3LKLA

Crystal structure of the c-terminal domain of anti-sigma factor antagonist stas from rhodobacter sphaeroides
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
NAFAVSSELSACGRARTYRVEGQLFYGSVEDFMAAFDFREPLERVTIDVSRAHIWDISSVQALDMAVLKFRREGAEVRIVGMNEASETLVDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antisigma-factor antagonist STAS
publication title Crystal structure of the C-terminal domain of Anti-Sigma factor antagonist STAS from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Transport protein
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3lklA00
1TIDB 5EUZA 2KA5A 3LLOA 3OIRA 4XS5A 5EUSA 1SBOA 3IHAA 1VC1A 1T6RA 1BUZA 1H4YA 3LKLA 4QTPA 5EUXA 3AGDA 1AUZA 4DGHA 3AGEA 3OIZA 3IHBA 4DGFA 5EZBA 1TH8B 1H4ZA 1H4XA 3IH9A 5EUWA 3T6OA 3NY7A 5EUUA 3ZXNA 3IF5A 1THNB 3F43A 1TILB 2VY9A 3IH8A 3MGLA 4HYLA 3ZTBA 2KLNA
chains in the Genus database with same CATH superfamily
4JC0A 5EUZA 1N6FA 3C0KA 3V97A 5EUSA 1V0EA 3AGDA 4AEJA 3K50A 3OIZA 3IHBA 1HF2A 5EZBA 3T6OA 3JU4A 3NY7A 1J7XA 1THNB 4L8KA 4HYLA 3GK7A 2DXNA 1N6EA 3GVLA 1WXWA 1T6RA 5EUXA 2ZO9B 4L1CA 1FCFA 3GHFA 4DGFA 3GMFA 5EUUA 3F43A 1TILB 3IH8A 2KLNA 1FC9A 1TIDB 2KA5A 2B78A 4AE2A 4XS5A 2DXLA 4GHNA 3IHAA 1BUZA 3DORA 3LKLA 1AUZA 3GVJA 4DGHA 3QDQA 3AGEA 3DJAA 1WXXA 2CWWA 1TH8B 1H4ZA 1H4XA 5EUWA 3D3UA 3IF5A 2VY9A 3EH7A 1FC7A 3MOGA 1K32A 1FC6A 1V0FA 2OASA 3LLOA 3OIRA 1SBOA 1VC1A 3D03A 3VSEA 1H4YA 4QTPA 4DMGA 2ZOAA 3DUPA 2RRLA 2AS0A 3GVKA 1BPLA 3IH9A 3LDFA 3ZXNA 3MGLA 3ZTBA 4HIZA 1N6DA 3V8VA
chains in the Genus database with same CATH topology
1TIDB 5EUZA 2KA5A 3LLOA 3OIRA 4XS5A 5EUSA 1SBOA 3IHAA 1VC1A 1T6RA 1BUZA 1H4YA 3LKLA 4QTPA 5EUXA 3AGDA 1AUZA 4DGHA 3AGEA 3OIZA 3IHBA 4DGFA 5EZBA 1TH8B 1H4ZA 1H4XA 3IH9A 5EUWA 3T6OA 3NY7A 5EUUA 3ZXNA 3IF5A 1THNB 3F43A 1TILB 2VY9A 3IH8A 3MGLA 4HYLA 3ZTBA 2KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TID B;  5EUZ A;  2KA5 A;  3LLO A;  3OIR A;  4XS5 A;  5EUS A;  1SBO A;  3IHA A;  1VC1 A;  1T6R A;  1BUZ A;  1H4Y A;  3LKL A;  4QTP A;  5EUX A;  3AGD A;  1AUZ A;  4DGH A;  3AGE A;  3OIZ A;  3IHB A;  4DGF A;  5EZB A;  1TH8 B;  1H4Z A;  1H4X A;  3IH9 A;  5EUW A;  3T6O A;  3NY7 A;  5EUU A;  3ZXN A;  3IF5 A;  1THN B;  3F43 A;  1TIL B;  2VY9 A;  3IH8 A;  3MGL A;  4HYL A;  3ZTB A;  2KLN A; 
#chains in the Genus database with same CATH topology
 4JC0 A;  5EUZ A;  1N6F A;  3C0K A;  3V97 A;  5EUS A;  1V0E A;  3AGD A;  4AEJ A;  3K50 A;  3OIZ A;  3IHB A;  1HF2 A;  5EZB A;  3T6O A;  3JU4 A;  3NY7 A;  1J7X A;  1THN B;  4L8K A;  4HYL A;  3GK7 A;  2DXN A;  1N6E A;  3GVL A;  1WXW A;  1T6R A;  5EUX A;  2ZO9 B;  4L1C A;  1FCF A;  3GHF A;  4DGF A;  3GMF A;  5EUU A;  3F43 A;  1TIL B;  3IH8 A;  2KLN A;  1FC9 A;  1TID B;  2KA5 A;  2B78 A;  4AE2 A;  4XS5 A;  2DXL A;  4GHN A;  3IHA A;  1BUZ A;  3DOR A;  3LKL A;  1AUZ A;  3GVJ A;  4DGH A;  3QDQ A;  3AGE A;  3DJA A;  1WXX A;  2CWW A;  1TH8 B;  1H4Z A;  1H4X A;  5EUW A;  3D3U A;  3IF5 A;  2VY9 A;  3EH7 A;  1FC7 A;  3MOG A;  1K32 A;  1FC6 A;  1V0F A;  2OAS A;  3LLO A;  3OIR A;  1SBO A;  1VC1 A;  3D03 A;  3VSE A;  1H4Y A;  4QTP A;  4DMG A;  2ZOA A;  3DUP A;  2RRL A;  2AS0 A;  3GVK A;  1BPL A;  3IH9 A;  3LDF A;  3ZXN A;  3MGL A;  3ZTB A;  4HIZ A;  1N6D A;  3V8V A; 
#chains in the Genus database with same CATH homology
 1TID B;  5EUZ A;  2KA5 A;  3LLO A;  3OIR A;  4XS5 A;  5EUS A;  1SBO A;  3IHA A;  1VC1 A;  1T6R A;  1BUZ A;  1H4Y A;  3LKL A;  4QTP A;  5EUX A;  3AGD A;  1AUZ A;  4DGH A;  3AGE A;  3OIZ A;  3IHB A;  4DGF A;  5EZB A;  1TH8 B;  1H4Z A;  1H4X A;  3IH9 A;  5EUW A;  3T6O A;  3NY7 A;  5EUU A;  3ZXN A;  3IF5 A;  1THN B;  3F43 A;  1TIL B;  2VY9 A;  3IH8 A;  3MGL A;  4HYL A;  3ZTB A;  2KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...