH 4WF8A 4Y11E 4Y76A 1L1JA 2BLWA 2BMGB 4BAQB 1J8AA 3ZZ7A 1JBUH 1BIOA 1KDQA 3A88A 3RM0H 1TPPA 2UWPA 4K1SA 1DWCH 3UFAA 1GI2A 1YKTA 4KTSA 1KXBA 3T29A 2Y81A 1MTNB 3ZVBA 1O32A 2TGAA 2BVSH 2AEIH 1CU1A 1SLXB 2F9UA 1WTGH 2XCFA 3MNBA 2O9QA 3MI4A 2ZQ1A 2Z3EA 1TBZH 1SB1H 4YM9A 1LPKB 3A8CA 1GBBA 2P8OB 3VGCC 3UREA 4WMEA 5A8XA 4Z6AH 5H4IB 3GY2A 4GSOA 1SR5C 1FI8A 2XTTB 1TBRH 1XM1A 1C2HA 3MNXA 2M5TA 4OGYA 1TGNA 1CA8B 1GBLA 2F9PA 1B0EA 1UJ1A 1P03A 1YGCH 2B5TB 3BF6H 1EPTA 2ZPRA 3A89A 1IHSH 3QGNB 4UFFH 1V2OT 5L2ZH 2R0KA 1DLEA 5JPMH 1XUFA 1HXFH 1HAYB 3ZVFA 2SGPE 2WPLS 1DM4B 3E6PH 3QZRA 1C1UH 2UUKB 1DWDH 4ABHA 1AN1E 1Z6EA 4X8SH 5L30H 1N8OB 1NRNH 3TJOA 4CR9A 3ZZDA 4ZKOU 4U32A 3OY6U 2A2XH 3QO6A 3RMLH 5K7RA 2GCTB 4JMYA 3LOXA 1SQAA 2Z3CA 1BUIA 3RM2H 1TBQH 1ZSKA 1J9CH 5LH8A 2JETB 4X6OA 2AIQA 3CS7A 1HJAC 3ZZ3A 1DITH 1XVMA 4KELA 2A45B 3R0FA 1FN8A 3RC4A 4DJZB 2V0BA 3QGJA 3ITIA 2GZ7A 3NUMA 3TK5A 2BTCE 2QY0B 3LU9B 5DJ7A 2XCNA 4ISIH 1XX9A 1THPB 4B74A 1YPMH 2BY6X 3ODFA 4VGCC 1ELEE 4YO9A 1T4UH 1GI7B 3FP8E 3N7OA 1LHEH 5GXPA 1O2IA 1UTNA 3A8DA 2H5DA 5SGAE 1C2MA 2J94A 3EDXB 2QIQA 2I6SA 4Y10E 2ZGCA 2PTNA 3SW2B 2A4RA 4MTBA 5E0GA 3KEEA 2RDLA 1UVSH 2CV3A 1CT4E 2G51A 4E7NA 1E38B 2BD3A 3LJJA 1TOCB 3P95A 1ABIH 1OWJA 2F83A 3FVFB 4X8TH 1HB0B 3FZZA 5GCHF 1C5OH 2ASUB 3PO1C 2HVXA 5BPEA 1CGIE 3BEFB 4MDSA 5G4BA 1FXYA 3BSQA 4NA9H 1F92A 1KLIH 1T8LA 4HI3A 3SJ8A 1C5LH 1IQKA 1O3AA 4NIVA 1N1LA 1EAIA 4BOHA 1ELFA 1MTWA 3E0PB 1A7SA 2XXLA 1XUIA 2ODYB 1OSSA 5J4SA 3A80A 1Q3XA 1NFWA 3P6ZB 2ZO3H 3SJ9A 3C1KA 1HIAB 1TB6H 3MTYA 1V2NT 3VB6A 1TFXA 4GCHF 2ZEBA 2G4TA 2BDHA 3PV4A 4DT7B 1A3EH 3Q3YA 1GI8B 1FY8E 4YLUA 4XSKU 2H2ZA 1WV7H 3PB1E 1Z1JA 2FIRH 5GJ4B 1UHBA 1AE5A 1BHXF 1IQLA 2FX6A 1O3CA 3SQEE 3SZNA 1CA0C 4ESTE 1OP2A 3SGQE 3B9FH 1CBWC 2EC9H 1D3DB 2OQ5A 1GHVH 2V35A 3TPIZ 1MTVA 2TRMA 4YESB 4DCDA 4DY7B 7GCHG 1YC0A 1O39A 4R0IA 2UUFB 3EQ0H 3ESTA 5C1XA 1Y3WA 2B8OH 2PKSB 4A92A 3GYLB 1GVZA 1VITG 2D1JA 3LGWA 2OQUA 1BOQA 1RXPA 1YLDA 2HGTH 1VJAU 4Y8ZA 3W94A 2A7JA 3AAVA 1IQFA 1GMHF 2A5AA 2OBQA 1QCPA 1QNJA 3QDZB 4BNRA 1F0SA 5EXMA 1L1NA 4K60A 3Q00A 1C1OA 3A86A 5TCAA 4ABAA 3E8LA 2PUQH 2ZU1A 2SNWA 2CMYA 1XVOA 1P3CA 3ELAH 1BTPA 2BLVA 1O2YA 2WYGA 3BEIB 2O8LA 1O3HA 2BY8X 2XC4A 3BG4C 2NU4E 5FPSA 1N6YA 2GV6A 4IC5A 2NU2E 1P04A 3MU4A 1WU1A 1XUHA 3Q3XA 1NU9A 1V2KT 1DY8A 3BTHE 1N6XA 4MNYA 2FOAA 1T8MA 2CN0H 2BY5X 1O3EA 1Y8TA 5LPRA 4X1QU 1T31A 2R3YA 3KQDA 3VFEA 2ZECA 3E3TA 3OU0A 3P70B 4FXGH 3TIUA 3ZVDA 1W7GH 1O3OA 2A31A 3TU7H 7KMEH 2H9EH 1C1RA 4BXWA 2VWLA 2H9TH 2VWOA 1MAYA 1HYLA 2RA3A 3SV7A 1O5BB 1SSXA 3ZV8A 3HKIB 1XXFA 2QA9E 1C5NH 1RTLA 3E0NB 1J16A 2Y5GA 4B71A 2O8TA 1QB6A 2LNCA 1L2EA 3FZDA 5A0AE 3NKKA 2GZ8A 4HTCH 1EP5A 1V2MT 3BTKE 1NRPH 1A3BH 1ZTKA 3L33A 3ZZCA 1YPHC 2FODA 1CGHA 2STAE 4ABJA 4AFUA 4LZ4B 4BTIB 1ESAA 2W7UA 1C2LA 4CHAC 1BCUH 3TNSA 4E7RG 1K1LA 1GHAG 3PROA 1G3BA 3W95A 3OYPA 3M5OA 2PKAB 1RJXB 1GI1A 1L1GA 1MMJN 2ZF0H 3D23A 1GG6B 1S83A 1V2RT 5C5OA 1SFIA 4KGAA 3FP6E 3H7TA 4GPGA 2ZFRH 4NWKA 4WY3A 1AZZA 4CH2B 3GY4A 1P2IA 2A2QH 5HXFA 2FXRA 4X6PA 1L0ZA 1QB1A 2F91A 4NG9H 3MNCA 1P06A 5A0CA 1BITA 1W7XH 3T5FH 1UK2A 1GGDB 2BX3A 1BDAA 1BMLA 1GBAA 3LT3A 5EQRA 1NM6A 1C1MA 1DFPA 1ZPZA 2LPRA 3VPKA 1V2VT 5TJXA 4NWLA 1SLUB 4AG2A 1AFQC 4X6NA 3TJNA 3MOCA 1LCYA 1IQHA 1O37A 2BHGA 3DHKH 1AZ8A 3U8OH 3RLYH 3ATLA 3SJIA 5DP5A 3RMMH 1AU8A 3ATKA 4E05H 2R3UA 1B5GH 4AFSA 1ZJKA 1BB0B 3TJVA 3EA8A 2VIQA 5EXLA 1GCDA 3F9GA 1GBDA 1ZRBA 4XDEA 5EW1H 2ZDVH 4MPXA 1C5PA 2BY9X 3IITA 1LQDB 1D9IA 2GCHG 5JDUB 5HMAA 2HNTF 3M37A 1DUAA 2A0QB 4ZHAA 4ZAEA 1LHCH 4X1NU 2CF9H 3M5NA 2B9LA 3SUGA 1D3TB 1N8OC 2Z9IA 2ALVA 2UWLA 2V6NA 3MH6A 4A1XA 2OBOA 1C5QA 4ZXYH 5AVDA 2QF3A 4H6TA 4RKJB 1LQEA 1AI8H 2OCVB 4AGJA 2BOHB 2Y82A 1T32A 3Q3KA 2PW8H 1K1IA 1K9OE 1V2UT 3PYHA 1O3DA 2C8YB 1P09A 1LKAA 3KL6A 2OUAA 2R0LA 5A8YA 2B7DH 2WPIS 3KCGH 4ISLA 3EE0B 2Y80A 1QR3E 3A81A 1GHYH 4RN6A 1BTZA 2FOEA 1EKBB 1NY22 3RXJA 1GVKB 1P01A 1UO6A 4E06H 1DICA 4XE4A 1HPGA 1YM0A 1F5KU 4ZKSU 1GBMA 2RG3A 1EZSC 2WUBA 2BQ6B 2BDGA 1BBRE 3LH3A 4NZLA 3RXPA 3TGJE 2K1QA 2J38A 1EZXC 3M36A 3PLBA 4BTTB 2VVCA 2BQ7B 1QQ4A 4WH6A 2P8OC 2GKVE 1AFQB 2VIOA 3EA7A 3QX5H 4GCHG 1XKBC 2TIOA 1E34B 2FOCA 1AUJA 1AUTC 3LJOA 3CENA 1EJNA 5CMXH 1HAVA 1Z1IA 3GCTG 1MTNC 4BXSA 2ZTYA 2GTBA 4K8YA 1GL1A 1OKXA 4FUBA 4GUXA 2D8WA 1TRNA 1OX1A 3PLPA 4R8TB 3U69H 2V3OH 1D6RA 1LTOA 2BDYA 2AGEX 3SBKA 2F3CE 5FCKA 1GG6C 1J15A 2PKAA 1RIWC 3P8NA 3ZZ5A 2HALA 1QBNA 3RXRA 1H1BA 1OWDA 2ODQA 1TMUH 4Y8XA 1GMDF 1SLVB 3S7KB 3E90B 2C8XB 4LK4A 4YOIA 3STJA 1EUFA 4NSYA 4HFPB 3QZQA 4JYTA 1GCTC 5JB8S 5JBBS 1HUTH 1DX5M 2FOMB 3U8RH 1K21H 1SGQE 3L3TA 1SGTA 2UUJB 2OINA 2ZG0H 1DSTA 1EOLA 1O2NA 1ACBE 1YCPM 1BTUA 2BXTH 5TCCA 1CHOF 2Z7FE 1ZMLA 4JZFH 1V2PT 2P3UB 1FY1A 4B2CA 3VB3A 1CT2E 1O38A 2BD5A 2JH5D 3MMGA 1YPEH 3BG4B 2BOKA 3S69A 2GX4A 1UK4A 3LGIA 1BTYA 2FPZA 1Z7KA 3U1JB 1KIGH 1S0RA 3G01A 4IN2A 2PHBA 1AQ7A 1C2JA 2FOFA 2ZCKP 3SNCA 4I8GA 2BM2A 1P0SH 2OP9A 4Q2KA 1AO5A 3KF2A 1A0JA 1WQVH 4KTCA 2PV9B 2HOBA 2BX4A 2G81E 4LXBH 2I6QA 1TPSA 2A32A 4UFEH 1IHTH 3RXBA 4FVDA 1BTHH 1TMTH 2W3IA 1O2KA 1ANEA 1W0ZU 5IYTA 1RTFB 4TWYA 4CRGA 5C20A 1SQTA 2DE9A 4YLQH 2PGBB 1CHOG 2ALPA 4FUGA 5DP9A 2VWNA 2VIWA 2IN2A 1MCTA 7GCHF 1LDTT 1CBWB 4B2BA 2CHAC 1O2ZA 2QGRA 1NN6A 1O31A 1NESE 3MYWA 1NRSH 4CRDA 1KYNA 3SU6A 3BTEE 1E35B 3I78A 3MNSA 3RXIA 4GVUA 4AX9H 1UTQA 4OS4A 3DFLA 3M7UA 3RMOH 4H4FA 2ZU4A 1F2SE 3RU4E 3KN2A 4Q7ZA 3SHCH 1GMHG 1MCVA 1RD3B 1P8VC 3SU3A 3F9FA 2QXIA 1C4Y2 3V12A 2QCYA 2WV5A 4I8HA 1CA0B 1HAGE 2P93A 4NIYA 2ANKH 3RXSA 1GCTB 2ZI2H 1U6QA 5EOKA 2ZP0H 1TNJA 3ZYEA 1O3FA 1OP0A 1C4U2 1TRYA 4AYYB 4OS7A 3T28A 4KTUA 1O2MA 1P2KA 4CBNA 1G3DA 1TQ7B 2OC0A 1C2EA 1QHRB 5A09A 3SJOA 2FP7B 4CH8B 2FLRH 1W13U 1LHGH 4BTUB 1EATA 2ZDNA 1GDNA 4X2XA 2ZU2A 1VZQH 3SV8A 1GDUA 1YPGH 1UTLM 1H9LB 1BZXE 1FLEE 3FANA 1C4V2 2BB4A 4MG3A 1VCQA 1C2KA 2EA3A 3DUXH 1O2WA 1HV7A 1SGYE 1BMNH 4K5ZA 1FIZA 1ZMNA 2J92A 5T6DA 1DUEA 3OY5U 1MU6B 1P9UA 1OWEA 1DWBH 1ZGIA 5L6NH 1MH0A 4NA7A 1EJMA 1O5GH 3PO1B 2OXSA 1SG8B 1W3CA 4B76A 2VNTA 3ZZ9A 1QA7A 3M7TA 4X2VA 1BA8B 3BTGE 2IJOB 3BV9B 1GJ8B 1GVLA 1QJ6B 4MNVA 4H6SB 2QXJA 1QJ1B 3SORA 3SU0A 3P92A 4LZ1H 3UNQA 2H6MA 3UWIA 2CF8H 1O36A 3GY6A 1GHBF 5DKMA 3SI4H 1AVXA 1D6WA 4O97A 1ELCA 3MH7A 4O03A 3HATH 1OS8A 2XRCA 1Y3UA 3GCTF 3PMBB 3UOUA 4WWYA 4D8NA 1HJAB 1QTFA 1O2RA 1MD8A 2PTCE 1AIXH 2VH0A 5GCHG 1MKWH 2VH6A 2ZFSA 4HGCA 1ZSJA 1OP8A 1K1PA 1K1NA 3ZZ6A 2ZFQH 1EP6A 3UOPA 5GDSH 1KDQB 3MH4A 1YLCA 1EZUC 4MLFB 1G32B 1NC6A 4I33A 3SU2A 1HFDA 1SGPE 3QK1A 4Q80A 4WJG2 1DVAH 2WPJS 1OYQA 1YPKH 2C90B 2ZPSA 2GCTC 4MNXA 3RXGA 4ZH8A 5GIBA 1FNIA 1EPTC 4A1VA 1EOJA 3BTTE 1A5HA 1NZQH 2HPPH 4FUEA 2XBYA 1HAXB 2VB0A 1QL9A 1D3QB 2VU8E 1FMGA 3AVZA 1YYY1 4A1TA 2ZNKH 5F8ZA 1CQQA 1ZZZA 3PTNA 4U30A 1GJ4H 1FIWA 5F8XA 4Y0ZE 2TGPZ 1SLWB 4DGJA 2AGIX 1ABJH 5HGGA 1XUJA 1SGEE 5IDKA 1FAXA 1Y5BT 4YT7H 2A4OA 4NFFA 1QFKH 3URDA 4Y7AA 2C93B 4Q7XA 1MAXA 4SGAE 3EA9A 1C2DA 2ZHEH 1PPGE 2FS8A 3VGCB 1ZR0A 3RXMA 3RXAA 2P16A 5E0HA 3OTJE 5FPYA 1PPHE 4X6MA 1NFXA 1J14A 3LGUA 1PPFE 1ETTH 4XBDA 1ANDA 4K2YA 4A6LA 2PSXA 1BT7A 2BYAX 2IPHA 2BLOA 2FWWA 5JBTA 2GP9B 8GCHF 2FDAA 1GBKA 4FUDA 2IOTA 2ILNA 1WOFA 2VGCB 1OXGA 1EAWA 4BAKB 4O3TA 2BVXH 5FXLA 1IAUA 3TK6A 1GJ7B 3LKWA 3ZVEA 1TNLA 1O5EH 2EI8A 3A7WA 3R3GB 2J95A 1JMOH 2VINA 3TJUA 3D62A 1EB2A 3BTDE 2ZWLH 1JRSA 1SC8U 2EI7A 3RXQA 2QXGA 4NFEA 1KTSB 3LIWA 3VB4A 1F0UA 1QA0A 1HJ8A 1A0LA 3IG6B 3SUFA 1ETRH 3SV9A 1GI0A 2GMTB 3UWJH 4Y71A 2FM2A 4OS1A 1SPJA 3VXFH 1F5RA 3S0NA 1BTXA 2H1UA 2VIVA 5C67A 1LHDH 2C8ZB 4U2WA 3PM3A 3VB5A 1Z8JB 3ZZAA 2BD7A 2FEQH 1TYNA 2XBXA 3HK6B 2FO9A 1TX7A 4WMFA 1A61H 3JZ2B 2W3KA 3GY5A 4IBLH 2GCHF 2FYRA 5E2OA 3T2NA 1KXEA 1GGDC 3UIRA 1DPOA 1E36B 1ELDE 3OX7U 1BBRK 2G52A 1H9IE 1V2QT 1QRZA 3HGNA 4XBBA 2QF0A 1P2MA 3D49H 3P8GA 3UY9A 1AKSB 2FOHA 2G8TA 5DGJA 1C1SA 5DP7A 4D7FA 4NCYA 5F6MA 2XC0A 2SNVA 1OPHB 2XBWA 4WH8A 5C5NA 1F7ZA 1HLTH 3ZVCA 2KAIB 3LPRA 1OWIA 5FCRA 3GCHB 1GBEA 1L4ZA 6ESTA 3UUZA 3GY3A 1IQMA 1UTOA 1Y3VA 2P3FH 3DA9B 4JZ1A 1OYTH 8KME2 1AB9B 1THRH 3ZVGA 3MU1A 1C5SA 5AFZH 2P95A 1YF4A 2ZPQA 2O8MA 1PFXC 2BZAA 1QQUA 5E0JA 2VWMA 1FY5A 1TLDA 1V2JT 3MFJA 1O5AB 3KQBA 2BDCA 1DOJA 5JB9S 5HM2A 1O2LA 1MUEB 3GDSA 3RU4T 3K6YA 2HLCA 2PKSC 5ABWA 3EYDA 2ZZUH 2J4IA 1EQ9A 2FI3E 1NO9H 3TGIE 3C27B 2JH0D 4KKDA 2HRVA 2BD4A 1TWXB 5T3HA 4MVNA 1TIOA 3TITA 1ZPCA 1P2QA 1C5VA 1BBRH 2BDAA 2AMQA 1C5TA 2ZGJA 1O3BA 3PMHB 1T8OA 3MHWU 3VXEH 1K28D 4I8LA 1BHXB 2CHAB 2ZDKA 2XWAA 4OS6A 1TGBA 4WVPE 2KAIA 1G30B 2EI6A 2A4QA 3RXOA 2AGGX 2OC7A 3TNTA 6CHAC 1A5GH 1NROH 1HAZB 1L4DA 3GY7A 3A83A 4AGKA 4I31A 3U8TH 4ABDA 1X7AC 2FI5E 1HAVB 5FAHA 3SV6A 1ELAA 1C9PA 4JK5A 3M5LA 2VIPA 2A1DB 1TNKA 1NRRH 4K1TA 1AWFH 3GOVB 2SGAA 1MKXK 1FUJA 1QBVH 3PWCA 1SGRE 4ZXXH 1DLKB 1O2TA 1AFEH 4UEHH 1ZSLA 2GDEH 1GJAB 3ATIA 4AYVB 3SI3H 3RXFA 1KSNA 1O3IA 2ZU5A 1UCYE 1ZJDA 4I8KA 1A0HB 1SGFG 4XFQA 3GCHC 3QUMP 3TK9A 1GBHA 1WBGB 3UR9A 4AZ2B 1UVUH 2BY7X 2NU3E 3AAUA 4RKOB 4NA8A 4U01A 1JRTA 1NT1A 3LDXH 4A5TS 1NFUA 9ESTA 2O8UA 4JYUH 1P3EA 5ESTE 1QBOA 4YT6H 3SU5A 2SGDE 5FBEA 4KP0A 3FAOA 1VCWA 2D2DA 1WQSA 4FU7A 5F03A 3QTOH 3V0XA 3UR6A 4ISHH 3VB7A 6GCHG 1OOKB 1TNHA 3Q77A 5A2MH 1FAKH 2SGEE 1ANBA 3RXLA 1TPOA 1QRXA 2QN5T 3KQEA 1TALA 3RC5A 2O8WA 2SGFE 2Q6FA 1O2UA 1SOZA 3SU1A 1QY6A 1ZGVA 1BRAA 2OLGA 1KLJH 1SBWA 1PQ8A 1GJDB 2PR3A 3PMAB 4ABEA 4BAOB 4F49A 1UTMA 5L2YH 1DSUA 2Z9KA 3A7XA 3P8FA 1PYTD 4MNWA 3U9AH 1YPHE 5E8EH 1RIWB 3SQHE 4D9RA 2GMTC 5EW2H 1BRCE 1TA2A 5ETXA 3QTVH 1GMCF 1D4PB 2RA0A 1H4WA 4TYDA 5E2PA 7LPRA 1SL3A 2ZCLP 2VGCC 2R2MB 1ANCA 3STIA 1FV9A 1C1TA 1GI6A 1C5ZB 2JETC 3MWIU 5A0BA 3UNSA 1O2QA 5HYOA 3RXCA 4I32A 4Y6DA 1YCPH 3ZVAA 2ZIQH 3TGKE 4DIHH 1CT0E 1PQAA 2ZCHP 3QWCH 1QJ7B 1FY3A 5CHAC 5K0HA 3EAJA 4ABFA 4IW4E 2CJIA 1G3EA 1SGDE 2ESTE 2G5VA 5EXNA 1ELVA 5F8TA 3PMJA 3DT0H 3ZZ8A 3BIVH 2ZDAH 3S9BA 4BAMB 5ESBA 1GHBG 1WAYB 5GPIB 4Y0YE 1G2LA 3DFJA 3F9HA 1H8DH 3L6PA 4RSPA 1DT2A 2P59A 3K9XB 1W11U 2FLBH 1ZTLA 2GT8A 4X1PU 4ZHLU 1BJUA 2DUCA 1VGCB 2ZFFH 1YPJH 3NXPA 4AOQA 1LKBA 2HNTC 4NIXA 4DIIH 1C9TA 1GBTA 1SMFE 3KHVA 1A46H 3MU0A 2ZDLA 1C5UA 1O35A 2C4FH 1SVPA 2VJ1A 3F1SB 1J17T 4JZEH 3T25A 4H42U 4AB8A 2XW9A 1C1VH 5LPEA 3S9CA 1XXDA 1ZHPA 3RXVA 1S5SA 3SOSA 1V2ST 1C1WH 1BMMH 4UONA 2ZHDA 3U98H 1AHTH 5DG6A 2TBSA 2R2WU 3K65B 2AMPA 1P05A 1PPZA 3GY8A 5GWZA 1O5FH 3BTWE 4ZROA 1CO7E 3MO6A 3ENSB 1PPBH 5DP4A 1V2WT 2F9BH 4TY7A 1CE5A 1YCPK 3RXKA 3DD2H 4ISNA 2WV4A 5EPYA 1A2CH 1O30A 3TVJB 1VR1H 3HK3B 1LVOA 1TQ0B 2XYAA 2HWLB 4GLYA 3KIDU 1THSH 3A8BA 4IC6A 4O9VA 1Y3XA 1C5MD 4IN1A 3HPTB 1MTSA 1GJCB 1C5XB 4M7GA 1KXFA 2PUXB 3S7HB 1C2GA 1C5RA 1MZAA 2BD8A 2Z9LA 1HAIH 5J4QA 1K22H 1WTHD 3UNRA 1QGFA 4DG4A 5DPAA 5AFYH 2GT7A 3BTQE 1TMBH 3LONA 2Y5HA 3UTUH 1CVWH 4AFZA 2W5EA 4MPVA 1HCGA 1JIRA 2PFEA 1XKAC 2BD9A 1UHBB 2OTVA 2ZHQH 4WXIA 2GV7A 1ORFA 1DXPA 5EGMA 3BN9A 1C1QA 2D26C 4Y7BA 1QL7A 3RDZA 2ZQ2A 3AW1A 1TA6A 2Q1JA 2G55A 4NIWA 4NZQA 1LO6A 1ZMJA 2AH4X 3HGPA 5LGOA 2FX4A 1HRTH 3Q76A 2YOLA 4FUCA 1O3JA 9LPRA 4OS5A 1C1NA 1P2JA 2A7CA 1GDQA 2AS9A 1RFNA 3GDVA 4X2YA
chains in the Genus database with same CATH superfamily
3NWUA 3UAIC 2ZHWH 1UTKA 3FN8A 2HPQH 4FUIA 4GHQA 1GJ6A 5DP8A 5EU8A 1V3XA 1W0YH 3M5MA 4SGBE 3A7VA 5EQSA 3V13A 4ASHA 7ESTE 2FZZA 2Y7ZA 4P02A 3D65E 4LOYH 4FVBA 1SFQB 1FN6A 1ELGA 3QLPH 4TPIZ 5DSFA 4DW2U 1F5LA 2WINI 4INHA 1GJ5H 1KXAA 2OC1A 1C5YB 2ZGXH 3PLKA 1O34A 4X0WU 4Q4LA 3I29A 6CHAB 3A8AA 2GVFA 4AORA 1S81A 1A5IA 3A87A 3SNEA 5EQQA 1PYTC 1QB9A 3AW0A 1VITH 3MO3A 3A84A 1ZYOA 1EZQA 1NRQH 1HNEE 1XUKA 1YLNA 4ZKRU 4J1YA 3CS0A 4YZUA 3RXEA 2JKHA 1VJ9U 1YP9A 1V2TT 4CR5A 1UCYK 3SGAE 3F6UH 1CHGA 1WUNH 2GDDA 2FESH 2BDIA 1UVTH 2Q6DA 1C1PA 1IQNA 1O3MA 4UFDH 2GGVB 3SGBE 3SU4A 1SGNE 1T4VH 4IMZA 3LGVA 1O2OA 1S0QA 4YOJA 4AG1A 2F9OA 1G2MA 5EODA 3PTBA 3KQCA 2J9NA 4X2WA 4INLA 1LVMA 2HNTE 1AB9C 1OWKA 4ABGA 1S6FA 3WWFA 3MO9A 3FP7E 3H5CB 4MQAA 4K1EA 3IWMA 4JK6A 1A4WH 3RC6A 2EQNA 4XOJA 1UMAH 3U1IB 1UK3A 2GZ9A 5FX5A 1DWEH 5DK1A 2Y7XA 2L74A 1S6HA 3SUEA 1GPZA 1Q2WA 3GCNA 3SUDA 1P11E 3RU4D 4CBOA 2YNAA 1TONA 1AVWA 1JWTA 3SN8A 3KYGA 3SJKA 4ZMAH 1E0FD 1CGJE 3P17H 2CXVA 1D3PB 1EXFA 1SGFA 1GMCG 2JJ2D 3A7TA 1K1JA 1LPZB 5C1UA 1SGIB 1Y3YA 1O2XA 1GMDG 1IQEA 2PSYA 4TWWA 1HIAA 1JXPA 1C5WB 1SHHB 1EAUA 3F9EA 4FETA 3A7ZA 1K1MA 4ABIA 3V3MA 1K0HA 1INCA 4ZKNU 2STBE 1G3CA 2ZFTA 1LVBA 3MH5A 3UB0A 1ZPBA 1VITF 1HDTH 1OWHA 1TRMA 1ETSH 4D9QA 1KXCA 3HKJB 4IS5A 3NZIA 5PTPA 4ASUD 1BRBE 1A1RA 2WYJA 5JBAS 4XRNA 3V7TA 5DO4H 3UQVA 3A82A 4I7YH 1MKXH 4YTAA 1UVOA 4YOGA 2YMSC 4JYVH 3BIUH 2J2UA 4F4OC 5C3NA 5BRRE 4NSVA 2V3HH 2Z3DA 1V2LT 4OGXA 1FZZA 1UCYH 1P10A 1Z8IB 3O8BA 1FJSA 1O2SA 2PWXA 2ZFPH 5F53A 1MTUA 3UQOA 4UE7H 1RRKA 1AMHA 4X1SU 1C2FA 2KX4A 3M61U 2RCEA 1BRUP 3MU5A 1ESTA 1GHWH 1TGSZ 3LGYA 2V3MA 3ATMA 4ZHMU 3B8JA 3O8CA 5FBIA 2ZDMA 2ULLA 1GI4A 1HAOH 1F0TA 1GI3A 4OM9A 4D76A 1GHXH 2Z9GA 3P8OA 5EPNA 1VGCC 4HZHA 1SHYA 1MKWK 3E91A 3FO8D 4FU9A 4AB9A 4TY6A 4MPWA 2AIPA 1O2HA 1TGCA 2XNIA 1YBWA 2AFQB 2JJ1D 1H8IH 3NK8A 1B7XB 4BAHB 3ODDA 1W8BH 1RGQA 1G36A 3UPEA 1S82A 1O33A 1W2KH 4PROA 1FPCH 2B0FA 1GI5A 3OEED 3B23B 5DP3A 1BTWA 5HM9A 4DVAU 1P57B 4B2AA 4Z0KA 4K69A 3GYMA 2ANMH 2ZTZA 4UD9H 3TH4H 3GCOA 3K6ZA 2ZC9H 4VGCB 2WPHS 2PGQB 1ZLRA 4ZUHA 3ZZ4A 4A7IB 3BG8A 1PPEE 1Y5UT 3F2GA 1ZOMA 2ZKSA 3PWBA 1B0FA 4AC9A 3VEQB 2SGQE 2H5CA 1O2VA 1EASA 2FTMA 1KTTB 1ZTJA 3F2FA 1QIXB 5A8ZA 1OHHD 1YPLH 4XBCA 4X1RU 4Q7YA 1QL8A 1H9HE 2Z94A 2M2AA 8ESTE 1SQOA 1Y59T 2C8WB 1QURH 2Z6BD 1ID5H 2R9PA 3GISB 3LH1A 1TX8A 1TAWA 2G4UA 5EJ1A 4GHTA 1P9SA 2ZGHA 1FX0B 1WYKA 3BEUA 4X8VH 1TPAE 2YMSB 1JIMA 1Z8GA 1W14U 2FI4E 1FY4A 2GD4B 4GAWA 1TNGA 3M3TA 1O2JA 5CE1A 2ANWA 3T27A 1F0RA 3M7QA 1MQ6A 2JH6D 1ESBA 2QXHA 1NS3A 4HG6A 4CREA 1O3LA 3A7YA 3O8DA 1DY9A 1S85A 1EX3A 4K3JA 1DANH 2P94A 3URCA 2TPIZ 1HXEH 1WCZA 4IMQA 1LPGB 1NTPA 1P02A 1IQJA 4J2YB 4CRBA 2FMJA 5C1YA 3GICB 2KZ4A 5I46H 1MZDA 1P2NA 2ANYA 4FUFA 3H7OA 1XUGA 1E37B 1MBMA 2BD2A 3SZEA 2F9NA 2BQWB 3E1XB 1EAXA 4UFGH 1O3KA 2BZ6H 4JZIA 2NU1E 4CRCA 4OS2A 2FS9A 5DP6A 2XC5A 4FU8A 3PV2A 3GS9A 3RXTA 2BXUH 2ZTXA 3RMNH 1BQYA 1RTKA 1O3PB 2NU0E 2VVUA 2A5IA 4B1TA 2YNBA 3RLWH 1O0DH 1EPTB 5CHAB 1O3GA 4INKA 2THFB 2G5NA 4IGDA 2XWBI 4O3UA 3ZZBA 3OSYA 1EB1H 2J5UA 1G9IE 4CHAB 1LHFH 1DS2E 2FOBA 1FDPA 1RS0A 4Y79A 1NU7B 5I25A 1BJVA 1MBQA 2VIDA 3K2UA 3SNBA 2QV1A 6GCHF 1ELBA 1GBJA 4QT8C 2ODPA 5EG4A 3LC3A 4I8JA 2F9VA 1TGTA 4WMDA 1AE8H 3SO3A 8LPRA 1Q31A 1O2GH 2FOGA 2PLXA 1ZHRA 2K0QA 1MD7A 2UWOA 3BTME 4CRFA 1M9UA 3RP2A 2Q6GA 3AASA 2OC8A 3M3SA 1QRWA 2QYIA 2EEKA 1GHAF 2OD3B 1UTPA 1ARBA 1IQIA 1IOEA 1XMNB 4JCNA 4F48B 2A4GA 2W6JD 5HIYA 1AWHB 1HAPH 5B6OA 3RXDA 1P2OA 1PPCE 3I77A 5AF9H 5AHGH 1W10U 2TGDA 4B75A 1BMAA 1FQ3A 1KXDA 2QAAA 3LGTA 2BVRH 1PQ5A 2Z9JA 1JOUB 2ZA5A 5FHTA 1KY9A 1SKYE 1T8NA 5T6GA 1KLTA 1TOMH 1GJBB 1ZHMA 1AY6H 3JZ1B 1CSOE 3PRDA 2F4LA 3KGPA 3QN7A 4FUJA 1T7CA 2WUCA 3TLOA 2AMDA 4Y8YA 2C3SA 3O8RA 3RXHA 4ABBA 1DXWA 1S84A 2UUYA 1GWAA 1PQ7A 4THNH 5FPTA 1VCPA 3LC5A 3NPSA 1ZRKA 1K2I1 1NFYA 1AD8H 4BANB 1MQ5A 2K8IA 4CRAA 3T62A 4YXWD 2TGTA 3RXUA 2NWNA 3KNXA 1G37A 4JZDH 3EGKH 2A7HA 1C2IA 2BLQA 1GL0E 1HJ9A 1Z8RA 2A5KA 5C2ZA 3F68H 5EIYA 3CP7A 4AN7A 1TE0A 2WPMS 8GCHG 3SNAA 1HGTH 5T6FA 1GJ9B 2Y6TA 1GI9B 1W12U 1TX6A 2J97A 3CNRA 4DURA 3GDUA 2YMSD 4D7GA 1GBFA 3WY8A 1E1QD 3T26A 2H9HA 3MU8A 1HBTH 2AYWA 4K8BA 2P3TB 3OTPA 1K1OA 2BDBA 1O2PA 2VVVA 3SV2H 1FPHH 3RUOA 3S9AA 1UVPA 1P12E 1ELTA 2CGAA 2W26A 2WPKS 1TNIA 1H8HD 1Z71A 3A85A 2ZHFH 1ARCA 1YY3A 2ZU3A 1H8ED 1SGCA 6LPRA 1EJAA 1Y5AT 1IQGA 1DE7H 1LVYA 1MU8B 2SFAA 2W7SA 2Y5FA 3M3VA 4B73A 3FFGA 1HAHH 4DOQA 1AVGH 1O3NA 4ISOA 4MPUA 4UDWH 1PJPA 4WXVA 1AGJA 4AFQA 4NGAH 1WSSH 1V6DA 4FUHA 3E16B 3F0OA 3TH3H 2QF4A 3NCLA 5JYIA 1SOTA 1Z6JH 4X8UH 1UTJA 3ZV9A 3SNDA 3TH2H 3M35A 1AKSA 1LMWB 2FTLE 2ZGBH 1SI5H 2AERH 1O5CB 3SHAH 1GBIA 2QC2A 2G00A 1GBCA 2J34A 3ATWA 5LPFA 2DE8A 5JBCS 1DDJA 2FYQA 3BTFE 5FX6A 1GHZA 1FONA 4TPYA 3W1EA 1NPMA 3ZYDA 2XBVA 1TABE 1O5DH 4WF8A 4Y11E 4Y76A 1L1JA 2BLWA 2BMGB 4BAQB 1J8AA 3ZZ7A 3OE7D 1JBUH 1BIOA 1KDQA 3A88A 3RM0H 1TPPA 2UWPA 4K1SA 1DWCH 3UFAA 1GI2A 1YKTA 4KTSA 1KXBA 3T29A 2Y81A 1MTNB 3ZVBA 1O32A 2TGAA 5IK2D 2BVSH 2AEIH 1CU1A 1SLXB 2F9UA 2RFKC 1WTGH 2XCFA 3MNBA 2O9QA 3MI4A 2ZQ1A 2Z3EA 1TBZH 1SB1H 4YM9A 1LPKB 3A8CA 1GBBA 2P8OB 3VGCC 3UREA 4WMEA 5A8XA 4Z6AH 5H4IB 3GY2A 4GSOA 1SR5C 1FI8A 1TBRH 2XTTB 1XM1A 1C2HA 3MNXA 2M5TA 2OK5A 4OGYA 1TGNA 1QZ8A 1CA8B 1GBLA 2WV9A 2F9PA 1B0EA 1UJ1A 1P03A 1YGCH 2KCOA 2B5TB 1EPTA 2J98B 3BF6H 2ZPRA 3A89A 1IHSH 3QGNB 4UFFH 1V2OT 5L2ZH 2R0KA 1DLEA 5JPMH 1XUFA 1HXFH 1HAYB 3ZVFA 2SGPE 2WPLS 1DM4B 3E6PH 3QZRA 1C1UH 2UUKB 1DWDH 4ABHA 1AN1E 1Z6EA 4X8SH 5L30H 1N8OB 1NRNH 3TJOA 4CR9A 3ZZDA 4ZKOU 4U32A 3OY6U 2A2XH 3QO6A 3RMLH 5K7RA 2GCTB 4JMYA 3LOXA 1SQAA 2Z3CA 1BUIA 3RM2H 1TBQH 1ZSKA 1J9CH 5LH8A 2JETB 4X6OA 2AIQA 3CS7A 2IPQX 1HJAC 3ZZ3A 1DITH 1XVMA 4KELA 2A45B 3R0FA 1FN8A 3RC4A 4DJZB 2V0BA 3QGJA 3ITIA 2GZ7A 3NUMA 3TK5A 2BTCE 2QY0B 3LU9B 3OEHD 5DJ7A 2XCNA 4ISIH 1XX9A 1THPB 4B74A 1YPMH 2BY6X 3ODFA 4VGCC 1ELEE 1W0KD 4YO9A 1T4UH 1GI7B 3FP8E 3N7OA 1LHEH 5GXPA 1O2IA 1UTNA 3A8DA 2H5DA 5SGAE 2WZQA 1C2MA 2J94A 3EDXB 2QIQA 2I6SA 4Y10E 2ZGCA 2PTNA 3SW2B 2A4RA 4MTBA 5E0GA 3KEEA 2RDLA 1UVSH 2CV3A 1CT4E 2G51A 4E7NA 1E38B 2BD3A 3LJJA 1TOCB 3P95A 1ABIH 1OWJA 2F83A 3FVFB 4X8TH 4FOUC 1HB0B 3FZZA 5GCHF 1C5OH 2ASUB 3PO1C 2HVXA 5BPEA 2QF5A 1CGIE 3BEFB 4MDSA 5G4BA 1FXYA 3BSQA 4NA9H 3OAAD 1F92A 1KLIH 1T8LA 4HI3A 3SJ8A 1C5LH 3WWBA 1IQKA 1O3AA 4NIVA 1N1LA 1EAIA 4BOHA 1ELFA 1MTWA 3E0PB 1A7SA 2XXLA 1XUIA 4B6EA 2ODYB 1OSSA 5J4SA 3A80A 1Q3XA 1NFWA 2KCAA 3P6ZB 2ZO3H 3SJ9A 3C1KA 1HIAB 1TB6H 3MTYA 1V2NT 3VB6A 1TFXA 4GCHF 2ZEBA 5FL7D 2G4TA 2BDHA 3PV4A 4DT7B 1A3EH 3Q3YA 1GI8B 1FY8E 4YLUA 4XSKU 2H2ZA 1WV7H 3PB1E 1Z1JA 2FIRH 5GJ4B 1UHBA 2WPDD 1AE5A 1BHXF 1IQLA 2F43B 2FX6A 1O3CA 3SQEE 3SZNA 1CA0C 4ESTE 1OP2A 3SGQE 3B9FH 1CBWC 2EC9H 1D3DB 2OQ5A 1GHVH 2V35A 3TPIZ 1MTVA 2TRMA 4YESB 4DCDA 4DY7B 7GCHG 1YC0A 1O39A 4R0IA 2UUFB 3EQ0H 3ESTA 5C1XA 1Y3WA 2B8OH 2PKSB 4A92A 3GYLB 1GVZA 1VITG 2D1JA 3LGWA 2OQUA 5C0TA 4B6FA 1BOQA 1RXPA 1YLDA 2HGTH 1VJAU 4Y8ZA 3MQKC 3W94A 2A7JA 3AAVA 1IQFA 1GMHF 2A5AA 2OBQA 1QCPA 1QNJA 3QDZB 4BNRA 1F0SA 5EXMA 1L1NA 4K60A 3Q00A 1C1OA 3A86A 5TCAA 3F0PA 3E8LA 4ABAA 2PUQH 2ZU1A 2SNWA 2CMYA 1XVOA 1P3CA 3ELAH 1BTPA 2BLVA 1O2YA 2WYGA 3BEIB 2O8LA 1O3HA 2BY8X 2XC4A 3BG4C 3ZIAD 2NU4E 5FPSA 1N6YA 5CHBA 2GV6A 4IC5A 2NU2E 1P04A 3MU4A 1WU1A 1XUHA 3N99A 3Q3XA 1NU9A 1V2KT 1DY8A 3BTHE 1N6XA 4MNYA 2FOAA 1T8MA 2CN0H 2BY5X 1O3EA 1Y8TA 5LPRA 4X1QU 1T31A 2R3YA 3KQDA 3VFEA 2ZECA 3E3TA 3OU0A 3P70B 4FXGH 3TIUA 3ZVDA 1W7GH 1O3OA 2A31A 3TU7H 7KMEH 2H9EH 1BMFD 1C1RA 4BXWA 2VWLA 2H9TH 2VWOA 1MAYA 1WDIA 1HYLA 2RA3A 3SV7A 1O5BB 1SSXA 3ZV8A 3HKIB 1XXFA 2QA9E 1C5NH 1RTLA 3E0NB 1J16A 2Y5GA 4B71A 2O8TA 1QB6A 2LNCA 1L2EA 3FZDA 5A0AE 3NKKA 2GZ8A 4HTCH 1EP5A 1V2MT 3BTKE 1NRPH 2KCPA 1A3BH 1ZTKA 3L33A 3ZZCA 1YPHC 2FODA 1CGHA 2STAE 4ABJA 4AFUA 4LZ4B 4BTIB 1ESAA 3AK5A 2W7UA 1C2LA 4CHAC 1BCUH 3TNSA 4E7RG 2KM0A 1K1LA 1GHAG 3PROA 5C0UA 1G3BA 3W95A 3OYPA 3M5OA 2PKAB 1RJXB 1GI1A 1L1GA 1MMJN 2ZF0H 3D23A 1GG6B 1S83A 1V2RT 5C5OA 1SFIA 4KGAA 3FP6E 3H7TA 4GPGA 2ZFRH 4NWKA 4WY3A 1AZZA 4CH2B 3GY4A 1P2IA 2A2QH 5HXFA 2FXRA 4X6PA 1L0ZA 1QB1A 2F91A 4NG9H 3MNCA 1P06A 5A0CA 1BITA 1W7XH 3N7EA 3SYJA 3T5FH 1UK2A 1GGDB 1NBME 2BX3A 1BDAA 1BMLA 1GBAA 3LT3A 5EQRA 1NM6A 1C1MA 1DFPA 1ZPZA 2LPRA 3VPKA 1V2VT 5TJXA 4NWLA 1SLUB 4AG2A 1AFQC 4X6NA 3TJNA 3MOCA 1LCYA 2LELA 1IQHA 3FOAA 1O37A 2BHGA 3DHKH 1AZ8A 3U8OH 3RLYH 3ATLA 3SJIA 5DP5A 3RMMH 1AU8A 3ATKA 4E05H 2R3UA 3PRBA 1B5GH 4AFSA 1ZJKA 1BB0B 3TJVA 3EA8A 2VIQA 5EXLA 1GCDA 3F9GA 1GBDA 2XOKD 1ZRBA 4XDEA 5EW1H 2ZDVH 4MPXA 1C5PA 2BY9X 3IITA 1LQDB 1D9IA 2GCHG 5JDUB 5HMAA 2HNTF 3M37A 1DUAA 2A0QB 4ZHAA 4ZAEA 1LHCH 4X1NU 2CF9H 3M5NA 2B9LA 3SUGA 3U28C 1D3TB 1N8OC 2Z9IA 3N7DA 5CDFE 2ALVA 2UWLA 2V6NA 3MH6A 4A1XA 2OBOA 1C5QA 4ZXYH 5AVDA 2QF3A 4H6TA 4RKJB 1LQEA 1AI8H 2OCVB 4AGJA 2BOHB 2Y82A 1T32A 3Q3KA 2PW8H 1K1IA 1K9OE 1V2UT 3PYHA 1O3DA 2C8YB 1P09A 2WHXA 1LKAA 3KL6A 2OUAA 2R0LA 5A8YA 2B7DH 2WPIS 3KCGH 4RT0A 4ISLA 3EE0B 2Y80A 1QR3E 3A81A 1GHYH 4RN6A 1BTZA 2FOEA 2W6ID 1EKBB 1NY22 3RXJA 1GVKB 1P01A 1UO6A 4Q63A 4E06H 1DICA 4XE4A 1HPGA 1YM0A 1F5KU 4ZKSU 1GBMA 2RG3A 1EZSC 2WUBA 2BQ6B 2BDGA 1BBRE 3LH3A 4NZLA 3RXPA 4Z1MD 3TGJE 2K1QA 2J38A 1EZXC 3M36A 3PLBA 4BTTB 4I86A 2VVCA 2BQ7B 1QQ4A 4WH6A 2P8OC 2GKVE 1AFQB 2VIOA 3EA7A 3QX5H 4GCHG 1XKBC 2TIOA 3OFND 1E34B 2FOCA 1AUJA 1AUTC 3LJOA 3CENA 1EJNA 5CMXH 1HAVA 4RT1A 1Z1IA 2AHME 3GCTG 1MTNC 4BXSA 2ZTYA 2PP6A 2GTBA 4K8YA 1GL1A 1OKXA 4FUBA 4GUXA 2D8WA 1TRNA 1OX1A 3PLPA 2EY4C 4R8TB 3U69H 2V3OH 1D6RA 1LTOA 2BDYA 2AGEX 3SBKA 2F3CE 5FCKA 1GG6C 1J15A 2PKAA 1RIWC 3P8NA 3ZZ5A 2HALA 1QBNA 3RXRA 1H1BA 1OWDA 2ODQA 1TMUH 3DSOA 1GMDF 1SLVB 4Y8XA 3S7KB 3E90B 2C8XB 4LK4A 4YOIA 3STJA 1EUFA 4NSYA 4HFPB 3QZQA 4JYTA 1GCTC 5JB8S 5JBBS 1HUTH 1DX5M 2FOMB 3U8RH 1K21H 1SGQE 3L3TA 1SGTA 2UUJB 1VKYA 2OINA 2ZG0H 1DSTA 1EOLA 1O2NA 1ACBE 1YCPM 4ZCNA 1BTUA 2BXTH 2QE7D 5TCCA 1CHOF 2Z7FE 1ZMLA 4JZFH 1V2PT 2P3UB 1FY1A 4B2CA 3VB3A 1CT2E 1O38A 2BD5A 2JH5D 3MMGA 1YPEH 3BG4B 2BOKA 3S69A 2GX4A 1UK4A 3LGIA 1BTYA 2FPZA 1Z7KA 5KEDA 3U1JB 1KIGH 1S0RA 3G01A 4IN2A 2PHBA 1AQ7A 2XNDD 1C2JA 2FOFA 2ZCKP 5EJLA 4ACAA 3SNCA 3F3BA 4I8GA 2BM2A 1P0SH 2OP9A 4Q2KA 1AO5A 4TSFD 3KF2A 5KECA 1A0JA 1WQVH 4KTCA 2PV9B 2HOBA 2BX4A 2G81E 4LXBH 2I6QA 1TPSA 2A32A 4UFEH 1IHTH 3RXBA 4FVDA 1BTHH 1TMTH 2W3IA 1O2KA 1ANEA 1W0ZU 5IYTA 1RTFB 4TWYA 2JIZD 4CRGA 5C20A 1SQTA 2DE9A 4YLQH 2PGBB 1CHOG 2ALPA 4FUGA 5DP9A 2VWNA 2VIWA 2IN2A 1KMHB 1MCTA 2J98A 1LDTT 7GCHF 1CBWB 4B2BA 2CHAC 1O2ZA 2QGRA 1NN6A 1O31A 1NESE 3MYWA 1NRSH 4CRDA 1KYNA 3SU6A 3BTEE 1E35B 3I78A 3MNSA 3RXIA 4GVUA 4AX9H 1UTQA 4OS4A 3DFLA 3M7UA 3RMOH 4H4FA 2ZU4A 3KQ5A 1F2SE 3RU4E 3KN2A 4Q7ZA 2CK3D 3SHCH 1GMHG 1MCVA 1RD3B 1P8VC 3SU3A 3F9FA 2QXIA 1C4Y2 3V12A 2QCYA 2WV5A 4I8HA 1CA0B 1HAGE 2P93A 4NIYA 2ANKH 3RXSA 1GCTB 2ZI2H 1U6QA 5EOKA 2ZP0H 1TNJA 3ZYEA 1O3FA 1OP0A 1C4U2 1TRYA 4AYYB 4OS7A 3T28A 4KTUA 5HIZA 1O2MA 1P2KA 4CBNA 1G3DA 1TQ7B 2OC0A 1C2EA 1QHRB 4F55A 5A09A 3SJOA 2FP7B 4CH8B 2FLRH 1W13U 1LHGH 4BTUB 1EATA 2ZDNA 1GDNA 4X2XA 2ZU2A 1VZQH 3SV8A 1GDUA 1YPGH 1UTLM 1H9LB 1BZXE 1FLEE 3FANA 1C4V2 1E1RD 3WW7A 2BB4A 4MG3A 1VCQA 3FKSD 1C2KA 2EA3A 3DUXH 1O2WA 1HV7A 1SGYE 1BMNH 4K5ZA 1FIZA 1ZMNA 2J92A 5T6DA 5T1VA 1DUEA 3OY5U 1MU6B 1WXRA 1P9UA 1OWEA 1DWBH 1ZGIA 5L6NH 1MH0A 4NA7A 1EJMA 1O5GH 3PO1B 2OXSA 1SG8B 1W3CA 4B76A 2VNTA 3ZZ9A 1QA7A 3M7TA 2L6OA 4X2VA 1BA8B 3BTGE 2IJOB 3BV9B 3F2HA 1GJ8B 1GVLA 5KGOA 1QJ6B 4MNVA 4H6SB 2QXJA 1QJ1B 3SORA 3SU0A 3P92A 4LZ1H 3UNQA 2H6MA 3UWIA 2CF8H 4TT3D 1O36A 3GY6A 1GHBF 5DKMA 3SI4H 1AVXA 1D6WA 4O97A 1ELCA 3MH7A 1NBMD 4O03A 3HATH 1OS8A 2XRCA 1Y3UA 3GCTF 3PMBB 3UOUA 4WWYA 4ACBA 4D8NA 1HJAB 1QTFA 1O2RA 3DSPA 1MD8A 2PTCE 1AIXH 2VH0A 5GCHG 1MKWH 2VH6A 2ZFSA 4HGCA 1ZSJA 1OP8A 1K1PA 3NRLA 1K1NA 3ZZ6A 2ZFQH 1EP6A 3UOPA 5GDSH 1KDQB 3MH4A 1YLCA 1EZUC 4MLFB 1G32B 1NC6A 4I33A 3SU2A 1HFDA 1SGPE 3QK1A 4Q80A 4WJG2 1DVAH 1W0JD 2GJGA 1OYQA 2WPJS 1YPKH 2C90B 2ZPSA 2GCTC 4MNXA 3RXGA 4ZH8A 5GIBA 1FNIA 1EPTC 4A1VA 1EOJA 3BTTE 1A5HA 1NZQH 2HPPH 4FUEA 2XBYA 1HAXB 2VB0A 1QL9A 1D3QB 2VU8E 1FMGA 3AVZA 1YYY1 4A1TA 2ZNKH 5F8ZA 5GNDA 1CQQA 1ZZZA 3PTNA 4U30A 1GJ4H 1FIWA 5F8XA 4Y0ZE 2TGPZ 1SLWB 3VG8A 4DGJA 2AGIX 1ABJH 5HGGA 1XUJA 1SGEE 5IDKA 1FAXA 1Y5BT 4YT7H 2A4OA 5C94A 4NFFA 1QFKH 3URDA 4Y7AA 2C93B 4Q7XA 4M9FA 1MAXA 4SGAE 3EA9A 1C2DA 2ZHEH 1PPGE 2FS8A 3VGCB 1ZR0A 3RXMA 3RXAA 2P16A 5E0HA 3OTJE 5FPYA 1PPHE 4X6MA 1NFXA 1J14A 3LGUA 1PPFE 1ETTH 4XBDA 1ANDA 4K2YA 4A6LA 2PSXA 1BT7A 2BYAX 2IPHA 2BLOA 2FWWA 5JBTA 2GP9B 8GCHF 2FDAA 1GBKA 4FUDA 1YWUA 2IOTA 3KYFA 2ILNA 1WOFA 2VGCB 1OXGA 1EAWA 4BAKB 4O3TA 2BVXH 5FXLA 1IAUA 3TK6A 1GJ7B 3LKWA 3ZVEA 1TNLA 1O5EH 2EI8A 3A7WA 3R3GB 2J95A 1JMOH 2VINA 3TJUA 1SQRA 3D62A 1EB2A 3BTDE 2ZWLH 1JRSA 1SC8U 2EI7A 3RXQA 2QXGA 4NFEA 1KTSB 3LIWA 3VB4A 1F0UA 2V7QD 1QA0A 1HJ8A 2WSSD 1A0LA 3IG6B 3SUFA 1ETRH 3SV9A 1GI0A 2GMTB 2LP6A 3UWJH 4Y71A 2FM2A 4OS1A 1SPJA 3VXFH 1F5RA 5DN6D 3S0NA 1BTXA 1UW7A 2H1UA 2VIVA 5C67A 1LHDH 2C8ZB 4U2WA 3PM3A 3VB5A 1Z8JB 3ZZAA 2KR7A 2BD7A 2FEQH 1TYNA 2XBXA 3HK6B 2FO9A 1TX7A 4WMFA 1A61H 3JZ2B 2W3KA 3GY5A 4IBLH 2GCHF 2FYRA 5E2OA 3T2NA 1KXEA 1GGDC 3UIRA 1DPOA 1E36B 1ELDE 3OX7U 1BBRK 2G52A 1H9IE 1V2QT 1QRZA 3HGNA 4XBBA 2QF0A 1P2MA 3D49H 5HKKD 3P8GA 3UY9A 1AKSB 2FOHA 2G8TA 5DGJA 3DSGA 1C1SA 5DP7A 4D7FA 4NCYA 5F6MA 2XC0A 2SNVA 1OPHB 2XBWA 4WH8A 5C5NA 1F7ZA 1HLTH 3ZVCA 2KAIB 3LPRA 1OWIA 5FCRA 3GCHB 1GBEA 1L4ZA 6ESTA 3UUZA 3GY3A 1IQMA 1UTOA 1Y3VA 2P3FH 3DA9B 4JZ1A 1OYTH 8KME2 1AB9B 2KFWA 1THRH 3ZVGA 3MU1A 1C5SA 5AFZH 2P95A 1YF4A 2ZPQA 2O8MA 1PFXC 2BZAA 1QQUA 5E0JA 2VWMA 1FY5A 1TLDA 1V2JT 3MFJA 1O5AB 3KQBA 2HLDD 2BDCA 1DOJA 5JB9S 5HM2A 1O2LA 1MUEB 3GDSA 3RU4T 3K6YA 3PV5A 2HLCA 2PKSC 5ABWA 3EYDA 2ZZUH 2J4IA 1EQ9A 2FI3E 1NO9H 3TGIE 3C27B 2JH0D 4KKDA 2HRVA 2BD4A 1TWXB 5T3HA 4MVNA 1TIOA 2JDID 1ZPCA 1P2QA 1C5VA 3TITA 1BBRH 2BDAA 2AMQA 1C5TA 2ZGJA 1O3BA 3PMHB 1T8OA 3MHWU 3VXEH 1K28D 4I8LA 1BHXB 2CHAB 2ZDKA 2XWAA 4OS6A 1TGBA 4WVPE 2KAIA 1G30B 2EI6A 2A4QA 3RXOA 2AGGX 2OC7A 3TNTA 6CHAC 1A5GH 1NROH 1HAZB 1L4DA 3GY7A 3A83A 4AGKA 4I31A 3U8TH 4P00A 4ABDA 1X7AC 2FI5E 1HAVB 5FAHA 3SV6A 1ELAA 1C9PA 4JK5A 3M5LA 2VIPA 2A1DB 1TNKA 1NRRH 4K1TA 1AWFH 3GOVB 2SGAA 1MKXK 1FUJA 1QBVH 3PWCA 1SGRE 4ZXXH 1DLKB 1O2TA 1AFEH 4UEHH 1ZSLA 2GDEH 1GJAB 3ATIA 4AYVB 3SI3H 3RXFA 1KSNA 1O3IA 1COWD 2ZU5A 1UCYE 1ZJDA 4I8KA 5EJZA 1A0HB 1SGFG 4XFQA 3GCHC 3QUMP 3TK9A 1GBHA 1WBGB 3UR9A 4AZ2B 1UVUH 2BY7X 2NU3E 3AAUA 4RKOB 4NA8A 4U01A 1JRTA 1NT1A 3LDXH 4A5TS 1NFUA 9ESTA 2O8UA 4JYUH 1P3EA 5ESTE 1QBOA 4YT6H 3SU5A 2SGDE 5FBEA 4KP0A 3FAOA 1VCWA 2D2DA 1WQSA 4FU7A 5F03A 3QTOH 3V0XA 3UR6A 4ISHH 3VB7A 6GCHG 1OOKB 2IJD1 1TNHA 3Q77A 5A2MH 1FAKH 2SGEE 1ANBA 3RXLA 1TPOA 1QRXA 2QN5T 3KQEA 1TALA 3RC5A 2O8WA 2SGFE 2Q6FA 4DT4A 1O2UA 1SOZA 3SU1A 1QY6A 1ZGVA 1BRAA 2OLGA 1KLJH 1SBWA 1PQ8A 1GJDB 2PR3A 3PMAB 4ABEA 4BAOB 4F49A 1UTMA 5L2YH 1DSUA 2Z9KA 3A7XA 3P8FA 1PYTD 4MNWA 1MABB 3U9AH 1YPHE 5E8EH 1RIWB 3SQHE 4D9RA 2GMTC 5EW2H 1BRCE 1TA2A 5ETXA 3QTVH 1GMCF 1D4PB 2RA0A 1H4WA 4TYDA 5E2PA 7LPRA 1SL3A 2ZCLP 2VGCC 2R2MB 1ANCA 3STIA 1FV9A 1C1TA 1GI6A 1C5ZB 2JETC 3MWIU 5A0BA 3UNSA 1O2QA 5HYOA 3RXCA 4I32A 4Y6DA 1YCPH 3ZVAA 2ZIQH 3TGKE 4DIHH 1CT0E 1S6LA 1PQAA 2ZCHP 3QWCH 1QJ7B 1FY3A 5CHAC 5K0HA 3EAJA 4ABFA 4IW4E 2CJIA 1G3EA 1SGDE 2ESTE 2G5VA 5EXNA 1ELVA 5F8TA 5B6LA 3PMJA 3DT0H 3ZZ8A 3BIVH 2ZDAH 3S9BA 4BAMB 5ESBA 1GHBG 1WAYB 5GPIB 4Y0YE 1G2LA 3DFJA 3F9HA 1H8DH 3L6PA 4RSPA 1DT2A 2P59A 3K9XB 1W11U 2FLBH 1ZTLA 2GT8A 4X1PU 4ZHLU 1BJUA 2DUCA 1VGCB 2ZFFH 1YPJH 3NXPA 4AOQA 1LKBA 2HNTC 4NIXA 4DIIH 1C9TA 1GBTA 1SMFE 3KHVA 1A46H 3MU0A 2ZDLA 1C5UA 1O35A 2C4FH 1SVPA 2VJ1A 3F1SB 1J17T 1E79D 4JZEH 3T25A 4H42U 4AB8A 2XW9A 1C1VH 5LPEA 3S9CA 1XXDA 2KCYA 1ZHPA 3RXVA 1S5SA 3SOSA 1V2ST 1C1WH 1BMMH 4UONA 2ZHDA 3U98H 1AHTH 5DG6A 2TBSA 2R2WU 3K65B 4RI0A 2AMPA 1P05A 1PPZA 3GY8A 5GWZA 1O5FH 3BTWE 4ZROA 1CO7E 3MO6A 3ENSB 1PPBH 5DP4A 1V2WT 2F9BH 4TY7A 1CE5A 1YCPK 3RXKA 3DD2H 4ISNA 2HVYB 2WV4A 5EPYA 1A2CH 1O30A 3TVJB 1VR1H 3HK3B 1LVOA 1TQ0B 2XYAA 2HWLB 4GLYA 3KIDU 1THSH 3A8BA 4IC6A 4O9VA 1Y3XA 1C5MD 4IN1A 3HPTB 1MTSA 1GJCB 1C5XB 4M7GA 1KXFA 2PUXB 3S7HB 1C2GA 2RDEA 1C5RA 1MZAA 2BD8A 2Z9LA 1HAIH 5J4QA 1K22H 1WTHD 3UNRA 1QGFA 4DG4A 4XD7D 5DPAA 5AFYH 2GT7A 3BTQE 1TMBH 3LONA 2Y5HA 3UTUH 1CVWH 4AFZA 2W5EA 3H09A 3EE7A 4MPVA 1HCGA 1JIRA 1EFRD 2PFEA 1XKAC 2BD9A 1UHBB 2VBCA 2OTVA 2ZHQH 4WXIA 2GV7A 1ORFA 1DXPA 5EGMA 3BN9A 1C1QA 2D26C 4Y7BA 1QL7A 3RDZA 2ZQ2A 3AW1A 1TA6A 2Q1JA 3DCLA 2G55A 4NIWA 4NZQA 1LO6A 1ZMJA 2AH4X 5C17A 3HGPA 5LGOA 2FX4A 1HRTH 3Q76A 2YOLA 4FUCA 1O3JA 9LPRA 4OS5A 1C1NA 1P2JA 2A7CA 1GDQA 2AS9A 1RFNA 3GDVA 4X2YA
chains in the Genus database with same CATH topology
3NWUA 2ZHWH 1UTKA 4FUIA 2HPQH 4GHQA 1GJ6A 5DP8A 5EU8A 1V3XA 1W0YH 3M5MA 4SGBE 3A7VA 5EQSA 3V13A 4ASHA 7ESTE 2FZZA 2Y7ZA 3D65E 4LOYH 4FVBA 1SFQB 1FN6A 1ELGA 3QLPH 4TPIZ 4DW2U 1F5LA 2WINI 4INHA 1GJ5H 1KXAA 2OC1A 1C5YB 2ZGXH 3PLKA 1O34A 4X0WU 3I29A 6CHAB 3A8AA 2GVFA 4AORA 1S81A 1A5IA 3A87A 3SNEA 5EQQA 1PYTC 1QB9A 3AW0A 1VITH 3MO3A 3A84A 1ZYOA 1EZQA 1NRQH 1HNEE 1XUKA 4ZKRU 4J1YA 3CS0A 4YZUA 3RXEA 2JKHA 1VJ9U 1YP9A 1V2TT 4CR5A 1UCYK 3SGAE 3F6UH 1CHGA 1WUNH 2GDDA 2FESH 2BDIA 1UVTH 2Q6DA 1C1PA 1IQNA 1O3MA 4UFDH 2GGVB 3SGBE 3SU4A 1SGNE 1T4VH 4IMZA 3LGVA 1O2OA 1S0QA 4YOJA 4AG1A 2F9OA 1G2MA 5EODA 3PTBA 3KQCA 2J9NA 4X2WA 4INLA 1LVMA 2HNTE 1AB9C 1OWKA 4ABGA 1S6FA 3MO9A 3FP7E 3H5CB 4MQAA 4K1EA 3IWMA 4JK6A 1A4WH 3RC6A 4XOJA 1UMAH 3U1IB 1UK3A 2GZ9A 5FX5A 1DWEH 5DK1A 2Y7XA 1S6HA 3SUEA 1GPZA 1Q2WA 3GCNA 3SUDA 1P11E 3RU4D 4CBOA 2YNAA 1TONA 1AVWA 1JWTA 3SN8A 3SJKA 4ZMAH 1E0FD 1CGJE 3P17H 2CXVA 1D3PB 1EXFA 1SGFA 1GMCG 3A7TA 1K1JA 1LPZB 5C1UA 1SGIB 1Y3YA 1O2XA 1GMDG 1IQEA 2PSYA 4TWWA 1HIAA 1JXPA 1C5WB 1SHHB 1EAUA 3F9EA 3A7ZA 1K1MA 4ABIA 3V3MA 1INCA 4ZKNU 2STBE 1G3CA 2ZFTA 1LVBA 3MH5A 1ZPBA 1VITF 1HDTH 1OWHA 1TRMA 1ETSH 4D9QA 1KXCA 3HKJB 4IS5A 3NZIA 5PTPA 1BRBE 1A1RA 2WYJA 5JBAS 3V7TA 5DO4H 3UQVA 3A82A 4I7YH 1MKXH 4YTAA 1UVOA 4YOGA 4JYVH 3BIUH 2J2UA 4F4OC 5C3NA 5BRRE 4NSVA 2V3HH 2Z3DA 1V2LT 4OGXA 1FZZA 1UCYH 1P10A 1Z8IB 3O8BA 1FJSA 1O2SA 2PWXA 2ZFPH 1MTUA 3UQOA 4UE7H 1RRKA 1AMHA 4X1SU 1C2FA 3M61U 2RCEA 1BRUP 3MU5A 1ESTA 1GHWH 1TGSZ 3LGYA 3ATMA 4ZHMU 3B8JA 3O8CA 5FBIA 2ZDMA 2ULLA 1GI4A 1HAOH 1F0TA 1GI3A 4D76A 1GHXH 2Z9GA 3P8OA 5EPNA 1VGCC 4HZHA 1SHYA 1MKWK 3E91A 4FU9A 4AB9A 4TY6A 4MPWA 2AIPA 1O2HA 1TGCA 2XNIA 1YBWA 2AFQB 1H8IH 3NK8A 1B7XB 4BAHB 3ODDA 1W8BH 1RGQA 1G36A 3UPEA 1S82A 1O33A 1W2KH 4PROA 1FPCH 2B0FA 1GI5A 3B23B 5DP3A 1BTWA 5HM9A 4DVAU 1P57B 4B2AA 4Z0KA 4K69A 3GYMA 2ANMH 2ZTZA 4UD9H 3TH4H 3GCOA 3K6ZA 2ZC9H 4VGCB 2WPHS 2PGQB 1ZLRA 4ZUHA 3ZZ4A 4A7IB 3BG8A 1PPEE 1Y5UT 1ZOMA 2ZKSA 3PWBA 1B0FA 3VEQB 2SGQE 2H5CA 1O2VA 1EASA 2FTMA 1KTTB 1ZTJA 1QIXB 5A8ZA 1YPLH 4XBCA 4X1RU 4Q7YA 1QL8A 1H9HE 2Z94A 8ESTE 1SQOA 1Y59T 2C8WB 1QURH 2Z6BD 1ID5H 2R9PA 3GISB 3LH1A 1TX8A 1TAWA 2G4UA 4GHTA 1P9SA 2ZGHA 1WYKA 3BEUA 4X8VH 1TPAE 1JIMA 1Z8GA 1W14U 2FI4E 1FY4A 2GD4B 4GAWA 1TNGA 3M3TA 1O2JA 5CE1A 2ANWA 3T27A 1F0RA 3M7QA 1MQ6A 2JH6D 1ESBA 2QXHA 1NS3A 4CREA 1O3LA 3A7YA 3O8DA 1DY9A 1S85A 1EX3A 4K3JA 1DANH 2P94A 3URCA 2TPIZ 1HXEH 1WCZA 4IMQA 1LPGB 1NTPA 1P02A 1IQJA 4J2YB 4CRBA 2FMJA 5C1YA 3GICB 5I46H 1MZDA 1P2NA 2ANYA 4FUFA 3H7OA 1XUGA 1E37B 1MBMA 2BD2A 2F9NA 2BQWB 3E1XB 1EAXA 4UFGH 1O3KA 2BZ6H 4JZIA 2NU1E 4CRCA 4OS2A 2FS9A 5DP6A 2XC5A 4FU8A 3RXTA 2BXUH 2ZTXA 3RMNH 1BQYA 1RTKA 1O3PB 2NU0E 2VVUA 2A5IA 4B1TA 2YNBA 3RLWH 1O0DH 1EPTB 5CHAB 1O3GA 4INKA 2THFB 2G5NA 4IGDA 2XWBI 4O3UA 3ZZBA 3OSYA 1EB1H 1G9IE 4CHAB 1LHFH 1DS2E 2FOBA 1FDPA 1RS0A 4Y79A 1NU7B 5I25A 1BJVA 1MBQA 2VIDA 3K2UA 3SNBA 2QV1A 6GCHF 1ELBA 1GBJA 4QT8C 2ODPA 5EG4A 3LC3A 4I8JA 2F9VA 1TGTA 4WMDA 1AE8H 3SO3A 8LPRA 1Q31A 1O2GH 2FOGA 2PLXA 1ZHRA 1MD7A 2UWOA 3BTME 4CRFA 1M9UA 3RP2A 2Q6GA 3AASA 2OC8A 3M3SA 1QRWA 2QYIA 2EEKA 1GHAF 2OD3B 1UTPA 1ARBA 1IQIA 1IOEA 1XMNB 4JCNA 2A4GA 1AWHB 1HAPH 5B6OA 3RXDA 1P2OA 1PPCE 3I77A 5AF9H 5AHGH 1W10U 2TGDA 4B75A 1BMAA 1FQ3A 1KXDA 2QAAA 3LGTA 2BVRH 1PQ5A 2Z9JA 1JOUB 2ZA5A 5FHTA 1KY9A 1T8NA 5T6GA 1KLTA 1TOMH 1GJBB 1ZHMA 1AY6H 3JZ1B 1CSOE 3KGPA 3QN7A 4FUJA 1T7CA 2WUCA 3TLOA 2AMDA 4Y8YA 2C3SA 3O8RA 3RXHA 4ABBA 1DXWA 1S84A 2UUYA 1GWAA 1PQ7A 4THNH 5FPTA 1VCPA 3LC5A 3NPSA 1ZRKA 1K2I1 1NFYA 1AD8H 4BANB 1MQ5A 4CRAA 3T62A 2TGTA 3RXUA 2NWNA 3KNXA 1G37A 4JZDH 3EGKH 2A7HA 1C2IA 2BLQA 1GL0E 1HJ9A 1Z8RA 2A5KA 5C2ZA 3F68H 3CP7A 4AN7A 1TE0A 2WPMS 8GCHG 3SNAA 1HGTH 5T6FA 1GJ9B 2Y6TA 1GI9B 1W12U 1TX6A 4DURA 3GDUA 4D7GA 1GBFA 3WY8A 3T26A 2H9HA 3MU8A 1HBTH 2AYWA 4K8BA 2P3TB 1K1OA 2BDBA 1O2PA 2VVVA 3SV2H 1FPHH 3RUOA 3S9AA 1UVPA 1P12E 1ELTA 2CGAA 2W26A 2WPKS 1TNIA 1Z71A 3A85A 2ZHFH 1ARCA 2ZU3A 6LPRA 1SGCA 1EJAA 1Y5AT 1IQGA 1DE7H 1LVYA 1MU8B 2SFAA 2W7SA 2Y5FA 3M3VA 4B73A 3FFGA 1HAHH 4DOQA 1AVGH 1O3NA 4ISOA 4MPUA 4UDWH 1PJPA 4WXVA 1AGJA 4AFQA 4NGAH 1WSSH 1V6DA 4FUHA 3E16B 3TH3H 3NCLA 5JYIA 1SOTA 1Z6JH 4X8UH 1UTJA 3ZV9A 3SNDA 3TH2H 3M35A 1AKSA 1LMWB 2FTLE 2ZGBH 1SI5H 2AERH 1O5CB 3SHAH 1GBIA 2QC2A 2G00A 1GBCA 2J34A 3ATWA 5LPFA 2DE8A 5JBCS 1DDJA 2FYQA 3BTFE 5FX6A 1GHZA 1FONA 4TPYA 1NPMA 3ZYDA 2XBVA 1TABE 1O5DH 4WF8A 4Y11E 4Y76A 1L1JA 2BLWA 2BMGB 4BAQB 1J8AA 3ZZ7A 1JBUH 1BIOA 1KDQA 3A88A 3RM0H 1TPPA 2UWPA 4K1SA 1DWCH 3UFAA 1GI2A 1YKTA 4KTSA 1KXBA 3T29A 2Y81A 1MTNB 3ZVBA 1O32A 2TGAA 2BVSH 2AEIH 1CU1A 1SLXB 2F9UA 1WTGH 2XCFA 3MNBA 2O9QA 3MI4A 2ZQ1A 2Z3EA 1TBZH 1SB1H 4YM9A 1LPKB 3A8CA 1GBBA 2P8OB 3VGCC 3UREA 4WMEA 5A8XA 4Z6AH 5H4IB 3GY2A 4GSOA 1SR5C 1FI8A 2XTTB 1TBRH 1XM1A 1C2HA 3MNXA 2M5TA 4OGYA 1TGNA 1CA8B 1GBLA 2F9PA 1B0EA 1UJ1A 1P03A 1YGCH 2B5TB 3BF6H 1EPTA 2ZPRA 3A89A 1IHSH 3QGNB 4UFFH 1V2OT 5L2ZH 2R0KA 1DLEA 5JPMH 1XUFA 1HXFH 1HAYB 3ZVFA 2SGPE 2WPLS 1DM4B 3E6PH 3QZRA 1C1UH 2UUKB 1DWDH 4ABHA 1AN1E 1Z6EA 4X8SH 5L30H 1N8OB 1NRNH 3TJOA 4CR9A 3ZZDA 4ZKOU 4U32A 3OY6U 2A2XH 3QO6A 3RMLH 5K7RA 2GCTB 4JMYA 3LOXA 1SQAA 2Z3CA 1BUIA 3RM2H 1TBQH 1ZSKA 1J9CH 5LH8A 2JETB 4X6OA 2AIQA 3CS7A 1HJAC 3ZZ3A 1DITH 1XVMA 4KELA 2A45B 3R0FA 1FN8A 3RC4A 4DJZB 2V0BA 3QGJA 3ITIA 2GZ7A 3NUMA 3TK5A 2BTCE 2QY0B 3LU9B 5DJ7A 2XCNA 4ISIH 1XX9A 1THPB 4B74A 1YPMH 2BY6X 3ODFA 4VGCC 1ELEE 4YO9A 1T4UH 1GI7B 3FP8E 3N7OA 1LHEH 5GXPA 1O2IA 1UTNA 3A8DA 2H5DA 5SGAE 1C2MA 2J94A 3EDXB 2QIQA 2I6SA 4Y10E 2ZGCA 2PTNA 3SW2B 2A4RA 4MTBA 5E0GA 3KEEA 2RDLA 1UVSH 2CV3A 1CT4E 2G51A 4E7NA 1E38B 2BD3A 3LJJA 1TOCB 3P95A 1ABIH 1OWJA 2F83A 3FVFB 4X8TH 1HB0B 3FZZA 5GCHF 1C5OH 2ASUB 3PO1C 2HVXA 5BPEA 1CGIE 3BEFB 4MDSA 5G4BA 1FXYA 3BSQA 4NA9H 1F92A 1KLIH 1T8LA 4HI3A 3SJ8A 1C5LH 1IQKA 1O3AA 4NIVA 1N1LA 1EAIA 4BOHA 1ELFA 1MTWA 3E0PB 1A7SA 2XXLA 1XUIA 2ODYB 1OSSA 5J4SA 3A80A 1Q3XA 1NFWA 3P6ZB 2ZO3H 3SJ9A 3C1KA 1HIAB 1TB6H 3MTYA 1V2NT 3VB6A 1TFXA 4GCHF 2ZEBA 2G4TA 2BDHA 3PV4A 4DT7B 1A3EH 3Q3YA 1GI8B 1FY8E 4YLUA 4XSKU 2H2ZA 1WV7H 3PB1E 1Z1JA 2FIRH 5GJ4B 1UHBA 1AE5A 1BHXF 1IQLA 2FX6A 1O3CA 3SQEE 3SZNA 1CA0C 4ESTE 1OP2A 3SGQE 3B9FH 1CBWC 2EC9H 1D3DB 2OQ5A 1GHVH 2V35A 3TPIZ 1MTVA 2TRMA 4YESB 4DCDA 4DY7B 7GCHG 1YC0A 1O39A 4R0IA 2UUFB 3EQ0H 3ESTA 5C1XA 1Y3WA 2B8OH 2PKSB 4A92A 3GYLB 1GVZA 1VITG 2D1JA 3LGWA 2OQUA 1BOQA 1RXPA 1YLDA 2HGTH 1VJAU 4Y8ZA 3W94A 2A7JA 3AAVA 1IQFA 1GMHF 2A5AA 2OBQA 1QCPA 1QNJA 3QDZB 4BNRA 1F0SA 5EXMA 1L1NA 4K60A 3Q00A 1C1OA 3A86A 5TCAA 4ABAA 3E8LA 2PUQH 2ZU1A 2SNWA 2CMYA 1XVOA 1P3CA 3ELAH 1BTPA 2BLVA 1O2YA 2WYGA 3BEIB 2O8LA 1O3HA 2BY8X 2XC4A 3BG4C 2NU4E 5FPSA 1N6YA 2GV6A 4IC5A 2NU2E 1P04A 3MU4A 1WU1A 1XUHA 3Q3XA 1NU9A 1V2KT 1DY8A 3BTHE 1N6XA 4MNYA 2FOAA 1T8MA 2CN0H 2BY5X 1O3EA 1Y8TA 5LPRA 4X1QU 1T31A 2R3YA 3KQDA 3VFEA 2ZECA 3E3TA 3OU0A 3P70B 4FXGH 3TIUA 3ZVDA 1W7GH 1O3OA 2A31A 3TU7H 7KMEH 2H9EH 1C1RA 4BXWA 2VWLA 2H9TH 2VWOA 1MAYA 1HYLA 2RA3A 3SV7A 1O5BB 1SSXA 3ZV8A 3HKIB 1XXFA 2QA9E 1C5NH 1RTLA 3E0NB 1J16A 2Y5GA 4B71A 2O8TA 1QB6A 2LNCA 1L2EA 3FZDA 5A0AE 3NKKA 2GZ8A 4HTCH 1EP5A 1V2MT 3BTKE 1NRPH 1A3BH 1ZTKA 3L33A 3ZZCA 1YPHC 2FODA 1CGHA 2STAE 4ABJA 4AFUA 4LZ4B 4BTIB 1ESAA 2W7UA 1C2LA 4CHAC 1BCUH 3TNSA 4E7RG 1K1LA 1GHAG 3PROA 1G3BA 3W95A 3OYPA 3M5OA 2PKAB 1RJXB 1GI1A 1L1GA 1MMJN 2ZF0H 3D23A 1GG6B 1S83A 1V2RT 5C5OA 1SFIA 4KGAA 3FP6E 3H7TA 4GPGA 2ZFRH 4NWKA 4WY3A 1AZZA 4CH2B 3GY4A 1P2IA 2A2QH 5HXFA 2FXRA 4X6PA 1L0ZA 1QB1A 2F91A 4NG9H 3MNCA 1P06A 5A0CA 1BITA 1W7XH 3T5FH 1UK2A 1GGDB 2BX3A 1BDAA 1BMLA 1GBAA 3LT3A 5EQRA 1NM6A 1C1MA 1DFPA 1ZPZA 2LPRA 3VPKA 1V2VT 5TJXA 4NWLA 1SLUB 4AG2A 1AFQC 4X6NA 3TJNA 3MOCA 1LCYA 1IQHA 1O37A 2BHGA 3DHKH 1AZ8A 3U8OH 3RLYH 3ATLA 3SJIA 5DP5A 3RMMH 1AU8A 3ATKA 4E05H 2R3UA 1B5GH 4AFSA 1ZJKA 1BB0B 3TJVA 3EA8A 2VIQA 5EXLA 1GCDA 3F9GA 1GBDA 1ZRBA 4XDEA 5EW1H 2ZDVH