3LKOA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1934 strain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lkoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lkoA01
2LU7A 3FCTB 3VD3A 3QZWG 3BDYL 5MENB 1SJEA 4YHIB 5GGQL 1AGCB 4X0KA 5I0ZA 1U41A 4U1NA 2IG2H 4EDXB 5DA4A 3RBGA 3EYUL 3QULA 4PJIB 5BCAA 4JRXB 4MAUH 2ZUVA 3AS0A 3OKDB 4A2LA 3WHE1 5HGBA 3V79C 4LVOB 1RMFL 4LSPL 4JRWA 1PY4A 5DVNA 3S5LA 5HGGS 4XCEB 1FZMB 5ALCL 3MXVH 1MY5A 4H88H 2XZQL 4Y88A 4RGNB 5FYLE 4V1DA 3LKPB 3V4VL 2HVJB 2D4DA 5FYJH 5T5FL 1B2WL 1KCKA 1KJ2B 5GXBB 2FX7L 5J13C 4MA8L 4WO4A 1OLZA 4ODBD 5JQ6H 3STLB 4YHLL 5HBBA 2Q86B 3L5XL 1SYVA 4MJIB 4B50A 4PRBA 3H3BC 3ZT7A 2VXQH 3C6LA 4JZNB 5I16A 4M7ZB 4V1DE 4BQCA 2B8OT 4JY4B 3C09C 4CJ0A 1DBAL 5DD1L 2NY6D 2VZTA 3IS0X 3S6CA 1KN2H 5I0DA 1AHWB 1JI2A 4JFYB 1J0HA 4H1LH 4KMTL 4HUXA 4YZFE 1MCQA 3ZE1E 3LS5H 1CGSH 3BQUD 1UQSA 3FOMA 2AEQL 4PJIF 1H9VA 2J8HA 3FN0H 3VFMA 4FQQA 3TJHD 1U8HA 3RBSA 4ZUWA 2XQBH 1NEZB 2VXSH 2Y06L 2WWMD 4DW2L 3TBWA 1A4JB 2JJVA 3PWPD 1NLDH 1FPTH 4PJDA 5ETUB 4ENED 1INDL 3E6FA 1KELH 3B9DA 3QEQB 5E08L 5DMYA 4YK4C 1C7SA 1WZLA 3UYRH 1VGKB 1URLA 4HAFA 4KHXH 3SDDB 1S3KL 4CW1B 4OFVA 3QIBA 3O3DA 4TVPL 1XGTA 4PLNC 4U0RC 4NO5B 4WEBH 4Y4HC 3BEWB 1CFTA 3Q0HA 3SDYH 3ZTJH 3T3ME 4JM2C 4K7PL 4YHZL 1HYSC 1NGYA 4YHOH 1FYHB 4TUJB 3MNVA 3LRSB 3P4NB 1J18A 1NBVL 4KGJA 4NFBA 4RZCA 2H9GA 1KNOA 3P0YH 1TNMA 1ZLWH 3T0EC 2R1YA 3SE8L 2ESVA 4CU8A 4ZPVA 4QRPD 1J8HD 1JF6A 3VXRE 3O2WL 4X9HA 3GO1L 3F6IA 3JWDC 5D1QA 4OI9A 4Y1AB 1Q94A 1FRGL 5HHNB 3WYRA 3S35L 4JQXA 1RZJH 1FV1A 5I75C 4LPVA 3O8XC 4JO3L 2DQIH 5FO9A 3I2CH 3KXFD 4MJ6B 2NY1D 1JRHH 5HVWA 1UG9A 2R1XA 1QNZH 1T21B 4XVUC 2VUOA 3SEPA 1QVOA 4LK4A 3B9KD 5DYOB 1YEFH 4U7SA 2QTEA 3BIKB 3N50A 5MI0B 3OAUL 1NBYB 4LSQH 1YN6B 4U33A 5DFWH 1EDQA 3W0WE 3NA4A 3QEUB 4RSVA 3EOBB 2NTFA 4HS8L 1MJUL 3DUSA 3T0BA 1UADC 3P4LA 4NDMB 1F4XH 1FNFA 3ZDZF 2NW3A 3L5IA 5F72S 4BYHA 4Z7WE 1U8OA 1S8DA 2MTPA 4AENA 3GB7A 4OM1L 3ARED 4I0PD 1QPPA 3MRDB 2IH3A 4MNGA 3H0TA 4KKLD 1YN7A 2IG2L 5DJ8B 4MQ7A 4ZAKB 4NQVA 5IVXF 1OL0A 5FDWB 3K8LA 3WUZA 3H3PH 2C4FT 3O3EB 4MAUL 4FRWA 3D5OF 1X5JA 4JN1L 4ZO6A 4YPJA 4P4RB 5H35B 5H94A 3KPRA 2FNBA 2MQCA 3MXVL 4EN3A 2DIJA 2YD4A 4H88L 1S7QB 4ELMB 1EAPB 4Z7QE 3MRCB 2P5EA 1IGIH 3FT2B 4YX2H 3KLHD 1XR9A 3DRQA 2W0LA 2R15A 3BPLC 1H3GA 1XGQB 3RU8H 5F6HJ 5JQ6L 3EYOB 3IJSA 2BSSA 3KPRE 4JFQB 1SBSH 4YC2B 3LB6D 3N9GH 2VXQL 3CVHH 4HUVA 5DQ9A 1NC2B 2PW2A 3QG7H 1G6VK 3MJ7A 2P5EE 5C07D 2EYSA 2AABH 4XXDB 3SE9H 3DX8A 3RGVA 3CSBA 3U9PH 43CAA 1SYSA 4HGKC 1CFSA 1UWXH 3KPSA 1Q72H 3L5WB 3WE6B 4X6CF 2ZCHH 3WJJC 1KN2L 4NRZB 4PGCB 4OFPA 4PJEB 3IU3B 3B9EA 3LS5L 4LLYB 1CGSL 1MFEH 4WDIA 2DLTA 2W65B 4L8CB 3PL6D 5JW4Q 1FZJB 1AQKL 3FB5B 3FN0L 3OL2A 3GSOA 3C6SA 3E3QA 3KPSE 1DBBH 2XQBL 4LCCA 2Y5EA 2VXSL 1TCRA 1NLDL 1WBXA 1FPTL 4WFGD 4G7YH 3BJ91 4UB0H 1KELL 1QO3B 3WIFB 1DLHA 1JWSB 5F7NC 1LEGB 1FVCA 1ZV5A 5J1TC 3LKQB 3KHOA 3W9EB 4GQ9H 3E3QE 3ULUF 4WFEE 2Y23A 2YD7A 4HF5H 4NC0B 5D70H 5DTFA 4KHXL 1AFVH 4F3FA 2I27N 1PX4A 2OQJA 5AAMA 2VIRA 1MHEA 3MZGB 3QWRA 4H0GA 4H8WH 1NANH 5HPMB 1KIPB 4WEBL 4ZXBC 1G7PB 3SDYL 4ZUSA 3VFOB 4WU7A 2LAAA 4YHOL 3IAGC 1G6RH 4RMUA 4GRLC 1JTOA 1WWBX 1S9YB 1U9KA 1JK8A 3P0YL 4Y19A 2V9RA 2D31B 5HHXL 1JFQH 1WICA 5IW6B 2N7BA 4XPBH 2R29H 5DQDL 1RZ8A 1DN0A 2A6KB 4DVBA 5J56B 4RMVA 1KIUA 1RZJL 1U8LB 2V5MA 4J3XA 1FL3B 2DQIL 3PUCA 4CMMA 4Z0XB 1W0VA 4U1NB 1JRHL 2CLVA 1MLCA 1QNZL 1RJLB 4X6DA 2OX5A 5FB8A 4XCYA 5C2BH 1DP0A 5DVMA 1YEFL 2APVA 3SO3B 3G5VB 1FNGA 3VG9C 3IFPA 3MJGX 4KRPB 4LSQL 4PV8A 2CMRH 4PRHD 5EU6A 1CLZL 1Q9KA 1LD9B 4HUUA 4DK6A 3EAKA 1I1YB 2OL3B 5E56A 1F4XL 1P6AB 1F4WH 2Q6WA 1ZVSB 2M1KA 1D9KA 4F7CA 4F58H 3WS6C 2QLVB 4HBCH 4JREC 5F7HA 4J3WA 4X99B 1LK2A 1JHKH 5DGRA 2VRAA 3KJ4C 3FTGA 5CIPB 3QA3A 1A1NA 2CRZA 4P2RD 1XF5B 1FBIH 4GMTH 4CMHC 2UYLA 1B0RB 3H3PL 4PJGA 2HT3D 3HRZB 1SJVA 1D5IH 4F7TB 1NCUA 1TQBC 5F3HA 4NYLA 4M5ZH 3VFSA 1J87A 4Y4KA 4RNRA 1E6OH 5GGSA 3LKRA 4IRJC 1N0LA 2E9JA 2ILLA 4HZLB 1IGIL 5ALBH 4PJGE 2C3VA 4YX2L 3BPNC 1RZGA 4C56B 4POZD 4LKXA 5ESAB 1K4DA 3RU8L 1HQ4B 4ZUWB 5K9OB 5EIVA 4ZFFA 4AH2B 2YPKA 3W82A 4MA1B 4QHLA 2QKIB 5E8EA 4GXUN 3ZKXC 4GBXB 4MJ2A 3GSRB 3RPKA 3N9GL 4S1RH 5HHPB 3CVHL 3GBLA 1BZ7A 4X4ZA 3QG7L 4S1SH 3UEZA 4P9MH 3ARGD 3VFWB 3SE9L 2AABL 4EDWH 5DO2D 3U9PL 1HK6A 5IVOA 5D7JD 3F8UB 1Q72L 4G6KL 3MRKB 3RNQB 1JHTA 1GGIH 2ZCHL 3BGMA 3BXNB 1IEHA 5FGBA 5FV2A 1NL0H 5JIHA 4YZFF 2VXUH 4OLWH 3VXSA 3ZE1F 3ZKND 1MFEL 4KU1A 3VXRB 3DO7B 1IAMA 3FT4B 5C3LD 1C1EH 5JDJA 3P30H 4YDKH 3GSXB 3MV8A 3V5HB 3D0VA 4YBLC 1OB1B 1NFDB 3DVGA 4IOIA 3BH9A 4M1DH 3PWLB 5BMFH 4JFOA 3QI9D 2VISA 3BT2H 5F44A 3MBED 5D6DC 1CL7H 3D9AH 3TO4D 3QUYA 3VXUD 1JP5A 3VXSE 4G7YL 3U46A 5MEOB 4G43A 3Q6GH 4UB0L 4XPFH 5J3HD 3JTSB 5CGYD 3P73A 3NFNB 2R23A 3MV8E 5ID0B 1FV1B 4GQ9L 4JFZH 2HA1A 2XA8H 2EC8A 4HLZH 4HF5L 5D70L 4OM0H 1AFVL 1YEHL 3B5HA 3W0WB 2QHRH 4AIOA 1T2XA 2BSRB 5IB1A 5F1IB 1IM9B 4H8WL 3AS1A 5DI8B 1CGVA 5FXCH 3UJTH 2NTSP 3PDGA 3T3MF 4ZPTB 4Z7WB 1G6RL 1XCQB 4H5SA 2ADGA 2DF3A 3S3JA 4M4PA 4LIQH 1NFIB 3DI2B 3QIWC 1WFTA 3FO9B 1JFQL 1SEBA 3FB8A 4GXUM 5DJYA 1QACA 1EHLH 2BNRD 2R29L 1RJCA 3UAJC 3HNSH 5T5NG 4MXVE 3F7RA 5DQJB 1IGYB 1HILB 1NGWA 3VWKC 2OLDA 5EZJB 2GSGA 3ULVE 1YZZA 4X4YA 4NO3A 5FGCE 2APWA 1FVEA 4D0CA 1TZIA 1FO0B 5I8CB 3OAYK 2FB4H 5C2BL 1FYTD 4PJAE 3KWWB 1KB5B 5F3BA 4IIQC 4Y5VA 1G9NH 1CWVA 3OF6D 5IFAH 2CMRL 3DIFA 4L9LC 2JJTC 3KS0J 3NCFB 4CUCA 1I8KA 2JJSA 2UWEA 4HIEA 1F4WL 4L3CA 3LH2H 3WNMA 2NNAA 2Q7YB 4F58L 5F7KC 4Z7WF 4HBCL 1B6UA 4P23D 3UTSA 2H8PA 5K9JH 5JMOC 2FJGB 2HKHH 1JHKL 4L4TA 1ORSA 1N0XH 1FNLA 1YC8A 3VGEA 4F33B 1FBIL 2VKWA 2IAMA 1F3DJ 3GHBH 1F13A 2OBGA 2FZ3A 2UWEE 3DX7B 3NABH 4JHWL 4Q6IC 5TE6H 3DX8B 4LHUD 3RGVB 1A7OH 4LOUC 3VFRA 1D5IL 3TF7C 4GAYA 3UTSE 1UA6H 2GITB 2DM7A 1KC5H 1E6OL 4BUGA 1NCNA 5B4MC 2YC1B 3WEXA 5IQ9B 3IJYB 2YMXH 4Z7QF 2MKWA 3ARBA 5HHQA 1AO7A 2AJYH 2GK0A 5FYKD 1KLGB 2H26A 4HHAB 5I17A 4YHMH 4PJCA 3UTPE 4ZUTA 4L29B 5E95B 2HJKA 4LCCB 5JORA 3CD4A 3KPPB 5HJ3A 3L95A 5J4MA 4QHNB 1BVLB 4XRCA 4OLZH 2J7LA 3QYCA 4UBDC 4POYA 4S1SL 5FECB 4P9ML 1XF2A 2FO4B 2EDHA 1GPOH 4PJCE 3X12B 3O6FB 1I1RA 1ZE3C 1U58A 1GGIL 4Z95H 1NL0L 1K2DA 1DVFA 2GJ6D 3BD5A 4QY8A 4Z0BL 1BQHB 2VXUL 4OLWL 4I5BB 1LP9B 5D1XC 4PV9A 2JE8A 1C1EL 4IRSD 3P30L 1C5CH 4YDKL 1BX2A 5CP3H 2DJSA 4KKAD 5E2WL 2Q20A 4RGOH 1QFOA 1QSZA 4AG4H 1FNHA 1I7RA 3MUJA 5BMFL 4NQCB 3BT2L 4ONGH 1CL7L 3D9AL 1CS6A 4K55A 1T04B 4XNUH 4Z8FH 4RA3A 3Q6GL 4XPFL 4YPGA 5E6IB 4OF3A 3MLVH 4FXGB 1FL6A 1F8TH 3MZTA 4KFZC 1MCPH 5BRZD 4LF3A 2W60A 1R3KB 3WLBB 4JFZL 4K3JH 1MHHA 2XA8L 5LCVH 1FLRH 1OGAA 2A73A 4P46C 4OM0L 3RQ3A 3ARUA 1CICC 1VADB 2OJZH 2QHRL 2F15A 3NN8B 3RTQD 2A6IA 3JTCA 3MXWH 1D7FA 3UJTL 5JPMA 2VLRA 1QPXA 4OCYH 4WI8A 4U1LB 5KSUB 2E7CA 5FYJD 3BE1H 2NY5L 5E00A 2OJEB 5DK0A 1CGWA 4LIQL 3U6RB 1U0QA 3O4LD 4EI5B 1EHLL 4JJ5A 2IQ9H 3AY4C 4UIKH 3HNSL 2VLRE 1HHHA 4PJ8A 3HE7B 2G9HA 4ZQKA 3G6AA 1XR8B 5DEFA 4U7MA 3RVTD 2DRUA 2CPCA 3JUZA 4BQ9A 3FO2B 3TN0A 4F9PC 4YDLB 4XP1H 2V7NA 2VDLH 4H0IA 3WDJA 4K94C 1LO5B 3TH3T 1G7HB 2V6HA 4PJGB 3S3PA 3X3FH 2FB4L 5IR1A 4IJ3C 2YD6A 1CE1H 4E42B 1TTGA 4Y4KB 1PSKL 3QUMH 4RNRB 1G9NL 2HJLA 1HZHH 5IFAL 3VRLE 2AK4D 1NBQA 2PYEE 4CVWA 1GZPA 4NQEB 3B8YA 4ZOBA 5GGTA 3LH2L 4G80B 1T1YB 1H3PH 4NN5C 3UZEA 4PRPD 3TFKA 1R3LA 4B41A 1U8NA 2P24B 5K9JL 5L0QC 2HKHL 3BQUC 4JANA 4ELKB 3QQ4A 1N0XL 5T1KA 3NZ8A 1I3VA 4WFHE 3ALPA 4F80A 3GHBL 2GJZA 3NABL 5TE6L 3VFNA 1A7OL 1JGVH 4LVEA 2ZUYA 4NO2A 5EO1A 5EZLA 4NJAH 1UKTA 3MROA 1UA6L 4ENEC 2GT9A 5EU5A 1KC5L 1M71B 1C5DB 4J23A 3SY0B 3QQ3B 4ISVA 3QH3A 5E2VH 5FCUL 3O41A 3BO8B 3VW3L 1EERB 2JIXD 5B22A 3F7YA 3GKZA 4PJGF 2AJYL 5DEGB 4LDOB 4YHML 1QQDB 3P4MB 1MRCH 5I1HH 1YY8B 4TUKH 1T7WA 4Y4FA 4WHYH 3BVNA 1JPTH 1FG2A 4BH7A 4GG8A 1JHLL 2OR9H 3E0GA 4OLZL 1W8NA 4QXTA 2WQ8A 2HFEB 3UTTD 5C8JA 1CCZA 1BECA 1ZSDB 2R23B 4XWGH 1BM3H 1GPOL 1QLFA 3RDTC 1MCEA 3SDAD 2DQFA 4XBPB 1RZKC 1F11A 4JFEA 4Z95L 2X4RB 4FTVD 4OLVH 1UCTA 3QUKA 4R97C 5CAYB 4U05A 3MCLH 5SWSE 4I18B 4FMKA 5AAWA 1C5CL 3VD4A 5EZIH 3MRJA 4LASH 1B9ZA 4U1KA 1II4E 4RGOL 4FFVD 4AG4L 1T22B 2NY1C 3LOWA 4MNHB 1U92B 4JY6A 4ONGL 1FNSH 4J3TA 3BJLA 1NEUA 2G2RA 4JFEE 1P1ZA 3IXAB 4XNUL 4Z8FL 3PHOA 5FGCB 5BZDB 5IHLB 3B9KC 3MLVL 4PJ5A 4WUUD 1F8TL 2FR4B 1RJZA 1MFNA 2BSTA 2AEWA 1MCPL 3MOAH 4HK0A 3SGEH 4GXVH 4PJAB 3THMH 4K3JL 4LLWB 5BW7C 2XACC 1SQ2N 5LCVL 1FLRL 2HFFA 4Y5YA 4HKZB 2OJZL 2VQ1A 2YPLD 3MXWL 3MOQA 4KDTC 1DBJH 1B6DA 3O9WD 3DETC 4NSKA 4PJ5E 1NGXB 2AJZB 3FFDB 1IT9H 4OCYL 5F7DB 1MFDL 1PG7H 3BE1L 1A7RH 5F3BB 4KKLC 3RKPA 2CGRH 4GLRI 1A7QH 4JAMA 1HE7A 2IQ9L 4UIKL 4DEPB 3B9AA 1I8KB 2NNAB 1UJ3A 1BOGA 1HKFA 5DURD 2AKRB 5DZLA 4ZFZA 3NCCB 4XH2B 2CSPA 1QSEA 4MXVF 1IGJA 5CS7A 2JK5A 3DHMA 3QZWB 2AV7B 4WI4A 4LMQI 3BESR 1G9MC 5EU3B 3KLAA 2KQNA 3ULVF 1H15A 2VDLL 5IJKC 3KLHC 1A1MB 4P3DB 2ZUQC 3H7BA 1H3TA 3X3FL 4DZBA 5HYJD 2VE6B 5BS0A 5B39A 4PJAF 1CD1B 1JJUA 1CE1L 1QSEE 5FK9A 3T0WA 1F97A 1BJ1H 1MCKA 1H3UA 3QUML 1EXUA 4GW4B 5GQBA 3MCKB 5HGAA 4QHMB 3AC0A 4G8EA 3AROA 2Z4QB 3P4OB 4XHJD 3HZKB 2XN9D 3OKOA 4CN6A 3LQZA 1FFNA 2GK0B 1DBMH 5BS0E 1H3PL 3RWHA 4ZUTB 5K33A 5JORB 2OI9A 5F88A 2X4PA 1I7TA 2BC4A 4L4JA 4XRCB 1CFQB 3PP4H 3SGDH 1W72A 5IKCB 1X5IA 3JV5A 4NN6B 1HQRA 2XKSA 2H3NB 3QNYB 2DIAA 2UWEF 1JGVL 1NUFA 5I1GH 2E9BA 4JO2H 4NJAL 1TIUA 5HGHB 5ACLA 1FZOA 1HDMB 1VA9A 3QG6A 2FGWH 5AZEH 3UP1A 4MGXA 2VYRE 5E2VL 1G0XA 5ERWB 1XEDA 4PLOB 3TYFA 5CILH 5E94B 1BX2B 5DWUH 1MLBB 1FFPB 3QUXD 1MRCL 1H0DB 4K9EH 5I1HL 4TUKL 1JPTL 3PABA 5GZND 2OR9L 4H26A 3T2QA 3GMPA 5DVKA 4P5KB 2R69H 1IEBB 4D0BB 1NUGA 1HHKB 1WBZA 4XWGL 3CUPB 1BM3L 2W60B 2NYYC 1FIEA 4FMFA 1NCWH 4PJCF 5E2JA 1B88A 4B53A 5IFHH 3F7VB 3GUTB 2LVCA 4OLVL 4WI6A 2AK1H 3MCLL 2P7TA 3OB0K 3RJDA 5CZXD 2X7LB 3QWOB 3FB6B 1VACA 3QFJD 5DD6A 5MEPA 5EZIL 1PEZA 1U8MB 4LASL 5DMJB 1X7QB 1I4FA 4YUEH 3DMMA 1T5WB 4Y5XC 3UDWA 1FNSL 1OP5K 1HSAA 5KSVB 3PHQB 4F8QA 2P5WA 3ULVL 2GSIA 5IVZA 5EB9A 4NC1C 4OGAD 1H5BA 4RAVA 4JRYB 2XG5A 4YNYA 3HR5A 1JIBA 3MOAL 3OR7A 4GXVL 3AU1A 3THML 3CCHA 4QNPE 4YH6A 4MNQB 1QSFB 1L9NA 4N0FA 4JDZA 4WTXA 2A74A 4XAKD 2XV6B 4DN4H 1YECH 2P5WE 2PYEB 1DBJL 3BP5A 1ZVHA 1QG3A 1P7QA 4ONFH 5LGJA 1P7HL 4X9GA 1IT9L 3PHSA 1PG7L 2APBA 3KHQA 1A7RL 4X7SH 2GFBA 4HS6B 5IEKA 1X5GA 3ES6A 3H3KA 2JJUA 1A7QL 2WIIA 4N0UE 2H2SC 4NUJA 5FFLA 2QBWA 4JVUA 5DJCA 5GGTH 4PPTA 4QRRA 4MAYD 5BXFB 1YMHB 4NKIH 1RJYB 4JR9H 4FA8A 1I1AD 1QA9A 4X7TB 5CMAB 4ZTOH 3TVMD 4OI7A 4MD0A 3MUHL 5ACZA 4CN4A 1HWGB 1YMMD 2F5AH 2CKBB 1AKJA 1MEXH 3DRTB 3WFEH 5D7IA 2AI0L 4N5EA 4YFLF 3S96A 3NZ8B 3VXMA 1E4XI 5MHSE 5C0BE 4PJHA 3HE6D 3OV6A 4QRRE 2I25N 1CZ8H 5F9OH 5HD8D 4X4MA 4ZO9A 3BYTA 4XNQB 4QTHA 3TIDB 5KBNC 1MFCH 1ND0A 3MRLA 5D7IE 1JPGA 2FCBA 2WUBH 4HCRH 3VRLF 5SWZD 4OBSA 5DO2C 2ESVD 5D7JC 2A77H 3DX6A 2NW2A 3QIUB 1DBML 4X4ME 1MWAA 5JZ7D 4PJFB 1OP9A 4U7KA 1RVFH 4GRWH 3TNMA 3MRHA 2UUDK 4G6AD 3SKOB 4D9RE 1NJ9A 2V2WB 2IFFH 3WUWG 4F37K 4B5EA 4IS6B 4PFEA 2XA3A 3WKMH 2PXYB 3U0WH 4JM4H 5SWSB 3PP4L 5D5ME 3RZCB 1IVLA 5TQ0H 2BVYA 3UBXG 3GJEA 2ICCA 4MS8D 3QI9C 5I1GL 2ATPB 5EIIB 3QNXB 4JO2L 1DN2A 2ERJC 2X5PA 2K7QA 3RVWD 2FECL 4OLEA 5SV3A 1V8HA 1ONQB 5J3HC 5CGYC 2MCPL 1JBJA 2FGWL 5AZEL 4XBGA 3QUKB 4APQA 1G7LB 3TBSA 4WNQB 5CILL 2ZUUA 3QHZH 5DWUL 2QQKH 3NCJL 3TNNA 4Q74A 4Z7OE 2BNQA 3ILPA 1IQWL 1NMAH 4RFEA 1I1FA 3FQXB 4K9EL 2YN5A 1JPSH 1NGQH 5ENWB 2O93L 2DQCH 3I3EA 3MV9A 2BVUA 1OTSC 4LAJH 5F9DC 1PFCA 1OSZA 1A3RH 1RY7B 3CH1B 1HXYA 2V5RA 2R69L 4PGJA 4GRMB 1AGDB 5HVFB 4FQHA 5E4IA 2PTTA 5K9KB 4ONOA 3KDMB 5IFHL 3ELAT 3U2SA 5EN2A 1GC1H 1HWHB 2GY7B 1PKOA 4HS3B 1VERA 2AK1L 2HAZA 2P43B 3LS4H 5J9PB 1MSPA 2EDQA 5C86A 1BVKB 1G0YR 1YDPB 1A6VH 3ARDB 3R1GH 2ED8A 3FQUB 4YUEL 4EI6A 2JTDA 4K07A 5T3XE 4M4RA 4XVJH 4KDWA 4I0CC 5BV7C 3TBTA 2GY5A 2FATH 3N1FC 1CXIA 3PJSA 1K4CA 3D18A 5HHOA 3BMVA 4JM2A 3U83A 1KJMA 2QADD 1LO0L 1A6AB 1DQLH 2FX8H 3MLXH 1QSEB 2WUCH 3T0EA 1E28A 1D5BB 5DD5L 2B39A 4N0CD 5ID1A 1KENH 3I6KB 4DN4L 1YECL 3LKOA 4WTZG 4YFDB 3LDBC 2A2QT 5HHOE 5I9QB 4E41D 4DKFH 3RWFB 4ONFL 1FZKA 2OXGA 4NO0A 3O8XA 3L3DB 5HY9A 4DGIH 1FNEB 2G5BB 3T0EE 3IRZA 4UAOC 4LCWB 4X7SL 2FJFB 1NLBH 3NBNA 1ZVYA 5FA4B 1XF3B 4F2MA 3IS1X 1HCVA 2A0LD 5GGTL 3JV0A 2V17H 2QQQA 4K7FA 3HUJA 4X6FA 1UT9A 1ZA3B 4WWKD 2Z91A 4NKIL 2IQAB 4O2CB 3LMJH 3C8KA 3M45A 4JR9L 3VD7A 4ZTOL 2E7HA 4KQ4H 4ZFOB 2F5AL 2ICWJ 1MEXL 3WFEL 5J57B 3VDAA 3WFZA 4FS0A 2R2EB 3ARFB 3JVGC 1W72H 1YUHA 3V95A 3HUJE 3T0DA 1CZ8L 5F9OL 2GTZA 4FZ8L 3KR3H 2PTUA 1TVBB 4H25A 5E5RB 1M4KA 3MACH 3PQYD 3OWEA 1MFCL 4HWBA 2WUBL 4HCRL 4TTDC 2XQYK 2J2ZA 5E1AB 3TYFB 1RK1B 2A77L 3EOTL 2R56H 2HWZH 3V6FA 3FRUA 1RVFL 3FJTA 2IFFL 2LABA 2ICES 3FOLA 3T04D 3BD4A 3WKML 4UNVA 2FL5B 5I6XB 5C0AA 3U0WL 1BJ8A 2E7BA 4P5MB 4IRSC 4JM4L 4X5XA 4AT6A 2R9HD 1MRFH 5TQ0L 2VLME 2I9LA 3H9HA 1KIQA 1UXSA 1A2YB 1XIWD 4TSAH 1B3JA 3MR9B 3SPVB 1IL1B 3H9SA 2ORBH 1MCFA 4QHUA 1TQCB 1RUPH 2NY2D 2WQRA 2W0FB 5C0AE 1WVZA 5DJZA 2NXYD 2EDEA 4KRMB 2NY4B 1V3LA 5EU6D 2LU4A 1MUJB 1TMCA 2QQKL 1AH1A 4QGTA 5E8PB 1NMAL 2R2HA 3DMMB 5ICYB 3RTQC 1JPSL 1NGQL 2RJMA 1SHMA 2DQCL 2P5WB 2GSIB 4EEEA 5FGSA 4N8VA 4U1GC 1A3RL 3VRIA 2BHUA 3HPJB 3TH2T 3DI3B 2K9UA 3G6JA 4XTRC 3T3PE 2A6JB 5JPNA 2GAZB 4P3CH 4Y8AA 5A2LH 4NZUH 2DYPD 5F7LB 1FFOB 3D85B 4N0FB 3VFPB 2UY6A 4L4VE 4XNMB 4XMPH 1GC1L 3CFJB 1E4KC 1J12A 3H2WA 4N0UB 2AGJH 3LS4L 3VRJA 4DTGH 3MRNB 4Z7UB 3VXTA 1A6VL 1O7SA 3GMQA 3R1GL 4QOKE 3VXOA 3IVKA 5DJXA 1KLUA 4YXKH 2GFBB 3ZSSA 4XVJL 4EUPA 1OD9A 1BD2A 2XICA 3TA3B 3IGAA 2FATL 5C0BB 4JGJA 3NFPB 1OY3B 3BH8A 4GW1B 1VFBA 5DJCB 5C0RH 2FBJH 4XPHH 4OFYA 1BQLH 4GRLA 4P2OD 1DQLL 3VFTA 3MLXL 4QNPF 2WUCL 1DEEB 2CUHA 4NZJA 5SV4A 3V8OA 1JCKA 1KENL 3S96B 1Y18B 3LD8C 4N90D 3EUUA 1C8PA 1I8IA 1GJIA 1Q0XH 4PLKD 4ETYA 2EDXA 5JXED 5B38A 1K5NB 3KVQA 5CBEA 4WHTA 3ALWA 1PJ9A 3RWGA 4HIJB 3U30C 4DKFL 3BMWA 4D9QD 4WV1C 5SX5K 3HCVB 4DGIL 4O2EB 4QRUB 2DWEB 1T0NA 2JLLA 3FO0L 2WIMA 5LAXA 2CK0H 1UWXK 1DQQB 1NLBL 4HXAH 4M8VA 4DUVA 4XBEH 4XZUB 4XXCC 4M6MH 4KI5D 1Z9SA 5D5MB 4LNRB 4PIRF 1R3IH 1VDGA 2V17L 4JHAL 3DX6B 3WCYA 3FFCA 1KEGH 3DV4B 3FQWB 3LMJL 3S88H 1MWAB 2EDLA 5ISZE 4P5TD 3PGDA 2YWZA 3TNMB 4EZMA 3SJVD 5F6IC 4KQ4L 1DCLA 4MJ5B 1Z0NA 3MV11 3RFZC 5FO8B 5DS8B 3PG2A 4JFDE 5CWSA 5EG6C 1Q8MA 3NCYP 1WZ1H 1ZLUH 1W72L 4FG6D 2B2XH 4N0YH 2PYFB 4K2UH 4PD4J 1YNKH 3BP6B 3KR3L 1T80A 4J4PA 4CVUA 1RZJC 3C60C 1HI6A 5E9DB 4FFZL 1GL4B 2CIKA 4J8RB 5GPRA 3MACL 2AXJA 1G7QB 5TH2B 4YAQA 1J0JA 3SCMA 4MD5A 3WS3B 5D7IF 5DSCB 2HN7A 1JN6A 2J6EH 1UGNA 2EE3A 2R56L 3O2DA 3SDAC 2HWZL 3EJYD 3DURA 4BQBA 3AAZA 4UUJB 3ILPB 4MVBD 3V5DB 2CDFB 5HDLA 2W59A 3JZ7A 2VNCA 3D39B 1P5VA 5C08A 4POUB 4PRIA 4TQEH 5DJ2B 5D5MF 1T2JA 3DJ9A 1MRFL 3MSPA 1IJ9A 2A9MH 4FFVC 3HPLA 4XMKH 3GMMB 5IWLC 4U1IB 2PTTB 3GSNA 4TSAL 4ETQA 1GOGA 5F1NA 4HWNA 2ORBL 3OMZA 2WBJD 2ZCKH 3ARXA 2X70B 1RUPL 5C08E 3LSOB 2YK1H 1EHAA 2X89A 2HRPH 3QO0A 4PRIE 3U36A 4U6YA 4TUOA 5FKAA 3VCLA 1AIFA 4OV5A 4Z7OF 5CINH 3T1WA 1H8NA 1EFQA 3LZFL 1NFKA 3O9WC 1EO8H 3OJDB 4JN2A 4Y4HB 3RUGA 3S37X 2C4FU 3D3VD 4PY8J 3CLEH 2PO6D 1S9KC 3QXUA 3DYMA 1XGPB 1U93B 4P3CL 2NXZB 3IDYC 3MX0A 2FEDD 4NZUL 3MV7A 1NMBH 3PV7A 4KJPD 4XMPL 1JZ3A 1JGEB 4D8PA 4F7MB 1FJ1B 2XKNB 1KJVB 2AGJL 3RUGE 1YPZB 4MLIA 3DUHA 3IF1A 5EC1A 2BCKB 5I75B 1CN4A 5IM7B 5I74C 5GS3A 4M93C 2EDOA 3UC0H 3H9ZA 1U8IA 4UU9A 5GHWH 3MV7E 3QWQB 4YXKL 3QO1A 1T1ZB 5J12C 3D48R 3K1KC 5D1ZC 2CQVA 5AUMB 2Z31D 3BW9B 2DM2A 4BZ2L 5C0RL 4RMSA 2FBJL 4XPHL 1XMWA 3FQNA 1BQLL 4ONHA 4DKEH 5D6CA 1ZHBB 3D2UB 2FDBP 3MRGA 3QIWA 5IB4A 2EXYD 5EOTA 2X4OB 3KPMA 5L6YH 2V2TB 1QZ1A 5EBGA 1Q0XL 4OF5A 4TPRH 1CG9B 5CGTA 3CXHJ 5GSVA 3VH8A 1Q9OB 1X5LA 1N2RA 3FB7B 5IEHA 3Q2CA 4JM2F 2CK2A 3BEVA 4KY1H 1HEZA 1EVUA 3V2AR 4OZGA 4ODWB 4M43H 2EICA 3MREA 4NKMA 4P57B 5DVLA 4M6NL 2NR6D 1KTDB 2VDNH 4WI9A 3VWKA 3U1SH 5DA0B 1BBDL 2CK0L 2Y9RT 5F89B 2F54B 4MLSA 4HXAL 2C1PB 2IMMA 4V3DB 4FQIH 4JZJC 5CP7B 1KB5H 4M6ML 3MRIA 3PWUA 1XF1A 1U3HD 4RIRA 2P8PB 1R3IL 3C5JB 4U6HA 3CVIH 4L8SB 1KEGL 4OZGE 1NAKH 2Y36H 2VZOA 1JWMB 5L2KA 3BP4A 4GW5A 3S36H 5HTSA 5I30H 3VGDA 1IZJA 4IIQA 5BQ7B 3L3OB 3RIAK 5DMIH 8FABA 3QDGB 3SDCA 2HTLD 1AGEB 4L9LA 1OGAD 1GGYA 2JJTA 3CLFH 3QDJA 3K46A 1WZ1L 2ATKB 2L4OA 2D03H 2B2XL 4N0YL 4K2UL 1T3FA 1YNKL 3NH7H 3HUJF 3BPLB 4KJWC 5L2KE 5EBWA 5GZNC 1U8QA 3GRWA 1F02I 4BH8A 4G8IA 4OV6F 5F71A 2J6EL 4QCIA 5EBMA 5DJ6B 5D7LA 1MI5D 2VITB 3TF7A 5IB5B 3QXVA 4GS7C 3DGGB 1D5ZB 4PD4K 3SGKC 3VG0H 2X4QB 4OZFG 4L4VB 1FGNH 5M95B 3GMNB 5TDNB 1KCUH 1IZKA 2I07A 4L3EA 4LPTA 5C09A 5JOFA 4OQTH 4TQEL 1N5YH 3VXPB 3IDGA 5DMKB 1EUTA 2A9ML 2UZXB 5D7LE 4XMKL 5H37G 4QOKB 2N7AA 4S2SB 1EFXD 4LBEB 4WO4C 2RAMA 1VFAB 1M6OA 3HZYB 5FCSH 2ZCKL 2CLRA 3R0NA 1CI5A 4JFFA 4LU5H 4G6MH 2YK1L 4L3EE 1OD7A 3C6LC 2HRPL 2J88H 2CLZA 3MA7B 2HJFA 4Y2DD 2ITDB 2G75B 5CINL 2H32A 5DJXB 3MCG1 5FIEA 4LGSB 3N1GC 3C8HA 5A16A 1SJHB 1EO8L 4W6XB 5CD3B 1ZA6B 4JFFE 4HIIA 4UZGA 3MOBH 2VLJB 4NPYA 5INCA 3BH8B 4ZXBB 2WK2A 4FQJH 4U1MA 2FIKA 1RIHH 5MEND 5IMOB 1PYWA 4WW1B 3QT2A 1T0MB 5C3TA 3ZMRA 3T3PF 1VFUA 4RMTA 1R5IA 2IH1B 1NMBL 3MGAA 4LP4A 2M8XA 3UTQB 3MLTA 1JNHA 4JRXD 4LLDA 4PG9B 2BNUB 4MQXD 3G9AB 3HG1A 4KKBD 5DR5H 3RWIA 5ISZB 5I2IA 4HV8A 2YXFA 3L3HA 5GHWL 3UO1L 4RGND 2OCFD 4GKNB 4PB9H 1HHIB 5GGRA 3HE6C 4JFDB 1J86A 3E2HB 1QFHA 4Y4FD 4HMEA 2VKXA 5D8JH 4IM8A 1CT8B 3CC5B 3HG1E 2F8VA 4DKEL 3PGDB 4MJID 3T65B 1MCOH 1NSNH 1XZ0B 3F58H 1TCMA 1LE9A 1F6FB 2Q1EA 4HGWB 3AY4A 5I8OH 4TPRL 1JL8A 4CNIA 1MVUB 5A43C 1T7ZA 2RB8A 5EU4B 5F9JB 5JZ7C 5D1QC 4G6AC 2C26A 3HI1B 4IMKA 4M43L 4JQXC 4JPVH 3WNPA 3CZFB 3KJ4B 3GJFA 4F9PA 1ZT7A 5D2NC 4FQIL 3DXAE 1KB5L 4O5LH 4S0TD 2YD9A 3U9UB 4ORGA 5BOZG 4MS8C 3VE0A 2ITCA 3LEYH 1IAIM 3CVIL 1JNNH 2EIDA 1JV5B 3M8OH 3M17B 1RFDH 1TQBB 1NAKL 2Y36L 4ZS6C 3RVWC 4M6AA 5GSRB 3S36L 5I30L 3CXHK 3PDDA 5C0EA 4KXZI 4OZHB 1W0WA 1GOHA 4IRJB 4OBRA 3IDJA 4KUZL 3QEQD 3CLFL 3OXSB 4PP1D 4G8GB 5F93C 2XRAH 2SEBA 3TCLA 1C5BH 2D03L 4AQ1B 2DLHA 3BPNB 3U4EB 2R0WH 1SY6A 3S4SG 3SDDD 1LE5A 1D5MA 4J3OC 3C5ZB 3BQUA 5HGDB 4ZTPH 3ZKXB 3GM8A 4HKJB 3OHXB 4K8RH 2GCYB 3B8SA 1VFMA 5CLWA 1L6ZA 2HFTA 3TJHA 1DQJA 1JUFA 1M1SA 5HYSA 3PWJA 3PWPA 3FONA 3R06B 1GZQA 1IC1A 4Q9CA 1ETZA 1A7BA 1C16B 1FGNL 4JCLA 5EPMA 1G9NC 4L8DA 4Y1AD 4K71C 1KCUL 4EN3C 3IDMA 5J1AB 2ZNWA 1PLGH 4OQTL 3HAEA 1N5YL 4V2BA 3STZB 4NNXB 4YBLB 3PWPE 3TWCH 2WM0A 1BJ1J 1WC7B 4LEOB 5HI5D 3MV7B 2F9BT 4X7DC 3NAAH 3IETA 4U1HB 2C7UA 4G6ML 3LEXB 1Q9LA 2J88L 2QADC 3JTTB 4C83A 5KJRH 3TCXA 1MCDA 5CZVH 1XF4A 3PDOA 3V0AC 1FL5A 4L1HA 4N0CC 1U8IB 4QRPA 4DK3A 1J8HA 1A6PA 4PBXA 1ZS8B 1DQMH 4HK3J 4BFIA 4OGXH 2YPVH 5IB3A 3T8XB 5C0CA 3MOBL 1MHCA 5FM5O 3C9NA 1F90H 4FQJL 4ZUUB 3VXNA 3V5KA 5KS9A 1RIHL 3GMLB 4EQ3A 2CDGB 4I2XA 3V7AG 3WO4B 1JWUA 3CSGA 3KXFA 5D6CB 3E3QC 4QRPE 1J8HE 4Y16B 4S1QH 3BWAA 2E8ZA 4ZAKD 2RIKA 1DE4A 2XXMB 3EDDA 3QIWB 1O0VA 3NFSH 1AQDB 2IALA 3B9KA 5A3ID 4WWKC 3RUGF 5C0GA 5KS9E 1KG0B 1HEZB 4I2XE 5HHVL 5BW7A 5DR5L 1CIDA 1IAOB 1KTKE 3LKNB 4J6RH 3H42H 4YXLL 5KANG 5DXWA 4OAWA 4PB9L 4D0DB 4KDTA 3IAQA 4JDVB 5CZKA 1ERNA 5D8JL 4DN3H 3LVEA 3ZYJA 3BIAX 4OKVA 3AREA 4I0PA 5E4EC 4DGYH 2FSEB 3ROOA 4AIZA 1MCOL 1S7VB 4YHNA 4DWHA 1NSNL 1HH9B 2AJXH 1NC2D 2XY1A 4XWOD 3KPOB 2DLEA 3VI3E 3F58L 5TDPA 1F2QA 5I8OL 4YIQB 3ZTJG 3BZEA 1CXEA 2EZ0C 2AXFB 1RUQH 4LSTH 4QXWA 4E5XA 1TVHB 2HVKA 3GI9H 1VGEH 4JPVL 3CFBA 4PGEA 1OARH 5I1AA 3CU1A 5KSAB 3OTTA 2D7MA 2Y72A 2FEEI 3D0LB 3L3IB 2HG5B 3U7YH 3K8MA 4UOW1 2R9HC 5HYQB 4O5LL 5D2LA 2YBRA 4O51A 2J12B 4Q6IB 1KCGC 1KFAH 1U8KB 3EO1B 3LEYL 5JW5B 1JNNL 2D9CA 1XIWC 3PXJA 3ZSTA 3SE4A 1RFDL 4OZGF 1MOEA 1FSKC 5TE7L 1LNUB 2NY2C 3U0TA 2NXYC 3WUWB 1LK3H 4PGDB 4G8FB 3BZ4A 5C07A 4L3EB 5D2LE 2XRAL 1C5BL 1K8IB 1KPRB 2VXVH 3DVIA 2FWOB 2R0WL 1JYVA 2XWJA 3UBXB 4N9GB 3V0VA 1D9KC 1MVFA 3WL9B 5EBLA 1KT2B 4ZTPL 3RP1A 2CLRB 4K8RL 3PL6A 1NDMB 2AJ3A 1FQ9C 3KPLB 5C07E 1A4KB 4KTEH 1JZ5A 1YEKH 4U3CA 2Y5TB 3X14B 4R3SB 2F8XC 2VAAA 3RWCA 3TYGH 1FP5A 3VFUA 3P0VH 6FABH 5DDHB 4U1SB 1CVSC 3MRMB 1F4YH 3L6FB 5IMLA 3F12A 3L7FB 5D1XB 2PN5A 2JF1A 1PLGL 1KXVC 4ESKA 3CGTA 3TWCL 3FL7A 4L8BA 4EXPX 5IMKB 4WFGE 5ACMA 3ZHLA 2YSSA 1DDHA 1WSST 4MD4B 1V7NH 3NAAL 3MLTB 2YD2A 1A1OB 3ESVF 5KVFL 1C08A 4PRNB 5CCKH 3IDXH 4P2OC 4F9LA 5E0QA 5KJRL 1OWWA 3RVUD 2O61B 5CZVL 1NH6A 4KRPD 1AXTH 5E5UB 4P46B 4HV8B 2RFXA 1CICB 1DQML 4OGXL 2YPVL 4GAFB 3CFKB 4XC1H 5JXEC 3WNNA 3G5XA 2EEDA 5FKPA 1F90L 2J1KA 4KTDL 1QFWI 5ANMA 5IV2A 3QXAA 3W5MA 2PW1A 4JB9H 3PWVA 4Y5XA 2DLGA 1ZLVH 4NRXA 4S1QL 4R4BB 2XZAH 4X98A 3D25A 3DOSA 4KI5C 5DRWA 3DXAB 3NFSL 1OF2A 2VDRH 4L5FH 2ICEB 3DUUB 4P5TC 4QRQA 5T3ZE 2B5IB 4KZDH 1LO3H 4QHKI 5I1LB 4J6RL 4PRHA 4WJ5B 3L7EA 1ZGLB 3GJFH 5C0FA 2BNQD 3M1BB 3SGEI 4NC1E 4FG6C 4JEGB 1NGZB 2KZ1B 1LILA 4C56D 2ZUTA 3MNWA 4DN3L 2XFXB 1CK0H 4TSBH 3SKJH 1BZ9B 5SX4I 3MGOB 3L3KB 4PRDA 3OX8A 1JVKA 2ZG1A 2QQNH 4DGYL 1GYAA 2FHCA 2WBWB 4GBXD 4P2RA 4QRSA 3MA9H 4YHPA 2AJXL 4BSVB 3G04A 1DANU 3T4YB 2EDJA 4LCYA 1MCJA 2B7DT 2OK0H 1IM3A 4QT5B 2GTWB 3EJYC 2CKBH 4KHTH 4NQDB 5F9WC 2A6DA 5GGVH 2ADIA 4BSWA 1RUQL 2CR3A 4A6YH 3W9DA 4LSTL 3GI9L 1VGEL 4P2RE 1OARL 3AMLA 2V7HB 3T4AB 1X9QA 2Z35B 3VXRD 3P11H 1HHGA 3U7YL 1IGTA 3F65A 5C9JB 2VXTH 4LVHC 4LLUB 5JLZA 3BZFA 4IMLA 1KFAL 5E24E 2BHZA 2YEZA 4RAUB 3PWPB 1ZHNA 3WV0A 4GUPB 4F7EA 2WBJC 3N1PC 1GZQB 4L9DA 3RL2A 1IAKB 3BYYA 5L2JA 4ZG1A 1PKQA 1S7UB 3QCVH 1LK3L 3EGSA 4Y5VC 3ARGA 4NWUH 5D7JA 3REVB 2VXVL 3OKYA 3MYJA 3HAEH 3PP3K 4N8CL 5EH1A 3S9DB 4XB8A 5TJWK 3GBNH 3CDGB 3W0WD 1KIRB 4MCZA 3S5LG 1PKQE 3GEWB 5DT1H 1IM9D 4K23H 4LCUA 1MCCA 2X4TA 2VR9A 4W4NA 1AGBB 4KTEL 3W39A 1YEKL 3VD5A 4QTIH 2IAMC 3QI9A 3RDTB 3MBEA 3HTLX 1KYOJ 3TO4A 3TYGL 3QDMA 2IADB 5GGVY 4KJPC 3VXUA 6FABL 3CDFA 2R0LH 3ARRA 1F4YL 4JHBA 4I9WE 4R97B 1HHJB 1W0YT 1PZUB 3I6GA 3HC0B 4YDJB 2CDEB 4LQ1A 4QWWD 1T20A 1ED3A 5B8CC 5HVHC 1J0KA 1MCLA 4NQSB 5CBAA 4N1EA 5SWQB 1OGTB 5I18H 1V7NL 4G42A 4NCC1 2Z31C 2L7JA 1DQTA 3IDXL 5FYKU 4PJ7B 4HFWA 3VWJB 2ZOLB 4CJ1A 1U8JA 3O3BA 4PJ9A 5EC2A 1AXTL 2EXYC 3K2UH 5GJSH 3PGCA 1XH3B 1FVDA 2IPUG 2BNRA 2B1HH 3HR6A 4LKCA 4XC1L 2R4RH 1DVFC 4I48A 5E5MB 1NBZB 4XNZB 2PUQT 1HIMH 4NRYA 1I8MB 5TF1H 3O45B 5DHYA 2EE2A 1KPVB 4NKDB 4JB9L 4FQXB 4RRPA 2WZPD 3ROOB 3DBXB 3GMOB 4K9EC 3TBYA 3MFFA 3EDFA 2XZAL 3KYOA 4NKOA 1V7MH 3QXDA 1FYTA 4KDVA 2VDRL 4L5FL 1BIHA 2FYYB 3AXLB 1EA9C 3WN5A 5EUOB 1G7JB 3FN9A 4MCYA 5KS9F 4KZDL 1M7XA 1R3HB 1LO3L 3JV6B 4E5XB 2P45B 3OF6A 2Q3ZA 5L9DL 1S9XA 3JUYA 1OP3H 3VJ6B 1FN4B 3MO1B 3I75B 1N3NA 4Q0XH 1YEDB 4CADB 4P23A 1CK0L 4TSBL 3O11A 4GLRH 3SKJL 3GDBA 1JI1A 2QQNL 3MRPB 3Q1SH 4ODUB 3MA9L 1JGUH 2EYRB 5DJ0B 1QHOA 1U8PB 4B7LA 3VI3F 3F5WB 4FXKB 4LHUA 2OK0L 4QXUH 3DHJA 3TIEA 3O6FD 4KHTL 2CKBL 4XGZA 1JZ4A 3QPXH 4DGVH 1BBJA 1INEH 4JFHD 1SY6L 4NNYB 5FO7A 4A6YL 5FYJU 4ZFGH 3MRBA 2CR6A 4P4KB 4LPXA 3P11L 4RQQB 5L8KB 2VXTL 3ARTA 4WW2A 1S7WA 3H9YA 4CVXA 5GRXG 5L7XH 5BZWB 5DRNA 5EUOF 3FN3A 4NQCD 5ABDE 2NZIA 4HG4J 3GSQB 1Y6NR 4MHHG 3VFUB 5HHME 4OGYH 2X4NB 5E6ID 1J1XH 3QCVL 2PKDA 2F53B 5GRUH 5FYKE 4NWUL 5D2LF 1AI1H 1WBYA 3QJFB 4Y2DC 1S9WA 1P2CB 4R7DB 4I1NB 1NAMA 1PQZB 4KPHH 4M8QB 3BUYB 4DUXA 5DRXB 4RMQA 1P7KA 1EO7A 5ESQB 4EVNB 3FAWA 5JO5A 1S7SB 3GBNL 5IB2A 2XNAA 2GJ6A 5CEXB 4UMGA 3TFKC 1MCSA 2EDFA 5T33H 2MHAB 5DT1L 4K23L 4GAGH 3QB7C 3I3DA 5DJAA 5IOPA 4IRSA 1CXHA 4C54A 5BVJA 4N8PA 1C08B 5EOCH 4QTIL 3IDIB 1Z3GH 1AP2A 3PV6B 1RZIB 3HMWH 3B5GA 2GJ6E 4LPWA 1S9VA 5IMMA 2R0LL 4EI5D 3V6ZA 1RHHA 1IAII 3TT3H 2NLJB 4MQXC 3HE7D 5BRZA 1B90A 1QLRB 4GKZB 1IC5H 1HSBA 3SO5A 5JMRA 1S7TA 3MMEB 1J05A 3X13A 4RGNC 4UQ3B 3RTQA 5I18L 1BWMA 1F5WA 1KTLB 1OTUD 3OXRB 4Y4FC 1I7UB 5HI3D 4KGLA 1RUKH 4FQ2H 5C0DB 1OF2B 5BRZE 3UCRA 2W9EH 4M61B 4TULH 1XGRB 1J11A 1NCTA 4YR6A 4U49A 4WEUD 4PTTB 1S7XA 3C87A 2ZSWA 1A3QA 1A9BA 3K2UL 5GJSL 4M7ZC 3O4LA 1RZ7H 4PGBB 2VL5A 4O2FA 1R3JA 5KANI 3DSFH 2B1HL 4NQED 2R4RL 5C70A 2XWBA 3LN4A 1HIML 2EYTB 1AHWC 5FYJE 1MAKA 5T1DH 5TF1L 4R4NC 1DBKH 2NX5E 3SDXB 4P2RB 3O4LE 2A83B 3D87B 4Z76A 1KB9J 1MJJB 1BZQK 3G6DH 2XTJB 1BQHG 1V7ML 1IM3B 1TZHA 3EJJX 3GKWH 4K8RD 2RBLA 1D5XB 4JFXB 4U1JA 1A6TB 5KAQF 1F42A 3V7AE 2XPGA 4S0SD 1AXSB 2AK4A 2H1PH 1FAIH 3LN5B 3P9MA 4Y5YC 1ITBB 4PJBA 3TPKA 4IDJH 4Q0XL 3UYPA 1OVZA 4RAHA 2V2XA 2WP3O 4LDEB 4MWFB 1UFUA 1ZT4A 4OCRH 5INDA 2XWTA 5DHVB 5JNYA 5C71A 3Q1SL 1MAMH 1UVQA 2AK4E 1GXEA 3BOVA 4NCDA 1PKQB 4WU5A 1JGUL 3CFEB 1SM3H 2ARJQ 2I60H 4DKDC 4QXUL 2BRQA 4PRPE 2LVEA 3L9RB 3QPXL 3G08A 1B4JH 4DGVL 1INEL 3IFLH 1E4XH 1UJ3C 2VLLA 3Q3GB 4R96B 4ZFGL 2I9TA 3SDXF 3X11B 2JIXA 2R2BA 5FAAA 5AYQA 3W39B 1MQ8A 3ILQD 1A8JH 4KRLB 4J1UA 2HKFH 5L7XL 5D71H 3HB3C 3QI9B 5IK3A 3U82B 3GSVB 4UDUB 1M7DB 4OGYL 5ESVB 1J1XL 1UCBH 2ZSVA 4OZFB 3UTTA 3OB0H 1UB6A 1JMZA 2RHEA 4JKPH 5GRUL 5T1LB 2LE9A 1AI1L 5MI0C 2P8LB 2VZVA 3EFFA 4JLRA 3SDAA 5JHLH 5J6GA 4KPHL 5DFVD 3VGHA 4E0RA 1DUYB 5KSBB 4FTVA 4PP2A 3W5NA 5T33L 2W0PA 2ZCLH 3I02B 4GAGL 5JW4R 4KMLB 4YGVB 3UTTE 3MLSH 5FUZH 4HG4K 4JFPB 4MQTB 4WCYH 5EOCL 3TESA 2X4SA 1GCFA 5TFSH 1Z3GL 2QSVA 1EGJA 3TM6A 3HMWL 3IT8D 4ZAKC 4OZ4A 3WIIH 3TT3L 4H20L 5F70A 4LKCB 4WUUA 1B0GB 3TH4T 2GUOA 1M7IB 2VH5H 1LEIA 4HK3N 2Q8BH 2D7OA 4F7PA 2OTUA 1IC5L 2YS4A 3I50H 1M05B 3RX5A 5JA8B 2D0GA 4G9FB 3HMXA 2BDNH 3MLZH 2YPLA 3QEGH 4WIQA 4X6BB 3SKNA 5J6HB 3OKEA 3O9WA 3O6LH 5BV7H 1T7YA 5GISH 1RUKL 4FQ2L 4ZYKB 3A6BL 2W9EL 4TULL 1CDYA 3OJMB 4NHUE 4KVNH 5IF0B 1O5DT 5FGRA 4YC2C 3WHXB 1UXWB 2YPLE 4XWOC 1D6EA 3BUTA 4WHYG 1RZ7L 1AD0B 5BJTA 5IW3A 4ZMAT 3DSFL 3ZHKA 4KJQD 3OGCA 3CVHA 4X8JB 2HLAB 1PZ5A 5FF6A 4HJJH 3QUZB 3D6GA 1UH4A 1KBGH 1WWCA 3GSWB 3Q5TA 5EFIA 5T1DL 3RNKB 1FORH 1KCLA 3VDCA 4UAOB 1T03H 4Y89A 1X6NA 4Z9KB 4PTUB 2AW2A 3EHBD 3G6DL 1LVEA 2RCSH 2B4CH 4UQ2B 2R1WB 4XNYH 4LHUB 5HYJA 2DTMH 4E9LA 2VWEC 1CFBA 3GKWL 1H5BC 1EZVX 4KROB 2YRPA 5D93C 2NY3D 2IPUK 5EZOH 4YDVA 5HHMB 4LAQH 2H1PL 1FAIL 1EMTH 5EIQA 4OFDA 1DUZA 1BIIB 2XN9A 3TPUA 1HKLH 3DVFA 3DTXB 5HYJE 5FYKH 2Z92B 5CKAA 3L1OL 1RK0A 5E2UH 4OCRL 5DRNB 2QSQA 2BRRH 1FDLH 1WCBB 5ICXA 2X1QA 4RX4D 2AS5M 3B83A 1YQ2A 1I3RB 4F57L 2XN9E 3EYVB 5BVPL 3TPUE 3L3JA 1P4LA 2I60L 1F6AA 4NIKB 4P2YA 4Q9BA 4XI5D 2IC2A 3FQRA 1HOCB 1NAMH 1TDQA 1B4JL 5JO5B 5C0JB 1E4XL 1G6RA 3S4SB 3QDAA 4YO0B 1WWWX 1JYNA 3QUXA 3TLRA 1KGCD 5EORH 1T1XA 2HKFL 1ITCA 3RWEA 5ITFA 3VXQB 4CBPA 5GS1C 1Y0LA 4AMKH 4JGMA 1A9EA 4YFEA 1L7IH 1RV6X 4FZEH 5CFHA 3S8WA 1UCBL 3UMTA 4JKPL 4JRYD 4QKXB 3ZLQC 4KRPC 1RHFA 3IFOB 4O00A 5JHLL 5HYFA 4MNQD 1QSFD 3PWNB 4DJMA 3BX7C 1RPQA 3SGKA 3RTQB 35C8H 2PYED 2ZCLL 2L0DA 1QR1A 3MLSL 3GGWA 5FUZL 4U1GB 3REWB 3FO1B 4U0QB 3ROLA 4GKOA 3QFJA 4WCYL 3G5YB 4BK4A 5TFSL 1Z9LA 4XX1E 2ZSWB 2P44B 4OZIA 1GOFA 2NX5B 1BGXH 3B2UD 3VGAC 2PCPA 3WIIL 3IAPA 4XCNA 2BOCB 3TO2A 2EEAA 4BKLA 2VH5L 3QFJE 4APQC 2Q8BL 4OUUA 3RX8A 3RWDA 3I50L 4R2GB 4ZD3H 2MMXA 4W70A 4R4FH 3K2MC 2BDNL 4OZIE 2DKSA 3MLZL 4NFCA 5GRZA 1U95A 3O6LL 4H1LB 5BV7L 4EQ2A 4UI2A 3B6SA 5GGUB 5GISL 1N8ZA 2DMBA 3MJ8A 4HDIB 2AV1A 4KVNL 3QJHA 3WNLA 5TGBA 3KYMB 4GBXC 3SN6N 4KJYA 2XPGB 3TGXA 1NDGB 2AK4B 1Y6MR 1NMCB 1UB5B 3BPCA 2WWKT 1ZHKA 3U4BH 4MAYA 9CGTA 3OKKB 2A1WH 5I71C 3QIUD 4HJJL 1I1AA 5CSZA 3TVMA 4PRPB 4UT7H 1GVIA 2CUMA 4ODXB 4WV1B 5INDB 4LLVA 1EEZA 3C08H 1FORL 1WTGT 1YMMA 1OTTC 4PJXA 5JOPE 2PXYD 1T03L 3MLWH 1EJOH 1MJ7H 2YA0A 5SWSD 2RCSL 32C2A 3HE6A 2B4CL 4PJDE 5C0IB 3RZCD 4XNYL 3ARYA 3LV3B 1F58H 2DTML 3DVNB 2H41A 5EO0A 4KMQA 4LFHG 4LLQA 3DV6A 5DK2B 5IGXH 5FA3A 3V6OC 3VI4E 3CNKA 5KVGH 4MSWB 4PY7A 4L3AA 2ENYA 4C55A 5EZOL 3GSUB 1OCWH 4LAQL 3OKLA 3MRQB 1EMTL 5SWZA 2EDKA 4Q2ZA 4YHYC 1C12A 4UDTA 3BRDA 2DJ4A 4AM0B 1P69B 1A22B 5FYKL 2RGSA 5IVXB 1DLFH 5E2UL 4HWZA 5IG7A 5C0CD 3OR6A 2J5LB 2Z93B 3C60B 1I85C 3KPNA 3HLAA 4MHHI 2BRRL 1FDLL 1K85A 5SWZE 3MUGA 4HMDA 2VQTA 5D2NA 2ESVE 5IIEB 3EO0B 2NY0C 4MS8A 1VCAA 3AM8C 1NAML 1G7IB 4KK5D 4HSQA 5EO9B 1A6ZA 5DLMH 3EYFB 2X1WL 3E6HA 3WJLC 3GFUA 1A64A 4PP2B 5E8OA 5L8LB 1F3JA 2ARJA 5D2NE 3ARVA 3IKKA 3I84A 5I76A 5K9QG 4FFEX 4QWWC 1A6UH 1QEWA 3ARDD 5EORL 4NZRH 2F19H 3P77A 2P8MB 1EGJH 2ENSA 4X6CB 5AZ2H 2G60H 3DX9B 2DS4A 4IOFD 4AMKL 2MCG1 1L7IL 4FZEL 4LIQE 5FV1L 2IBBA 4N68A 3AGVA 3QNZA 3QEHB 1YNTB 2BVPA 5JHDB 2N4IA 3CPLB 4JZOA 4NHUB 2HH0H 1Q9WB 1PD6A 3HMXH 4JKMA 3LRHA 2M26A 2KPNA 4OD2B 35C8L 3BKMH 4HC1A 2BY2A 4KK9D 4MNGE 3SGJA 2WP3T 1I9EA 5FYJL 3BFOA 2HMID 1GGCH 4LCWD 5T1MA 2KBGA 2ADJB 5DRZB 4BQ8A 1PEWA 1BGXL 2IANB 3ECBA 4NQTA 4JY5H 4ERSH 5SX5H 5KN5A 4Q9QH 3KYNB 3OPZH 1X4XA 3B9VA 3CFDB 4M93B 4R4FL 4ZS7H 4X6EA 5K59E 2FIRT 5E6YA 4N0CA 1CYGA 3ARFD 5J12B 2XY2A 4HEPG 4E41A 2DIBA 1KULA 1KTRL 5D1ZB 4RWYH 4UNTA 2UZYB 4G6FD 1AC6A 5CJBA 5IQ7H 4HH9B 2V5SA 4MX7A 3KNBA 4JPIB 4UIMB 1CDGA 3Q48A 4R9HA 4DVRH 2OSLB 4E41E 3U4BL 3O6FC 4WWKA 2A1WL 5FOBB 1KPUA 1UYWH 2HT4D 4UT7L 3HNTH 4Z78B 4K3GA 1JPFA 3C08L 3TC9A 4R0LB 3UYRL 1IILE 2FD6H 4XVTH 3VFVA 1EJOL 1MJ7L 3L3GB 3RKDD 1JGDA 4RWHA 5IW1B 4JZJB 1EX0A 1BLNA 3T2PA 4LLAA 4PRAA 1T5XB 1NPUA 2ICWB 1F58L 4K3HA 1ZEAH 3RPIB 5IGXL 3BHBA 1K6QH 1B0WA 2QV2A 5CP3A 1JTTA 5KVGL 3PQYA 4J3UA 4N1HB 4NFDA 1S7RB 1RZFH 5E6IC 5KG9B 3B3IA 2W07A 3QR2A 1XGYH 1PW3A 2NY4D 2FBOJ 1IC4H 1R5VB 1ZKAA 1AGFB 2C5DC 4I4WA 4NZTH 4OCMC 3U0PB 2D7NA 1OPGH 1DLFL 3RWJB 3VD9A 4W6YB 4MA3B 4GQPH 3PQYE 3F7QA 4KVCH 4I3RH 1FH5H 3I2CL 1SJEB 3IB4A 4GKSA 2K7PA 4X0KB 4Y19E 4ZNEA 3BSZH 1JZ6A 3QULB 2VUYA 3RVVD 1XIWA 4XP9H 2ID5A 5C7XH 5B39G 5HGBB 4JJHA 5DLML 4V2CB 4EI5C 1JZ2A 3FKUS 3S5LB 3P2TA 4P0DA 5AD0A 3HE7C 4ZNEE 1CD0A 3OKMA 3NIFE 4QO1A 1K8DA 1A6UL 2K3TA 4V1DB 4X6DE 2EIZA 4NZRL 5AG8A 5KVEH 1A21A 4ZSOA 4Q6YA 2F19L 4YDLC 1EGJL 4WO4B 5MERA 4J4PC 5AZ2L 2G60L 2IPKA 3KLSA 5HI3C 3TA3D 3Q6FA 3KPQA 5C0BD 1SYVB 3NCYS 4PUBH 4PRBB 3QP3A 2H2PD 5EU6E 3C6LB 2B20A 3SCMC 5I16B 3RWDB 1N59A 1JZ8A 2HH0L 4ZSOE 2DYPA 3HMXL 4KUCF 1RIUH 2WLYA 1ADQH 1XAUA 5ADPH 2OZ4H 3BKML 3LN9A 3QUMA 1HXMA 1U95B 4TN9A 2VZ1A 4HUXB 2LU3A 1CTNA 1UQSB 3GIVA 3CFIC 3TP4A 3FOMB 4HFUH 4CKVX 4F8TA 3VFMB 1GGCL 4FQQB 4I3SH 1DQDH 5KOVC 1U8HB 3RGHA 3HS0A 1HYRC 1BFOA 1OAQH 3TBWB 3BPCB 4LSRH 4PJDB 2GQHA 4LVNB 1SBSL 3E6FB 4K8RC 4JY5L 5DEZA 1GGBH 4ERSL 4P2OA 1UEMA 3UTZA 2BVQA 4Q9QL 3OPZL 5F7FA 1DR9A 5IT2H 3RZWA 1KACB 4ZS7L 1L6XA 2QR0A 4OZIF 4HKBA 1ZANH 1K3IA 4ODVH 5B3JE 3QIBB 3RL1A 5JXEA 3O3DB 1UZ8A 7FABH 4RWYL 1XGTB 1JF1A 4XAWH 4IDLA 3EOAA 4R90H 5IQ7L 1CFTB 4EIZC 4HPOH 5DUBA 5E9DD 4LL9A 5GIRA 1X5AA 4W6WB 3SQBA 1NGYB 3HC4H 3MNVB 3WFDH 1DBBL 3LPFA 1HN1A 2GJJA 2YRLA 1MCWM 2UVFA 4RZCB 5IFJA 2H9GB 1KNOB 2ZOKA 4DVRL 2R1YB 5IROC 2ESVB 3QDMD 4ZDHA 2IBGA 4ZPVB 5I1DA 4D9QE 4XCFH 2CXKA 1UYWL 4PREA 5H2BA 5D1QB 4LQFH 4P5TA 1Q94B 3HNTL 3SJVA 4OCWH 4OIIH 3NCMA 3D39D 5FO9B 2FD6L 4XVTL 4CAGA 3MUGB 2WV3A 4KI5E 3ILQC 4PJDF 4WI2A 3SKMA 2R1XB 4R7NA 1ZEAL 1QVOB 3SJVE 3BP7A 1K6QL 4WUKH 4J3VA 1WAAA 4QF1A 2DWDA 3VI4F 5IBTH 3H7LA 5AEAA 1RZFL 1UKSA 5CJ5A 5DJDA 5JOEA 4OCLC 1XGYL 1CFNA 4X80H 1CXFA 2Y6SC 3QFDA 4PJ9D 1G7MA 4NZTL 2NTFB 5CHNA 4QYOA 1T4KA 2OTPA 3DUSB 4M3JA 5DFVC 4XPBL 1OPGL 1QEWB 2D2OA 4MVBA 5DF0A 2NW3B 3RIAF 1WAAE 1U8OB 2E7MA 4KVCL 1S8DB 4JKKA 4I3RL 4AENB 3GB7B 4XB7A 4Y4HD 2PTVA 2IH3B 2P48B 4MNGB 3H0TB 3BSZL 1YN7B 4MYWB 1HYSD 1EEYA 4MQ7B 2VDMH 4NQVB 5E99H 4KXZH 4XP9L 2NXZD 1YYLH 5C7XL 4MDJA 3IXTA 2WBJA 3WDHA 3MRRA 4DEPC 5H94B 2JB6A 3KPRB 1A6WH 1UZ6E 4HC1H 3MRFA 2X44D 4K71B 4P9HH 3SDCC 1J8KA 4EN3B 3GZKA 1NCAH 1ZLVK 5AWNH 1LEKA 1ULVA 2P5EB 1IQDA 5KVEL 1XR9B 3DRQB 2J4WH 2EDTA 3FZUC 3IJSB 2BSSB 3NCEB 3TBVA 5A1AA 3ECBB 3D3VA 4PUBL 2HLFC 2PO6A 4HUVB 5DQ9B 2PW2B 3GJFK 3MJ7B 1MCNA 3HZVA 4GMTL 3S3SA 2EYSB 2DM3A 4HJGA 3EYQD 43CAB 3D2UD 1SYSB 4X5WA 1CFSB 1RIUL 5MEQA 3KPSB 1JNJA 4M5ZL 1ADQL 5ADPL 2OZ4L 4CDGC 3KYKH 4L4TE 8CGTA 5I66A 5J11B 2F74A 3D3VE 2BMKA 4M3KB 5F8RC 4WDIB 1ROWA 5F21B 5ALBL 4HFUL 5B8CA 2IFGA 2CO7B 4MXQD 3PXHA 3MNZA 4NBXB 3GSOB 3C6SB 4I3SL 1DQDL 1KCRH 2F54D 3EHBC 1J1PH 4Z5RA 4NN6C 1OAQL 3ULSA 5IVNA 1TCRB 1WBXB 2Z31A 2EKSA 4LSRL 1FG9C 2IGFH 4NC2B 1XGUA 4S1RL 1GGBL 1J0YA 2VLMD 1DLHB 5E1HB 2XT1B 1FVCB 3SHSA 1ZTXH 2NY3C 4ODTH 1ZK9A 4WGVB 1AO7E 4EDWL 2VN7A 3QDGD 5CEZD 1S5HA 1ZANL 4ODVL 5DTFB 4F3FB 2APFA 1X5ZA 4HIHA 2OQJB 3WO3B 2VIRB 1MHEB 4PRAB 1Z5LA 2MQ3A 1BF2A 5EOCJ 7FABL 3N1QC 3PIQA 4XAWL 1XCTA 4BELD 1YY9D 4R90L 4I8DA 3QAZB 4ZUSB 4HPOL 4N0RA 1LQSR 4WU7B 5E4EB 5C6PB 4BZ1H 3HC4L 3WFDL 2COQA 4M1DL 3MLUH 4LPCA 1JK8B 4YFLI 1U3HA 1S78C 4Y19B 1XFPA 4XCFL 4JHZA 1BQSA 4LQFL 2VSDA 1RZ8B 1DN0B 4DVBB 5JDSA 1BEYH 4OCWL 4OIIL 5EUKA 3IJHA 4IBLT 4L4VD 3T77A 4CMMB 3BRGC 1W0VB 2OTWA 1CBVH 4GG6A 4Z7VA 2CLVB 5DMGD 1MLCB 1ZT1A 2AJVH 3JXAA 2IMNA 2WINA 1A5FH 4X6DB 3AUVA 5FB8B 4QOKD 4XCYB 3BZDA 2Q76A 4WUKL 4F15B 1FSKB 5IBTL 2JJWA 1FNGB 1OGAE 3IFPB 4X80L 1EVTC 3GI8H 4PV8B 4Z7VE 5EU6B 3D1MC 1Q9KB 1U3ZA 4HUUB 1MI5A 2GYSA 3HZMA 2Q6WB 4PR5A 1D9KB 4F7CB 2WNGA 1ZWIA 5CKGA 4IMKC 1KN4H 3HN3A 1LK2B 2VLJD 3OG6B 4ZXBD 2WAHA 3FTGB 5E70A 3QA3B 1A1NB 3I6LE 4Z77A 1CLOH 4U6XA 4C57C 1MI5E 1F2XK 5FDYA 5F1KC 5E99L 1N59B 2UYLB 3IKCA 1EFXA 2DYPB 1YYLL 1C7TA 43C9A 3B2UC 5F3HB 4NYLB 4QRTA 3VFSB 1HH6A 4KRNA 4IHOA 3QUMB 1TPXB 4HC1L 4P9HL 2GEEA 1Y6KR 3VA2C 5GGSB 3LKRB 3I3BA 2Y25A 4O02H 4NQXA 4Y2DA 1EJ6A 1CE6A 3NIFF 2AXGA 4OT1H 5ISZD 4X6DF 2C3VB 2NY6C 1RZGB 3DROA 4ZUVA 2J4WL 5CEYA 4LKXB 2JCCA 1K4DB 2JKXA 4ZFFB 2YPKB 2EIBA 4JFDD 4QHLB 5E8EB 3FCTA 2ZKHH 4OD3H 5MENA 4LCIH 1BZ7B 4P2OB 5M94B 4YHIA 1AGCA 1OP3K 3TJHC 4GOSA 1L0XA 4EDXA 4PLJD 5TPWH 1WWAX 2JCCE 2VERN 5GRVL 4FXLA 2WWMC 5HDOA 1JHTB 3BGMB 4JRXA 1J10A 3KYKL 3OKDA 4YHKH 3QIUC 5MENE 3VXSB 4FFYH 4HCRA 4ORZC 4XCEA 1FZMA 2YMXL 3EW3B 4CGTA 4O4YH 3MV8B 2PXYC 1L0YA 3D0VB 3DVGB 1J1PL 3BH9B 3LKPA 4IOIB 4WI5A 3H8NA 4JFOB 2HVJA 2VISB 4NN7C 3RZCC 1KJ2A 2ADFH 4UT6H 3S7GA 4ZDHB 5KVDH 3QUYB 2IGFL 4OLXH 4N8VG 3U46B 4G43B 3STLA 2Q86A 2CRYA 4PREB 3P73B 3R8BB 3VFGH 4MJIA 1ZTXL 2C3WA 3SJVB 4ODTL 4W81A 4JZNA 4RGNE 3OJVC 4GRWE 5J06A 4IRJD 2BXZA 4JY4A 4G8GD 5B3JF 4EBQH 1QFWH 5IB1B 1AHWA 2IBZX 4JFYA 3SKUD 1BWWA 3BP7B 3C5ZD 3TJEH 4QF1B 3BD3A 4BZ1L 4H5SB 2ADGB 3U7AA 1FCCA 3KLDA 4AEFA 3MLUL 4EUPG 4FABH 5J8OA 3QFDB 2BP3A 4LGRB 5CHNB 1SEBB 1NEZA 3FB8B 5DJYB 1IARB 5F9WB 1A4JA 1CDJA 4KK5C 1NUNB 5ETUA 1N6VA 1TITA 1BEYL 1S5IH 3QEQA 1RUAH 4U3XA 1NGWB 1CBVL 5EDXA 5DHVH 4KI5F 5SX4H 2GSGB 1VGKA 3ARDC 4X4YB 4NO3B 2AJVL 3SDDA 5B38G 1A5FL 4CW1A 1FVEB 4D0CB 2YD1A 1TZIB 1ZLSH 1BP3B 4U2YA 3RY6C 1INQA 3AREC 4I0PC 4NO5A 3QEQE 3BEWA 2I5YH 1WIPA 3GI8L 4Y5VB 4TUJA 3DIFB 2EH7H 2VDKH 3LRSA 3P4NA 1G1CA 3O4OC 4JVPA 1X5FA 2UWEB 4HIEB 4L3CB 4GJTB 2FEEL 1L7TH 1WAAF 1VFOA 5D96C 3UTSB 4Y1AA 1KN4L 4RFNB 5EU7C 3S34H 4KK9C 5HHNA 2H8PB 4L4TB 1ORSB 3UPRA 3JWNC 1R24A 4XP1L 1CLOL 1CDIA 2IAMB 2HMIC 4MJ6A 2FZ3B 4OFKA 4Y16D 1T21A 4YWGH 3VFRB 5FM4A 5MEQB 3SE4C 1NQBA 4GAYB 4Y1AE 5DYOA 3EKCA 3LB6C 5GJTH 1UZ6F 1RMFH 4P2QD 1HZHL 3BIKA 2IEPA 1MQKH 4NT6A 4O02L 3WEXB 1NBYA 5I15H 1YN6A 4OT1L 2OS7A 3ARBB 1KF9B 3DNKA 3NPSB 3QEUA 5HHQB 3EOBA 3RHWK 1AO7B 2H26B 5I17B 4J12A 4PJCB 3SBWC 4NDMA 2HJKB 3DARA 2GW5A 5HJ3B 2W91A 3L95B 5L8JB 1XGUB 2ZKHL 4OD3L 1KUMA 3PL6C 4LCIL 1CFVH 3MRDA 5KZCB 1XF2B 3RIFK 5TPWL 4ZAKA 4M9OA 2VAJA 3BPOB 5FDWA 1TFHA 1U58B 2YD8A 3O3EA 3QBTB 5LVEA 1DBAH 2OR8A 4YHKL 1K2DB 1DVFB 4QY8B 4FFYL 4P4RA 4PV9B 5H35A 4O4YL 5KSAD 1S7QA 4ELMA 1IKFH 1EAPA 5A2IH 1MFBH 3RKDC 3MRCA 1I7RB 3FT2A 1EHXA 2ADFL 1CGUA 3S37H 4UT6L 5KVDL 1XGQA 1TETH 3EYOA 3BGFC 3UYOD 4YPGB 3VFGL 1FL6B 2AVGA 4JFQA 4WRLA 3SOBH 4F9LC 4LF3B 1NC2A 4XP4H 5EUKB 4ELME 1Q38A 3T77B 1MHHB 2NY4C 1OGAB 4JG0H 2A73B 4XXDA 3CX2A 4OLUH 4EBQL 5I8EA 1QFWL 4NKQB 1TXKA 2A6IB 3L5WA 3WE6A 2DQJH 4Z7NE 3K80A 4KK8D 4NRZA 5JPMB 2VLRB 4PGCA 2YHGA 4PJEA 3IU3A 4TVPH 4LLYA 3TJEL 1OT1A 2FLRT 2W65A 4L8CA 5E00B 1FZJA 3PNWA 1I3GH 3FB5A 4K7PH 5DK0B 3QHFH 4FABL 3PP3H 3N1MC 2FH6A 1UENA 4JJ5B 1I8LC 2KQMA 1HHHB 4PJEE 4PJ8B 1A3LH 5E7FA 2G9HB 1QO3A 4ZQKB 3G6AB 3WIFA 1JWSA 1S5IL 4OF7A 1FAKT 5D1XD 5DEFB 5LXGH 1RUAL 1AR1D 3LKQA 4XPAH 2HT2D 3W9EA 3TN0B 4RMRA 2VWEE 3VH8G 3RY4A 4NCC2 2V7NB 1ZLSL 5IR1B 4WHDA 3TA3C 1H3WM 5HPMA 1KIPA 4UT9H 3VFOA 1HINH 2CGRL 4HUMB 2HJLB 1WLHA 2EH7L 2VDKL 4Z7VF 1LWRA 4RGMB 5ICZA 4OD1H 1S9YA 4Y2DB 1GZPB 4XP5H 2HT3C 2D31A 4P46D 5IBLD 5ILTH 5CEYB 4LSUH 1IKNC 1CICD 1L7TL 2JCCB 1U3YA 5IW6A 1R3LB 3S34L 1A7PH 1U8NB 2A6KA 4JANB 1U8LA 3L5JA 3QQ4B 4K7PY 1FL3A 5T1KB 1CGYA 4Z0XA 2QEJA 4OM1H 3LEVH 2DB8A 4POZC 2GJZB 5GS1A 2VLKD 1UH3A 3VFNB 2ZP0T 4YWGL 1K3ZA 1RJLA 4NO2B 5EO1B 5EZLB 1EEQA 1J9CT 3MROB 3DXAD 1DSFH 2GT9B 3MGTA 1BPVA 4M02A 5EU5B 2VJXA 3RJQB 5GJTL 1QRKA 2EC9U 4JN1H 3G5VA 3VXME 1MQKL 1SJXA 4ISVB 3ARGC 3QH3B 4PJHE 5I15L 3O41B 3F7YB 3GMRA 1LD9A 3JV4A 1I1YA 2OL3A 4GRWB 1Z9OA 4DKAA 1ZVSA 1QP1A 4Y4FB 3BVNB 1FG2B 1KJ2H 3ZKNC 1G9EA 4BH7B 2XZCH 4GG8B 3GM0A 4X99A 4TNWK 3V6BR 4MDIA 3CX5J 3MLRH 4QXTB 5C8JB 1CFVL 5CIPA 3WHE0 1IAIH 1XF5A 1NCDH 1QLFB 3MBEC 2JCCF 3TO4C 1B0RA 2DQFB 5J0BA 1E4JA 1F11B 3HRZA 4JFEB 4F7TA 4NQDD 4AEEA 1CLYH 3N85H 1ZGLM 1OOAA 4HPYH 2J6EA 1P6FA 5CJQH 3MRJB 1IKFL 1MFBL 4U1KB 4HZLA 3MV01 4OCSH 5D7KD 4JY6B 1Q0YH 1AQKH 4C56A 2G2RB 5E03A 1P1ZB 5ESAA 3S37L 2CUIA 2I26N 1HQ4A 1BMGA 1TETL 5K9OA 4AH2A 3PHOB 2QKIA 1RUMH 5JW3H 4PJ5B 4GBXA 3GSRA 1WFUA 1RJZB 2BSTB 4HK0B 3SOBL 5HHPA 2ZJSH 2BNQE 4XP4L 5JIIA 1NCWL 2HFFB 1EV2E 4GRWF 4PJ9C 5IESH 1BJMA 4JG0L 4Y5YB 3VFWA 4C56E 4OLUL 1MPAH 3MV9E 4JO4H 2VQ1B 3RNQA 3MRKA 2DQJL 3BXNA 2L7UA 1CGTA 2YUZA 5DC0A 4NSKB 1PX3A 2EDNA 1GH7A 2D4FA 3J8F7 3ZDXE 1INQB 3VXRA 3DO7A 1CD8A 1IEAA 3FT4A 2R0KH 4PBVC 4XMLH 3MBXH 3NGBC 1I3GL 3GSXA 4NP4H 3V5HA 3QHFL 1OB1A 3UXFA 1NFDA 4JAMB 3PWLA 4W4OC 3RDTD 2NXZC 4MA7H 1I9RH 4M9PA 3V6OA 3QXTA 3WIHA 1YEEH 5HHXH 1A3LL 3BRFA 1UJ3B 5MEOA 1BOGB 1NC4D 4QGYA 3WN5C 3JTSA 4O58H 4ZFZB 5DQDH 1QKZH 3U79A 3NFNA 1IGJB 5LXGL 2JK5B 4QLRA 4XPAL 5ID0A 3CIQA 1CGXA 3UPRB 1NFDE 1R24B 3KLAB 1H15B 4BZYA 1Z6JT 3V6OE 3W0WA 3H7BB 1I85A 4DZBB 2CXGA 4P23C 2BSRA 5BS0B 5F1IA 1IM9A 5B39B 3NPZB 4TYUA 5D72H 5DI8A 4UT9L 5FK9B 1H3XA 1HINL 1EXUB 5HGAB 4ZPTA 4Z7WA 2HRLA 1XCQA 4G8EB 2B4CC 4NT6B 4OD1L 3VWJD 4XP5L 3TZVD 3EYQC 4P99A 3AM8A 3OKOB 1NFIA 3LQZB 1FFNB 1CLZH 3FO9A 2YD3A 4HH8A 5ILTL 4LSUL 3WJLA 3RWHB 3JSSA 1MFAH 2Y7QA 2UZIH 2OI9B 5F88B 1A7PL 3DETD 1VHPA 2X4PB 5LGHH 1I7TB 1B4RA 3TT1H 3T0AA 2BC4B 4OLYH 3OQ3B 2DBLH 5DQJA 1IGYA 1HILA 1W72B 4MXQC 3LEVL 1HQRB 4WW2C 4FQXD 5EZJA 5DD3H 3A6CH 3QISA 3S98A 1ZOXA 1FO0A 5I8CA 5HPOA 1DSFL 4Z6AT 4ZNCD 1FZOB 4L8SC 2XKUA 3QG6B 3KWWA 3B43A 1KB5A 5C92A 3LY6A 5HYSG 4RISH 2MWCA 1UJTA 1IGCH 2V5TA 3DGCR 4U4BA 3CU7A 4XP6H 1WQVT 5J89A 1V3JA 5F7UA 2Q7YA 4FHBD 4J3SA 1KJ2L 3ULUH 3PABB 2EDRA 2XZCL 12E8H 1YY9C 4H26B 1WEJH 3GMPB 3HAEG 2FJGA 3MLRL 3WXVH 4KKAC 1IAIL 1WBZB 2VDQH 3BN3B 1NCDL 4F33A 4ALAH 1PVHA 4AEIH 4X4XA 3DX7A 4HX1A 4JPWH 4N9OB 4ZOCA 5I8EB 2EKJA 4G6KH 5IHZA 1CLYL 2BOBA 3N85L 2GITA 3MUZ1 4HPYL 2P7TB 5EULV 2YUWA 1VACB 3QHZL 5CJQL 5DD6B 2YC1A 5IQ9A 5MEPB 1I4FB 3IJYA 5CGMA 4P4KD 4OCSL 3CX5K 3PNWB 5DMGC 3H9SE 1Q0YL 1KLGA 4HHAA 5HI4D 1HSAB 2BY1A 4HUWA 4L29A 5IVZB 3KPPA 1H5BB 4OQTA 1IRAY 1RUML 3EDEA 4JPKH 5JW3L 4RAVB 5D93B 4QHNA 1BVLA 4YNYB 3HR5B 3OR7B 2ZJSL 1J0IA 3AU1B 3K1DA 3CCHB 4ELMF 5FECA 4M7JH 2F53D 5IESL 4TRPH 2FO4A 4JDZB 2A74B 3X12A 1MPAL 3O6FA 2AEIT 4JO4L 4LGPB 4X5LA 4MB3A 1UC6A 3BP5B 2XZZA 4Z7NF 1YEHH 3MTRA 1P7QB 2VB5A 1L9MA 2YA2A 5H8DA 4GSDH 5LGJB 1BQHA 3G6JE 4I5BA 1LP9A 3FQTA 3RVTC 2VQUA 4XMLL 2R0KL 3MBXL 3ARZA 4NP4L 5IEKB 3ES6B 4LRIA 5ICZB 3L5HA 2WIIB 2XYCA 4NBYB 2NYYD 4JFHE 4NQCA 4NUJB 5CD5D 4MA7L 1I9RL 2GIYA 1RU9H 1T04A 1YEEL 4QRRB 4PJEF 1I1CA 1LP9E 5E6IA 4O58L 1QA9B 1A14H 3IU4H 4FXGA 2FX8L 1QKZL 1RIVH 4MD0B 5ACZB 1VKXA 2F58H 1AKJB 1R3KA 3WLBA 5D7IB 4WI3A 1BD2E 3VXMB 3Q5OA 4NQCE 4PJHB 5T3ZD 2DDQH 1VADA 1P9MC 5GS1B 3NN8A 3ZE0E 3E2HC 5D72L 5FYLH 4IOSD 1J5OH 4QTHB 3MGTB 1WT5A 4JVWA 1ND0B 3MRLB 4U1LA 5KSUA 2VC2H 2Z0BA 3I9GH 1JPGB 2YR3A 2MJWA 3WKNA 2OJEA 4PLJC 4PB0H 2Q3AA 1QRND 3U6RA 3GMRB 3V9FA 2NW2B 4EI5A 5F7EH 3JV4B 1Z2KA 2OP4H 1MFAL 2OL3H 2YZ1A 2UZIL 3MRHB 1F6LL 1NJ9B 3RI5K 3HE7A 1MELA 5LGHL 4M7LT 3TT1L 3V4PH 1XR8A 4OLYL 2VDPH 2RR3A 2DBLL 4MDIB 4N1CA 1FFRA 4P49A 5EA0H 3FO2A 5CIPH 5DD3L 3GJEB 3A6CL 4KV5E 3FFCE 5J13B 2WBKA 3D69A 1LGVA 2XTJD 1LO5A 1G7HA 4JHWH 2EDYA 3VGAB 2H2SD 1EAJA 2DM4A 2VN4A 4XBGB 4YE4H 4APQB 2WY3A 4E42A 4CDHA 4X7CC 5C6TH 3TBSB 1WZKA 4PJHF 3C09B 4RISL 2IPTH 2N56A 3TNNB 2BNQB 1IGCL 4NQEA 1G0DA 4OTXH 4D3CH 4RFEB 1I1FB 4XP6L 4G80A 1T1YA 2APXA 3ULUL 3C2SA 1RSFA 3MV9B 12E8L 1WFNA 1WEJL 1OSZB 1SMOA 2P24A 1XT5A 3C5ZC 1HXYB 3WXVL 2BSED 4MB5A 4CN1A 2LV4A 4ELKA 2VDQL 4ALAL 4NQEE 1X4YA 4AEIL 3C5SA 4FQHB 4AL8H 3BKCH 4JPWL 3U2SB 5EN2B 1ZXQA 5I71B 1LO2H 3SE3A 3ZHDA 5B3NA 2DAVA 5FUOH 2CJUH 1P5UA 4YK4B 4YEEA 1M71A 1C5DA 3ALXA 4Z0BH 4OF6A 3SY0A