3LKOA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1934 strain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lkoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lkoA01
1SVCP 1XGUB 4GBXC 4QXWA 3T3ME 3GKWL 4N8CL 3B6SA 1SM3L 4KTDH 3QDMB 5E2VL 2EIZA 2CGRH 2VDMH 4ZS7L 3WNKA 3LKNB 5FYKE 3ZTNL 3MLUL 4FXKB 3PHOB 4GG6B 4FXLA 4AH2A 4Z95H 5D9SB 1EEYB 3GSOB 4HFUH 1CK0L 1IC1A 4Y8DC 4J8RB 1KPRA 1Z3GH 2XWTB 4MXVE 4QF1B 4PRAB 3WYRA 3GUTA 5E08H 2UVFA 5DJAA 5E8EB 2AI0L 4PRNA 1G7QB 4D3CH 2UWEB 3HCVA 4PJFE 3PNWB 4O51B 4P3DA 1UEMA 2WY3A 5C0AA 1TTGA 1DQMH 1KB5L 2AI0H 3KPLA 1OP3H 4F7TA 1U6AH 3D3VD 1NAML 5C0FA 2Y72A 3RZWA 4YAQA 4H26A 2AJVL 5JPMB 3VFTB 1DBAL 2P24A 1HNFA 1U6AL 4P2QE 4WHTA 3EOAA 4QXTA 3GSNB 3L95B 1I7TB 2R29H 1FZKA 3VWKA 5JNYB 3MR9A 5EU3B 1QLRB 4M03A 2ITCB 2C3HA 5DA4A 4NZTH 3HG1E 5EU4A 3GJEA 4GXUM 4UQ3A 5ERWB 4WV1A 2E9IA 3QNXA 1J0IA 4M8QA 5DI8A 2IANA 1S7XA 3F12B 2NX5E 4JDVB 4ELKA 4P9ML 1F4XL 2VDRL 4Z7UB 5T1KD 4HUVA 1S7WA 3MJGX 4BFIB 4KPHH 4S1SL 3TO4B 2F8VA 5F1NB 1B2WH 1N0XH 4LLVB 1R3IL 2Z4QA 4M6NH 3MNVB 2GK0A 3FB5A 4S11A 2FATL 5F7NC 4O2CB 3WE6A 4XPHL 4JQIH 2W9EH 3PV6A 4L4VE 4G8IA 4XHQA 1PGRB 3RRQA 1R5VA 2E6PA 1L0QA 5GS0H 5CLWA 2F15A 4WI2A 3SOBL 5INDB 4RBPK 5KVFH 1ZXQA 1OSPL 1MNUH 1AP2A 4FFZH 2O61A 2DTSA 3FKUS 3U9UA 3V9FA 3MLXL 1G6RH 4NHUA 3GDBA 3VDCA 4ZD3L 1JGLL 3MBEA 3QWRD 3U0TA 2QSCL 2EIDA 4WO4B 2G2RA 5E9DD 5J6HB 4EXPX 4NHCH 2X4OA 1IMHC 3EO9H 3OWEA 3L6FA 1NGWB 3QO1A 1I3GL 3MO1A 3W0WE 4F58H 4N0CC 1EUTA 2X44D 3E2HA 3WFBH 3ARDC 5EU6B 3U7YH 2B4CL 5I1KH 5JDSB 4HQQH 4NRYB 3HAEB 2YD8A 3QEQD 4MAYB 1NKRA 5T3ZH 1NLBL 3TC9A 2Q76B 1R0AH 3KXFE 2Q8BH 2VABA 2BOBB 4YPJA 1EJOH 1QQDB 3VXOA 2GIYA 2R1YB 4HS3A 3OHXB 4GRLB 1BP3B 1OD7A 3I85A 3HC3H 1GXEA 5T1MA 2YR3A 4WIQA 2I5YL 3MNWB 3KLHC 3EGSA 5JORB 2I9LA 4JFDE 3QDMA 3K0WA 3L3OA 1OP5K 2YC1A 3KDMA 3M45A 4LGPB 5J13C 5KVMC 4K7FA 3O4OB 1TPXB 3P0GB 5CJ5A 3QWOA 1BVLB 3MRKB 1PAMA 1NMBH 2IALA 5DRXA 1UM4H 5F8QC 5I73C 2VQUA 1XCTB 1AXTL 4OV6F 1XH3B 4NWUH 3C09C 1RU9L 4XRCA 2VAAA 1KLUB 4JFDD 2DD8L 5DHYB 5CP3H 2HRPH 5C92A 3VH8B 4LHJB 4PYHA 5BRZA 3TO2B 1FZMA 1RK0B 4FMFA 1SJEA 5FUZL 1PG7L 1D7FA 1UH3A 2DD8H 1I3RA 2MWCA 1F3DJ 5C07B 5D7KE 2GTWA 2NY6B 4KWUA 4RQQB 3MOQA 1U36A 3G08A 1MFCH 1JZ2A 5DD1L 3WFHA 2JB5L 2E7MA 3NH7L 1AO7B 3KPPA 2BVPB 1QTYT 3WCYA 4WDIA 2Z4QB 1ND0B 1OTUC 3VXSE 3RWGB 3QEUB 4BSJA 3SDYL 3BXNA 1X5KA 4GW1B 2Y25A 4H8WH 4JR9H 3OKKB 3KPMB 5EG6C 4N90D 4G5ZH 2WAHA 4N8VG 5DD3L 4JFQA 3LIZL 3D3VE 3FB6B 2KUTA 3OB0K 2ZOLA 4S0TD 1GGTA 3PP4L 4NFCA 5GRUH 4TVPH 1VFUA 1AD9A 4B7LA 4ZPTB 1CFTB 1OHQA 3BQUC 1R5IB 4Q2ZA 1XGQA 4YAQB 4IJ3B 4XX1G 2XN9B 4P2RE 3SOBH 5BW7C 4HDIB 4K94C 2AS5M 2Y9RT 4LVEA 1IGCH 1T3FA 5E7BA 4BSWA 4QRRA 4FQHB 5JXEA 1L4IA 3INUH 2QADD 2VC2L 3CSYA 3BD4A 4QRRB 4O4YH 1J0KA 1U8NA 2ZNWA 1DN2A 4OD3H 4OF3A 1INDL 4A6YL 3H6JA 2V2TB 2GTZB 3B2VL 4PV9B 4O2CA 5IT2H 1NC4B 1FRGH 4MMXC 1A6AA 5MENA 4WO4A 4I1NB 3ROOA 2Z93A 4LEOB 1I85A 1U8IA 3TA3B 5T3XD 1RUMH 3I2CL 3LQZB 3SKUD 3O11B 1E28A 5DQ9A 5I18H 4LMQE 3WFDL 2AJUH 3DURA 1CI5A 5CJQH 3VFUB 5FHAL 3S37X 1T0PB 2ZCKL 2V5TA 4YFLI 3SDDA 2IGFH 4QGYA 2Q7YA 2ZKHH 3VDAA 1JNNL 4NQEE 4WHTB 3TJHD 1N3NB 1N7ML 3BZFA 1GOFA 4MNGB 3MRKA 4ONGL 3EOYG 4GT7A 5TH2A 1RULH 4OZGE 1OAKH 4XB7A 4J3VA 1IGFH 1F4XH 2VDRH 4YFDB 5IBTL 4FQLH 1AGDB 4TQEH 4PYGA 3X3FL 4AENA 5E5RB 4DCQA 2JELL 2I9LB 4Y1AD 4UOW0 2ARJQ 2BSRA 2BMKA 1IC5H 2GSGB 3D39B 4Y16B 1FVEB 1GGBH 4LSDA 3ZHDA 4LFHG 1KBGL 2J1KA 1HNGA 1F58H 2Q3AA 3H8NA 3QUKB 3QFJE 4H1LH 4KKAC 4NHCL 4X9HA 3DRTA 4XP9L 1PKQA 1KT2A 1SBSH 3B2UD 4TUOA 3BGMB 4WV1B 5EC2B 5I74B 3RWEB 3OAUH 1NFDA 3O3BB 2AKRA 1SBBA 1MLBB 4MHHG 5EBLA 5CS7A 2FR4B 4QEGA 3IFPB 4LCYA 4OZFB 4L8CB 2PO6B 3OB8A 2BY1A 4GAFB 5IB1A 1IGJB 1J05B 3I50H 1AIFA 1I7RA 5BMFH 4QHKI 1CFSA 4HLJA 4JJHA 2NY0D 3EW3B 4OBRA 4Y19D 3QDJA 4X7TA 1S3KL 4OFDA 3IKKA 1VPOL 3CDFA 2OJEA 1R3KA 4P2CG 3EGSB 2VLLB 4XPTL 4LRIA 2X7LB 1A22B 4JFFB 4OFYA 3GSVB 1F11A 4WJ5A 3O6ML 3MLUH 4RAVB 4X6FB 1UQSB 3OAYK 4N5ED 1DTUA 2FSEB 5D7LE 4X6BA 1EMTH 15C8L 3H7BA 4FQ2H 4KPHL 5I18L 1U8PA 5FCUL 1P69B 3VRIA 2EKSA 4G3YL 2IGFL 5I1JL 1YN6B 3D39A 4D9LL 3MOAH 2UWEE 3VWKD 1F6AB 3BP6A 1MIEL 1N7MH 1ZT1B 3K1KC 2D2OA 1HXMB 2AEWA 3MX0A 4GFTB 3O45A 5KSAA 3UEZA 2SEBB 5TFSH 3LRGA 3RUGA 4JG0L 3IGAA 3BD3A 4XCYA 3SCMD 4FN0A 4NQTA 3VWKC 5H35A 3HUJF 3EFFB 5L9DL 1A7BA 1MSPA 2Y5TA 3RVUD 3IKCA 3MRIA 2XKSA 1INDH 4RWHA 5CEZH 3GZKA 1E28B 2APWA 2X4SA 1W0WB 3QFJB 2DWEB 2VAJA 3VFWA 1HHKB 3CFKA 3OMZA 1P5VA 1UT9A 5IV2A 1NBYB 3PHQA 3RA7L 2HT2C 1BGXL 1KXQE 1FPTH 1FYTA 2F53D 5EZJB 5MENB 1IGML 3V0WL 4OTXH 4LDLB 2HT4C 3SDDC 2BCKB 4WWKC 3C6LD 1RPQA 5TE7H 1UG9A 5J0BA 3DVGB 1BVKA 2YPLD 5AUMA 1MHCB 5KOVC 4M1DH 2EIBA 5ANME 1ZLSH 4XNZC 3FT3B 4HC1L 4KTDL 4XWGH 5L2KD 2IAND 3TCLA 1TIUA 4X5LA 4X4XB 1SYVB 4OCMC 1P4IH 1ERNA 1S7XB 3F12A 4YDJB 1GOGA 2D3VA 2LU7A 4PLOB 5GRJH 5FYLE 2APFA 3WXWH 1KG0A 2VZSA 3W11C 4OV5B 3HE7C 3DVGA 1R3HB 4G7VH 4WWID 2JIXD 5EUOB 2DQGH 4L3EA 4PJIB 2MCPL 1A21A 5IK3B 3WXWL 5GGQH 5SX5H 3MBEC 3AVEA 4N0FB 3C60B 5DHVA 4I0PC 4OZIE 3P4NA 3PGFH 1QLEH 1QHOA 5CZKA 3PL6B 3RGHA 4KMTH 2AEPL 2UY6A 4MXQD 2D7MA 1J8HE 5C0AD 1JCKA 3QDGA 1K8DA 3V0VB 3R8QA 1RU9H 1A7QL 1BIIA 2BNQA 5FYKU 1G9NL 1EHXA 3AC0A 5DD5L 4I3GA 2J12B 3C8KA 1RZ7L 2YEZA 2XKNB 4U1KB 4WFHD 5HGAA 3TNMB 1KULA 2EH7H 2WINA 3HB3D 2E7LE 5IOPB 1CZ8H 4I2XB 4WW1B 1X5GA 3SGKC 5HHPB 3NFNA 3L3JB 4ZUTA 3TO4A 3KYMB 3EDEA 3S35H 2DI8A 3FT2A 4U7MA 1WV7T 3TF7A 1A1NB 1DE4A 1NJ9A 2BJML 2K7PA 5L7XH 4NJAH 3R8BB 2GJ6B 4UT6L 1FH5L 3D39D 1L7IH 4KV5E 4KHTH 1M7XA 4LKCB 4Z78A 5FUOL 3VXTA 4PGCB 4MJ5B 3KWWB 4POZC 1JFQH 1NC2D 4QRSB 3RVXD 4E41A 4MX7A 3LMJH 5SWSD 4CL7A 3CDGB 4NO3A 1RD6A 1ZOXA 4YJZL 3ZYIA 5EU7E 3OKDA 2AK4E 4D8PA 2ICEB 1P4IL 2ZUVA 7FABL 2YC1B 4JRXA 5ALCL 5TQ2H 3S34L 1ZSDB 1NDGB 1YYLL 3FL7A 5CIPB 4MX7B 4CGTA 3MYJA 3VXRD 4APQA 1WVZA 2DI9A 3QIBD 1HK6A 3NN8A 3TT1L 4L8DB 4ZFOB 4NT6B 1F90L 1QR1A 5FUCE 4K07A 2OL3B 1HZHH 3HC0A 1NCCL 4MS8A 4R96B 2CDEB 4Z0BH 3BW9A 4GAGL 1KUMA 1U3HC 5TGBB 4NSKA 5DJ2A 2DICA 1OAQL 4AEEA 3HRPA 1X5XA 4LDOB 3BJ91 4PRHA 3D3VB 4F3FB 2B5IC 3FQNB 2Z92A 3FO2B 2MHAA 5I71B 4QY8B 1B0GB 1S9WB 3DO3A 4HUKB 5HYJA 4L3CB 4XMPL 3Q5YA 5ENWB 5I66A 3DJ9A 4XNUH 1OW0C 4E41B 4LAQH 4NZRL 2VN4A 2X41A 1S7QA 3RWCA 5JHDA 4X98A 5DD6A 1FG2B 4NRZB 4CU7A 1T20B 1U3ZA 1S7QB 1JZ3A 5JO5B 1NGQH 1B88A 4HIHB 1P84K 5DURD 2A6JA 1NGPH 4FQ2L 2NLJA 4PB9H 1DLFH 1JNLL 4DKFH 3RGVD 1P4BL 3ARWA 1BHGA 1K2DA 1NKOA 2D31B 3OV6A 4ELMB 3CX5K 1OSZA 2H8PB 2V5SA 5JOFA 4LCIH 3ORJA 1I9JL 4XAKE 5I17B 4OGXL 3OAUL 3RZCB 3KS0J 4WFEE 4ELMF 4ZOEA 2MPAL 1ZHBA 4I77L 4PJAE 5DFVC 3DSFL 1BQHB 5AUMB 4K9EC 2NW3A 3VE0B 5F6HI 3EYUH 2ATKA 1U92B 2UUDK 1F90H 3BPNB 3V5DB 1D6EA 1F3DH 4EVNA 2Z8WC 3RGVA 4MSWA 4Z77B 3F6IA 4OLWH 5D2LB 1XIWA 4X7SL 5E2VH 4ZS7H 3IETA 4K9EL 4J7RA 5F7WC 2FEDC 2VXSL 1A4JB 2CPCA 1JBJA 2R0LL 3HI5L 3O9WD 1FAIL 1MWAH 5DD3H 1XGTA 4K7PH 1CXLA 1CF8L 4ZFZB 3X13A 1U3HA 3RAJL 3D69B 2FD6L 2BZDA 5F7EL 3KPMA 1N5AB 1ZK9A 3D5OF 5E6IA 5DJAB 2F5BH 4PJ9C 2FX7L 4MMZC 1MCOH 1IL1A 4LAQL 1FO0H 2YA2A 3HMWH 1VSCA 1KXVC 2YK1L 4HMEA 3QXVA 2CUHA 3DXAE 3QCUL 3SGJC 5DR5H 1M05B 3H2WA 2V5YA 2A6IB 1B3JA 2HTKC 2VZVA 3ARGA 3MODH 1H5BB 1F3JA 1RJLA 4OCXL 4KVNH 4CW1B 2BNRB 1IEAA 3SQOL 5BRZB 3HI6L 4LGSB 4WFED 3T2QA 3D6GA 3B3IA 1WC7B 5HHOB 2OK0H 2M26A 3UBXI 1LNUB 1KCGC 2Z31C 1HZHL 3UTQA 2ADFH 4BZ1L 4MA3B 5ESVB 3CDGA 4FS0A 2BNUB 1B0GA 1S9WA 1WQVT 4U1IB 2O5XL 1P1ZB 1IAOB 2H2PD 4Z7VE 4HPOL 3TBTB 1TZIA 1I7RB 3QPQD 1TJHL 4LQFL 4F80A 1D6VH 4I18B 5MHSE 4F7MA 4NQDA 3DI2B 4XVUD 2B0SL 4I0KA 2XY2A 5INCB 2BX5A 2W60A 4R4BA 5IJVB 5IW1A 4HWBA 1XF2A 1I8MB 4FTVB 4XWGL 1YZZA 3LKRB 3KAAA 1R3JA 3OX8A 1T5WA 3P73A 3EJJX 2DOCA 3C8KB 4DZBA 5F9WC 4E42A 3QCVH 1HSAA 4XWOD 5EZIL 3EHBC 1OAZL 2A74A 1T7XA 5AAMA 5JW4R 1BF2A 4UV4H 1EFQA 4XPGH 5C09B 5IQ9A 3NBNA 4NQSA 1S9VB 1IEAB 1CYGA 1OL0A 3QYCA 1AJ7L 2BNRA 3RWJA 5BV7H 4NBXB 3BP4A 1KJ2H 2B7DT 2P45B 4XMKH 4NN5B 1BPVA 1J8KA 2DTML 2Y6SC 4TSBH 3BAEL 4PJ9A 2HTLD 1T0MA 5FM8A 4JZOB 2JJTA 4Z77A 1S7TB 2J8UF 3VMOA 4UT7L 1NCUA 5I1IL 5ADOL 3I75A 3U46B 2R9HC 1G9NH 3DXAB 1MHEB 1J8HD 3EIFA 1NGZB 2HFTA 4JFYB 3IAQA 4P2RB 4U31A 4GMTL 2LTQB 4PJIF 2QQLH 1WAAE 1C08B 3L3DA 1N26A 1D5ZA 4QXGH 4M7LT 1ZLSL 4B5EA 2P44B 1XR9A 3AROA 3CFEA 2R56L 3GI9H 2FWOA 1G7PB 4QRRE 2XZCL 2DM4A 5CD5D 2BCKA 3L7EA 3WKMH 4JAMB 4OD1H 3SKOB 4OFKA 3STBA 2X4UB 4OCNC 1G1YA 2BVTA 4EN3D 5CKGA 4O5LL 2BNQB 2DIAA 2L4OA 3I6KA 1VEPA 4CNIB 5DMIL 3HI1B 3BISA 4OZIB 1ONQA 4XCFH 4HWUA 5K9OB 4TSBL 1CXEA 3OJVC 3LH2L 1H0DA 2GFBA 2VLRD 4PP1D 2ATPA 3OL2A 3ZDXE 1CFVH 4L9DA 4N5UA 4MWFA 3QXTA 1IKFL 1IZJA 1SHMA 1T6WA 1YEFH 4NN5C 5JNYA 3WHE1 5GGTL 1U8JB 4I3RH 1VERA 4GKNB 4Y16D 5IK3A 5CEXB 4RZCA 4TN9A 1WCQA 4A6YA 3GJFB 1FN4A 3DIFA 3TBWB 4KRNA 5GS0D 2C1PB 3DGGB 3K3QA 3CMGA 4MJ4A 4C56E 3WSQH 3V6ZA 5T3ZD 3U0PA 1GC1H 3BH8A 5CD3B 3V4PH 4X5WB 5F93C 1GJIA 2IFGA 2P43B 1TVBA 1G9ML 3M8OL 3V52L 1J7VR 5D71H 1A7OH 1H3TA 5F9AC 1FAIH 2Z91B 1K3ZA 2WM0A 5AZEH 1LE9B 1HN1A 1MRFL 4LDEB 3UTSD 2A77L 2H2SD 1VACB 1KTRL 1PG7X 4KXZH 3DMMB 2R4RL 4DEPB 5HYJD 4FABH 3PHQB 5ICXA 2A83A 5IBUG 4Y16A 4OM1H 4Z5RB 5ISZB 1CGXA 1OQXA 5D7JC 4J1UA 2E9WA 2W38A 4RRPA 3V95A 3IJHB 2ZZUT 5D72L 5D8JL 1MQ8A 2I07A 2V6HA 3HB3C 3UBXB 3ZYOA 3PWLA 4PRHB 2ZUXA 3SDCB 4IDJL 4F57H 1Q72L 3JWDH 4WY7L 3RWIB 3MLSH 2VLKB 4K8RH 4HGMA 3RNQA 1YMMA 2J8UE 3OX8B 1C5DA 4GJTB 1KCKA 4NFDA 4K8RL 3X11A 2AJ3A 1A7RL 5JQ6L 4LKCA 1BBDH 4MLIA 2X4TA 4TTGA 5KVEL 3VCLB 32C2B 1KC5L 5F3HA 3MROA 1KELH 1CIDA 1UWEL 2XNAA 2Z93B 3ESUF 3VCLA 3LEYH 3CFCH 3JWOC 1JWSA 4JRXB 1TNMA 3O8XC 1FNSH 1B6UA 1XFPA 2BERA 4X6BB 1MELA 1N2RB 1AQKL 3EO1B 2G9HA 5EU6D 3TYGH 2J8UA 3TNMA 4ODUA 2NX5A 2QQQA 3HC4L 3BDYH 3QFJD 4JDTH 5F9JB 5KVGL 4XPBL 1KJ2B 3IDNB 2W0PA 1YEKL 4WTZG 1IM9A 4P4RB 3PDGA 4FQXC 4Y5YC 4TUKH 4HKZA 4JFHE 4H5SA 3C08L 1N6UA 1SQ2N 4Y4KC 3CFDB 1JGDB 3AU1B 4BQBA 2ADJB 3IXAB 4ORGA 5E8OB 4OGZA 1IM3B 3RBSA 5ITFA 1KEGH 1R5WB 3HG1D 4R90H 2Y7QB 4Q74A 5AWNH 1RUKL 3QHFH 3X17A 3VFRB 4RGNE 2ZOLB 2I60H 5DMKB 1R3HA 5BS0B 1P7HL 2AQ3A 1ZGLM 1WITA 4NGHH 1ED3A 3LS4L 3RKDD 5IFAL 5DK2A 3CLEH 4PIRF 2P8PA 3QEHB 1XF1A 3V79C 1C12B 4XP1L 4MQSB 5ALCH 3ARTA 3DROB 4WY7H 5KBNC 2LU4A 1GGCL 3T3PE 4U1LB 5ANMB 1E4JA 1E4WH 4NZRH 4WDIB 3GNML 4HXBH 4OJFL 5IG7B 1NMCC 5GSRA 4OFIA 4CMMB 4ODHL 2WBWB 4AEIL 1X5JA 4ORZC 4LVHC 1RZFL 3GI8L 4Y4HC 1UACL 4P99A 4UZGA 5IFJA 1Z9LA 3FQRA 1AP2B 1T2QL 2O61B 5C9JB 1J1PL 3QIUB 4PTUA 3P2TA 2XZAH 1KN2L 2A6KA 4WUUE 1KG0B 1SBSL 2DRUA 1T04A 1Q0YL 4YHLH 4WWKA 2ICWA 4DKEH 1I8KB 2WUBH 4CNIA 5HPMB 3BKJH 1QFHA 4MB3A 2X89D 1YYMH 4OGXH 2FO4B 3VFTA 1G7IB 3GMRB 3HE6A 1IAKA 2F58H 2DN7A 2ZCLH 5AD0A 3NFSL 1MI5B 4LSUL 5KSVA 2OYPA 3QJHB 5JW5B 1U42A 1WEJH 4Y19B 1UGNA 3VRLE 3VI3E 1MHPH 1A7PH 3EYOB 4WGWB 4LSUH 4K94L 32C2A 5F3HB 1H15B 2HWZH 4PRAA 3GUTB 3VXOB 3L3KA 1N8ZA 3HZYB 2GYSA 2JJSA 4JFYA 4XPFL 4FQIH 3PDOA 1RURL 4P9HH 2BSTA 1A2YA 3UJIL 2FEDD 2XYCA 1OTTD 4FZ8L 2H6PB 5D96B 4XVTH 2XZQH 4K7PY 2CK0L 4HBCL 5C08E 1Y18A 2XTLA 4RDQF 5M7QA 5JPMA 2VZ1A 3AAZB 4TNVK 1G6RL 4IRSC 1QBLH 3TNNB 1PQZB 2FECI 4GKSB 3UBXG 4P4RA 3DX9A 1RY7B 4XXCA 3F7QA 1RIUL 2EYRA 1YC7A 1MFEL 1ZVHA 3H3PL 4U3HA 4IRSD 4NUJA 4YX2L 1MCBA 2QSTA 3F7YB 2GUOA 3FOLB 3IU4L 1X7QB 5JW4N 3GMLB 2W65A 4IRJC 1U9KA 4C57C 2X4RB 5J4MA 3HNVL 5DQDH 5K9JH 1J1OH 4GG6A 4I8DA 4V1DD 1HEZA 2FECL 4LU5H 3JTTA 4Y19A 2DQGL 1NBVH 4MDIB 5I2IB 1UJ3C 1GSMA 3HNSL 4HBCH 1TMCB 4I3SH 43CAB 2FCBA 3O8XA 4X6CA 1S7RB 3MV9B 3CDCA 4MXWL 5IB2A 3PP3K 3T0ED 1MCQA 4TVPE 1QBAA 2XTJB 5E4EC 4V3DB 3MV7D 5DEGA 1EXUA 1INQB 4FTVD 2FR4A 4YBHA 4L3AA 1I1AC 2XQYG 4HKXB 3NACL 1TMCA 4EDWL 4ERSL 1C16B 4FQIL 3L3OB 2EC8A 1LQVA 1AHWA 5GGRY 5J9PB 1TTFA 1MCCA 5ISZA 1X4XA 3PP3H 1FLTX 3GSNA 1G6RA 5KZCD 1FVEA 5HHMD 4FXGB 5LGKA 3RZCD 4JN2A 5I76B 4UI2A 5A2LH 4MZ3A 3WHXB 4WCYL 2YD7A 3CC5B 1NC4A 3ULVL 2X40A 4FQQA 5F1KC 1KELL 1LP9A 4HPOH 1A6VL 4HZLA 5KS9E 4RFEB 2B4CC 4YQXL 4YHLL 1T1WA 3ZKQD 1AKJA 1YMMB 3QO0B 3VI4E 5AZ2H 4K3EH 3GMPB 1TJGL 4AEHL 1KTLA 2DL2A 1RZ8B 2MQCA 3MFFB 2Y06L 3IXTB 1NGWA 4P2OB 1Z3GL 3HS0A 3TZVB 4XXCC 2EDDA 1OB1B 4BQ8A 3SDAD 3AMLA 5F7EH 4YHML 1XR8A 3GB7A 5TF0A 2KQNA 4D9LH 5KVDH 1BREA 4BYHA 2BVQB 1G6VK 3TT3L 1Q9OB 1Z0MA 3RVWC 1NFKA 1MCEA 3GGWB 1CN4A 1JGUL 1JUFA 2F53B 1L8JA 2XIDA 3ZE1F 1FNEB 3W9DB 1CL7L 3WDHA 2NY7L 3QISA 3W0WD 3V2AR 3VWJD 4OI8A 2Y5EA 1F4AA 4MA1B 4OIBA 4PRNB 3IJSB 4HSQA 4M7LL 2P8LA 5HXMA 4GXVH 1AI1L 1UJ3A 4Z0BL 1MF2H 5C8JA 4R97C 5E08L 1UCBL 4JB9L 5CP7A 4M8VA 4DKEL 3WDIA 2PO6D 2VLJE 2WBJA 1FRGL 3QJFA 1FE8H 1S7WB 1RJYB 1T6VN 2CR3A 4UB0L 1FNAA 5GZNC 1I1YA 3UP1A 1FZMB 3DXAA 5D2NC 1BOGA 43C9A 3GJFH 2R2EA 1IKNC 1YEHH 3E6FB 2ITCA 5JHDB 5DRZA 5I9QB 1Q94B 1VEMA 3X14B 5F89B 3DV4B 1LK3H 1YEJH 1VESA 4O58H 1MH5B 2CKBB 2FJFB 4I4WA 3RU8H 4EIZC 4RRPG 5EUOE 4N68A 3O2VH 3SJVB 4F2MA 3R0NA 2FGZA 2BVOB 5KJRL 1NDMA 2XQBH 4BFEA 4E5XB 4OKVB 4TUJA 5F7LB 3NAAL 3UTPE 5IMKA 4PB9L 2DS4A 3GBMH 2I60L 3SO3C 4JM2D 5EUKA 2XNAB 2NY2B 5C0AE 1HXYA 1MCJA 1NCWL 3S4SG 5BQ7A 1MHHB 1YEFL 5EORL 5L2KA 2R1WB 2OX5A 3SGEI 5TJWK 4IS6A 3VFNB 4ISVB 1RVFH 4HWZA 1Y6NR 2CDGB 5CILL 1RZJC 2YPLA 1SEQH 2X2YA 3KPNB 3NACH 1N64H 1T5XA 1SY6A 1UB5B 2OR9L 4EOWL 3RVWD 1R5WA 1FYTE 1WSST 3LQAH 4YDVA 3BH8B 3MLRL 1H3UA 4F7PA 5CD3A 2AJVH 3VXRA 3LEXA 4JDTL 1ODAA 2VMFA 3H9SA 2XI9A 4G6JH 3O8XB 1P7QB 3VW3H 5I9QC 5D7IA 3WUWG 3QUYA 1A64A 1H3VA 2D4FA 3AFLA 3VJ6A 4WVRA 2PN5A 4GAGH 3EYSL 5BV7B 5DZLA 2J2ZA 2DMKA 2NX5B 5JOPE 4GS7C 1A14L 3KYAA 5E2TH 1JZ4A 4NCC1 1XF4B 1CIUA 5DQJA 5IVXA 1RI8A 4I9WE 5D1XB 2YUXA 1HH6A 4NP4L 1KYOJ 2IG2H 3QXUA 1CXHA 5I1DA 4KDTA 2VXUH 3ULUD 1DVFB 1KLFA 3MLSL 3LH2H 1U93A 1FVDA 1KB5B 3MJ7B 3O3EB 1UKTA 1LDPH 3QWRA 5D6CA 3HC3L 4JE4B 4WFGE 4Y1AB 1X44A 2MTPA 1BD2B 2XWJA 3D0VB 4P5KA 5ESAB 1RJZA 1ZHKB 1NBVL 2KH2B 5CEXA 2EDTA 3VD4A 5EWIL 3VI4F 1U8JA 3IDYC 1YUHB 4I2XE 1A6ZA 4ZPVB 2RFXB 5IB3A 3VFVB 3CD4A 3QUYD 1MHEA 2A6KB 5B22A 1T20A 2IPTH 3DGCR 2EYSB 3ECBA 2JJVA 2PW1B 3GBNH 5DA0B 1YN7A 3MRRB 2LAGB 4TOYL 5I8CA 2W9DL 1U2HA 1RQ5A 1HI6A 1JYNA 4GRMA 2FGWH 3QPXH 1U2CA 3SEPA 4Y4FA 2FIKB 2UZXB 3FN0L 1VKXA 1Q0YH 12E8L 4G7YL 2LVCA 4OQ1A 4MQTB 4GAJH 4YHYB 3TF7C 3QQNA 4TSAL 2BK8A 2R0WL 1MI5A 2G75A 3OXSA 4FG6D 4JVUA 5HHQA 4QHLA 4GW4A 1EEQA 3QI9B 5TDOA 4NO5A 2GCYB 4Y19E 3KLAA 3NFPB 3RVTD 3IU4H 2HFGH 4E9LA 3F8UB 3G6JB 2PW2B 4L29B 4OZ4B 2G75B 1MIMH 4PJXE 5EC1B 2V7NA 4S1DD 1KB5A 5TDNB 5JMRA 3NAAH 1EVUA 3DI3B 3OQ3B 2VE6A 5C08B 4XCFL 4D0BA 3QXAB 3CLEL 3L95A 2LE9A 4TNVF 2ED7A 4C83B 2R4SH 3OR7A 3HE7A 3WJLA 5BZWA 3B9EA 5IKCA 4S1DC 1KV3A 1NMBL 2J6EL 4D9QD 2PYFB 2BY2A 1IAMA 4PJ7B 1PYWA 4PJAB 5D2NA 1CL7I 2G60H 5FK9A 2H26A 2VLRE 1BQHA 2FBOJ 5EOQH 4HKJA 3U4EB 1AQDA 1G0YR 4PBWD 4Y5VA 5C0RL 5LGJA 4ZSOB 2I9TA 3NPZB 2DQTL 5IFHH 3U30C 3MUGB 3L7FA 2VLJD 3MLZH 2X6MA 5MEND 1F8TH 3HE7D 3VXTB 4AY0A 4PY8I 3WFHB 4RMTA 4MCYB 4PV8B 3JWNC 4F15B 2XZAL 2DJSA 3MV8D 1EAPA 1ZEAH 1FVDB 1JRHI 2JJTC 5CSBA 2YPKA 3P9MB 1RUPH 4IEFB 4HUMB 2E3VA 2ADFL 4BZ1H 2ZG1A 4I48B 2AP2A 2BC4A 4QRTB 1MLCB 4PGBA 1U8OB 1TZGH 2JB6A 1JGLH 5I16B 3FHQA 3EKCA 1ZWIA 4NBZB 4I13B 4U6VH 1GIGL 1A3LL 3C8HA 4Z7WA 4HLZH 4Q6IA 2VLKA 1YJDH 4JFHD 1C5BL 3O4LB 5C71A 4YLQT 4HFUL 4OBSA 5BJTA 2VXQL 1MI5D 4R2GC 5MI0C 5KVDL 1I1RA 2UUDH 3BPLB 4AK1A 3IU3A 4LVOB 1KB9K 4F7PB 1PY9A 4PRHE 2UYLB 1XEDA 1IEHA 3MODL 4WHYH 5A40E 2JJUA 1I4FA 4KAQL 5IBTH 3AS0A 4P57A 2PR4H 5FYLH 3WN5A 1RFDH 5T1DH 4Z7QF 4OF5A 5IHZB 5A2KH 2EICA 1Y0LA 2Z91A 5IGXL 4TUOB 1NC4D 2WUCL 3GSXA 4LCUA 2DJ4A 3NN8B 3S37L 5A3IC 2H32A 5L2JB 2WQRA 1SJHB 5B3JF 1OT1A 2E6QA 5FYJD 3RZCA 3QHZH 1PKQE 1G0DA 3WLBB 4NO5B 1PX3A 4Y4HB 3L3JA 4G9FE 5C0CE 2W0FA 4LPUA 5EN2A 4DGVL 3U6RB 3FQUB 2AXFB 4RMVA 5J6HA 4BQ9A 1JMXA 1REIA 4PP8C 2FHFA 1DQML 4ZSOE 3RKPA 4L4VA 3TGXA 3BX7C 1EO5A 2ZUQC 2EIEA 5DJCA 1JK8B 2MJWA 3C5JB 5E8DL 1WICA 3E2HC 1DANU 3QIUD 2M2DA 5GRUL 5CD5C 5DJ0A 1T66C 4HWEL 4AT6B 4IHOB 3BZDA 2W0LA 3PHSA 3NTCH 5HHNA 2FBJL 1CGVA 1ZT7A 5DJZB 1BWMA 1U8MB 2L0DA 2UZYB 1RZIB 1VGKA 4MJIA 1A6TB 4NQDD 3O9WC 5D4QA 4KH2A 25C8H 5FA4B 1WTGT 4XNXH 2B1HH 4X6EA 2DI7A 2NLJB 3ZMRA 2NR6C 2WWMD 2JCCF 4X99B 4OCWL 2GSIB 1XAUA 3FRUA 5T5FH 5E70A 3VXMA 2BVUA 1S9YA 4P9HC 5JPNB 3MYZA 2DLIA 1AFVL 1IARB 5B39B 5C0GB 3DV6B 2WIMA 4E0RA 1UQSA 1NBZB 3FFCD 4GMTH 3CX5J 4WEBH 1G6RB 3MXVL 4NWTL 4PJEE 3DRQA 3F7VA 4HJJH 4LLQB 1ZLUH 3T08A 1E4XI 3DETC 3NCYP 5KAQG 1TJGH 3QDME 4KK5C 2R69H 2FJGA 3RGVC 3ZDXF 5HD8D 1KJ3L 5IT2L 1QLFB 4HT1H 4XP5L 2QKIA 1A47A 3IXTA 3MRCA 4PG2A 3LHPH 1D9KA 3KJ4C 4OLUL 3MRDA 3S5LA 3SGEH 1KCSL 2M8XA 3K74B 5E5MA 3B9KC 1JYXA 4J12A 3X3GH 4XBGB 1S9KC 1M7DA 3ARZA 1BQLL 4LLAA 4WI6A 3KPPB 5TF1H 4Q97A 1TPXC 4UOW1 4R4FH 1A3QA 4XHJD 2C7UA 2IQAB 4R4BB 4L9LC 5FDWB 3B9KD 3S4SA 1R0AL 2HJFA 3BDXA 3PHOA 4I48A 4M5YH 1LDPL 1BZ9B 1F5WA 4NQDB 3N1PC 3MV11 4EUPB 4LPXA 2C5DC 2HG5B 4LCWD 2RHEA 4NQSB 3JTSA 4ETQA 1BD2D 3VH8A 4GUPB 4HAFA 5HYSB 3BN3B 4QHMB 3C6SB 3S35L 4S10A 3GRWH 4M43L 3GSNH 3H3BC 4P3CL 4FFVD 3TBYB 3WFEH 4N0RA 2P5EA 4YE4H 5ESAA 5I1GL 4XC1H 2YD3A 1KIUA 3QXDB 3HRZB 1MRCL 4JFPB 2PYFA 4JFZL 1MREH 3O6KH 4M48L 3O3EA 2O5XH 3C6LB 4MJ2A 2VIRB 2NY6D 3T3MF 3VXRB 4Y4HA 2NY5C 4GAJL 1OLZA 4OF0A 2LTQC 4G6KH 3SE9H 2DKSA 5IM7A 4HHAA 3AREA 4YHPB 3HAEG 3ZKXB 3MBXH 1M6OB 3NIDF 3EJYD 4ALAH 2WWKT 4NDMA 1WAAA 5F1OB 4PD4J 4ZQKA 5HHVH 4ZFOA 2YRPA 1M7DB 3VW3L 2FX9H 4LNVA 4UTBH 1KPVB 3GSVA 1IQWH 4JVWA 1BLNA 1A6WH 1FP5A 1JTTA 1LD9A 2YSSB 4GBXB 1S7SA 2QBWA 5I73B 4LHQB 1XGTB 5EORH 3OAYH 5HDBF 2CSPA 3QUZB 4AM0A 2XN9A 3V6OC 3AAZA 2CIIA 1DEEA 2B1AL 4YE4L 4OAWB 2VDKL 1CE6B 4HCRH 3U0TB 3B5HA 1QFWM 1W0VA 2Q86B 4XPHH 3LSOB 3C8DA 2C3GA 3V8OA 5B38G 4K94H 3RWHA 1GAFH 2YD5A 1I9EA 2IAMD 3BDYL 5IB3B 2ARWA 1NLBH 1P6AB 2R1WA 4XCNA 3L5XL 3KJ6L 1GYAA 3NOIA 1KTLB 3TA3C 4L4TE 3V6FB 5AYUH 3C08H 3QEGL 4IRZH 1OQOA 5IVNA 3NGBB 4GQPH 2DLFL 1ROWA 2JCCB 2GITB 5HI4D 5EZJA 4LFHD 2H2SC 3DROA 2YA0A 4HWBL 3IYLW 3HFML 1H3GA 4KI5E 1IGFL 3K4ZA 1CLZH 1P4BH 5GRXG 1B2WL 1N0XL 4KJQC 2QADC 5F6HJ 5CFHA 3C2AH 1OY3B 3PWVB 3QP3A 2RFXA 2QQNH 3P0VH 2MPAH 2FX7H 4OGAC 1FDLH 4BZYA 4U49A 3QJFB 5CJQL 2ICWI 5HGDA 2VRAA 3KNBB 5EO1B 4JM2F 4AJ0A 3FQTA 3VDBA 4MQ7B 1FDLL 5DFWH 3D25B 5CLTA 1URLA 3MV8A 5GS1A 4OLYL 4P2QB 4YIQA 4XAWL 3MA9L 5DSCB 3LPWA 5GRVK 3FRPG 2O26U 5B3NA 3VXUD 5EH1A 1T1WB 2VSCA 4J3OC 3MV7B 1PLGH 3OXRB 4TULL 3RPKA 3MLYL 1RZJH 4WUUB 2YKLH 3DVIA 4O00A 4OB5H 3VXPB 5D7LA 5IWLA 1BM3L 3KPOB 5MEOB 3O3UN 5J06A 1OAQH 3CVHB 3V4VL 3ZKNC 5HJ3A 4XTRC 1TZGL 1G7MB 3CFCL 1JNHA 4DQOH 1DR9A 4ZPTA 3T0XA 1AE6H 5EUKB 5L0QB 1ZVYA 3I6LE 4EN3B 1CS6A 2J8OA 4KZEH 3EDDA 3MRRA 1BWWA 1EJ6A 2IBBA 2YRZA 4YX2H 1LO3L 1FNHA 4PRIB 4FFYH 3KYNA 3HPLA 4Q0XL 3OG4B 5E8DH 1AIFB 1QOKA 5JR1L 5K9KB 3BGFC 3QA3B 4PJGA 3GMOB 5HYEA 4L4TB 3B5TA 4JO2H 1QRND 2F19H 5E00A 3ZT7A 3GFUA 5HDQL 4JZNA 5DJ8B 3WHE0 3X3FH 2VZTA 1IVLA 4NZJA 1EHLL 1QRNA 5L8KB 1CGSL 1LMKA 1O0VA 3G5ZA 5ACMA 4X6CB 4RFEA 5MP6H 2C3WA 4YHIA 4Y4KD 5E99L 5JIIA 4Z78B 2DKUA 4Y5YA 1DN0A 2CLRB 5TQ0L 4WNQB 4H1LG 3BRDA 2CK0H 3DBXA 4PGEA 1U8IB 4PJ5D 4TQEL 4FOMA 3IDYB 2GEEA 3IRPX 2DQTH 4PRID 4LPCA 1GPOH 1JI1A 5LXGL 4J3TA 2ZG3A 1QRNE 2IWGA 1V7MH 4X80H 3BUYA 2DBLH 4NKDA 5D7LD 1IRAY 3I50L 2XACC 1KB9J 5DEGB 4XXDB 4HS6A 5EBMA 1NGXA 1JGEA 3SDDB 3O3AA 5C0BE 1ZA6A 3WLWD 4UU9B 2R2CA 4OD3L 1YPZF 4A6YH 2APTA 4X9GA 3PQYB 3ULSB 5C6TL 1IGJA 1IC7H 2QQLL 1EGJH 2HKFL 2HH0L 3PIQB 4R26H 3TM6A 1I7TA 1AD9B 3EOTH 1HWGB 2AV7B 5C0EA 4JFEE 4PJ7F 4YWGL 4NNXA 3OHXA 4R4NC 2E8ZA 4J3SA 4H26B 3FB6A 1MAMH 5JXAL 1E6JH 3T2NL 2B1AH 2EE3A 1RZGA 3K8MA 1ZANL 3FN3A 1ZHLA 5C8JB 5I19H 1CICA 2W91A 3B4NA 1QYGL 4XVJH 3GO1L 4XP6H 5CHNB 2GSIA 3EYOA 5C0BD 3T4AB 5MEPB 4HG4J 3WEXA 3I02A 4OFYD 2YBRA 1MI5E 3QEUA 2IFFL 3QJHA 3GMNB 4UILH 1FCGA 3WNNA 1FNEA 2XA8H 3UAJC 2XWTA 1DP0A 5HVGB 4KRPC 4KRPD 4LBEB 3F5WB 1UB6B 3OJMB 4U7SA 5DS8A 5DMKA 3ARBC 1VGKB 3KNBA 4APQD 1DQJA 1JYVA 2PYEA 2BVYA 5DHVH 5F88A 4XPFH 4JZJB 1NCDL 2P5EE 5C86A 2KZ1B 2Y07H 4N0UA 3K4DA 2VKWA 4CJ1A 2JB5H 1CLYL 3PWNA 5EU5B 5D1QD 4MVBC 3AMKA 2IPKA 4GW5B 2NY3C 3DURB 3HZMA 3T65B 4OV5A 3PWNB 5EU5A 3RA7H 1BGXH 2RB8A 1FZKB 1UZ6F 4G6MH 3STZA 2WV3A 1MCPL 2DYPD 4M6MH 4AZ8A 4MS8C 4BSVB 1TJHH 35C8H 3UTTB 1YY8B 1FFNA 3QWOB 1M7IA 4JN1H 1RIUH 3DYOA 4NOFA 1TITA 2AK4A 3RHWF 2HTKD 5IEHB 4JN1L 4P23C 1WZKA 5IMOB 3W9EA 1QFUL 4PJBF 4V1DB 3BI9X 4P3DB 3QEQB 1MFDH 1T22A 4X4ME 1QZ1A 4DGIH 2AABH 5FCSH 3L5WA 3SCMB 3CUPB 2MCPH 4NO0A 2BOBA 1KGCE 1W8OA 1TETL 2GJZB 2VISB 5C09D 4JM2C 1AY1H 4MNHA 1R5IA 4Q2ZB 3QFDB 3TVMA 3G5ZB 3NZ8A 1QPPA 5GRJL 5JHLL 4OIIL 1RHFA 4UV4L 4XPGL 3VWKB 1BJ1H 1I4FB 3V6OE 4JZJA 2E7LC 1AR1C 4XX1E 1HYSC 1JFMA 4HIJB 2FLRT 4OZHE 3WFCH 5DC9B 4HMDA 4LHUG 5GXBB 1FC1A 2CD0A 4G6FB 1IT9L 1DQLH 3OKLB 4XH2A 4JCLA 4YDVB 5J1SC 4U1IA 4PJ5E 3BWUC 3QI9C 2A83B 1HEZB 4OSUL 1JZ6A 1QNZL 3MRBA 2XV6B 1I1FA 2NZ9D 2L7UA 3BUYB 2HT3D 3QIUC 3FT4B 1WC7A 5HHOA 4ZOAA 5F6IB 4M00A 2JJWA 3HUJB 3H9ZA 2HG5A 3DRTB 3C6LC 4NUJB 1WF5A 3DVNA 1BFVH 2A1WL 2EDBA 4FFZL 1TDQA 1JE6A 4CU8A 1MY5A 5SV3A 1QHPA 2HT2D 4N9OB 4DZ8B 5IM7B 3MLWH 3SBWA 4C56D 4YK4C 4RAHA 2UWEF 1R24A 1N5YL 5E99H 1A7RH 4PJCF 2OTWA 1A14H 4X6DB 5C09E 3Q1SH 3U79A 1PZ5B 3TBWA 5FIEA 3MRQA 4JRYB 1II4E 4G80A 1YA5A 3SDAC 2YHGA 4Z95L 4HUVB 3RX8A 5KG9A 2A6DB 1U8QB 2NYYD 3OBAA 3RIAF 1S7RA 5ETUB 2QKIB 2AERT 2R2EB 4X8XA 3BE1H 5JLZB 3WUZA 3QCUH 4MDIA 5CBAA 5DMJB 4NQEB 3ZKMD 3ZKMC 1JPST 3TFKD 1LO0H 4X7DC 2AJSL 3A67H 3WL9A 5B8CB 5AYQA 3U9PH 2OP4H 3W9EB 3R1GL 1K5NA 2YPVL 4WHYG 1X7QA 4MS8D 2NY7H 2BSSA 1ZVSA 4JQVC 1UWXH 5H8DA 3QEGH 4HKBA 3QG6A 3FCTA 4HIIB 1JWMA 3E3QC 3MTRA 1MRFH 2EXWC 4OLEA 4YO0B 2LU3A 3CSPA 4XNQA 4YQXH 2H8PA 2P5WA 2E7CA 1I9RH 4XVUC 1MUJB 4FABL 2H45A 1T03H 1FE8L 4K7PX 1OAXH 4Z76A 1LEIB 3HN3A 4A6YB 2UVEA 4YHOH 3KJ4B 2JF1A 2J3SA 4BH7A 3A6CL 4L8SC 5FM5O 5ITFB 1RUPL 4JO4L 2EIZB 3RDTB 2FEEI 3B6SB 1ZLWK 4P5TC 2NCMA 3RWJB 5GS1C 3MLWL 2BSTB 5J12C 5T3XL 4JQIL 2P5WD 4LLUA 5GSRB 3U9PL 2QHLA 4YUEL 4GRWE 1IEBB 1KTKE 2FX8H 3UTZA 3RVXC 4U7KA 2P49B 1BBDL 1CDBA 2NW2B 4DZBB 3VU2A 3EO0B 2X1OA 2Y6SD 3PV6B 2B2XH 2ZSVA 4JRYE 1F4WL 1G7PA 2CLZB 4MQ7A 2ZCHH 3I6GA 1IFHH 1FL5A 5K59F 5I8OH 5CWSB 2B39A 2QQNL 1GH7A 4NNPH 4UOJA 2BNQD 2R0WH 1SEBB 3QNXB 4M8QB 5F7DA 4B7IA 3K81A 4R3SB 3K2MC 4XMPH 3V5HA 1MFCL 3HZKA 3O6FA 4PJCE 3RVVC 4HKZB 4NM8L 1HINL 1OAUH 5DJ0B 2H1PH 4PRIE 1C5DB 2NXYC 4UT9H 3IFOA 2VLME 2PTUA 2AXGA 4QRPE 4RGOH 5E00B 3BN9C 3TJHC 4QXGL 1WZ1H 4UUJB 1MAJA 1FBIL 3V4PL 1MFNA 3U2SB 1WWBX 3SDDD 1NANH 4PJEB 3IF1B 1CGTA 3O9WA 3VH8G 3LHPL 1O7SA 2GK2A 3ARFC 2J8UB 5EBWA 4WHCA 3FO2A 5I75B 1AO7A 4S1QH 3KDMB 4YHKH 1XR9B 3H9SB 1OGTB 5CEZE 2V9QA 5C0IB 1K6QL 5CINH 4EI5C 3ZKND 1OTTC 2I27N 4QOKD 3KR3H 3OZ9H 3PXJA 2NTFA 3LCYA 4QF1A 5F3BA 1AGCB 5F97E 1X5FA 3S6CA 3MRGA 4UINL 3HUJA 4P3WA 3M1BB 1ZWIB 4FQ1L 4WWKD 4X4MA 4Y89A 5DHYA 1AXIB 4IS6B 3VFNA 1VADA 3O6LL 5D70L 4NRXA 5JIKA 3RBGA 4JJ5B 1CG9B 1GZPA 3VFMA 1MCHA 1QPXA 3FT2B 3RX5A 2J6EA 3D87B 3LS5H 4LPVA 5FF6B 1OCWH 3ELAT 1FZOB 4G7VL 3MMEB 1WIOA 4PJBB 3LVEA 1EO8H 1BD2E 4ERSH 3STLA 4I2XA 1ACYH 2NY4D 1GCFA 3BP5A 5LGHL 3U7WH 3HNVH 5DQDL 4PR5B 3F58L 3OKDB 1P1ZA 4Y0GA 2VL5A 4HD9A 4JFEB 3NVQA 3PGCA 4JDZA 4YHKL 3MUJA 4GG8B 4HFWB 3SDAA 3ARDA 1LNUA 3BIBX 3QSKB 2HKFH 3LRHA 3ARFB 1JF1B 4ODSL 3QUMB 1KCSH 1U92A 5BVJA 1IGYA 4Z7QE 5FGCE 5J8OA 2VJXA 3IFNL 3M17B 5GZOD 4R7DA 3P4NB 5FB8A 5K9QI 4ALAL 5ADOH 3ISWA 4MXVF 4QO1A 3BWAB 4X5WA 1XMWA 2AEIT 3D85A 2K9UA 5DVLA 1MCLA 5HI5C 3BMVA 4M61A 4ZO7A 4JPIB 4ENED 5I1JH 4XCEA 1EUUA 4MCYA 2P8MB 3ARBA 1T83C 2F74B 1MCSA 3L5IA 1TJIL 4KDTC 1OAZH 5E24E 5D5MF 5HGDB 4YDKH 4F9LC 5IROA 3AS1A 3D85B 2WK2A 4P2RA 3U7WL 3F58H 1DFBL 1D5IH 2W07A 2XG4A 4Y5XC 1OGAD 4DKFL 1RJCA 5F70A 3A6BH 4URTB 2BRQA 4G9FB 1CLYH 1TCRA 3HZVA 4C58B 5T33H 3TYFB 3Q48A 5IFJB 3ARGB 4G3YH 1CE1L 2WIIB 2PYEB 1YPZA 1HI6B 4MAUH 1Z9SA 3WD5L 2C7UB 3IT8D 3THML 4WU5A 1BZ7A 4R6UA 5GISH 5HDLA 1GL4B 3QUXB 3TBVB 1CD1A 1UXSB 3BZEB 4XPBH 3Q5OA 1DBAH 5LG1A 5D1ZA 5E8EA 1BLNB 4NYLB 3QO0A 2WBJC 4JO3L 1A6VH 4PRPD 1ZHLB 5IBLD 3ALPA 2X1QA 4Y1AA 3O45B 4WI9A 3CXHJ 5JIPA 1BZ7B 2R69L 4UAOB 1U93B 5EU3A 3MLVL 1G84A 3MV9D 3HAEH 4RA0C 2JCCE 5K59E 2A6JB 4HH8A 5FYJH 1LE5A 4HMCA 1LQSR 2Y23A 1QR4A 1ZHNA 5C0IA 4M62H 1L6XA 3EFDH 3V6BR 5KSAC 5KSBF 3N50A 1YN7B 4XWOC 5C0GA 4ZDHB 4YXHH 1NCBH 4HGWA 3SDCD 4OT1H 5EIIA 3GHEH 4HKXA 3RWCB 4J3XA 2XKUA 2EECA 1KIRB 1UADC 4OCWH 1KN4L 4PJ5B 4KK8C 3Q6GL 5EOQL 3QRFM 3VD3A 4KRPB 4QTIL 2AJSH 3FTGA 2VLKE 5C7XH 4BKLB 4OGAD 1FL6B 3NCJL 1TETH 3BKMH 2VOTA 1D5ZB 4HXAH 4H8WC 4YR6A 3T0AA 1DBBH 1FGNL 4WO4C 4ZS6D 1FSKB 1XGRA 3S37H 2YPKB 3IFLL 5EBLB 3RWDA 3GMLA 1CTOA 3GKWH 4K3EL 5DQJB 1NEUA 1EFXA 4YHIB 1T89A 1CF8H 4P2RD 1PKQB 2FSEA 1A7OL 4S0UC 2IPUG 3MLPA 3J7HA 1GZQB 5HHXL 5FECB 2E9JA 4WUKL 3QBTB 5DMYA 1JK8A 1QA9A 1OAXL 5KSBB 2OMBA 3X13B 4JFXA 3S97C 2OJEB 5CCKL 3LN5B 4JM2A 5DUBA 2D0FA 3O81A 5D2NB 4I18C 4JHWL 4JO3H 3VGFA 5CSZA 5DUBB 2YWYA 5L6YH 4XVSH 4J1UB 5BZWB 5TH2B 1JGUH 4LLQA 2A1WH 4LCWB 2N7AA 3KPQA 5FYJL 1U95A 3PWUA 4KDWA 3BSZH 3BPOB 3RUGE 4PJFA 3TPKA 4NNYA 4WUUA 2CDGA 4BQCA 5T1DL 5IR1B 2IANE 3SCMA 5B4MC 2GJ6A 5EOCH 2G60L 2G5RA 1U91A 4CVXA 4QGTA 4YO0A 5T33L 3NIDE 2X10A 5IHLB 3JV6A 3S5LG 3FO9B 3LMJL 4C4KO 4F33A 1EAPB 5DLMH 2OLDA 2F8XC 5I1HL 5GSVA 1I1AB 3HE6C 3UC0L 3LZFH 3T1WA 2HFFA 5H2BB 1R6VA 1AGDA 2EH7L 1IZKA 3IDGB 3RZCC 3HA0A 5HYIA 3RY5A 4NKOB 1KENL 1S5IL 3TA3D 4JCMA 3CNKA 5F1SA 3REWA 4HCRA 5DJZA 4H25B 4PRBB 1FFOA 4Q6YA 1NH6A 4WI3A 2HLFD 2AAVA 1WWCA 4U1SB 4U2YA 3TJEH 2BJMH 5L7XL 1H9VA 5EO9B 3ULVF 4Y5XA 3TPUB 4PRPA 1NGYA 1BVZA 5FKAA 3CFIC 4LSRH 1A6WL 1FGVH 2F54D 2VDNL 3O4LD 4JKPL 3AGVA 1NCCH 3JSSA 4PJIE 3WLWC 2ID5A 3T0EC 5GS2D 2A6IA 3C60C 1EO7A 4HZAA 1JHTB 3MA7B 4PGZA 3IVKA 4ZFFA 5J6GB 2RAMA 1Q9LB 3OKNB 1MJ7L 4LBEA 4F3FA 4TPRL 2XZQL 4ZFFB 5J6GA 5GGQL 2DQHH 2DQJH 1A6TA 4M7KL 1F6AA 1GVIA 3QCTH 2E8YA 1EV2E 1Q1JH 1QLEL 3U7AA 3C5SB 2P8PB 4HZLB 4P48A 5TE4H 3CSBA 5EOTB 4BQ6A 4UDUA 5EWIH 5SWZB 3LS5L 2QJDA 4XGZA 4M3JA 1EX0A 3WIHH 4JFFA 2BVQA 3FQXA 2NY6C 5FOBA 1R3KB 1PSKH 3QUZA 2IH1A 4Q58C 4LF3B 3VFGL 3W5NA 3VWJB 2V17H 5HYQA 5JW3H 1I75A 3RIFK 4C55A 5T1LB 5C0CB 4QRSA 1MCDA 2DQHL 2DQJL 3ABZA 5TDOB 5JW3L 3G6DL 2WUBL 5IR1A 3GMQA 1MHCA 3U4BH 5KSAB 2AK1H 1PY4A 1FVCA 1GHFH 3L3GA 1NAMB 4R3SA 2VITA 4L8SB 4O2FB 3BO8A 3CH1A 4RMSA 5IV2B 4LVOC 4Y1AE 3ZE2F 1ZSDA 5DR5L 4GRMB 1I3RB 5CGYC 4HIXL 4RDQG 3TPUE 2X4SB 2X4TB 2R23A 4O02H 3B9AA 1FNLA 1FG2A 3MCLH 4MA7H 2ZUTA 3BDBA 2XQBL 2QHRH 3ETBF 3IKCB 3MGOB 3VXSA 3LS4H 1OPGL 4KJPD 4NQED 2AQ1A 4JDZB 1QA9B 1NUDA 3RTQA 2ESVA 3QAZB 1F6FB 1H3XA 1AQDB 1UM5L 1AJ7H 5BV7L 1N4XH 4N9GA 4OLVH 4GUPA 1Q94A 3B3IB 4G9FD 1OD9A 3HPLB 3SKNB 1WWAX 3KYKH 4Z7OE 4UILL 2OTWB 3IJHA 3D3VA 3VXNB 1DQQB 3E0GA 2AGJL 3X12B 1J86A 5CMAA 3T2PA 4N0FA 2OR9H 5EZLA 1HKLH 1P53A 1KYOK 1I7ZB 1I9RL 1RZFH 4LSVL 2OTUA 1AO7D 5CJXC 3QIWD 2B4CH 1AR1D 3GHBH 1UFUA 4BKLA 5JUEH 3ZDZE 1KT2B 5EC2A 2VWEE 3P77B 1CFQB 1A6PA 1CDIA 1Y6MR 3V0AC 5L2KB 4IOIB 5FKPB 3MRMB 3DMMC 4DEPC 4WEUD 4U6HB 5JUEL 3QZWG 1LEGB 4DGYL 1EGJL 4NQVB 3WNOA 2CDFA 4Z6AT 3ZYZA 1WBZA 5I75C 4GH7B 1HHJA 4YUEH 3L6FB 3FB5B 3G5VA 1VCAA 2VDML 1YPZE 4PJGE 4LP5A 3LKSA 3O4OC 3INUL 3UTTA 4MB4A 3KPSA 4ELME 4ZAKD 4P4KB 5M95B 4QHNA 4D9RD 2UZIH 2PO6A 1F58L 4XPAL 2QV2A 4ZXBB 4JO1H 1UCBH 3TIDB 3C5ZD 1XR8B 1CFVL 1DBJH 3EOBA 4ZOCA 1WCBA 5F72S 4YHMH 3OKMB 3G04A 3HS0B 4PB0L 3TZVA 2NQCA 4AQ1B 3LQZA 2MQ3A 4EOWH 2R8SL 1T0NB 3O3DB 4GMSH 3ARPA 3W0WA 3D2UA 5D1ZB 3ULUF 2VLMD 5I8KL 5IHUH 1KJVA 1NMAL 1ZT4A 4IIQA 3BKML 5B39G 4MD0B 1RHHB 3NFNB 4ZUTB 4Y8AA 5C0FB 1NAMH 3S88L 4PREA 5EOCL 1Z5LA 3B8SA 5GRVL 2EEBA 4LLVA 4EXKA 4JM4L 2PUQT 1KEGL 2ZG2A 2DAVA 4IBLT 4M61B 2F19L 2LQRA 3NABH 4LP4A 3REVB 3TVMD 5I15L 3L5HA 4RGNB 3DV4A 4P46B 4XCNB 3VFWB 1ADQL 4MQXD 5DI8B 5K33A 5E5UB 2EYSA 3ECBB 4AEHH 1CICD 3T65A 2HLAB 2CRYA 4RAVA 4WENB 4X6FA 4XTRD 1QLRA 3TT3H 5C9JA 3GGWA 5FYKD 3UPCA 4HWNA 3TCXA 2BRRL 2CMRL 4JHWH 5E4EB 2HJLA 5CZXD 4BH7B 4Z8FH 4KMLB 4NC2B 4KGJA 4PUBH 4N8CH 4W70A 3JWDL 4YH6A 4IDJH 4F57L 5AEAA 4I9WD 1FG9C 1X5ZA 4H20L 3TO4D 4Z7VF 5EIQA 3MJ7A 1J05A 1I1AD 4I3SL 5BRZE 1J5OH 1AY1L 4XNMB 3A6BL 1CDGA 2VDKH 1CFBA 3VGAB 1OPGH 1SJHA 3RY6A 3PQYE 5CHNA 3FCTB 3PUCA 4HIIA 4OLYH 3C9NB 3MRPA 5IQ7L 3KYOB 4JGJA 5C0NC 4CN6A 4O9HH 3RPIB 4Z0XA 1RZKC 2O5YL 4UTAH 3QI9D 2ICWJ 5DGQA 5GRZA 4AG4L 5AZEL 1JGVL 3MV7A 5ECJE 1TVHA 2J5LB 2P47B 1JZ8A 5KOMC 2GTWB 1RUAL 5C07A 1DUZA 4RIRB 5IMOA 2OM5A 3MRLB 1IGTA 3MO1B 2KDGA 1KLGA 3RQ3A 4OZHF 1N6QH 4U3XA 3ULSA 4XAKD 2ICEA 4PJHB 2K3TA 3HKFA 3S3PA 2P7TA 2J88L 4Y5VC 1BQSA 4E41D 1JGEB 1MFDL 5JMOC 1Q0XH 2AJUL 5IB1B 3BZFB 5SWQB 1MCFA 5F7HA 5GGUB 4OZFH 3OAZK 2AXGB 4JJ5A 4NUGL 3JV5A 1BBJB 4MJIE 4DGYH 4K3JL 1QKZH 3RUGB 5K9KA 5C0JA 2FIRT 2NXYD 3M8OH 1WJ3A 4P49A 3UTPD 2VXTL 5D6DC 3E8UH 4NUGH 4FZ8H 2AJXL 4X9BA 3HG1B 2FB4L 4WI5A 2FEEL 1FZJB 1IC4H 1OW0A 4PRDB 4U1NA 1NLDL 1DDHA 3K80A 4P5TA 1H8SA 4PJ8B 3K2UL 4S1RL 3FQWA 5ELIA 2HJFB 1CVSC 1ACZA 1Q38A 2DB8A 4PV8A 5MI0B 4M48H 4YDIL 1IQDA 5IOPA 1B0WA 4DOHB 1XF5B 5DMGD 4MZ2A 1S7UA 5EFIA 2IBZY 4O2EA 3OKYA 5DO2C 4ZFGL 1GGCH 4NRYA 3F62A 4HIEB 2ARJA 5IVZB 4BSWB 3WIIH 3ZO0A 5DGRA 3K4AA 1KEML 4ONFH 5T1LD 3X14A 1CFSB 4XT1C 3QNZB 3W11D 2APBA 4HS8H 4MVBD 3GSRA 3U48A 3QUMH 5ILTL 3BHBB 4F9PA 1LGVA 1CT8A 2FHBA 4K3DL 3ZSSA 4RNRA 2D9CA 5DRNB 5GHWL 5HHMB 3QUXC 3JTTB 5B4MD 3EO9L 1KJ3H 3VG9B 1KCRH 2NMSA 1IC4L 3R06A 3IFNH 4DVBA 4BFGA 3DV6A 3EJZD 4IOSD 1EBPA 3MV9E 3QNZA 1CGYA 4ZNCD 2F9BT 3KYOA 2VLRA 2V2WB 3P40A 3LKPB 3ZE1E 4NM8H 3LKQA 4M4RA 5JDSA 5ICYB 2RQ8A 1IILE 3RWGA 2W9EL 3QDHA 2H3NB 4F9LA 1CICB 3D9AH 5SWSE 4N0YH 3NA9H 2D31A 1UKSA 4M1GH 3G6JE 5T5FL 4DJMA 1PG7H 4N5EC 2B8OT 1S7VA 3MA7A 4MD0A 3MBEB 1RZIA 5DD5H 1JPTH 2PCPA 4KJWC 2PR4L 4CMHB 2Y7QA 4KQ3H 1ZT7B 1KC5H 4NPYA 3QDGE 3GB7B 3LKNA 3WIHL 1NCWH 4MWFB 5J11B 3G5XA 2W9DH 1G7LB 1JF6A 1DN0B 4Z76B 2ADJA 2GY7B 3IXAA 1LEIA 4GO6B 4FHBD 1G7LA 5T5NG 2ZJSL 4X6CF 2NY3B 2ORBL 2DQCL 2NYYC 1FGNH 2F5AL 4UIMA 3OJ2C 2PCPB 4Q6IC 2RIKA 4ZODA 1A9BA 4OCYH 1NCAH 4M5ZH 1DQJB 4P46C 4Q9RL 3BUTA 5D6CB 1HIML 2I24N 2R23B 3DMMD 5I2IA 3U6RA 4BUHA 1X5YA 2HKHH 1KJMB 4R4ND 1BJ1J 4RIRA 4EUPA 1DVFA 2VERN 1A6UH 4FTVE 2PNDA 4C4KT 5LAXB 1G7QA 4CDGC 3LKPA 5C0BB 5FV1L 4GSDH 4RFNC 1AHWB 5BVPL 3GIZL 4JREB 3O2VL 1MJ8H 2EDRA 1XF4A 4Z0XB 4YHNA 3LKRA 3ARRA 1J1PH 2R0ZL 4MAYD 2VSDA 4ZAKC 2EH8H 4XAWH 2V5MA 3BPLC 1YMME 5A2IH 3GMQB 1LVEA 4K8RC 4XBGA 1N0LA 2VO5A 1HWHB 2AV7A 1P7KA 5GGVL 1EHLH 4KZDH 3QDJD 4M7LH 3LSOA 3OGOE 1VFBA 1TNNA 5E2JA 3MLXH 2VQ1A 2CRIA 1UC6A 4QRUB 4D0DA 1CXIA 1HCVA 4NZDA 4XPAH 4YBQD 3PE9A 4F8TA 3JZ7A 4OCRH 3MCG1 4Z7NE 4P4KD 2A9MH 3Q6GH 1C5CH 3ZT6A 1I8LA 4AEIH 2J5LC 4XXDA 4DK6A 3BE1L 3P4LA 4JG0H 4OZFA 3WUWB 5C7XL 2ZP0T 3QIBB 4U1HA 1E4XH 3NZ8B 2Z8VC 4MA1C 3T2OA 2R8SH 1KPVA 3NCBB 4GMSL 4I0PD 5ID1B 5JHDE 4UDUB 3M1BA 3JWOL 2VABB 2B20A 1DLHB 1W8NA 4QRPB 1JIBA 1JWSB 5DD0L 4BK4A 1MPAL 5JW4M 4MDJA 1EZVY 2WWKO 4PJ8A 3S88H 2R29L 4G42B 3PJSB 3ZE0E 3G5YA 4MA8L 1INEH 1N59B 5CMAB 1OGTA 3DUHA 5IVOA 4APQC 4X7EC 2YN3A 3G6AB 3KVQA 2X4NB 1TQCB 3JXAA 4KZDL 3TO4C 3DGGA 3VXUE 4JFPA 3VXQB 4UB0H 3HFMH 3FQTB 5BXFA 1UEYA 4NOBA 1HYRC 2BHYA 4RZCB 4YXHL 5C0CA 2HKHL 4EIGB 3U83A 1KCLA 4LIQL 1RIVL 3D2UB 4IDLA 3U0WL 3GMOA 4LRIC 1W72A 4X83A 3UTSE 5J12B 4HPYL 3CLFH 3UBXA 5HYSA 1T2XA 1U58A 2HJKB 4FNLH 5C70A 2VDQL 2LABA 2YA1A 3JTCA 4K2UH 3EJZC 4LCIL 4RMUA 2E9BA 4KROD 4D3CL 3N1QC 5F1IB 3VXUA 4L1DA 1WTLA 2IEPA 3QIBC 4OZGB 3FFDA 1ZEAL 1KXTB 4HXAL 5B8CC 2C4XA 3MZGB 2FJHA 5SWZA 2OS7A 5I8KH 3VXPA 3ARVA 5IB5B 1HHJB 5FYLL 3VXME 5KANI 2YXMA 1AGBA 1KBGH 2OZ4L 3I6LD 5C0AB 3PABB 1Z2KA 4U1JB 5DRWB 4BH8A 4Y16C 3V6FA 1LD9B 3C5ZB 2JLLA 4HCRL 4P5MA 4KQ4H 4NKQB 4CVXB 2ZWLT 3W0WB 4FQCL 4DUVA 3H9SE 1U3HB 4KUCF 1Q9KB 9CGTA 1A7NH 3VWJA 1M4KA 5HTSA 2IH1B 5I8EB 1IGIH 1WFTA 3BEWB 4HUUB 4QOKA 5ALBL 3PF2A 4OZIF 4C56B 2PTTA 1ULVA 5F88B 3U82B 1HHKA 4LSTL 2FHCA 5E8OA 3IU3B 4X4ZA 3V5DA 1YEDB 2ATPB 3VMPA 2OL3L 1KCRL 4JPWL 4X6CE 4LLYB 1F97A 2D7PA 2IBGA 5E1AA 4OGYL 4DGIL 1Y6KR 2KKQA 4JG1H 5F9JA 3PNWA 1OT2A 5HYJB 3UYRH 5AZ2L 1CVRA 3MRNA 5F9WB 1RJZB 1ZHKA 4OGYH 1J8HA 4PY8J 3O6FD 1ZTXH 2G9HB 3BYTA 2P8MA 2BNQE 1Q1JL 1KJ2L 4XMKL 1ZS8B 4LPYA 4NCDA 2AK4D 1J1XL 1RHHA 3HTLX 3ZDYE 2VDPL 5DK0A 4LARL 3UZQA 3ZE0F 4FQXD 4X4YA 2BNRD 3EDJA 4JPVH 4KV5F 2VDPH 5FO9A 3FOMB 2CLRA 1WFOA 4ORGB 3G04B 3GJEB 1JHKH 1S78C 2WMPA 4UU9A 4NT6A 4F8QA 5FAAA 3BH9A 5EO9A 5K9OA 3I75B 3V5KB 2OBGA 5A3ID 1KEMH 4ONFL 2YN5A 1K4CB 4U3CA 3RNKA 4ETYA 2D7NA 3PGCB 1XCQB 2P24B 5FO8A 3O8XD 1VPOH 3U4EA 4AEFA 4N1CA 2O5ZL 5MEQA 4J4PA 4PJXB 2CXGA 3NIGF 2I07B 2FX9L 3FQNA 3BIKB 4K3JH 3RUGF 1W0YT 1JNJA 3EYVB 35C8L 4HH9B 2QSCH 4JR9L 1W72H 4HT1L 4XP5H 4WO4D 1TVHB 1ZANH 4PJHF 5SWSA 3WO3B 5KN5A 1NLDH 2X4RA 1FJ1B 3KWWA 1NC2A 3QCTL 3U4AA 3WFBL 4HEME 1JVKA 3BQUB 3MOAL 3CK0H 2P5ED 4XP9H 1U8OA 4L8DA 4L4JA 3RHWK 5GS0L 3C9NA 1U95B 3PWUB 1AGFB 4XI5D 4P57B 4M9PA 5L88H 4OQTL 2R1XB 3MACL 4PJ8C 4JKKA 2CJUH 5FOJA 4S2SA 5CUSH 3H3KA 3BSZL 4NQXA 3GI8H 2WW8A 1I1CA 2CIKA 1LO0L 3GJFA 3BN9D 1S5HB 2IH3A 4RX4D 3LD8C 2GJ6D 5TQ0H 4FRWA 3RX7A 2BNUA 1HILB 1QSEB 3BEVB 4KFZC 3TVMC 8FABB 2ICCA 3RNKB 2OK0L 5I1CH 4QHMA 4Z7VB 1TCRB 3HZVB 4FQCH 3QULA 3LDBB 3FHAA 1QSFB 4MJ5A 5DC4B 5T3ZE 3TESA 3QDGD 4PJDA 5GS2H 4MAYC 2NW3B 3FFCE 3EYUL 2JB6B 3G5XB 1DJSA 4WUKH 3T0VA 3C5SA 1CQYA 1BQLH 4WTWA 5DHVB 4NO0D 5J1AA 2VXQH 1VFAA 2VE6B 2OQJB 3CVIH 1WEJL 5GGRB 3RI5K 4OZGF 3Q6FA 5E6YA 5EZOL 4WFHE 5FA4A 5KJRH 3QWQB 5DYOA 3VRJA 1FN4B 3DIFB 4LSRL 4JO2L 1SY6H 3C60D 1NCTA 1N5AA 4LLWB 3SDCC 1JV5B 2QR0B 2V2WA 4LLYA 4U1GC 3QDGB 4M02A 4M3KB 3W39A 1PDKA 5EIIB 4Y5XB 2XRAH 2V7HA 1RZKL 3C87A 4OCLC 1G7HA 4M1CC 4CBPA 1S8DB 4MD4A 3SDAB 4JZOA 4OLXH 5TE6H 2O93L 2A0LC 1AI1H 4P4KA 5DJCB 4J2XA 4MD4B 4PJ7E 4PB0H 2AGJH 1X5LA 2EYTA 3B43A 4NKOA 1YEGH 5DURB 3VXRE 3UTTE 3EHBD 5J11C 3QDMD 3RTQC 4WEMB 4K55A 5FF6A 1T80A 3WEXB 1C08A 2ARJB 3JWOH 5IVZA 2VUYA 2R9HD 3OKKA 3HMXA 3QQ3B 4S0SD 5DJDA 5KSUB 4ENEC 1JWMB 5E9DE 3TBVA 4Q9CA 3T77B 3F6LA 4TUKL 3ZE2E 3L1OH 4O2EB 2PXYD 4FFYL 2IADB 1XGPA 1X5IA 3KHOA 3TV3L 5JHDD 3O41A 1EFXB 2P4AB 2E27H 1DQDL 5C2UB 1QR1B 1NC2B 4XPTH 1LK3L 1L7IL 5CKAA 4OLZH 1MJ8L 1YEJL 3QB7C 2XWBB 4OZGA 2FH6A 4HK3N 4APQB 3WJLC 2QQKL 3MLVH 2VXSH 3CFKB 4MSWB 2EKSB 3EYVA 1U8LA 4OAWA 1WZLA 2YXFA 1SJXA 3HG1A 5D93C 4LSVH 4L9LA 2CQVA 4PRHD 4XNYL 1EEZB 5DT1H 4N0YL 4ACPA 4JHBA 4XC3L 5GS3A 4Z7VA 5GJTL 3SJVA 4F2MB 5MERA 1NEZG 3QDJE 4ZOBA 2JK5A 2PF6A 2DYPA 1NCBL 5EPMA 1ZHBB 4H25A 4PRBA 1G0XA 2YD1A 5CJOL 5E8PB 4L3CA 5ENWA 3A6OA 4K23H 3TIEB 1A7QH 5E6IC 4QRQA 3RP1A 2EEDA 2Z92B 4LAJH 1D5IL 3MGTB 1QNZH 4P23A 1QSVA 4L9LB 3TBSB 1FO0A 2X5PA 4ODWA 1R24B 1OVZA 3R1GH 1RJLB 4OZFG 5GQBA 4MNQA 1T21A 2YKLL 3VGBA 1F45A 1BEYH 3KPTA 1K8IB 1P7KB 1TLKA 5KS9B 4RGNC 1M05A 4F7MB 2UZIL 2VB5A 3BKYH 1LO2H 5F7MC 2KPNA 1NCAL 4UNTA 2VIRA 3O3BA 4H8WL 4EN3C 5EU7C 2C26A 3MRGB 4ISVA 4JFFE 1LO4H 4IIQC 5EA0H 1I1FB 5FYLD 3LV3B 5FUZH 5CBEB 1RUQH 3WFDH 1OP5H 4KKNA 1D5MB 5I6XB 1PG7W 4ZAKA 3SE4A 2NY1C 4JFED 1YNLL 2CLVA 4HF5H 5H94A 1AH1A 4M6OL 3P30H 1A8JH 4MGXA 1BZ9A 5CBEA 3CXHK 3VD7A 3H9HA 4N8VA 5F21B 4NN7C 3PWJA 1YJDC 5I1AB 1N6VA 3TJHA 4HUWA 1NBZA 2DQFA 3GBLA 3D85D 4WU7A 4LRNL 4Z7OF 3BD5A 4KJQD 4R97B 2BXZA 3QG7L 4GRLC 2C1OA 5B38B 1SEBA 3GRWL 5F7DB 1JV5A 5MHSD 5JIHA 4B41A 1M1SA 5D96C 4N0CA 1N4XL 3MCKA 4WGVB 5BZDB 2DM7A 3IDUA 4CADB 1CD8A 1EDQA 4OZHA 4P5KB 4D94A 3MV8B 2C1PA 2VZUA 5F71A 2MKLC 3IVKB 4PJXF 4DOHE 2DTMH 3CH8A 3TN0C 1NAKH 2IFFH 1OCWL 1MIEH 4HUNB 2XFXB 1L0XA 4PJ5A 4ZFOL 2IBZX 4NZUH 2C3VA 1V7ML 4X80L 5F1IA 4M93B 1U8HA 3RTQD 1KCUL 4NN6B 5J3HC 5D1XA 1W0WA 3VXSD 4KI5C 2APXA 3B9DA 3SKMB 1O5DT 4M1DL 1JF1A 1ITCA 1EHAA 4YWGH 2WNGA 3KPSD 4GLRH 2A6DA 3C5JA 5FXCH 1A5FH 3R4DA 5C08A 4ODVL 5IMMB 4G9DA 4R7NA 1K6QH 3LKSB 4F58L 4JG1L 1DUYB 3BKJL 1P7QA 3FQUA 4S1RH 1W2KT 1MUJA 2MNUA 3H42H 1FL3A 1IBGH 3EAKA 3CPLB 5D7SH 1LEKA 3GM0A 4OF6A 1FV1A 3TCLB 3QQ3A 5JZ7D 4J4PD 5J1AB 1C8PA 1CD1B 1AKJB 3QI9A 4FQHA 2GI7A 4KI5F 3FO0L 3KPRB 1QSED 1UB5A 1AGBB 1J12A 1IEBA 4KRLB 4FP8H 1D9KD 5JDJA 4WU5B 2YPLB 4EUPG 4M6AA 1MQKH 3H9YA 2C4FT 1JN6A 3OF6A 1G7JA 5IMLA 5LVEA 1AD0B 1EEYA 3GSOA 2IC2A 4LKXB 1S7TA 2NTFB 4JPWH 4N1EA 2EKJA 3N85L 4Z7WE 3P9LB 2CXKA 3HI6H 5I66B 3MZTA 1W0VB 2Q86A 1J0JA 3UJIH 4FXKA 5HHMA 5DVKA 3BMWA 2YUVA 2W92A 4W68A 4ZO9A 4WV1C 3BIKA 2VXVH 3NCYS 5I74C 2OTPA 1F4WH 3ILPA 3G9AB 3ZHKA 1LP9F 2RBLA 3LZFL 3G9VA 4CRPA 1Q9KA 2Z31D 2BSED 5DDHB 3CFJA 2J4WH 2R0LH 3HI5H 15C8H 1ZGLP 3EFFA 4R8WH 1K4CA 3V5KA 3B8YA 1VADB 2BHZA 3VXQA 1BVKB 3OR6A 2NPLX 2VLJB 4XNYH 4N5EA 3BQUA 4HQQL 5HGHB 5I1KL 1ZVSB 3V5HB 5HGBB 5J89A 3D48R 5BQ7B 2R2HB 1BQUA 1CTNA 4IRZL 2FBJH 3MREB 3CLFL 4HPYH 1GOHA 5BCAA 3P9MA 5GRWA 3CH1B 3W2DL 4HH9A 1OWRM 1ZS8A 1FO0B 3K1DA 1SY6L 4L8SA 4JQXA 4YDLC 4LRNH 1B0RA 5EBWB 2UY7A 2HT3C 4L8BA 3LRSB 3WUWA 4POYA 3SGDH 5J1TC 3UTZB 4Q6IB 3IGAB 3MRQB 4JRYA 1VA9A 3QAZC 5FK9B 1CLCA 3CZFA 3LEVH 4L4VD 3FFCB 4LLUB 5A16A 1I8IA 1FNGA 1UM5H 4QRUA 4D0DB 2MSPA 1GPOL 4S2SB 4C59B 3FOMA 2DQDL 1YEGL 3QHZL 4GQ9L 5ID0A 3MBED 2I26N 5DJYA 3DVNB 3QXWA 1EPFA 1B4JH 3QEQE 4MD5B 4KMQA 5I8EA 5L6YL 4HWZB 5INDA 2ZKHL 5DFVD 5GGSB 3U36B 1OLLA 4GSDL 4GG6F 2DWDB 1HSBA 3S8WA 1T66D 5HDQH 3CSYB 3ZTJH 5MEPA 2PXYB 1FV1B 1TJIH 4OUOA 4ZFZA 3CMOH 4DCQB 4FQLL 3T1FA 3BYYA 4PJAA 4AIOA 5IEHA 3G6DH 3QIWA 4PLJC 4HWBH 2FJGB 5CZXC 2VQ1B 1RIVH 3LN4B 3WIHA 5IKCB 4M62L 4AQOA 4G6FD 4ESKA 5IW6A 4N8PA 1BFSA 4Y2DD 2CKNA 5D7JB 4EI5A 1UM6H 5DRZB 3EZ8A 5H37H 3GSRB 1SVZA 3EYFB 4M7JH 1J10A 5JPNA 1SMOA 1I1YB 1WCBB 2QR0A 1B9ZA 1U8HB 3TA3A 5JXED 2EXYD 1KJ2A 1R5VB 5DF0A 5D1XD 2PKDA 5CWSA 5C07E 2RR3A 2GCYA 4GW1A 1ITBB 4I0PB 5JQ6H 3QCVL 1ZKAA 1T1XA 1QO3A 1GC1L 3D0VA 2SEBA 3N1FC 3MA9H 4A2LA 3ROLA 3KJ6H 3MOBL 3RY4A 2R4SL 1K2DB 3ARBB 4FQQB 4F7TB 3F7RA 3CFBB 5GSVB 4EEEA 4O4YL 2DJUA 4U1LA 5ANMA 1TZHA 5E1HB 5IIEB 1YQVH 2CDFB 4OM0H 4BSVA 3FQWB 5GIRA 4PJCA 2J4WL 2VH5H 2X1XR 2C9AA 1HSBB 2EZ0C 5IB4A 4JGUA 2DWEA 3DTXB 1ED3B 3G6JF 4PJDB 1C1EL 4LQFH 1KPUB 1D5BB 4HG4K 3QH3A 2Q8BL 1EEUA 1U58B 2HJKA 5D7SL 3VFVA 4D2NA 5L0QC 1U8QA 5FUCC 2HMIC 3OZ9L 1I7ZA 4NPYB 3BIAX 4JFEA 3D18B 4PJ9B 1CD9B 4HF5L 3ROOB 4FP8L 5TF1L 1MWAA 3QUXD 1QBBA 43CAA 1MCWW 3KPLB 3DX8A 2ADIB 2KBGA 3CZFB 4YFLF 5L2KE 3HNSH 3LEXB 4P4KC 3WLBA 4FZEH 5KSBA 2ESVB 4O51A 3IAGC 2R1XA 1KNOA 4DVRH 4MDJB 4J6RH 1ACYL 4U05A 2VZ3A 5CGMA 3O4LE 1OF2A 4J8RA 2EDXA 4M43H 1N8ZB 4EDWH 5FYJU 3RY6C 5KANG 1X6NA 4LGRB 5B8CA 3KG5A 1IKFH 5I1GH 5LXGH 4TVPL 1IFHL 5IIEA 3D0LB 1KENH 1S5IH 4QHUB 4YC2B 2EDKA 5KSBE 1UYWH 4LQ1A 3QO1B 1FVCB 3LDBC 4MJID 4XBEH 4JQXC 4JRXD 5CEYA 1BF8A 1MHPL 5ICZB 3ZZ1A 1A7PL 1OGAA 1JP5A 2BFVL 3IDIA 3Q5TA 3O4LA 4HWEH 3BRFA 3QDAA 3STZB 5IROC 3NA9L 3N06B 2KL6A 1P4LA 3H0TB 1XF5A 3FRPA 1EHNA 4PTUB 3UYRL 3O11A 1WK0A 1IGTB 1WBXA 4QRTA 1ONQB 3L3KB 3G08B 5KS9F 1MHHA 2YMXH 4G42A 5T1MB 3KGRA 4Z7UE 1ZA3A 4TPRH 4YHOL 4NQCD 3DMMA 3CK0L 3U0WH 3LN4A 1C7TA 4P2OC 2IQAA 1DLHA 4WNQA 2X09A 3GO1H 3CVHH 2NNAA 4LSPL 4XP1H 3DX7B 4XP6L 4ZG1A 2GK0B 4ZO6A 3I9GL 3MRPB 1KB5H 1M7IB 1U8NB 5DJXB 3GSQB 1AXTH 4WI8A 1SEQL 2PXYA 1MH5A 2CKBA 2FJFA 5E6IB 2YK1H 4WFGD 5C9KA 3FONA 2VYRE 1T3FB 2Q6WB 3B5GA 1KOAA 5D1ZC 4KKBC 1DBKL 1DEDA 1MEXL 5GGSA 5JQHC 3DX9B 3KYNB 1CGSH 2Z0BA 3SDXF 1NCDH 1DUYA 1CK0H 2HN7B 4XZUA 4YZFF 1JHTA 3LKOA 3MRLA 1T2QH 2B1HL 1LO4L 4OKDA 5EA0L 2RCSH 4XI5C 2EXYC 2WBJB 4DN4L 3TYFA 1VHPA 2DQDH 5HI4C 2GJJA 5FKAB 3CXDL 1A2YB 3RFZC 3V4UL 5A16B 5D7LB 4XP4L 2B0SH 1A02N 1R3LA 1H15A 1RZ8A 1U0QA 4OF8A 2YSSA 2ZOKB 4X9IA 3C5ZA 4P5MB 3ZDYF 1HCFX 3MUZ1 4HKBB 3W9DA 5CAYB 5F96L 1CXKA 1EFXD 3L7EB 3O6FC 1ZE3C 5IB5A 1R3JB 4KKCD 1FYTD 2F53A 4FFWD 4W81A 3EUUA 5GJSL 3FO9A 4AH2B 1TVDA 3GIZH 5IHUL 1KIQB 5DMGC 2AJYL 2CUIA 3JVGA 1IM3A 1GGBL 1A9EB 1QFWH 4KUCD 4QNPF 1DLFL 1JNLH 5T3XE 4PRPB 2VLJA 1RVFL 2CKBL 2MMXA 5KTEL 3S96B 3V7AE 4JO1L 3PWJB 4U1SA 4N0UB 4L5FL 2FL5B 1I9JH 4P2OD 3IDIB 4XCYB 2A73B 3WJJA 5D7KD 2XFXA 4CN1A 2IMMA 2A9ML 5E0QA 1LP9B 3FZUD 1X5HA 3TYGL 2JTDA 1NEZA 5CUSL 1HXMA 2R4RH 4YFEA 1I1AA 5HPOA 3MRFB 2ZUWA 4P5TD 3SE3C 1YEEL 4JO4H 1RUML 3I2CH 4U6HA 3FZUC 2DLFH 4Z7UF 3CIQA 1BFTA 4KK6C 1G7MA 4KKAD 4H20H 5D72H 1DSFH 5D8JH 3EYQD 4NC1C 1KPRB 1YEHL 3DHMA 1CU4H 1OF2B 1WFUA 1WUNT 1EMTL 3OR6B 1JNNH 5E4IA 3KLDA 3VFRA 3KPRA 4RA3A 2OI9A 1YNTB 5FA3A 1JRHH 4X5XB 2DM2A 5AG8A 4OT1L 4QHNB 4MCZA 2EYRB 1XZ0B 5T1KB 1LEKB 2A77H 3Q2CA 3X12A 1CE6A 3ET9F 3PWLB 2OSLB 3VGHA 3SGJA 1FORH 1FNGB 3U4BL 3TNNA 4RMWA 1KLGB 1T7WA 5EO1A 3B9VA 1DBML 5FOBB 4QTHA 5D2LA 4HW6A 4LSQH 4LKXA 4TVPD 3F7PC 1QQDA 4YPGA 2EDQA 3QH3B 2WZPD 4EDXA 1YYLH 1EO8L 4OSUH 2Z31A 3F7YA 4FQXA 4X8JB 1NMAH 5FM5M 4CW1A 1AGEB 4QT5A 5D71L 5JHLH 3GK8H 1T21B 1DDHB 2XWBA