3LKUA

Crystal structure of s. cerevisiae get4 in complex with an n-terminal fragment of get5
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
286
structure length
286
Chain Sequence
AKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0363 protein YOR164C
publication title Structural characterization of the Get4/Get5 complex and its interaction with Get3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 116
structure length 286
sequence length 286
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2010-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lkuA01
3RIBA 2HO1A 2LSVA 5DBKA 3CVNA 5FZSA 4GYYA 2XGSA 2R5SA 3OXLA 3VTYA 4J0UA 4KBQA 3EDTB 2KCLA 4GA1A 3TAXA 4UQXA 4I9EA 5EKQD 4I2WA 4JA7A 3R9AB 4GYOA 4WNDA 2Y4UA 5C1DA 4HORA 4N3AA 1TJCA 2FF4A 5CHEE 3KAEA 4NRHB 5CCMA 4N3CA 1ZU2A 5G04J 4HOSA 3MV3B 3ZFWA 5FJYA 3RU0A 2XPIA 2VQ2A 5ARGA 4A1SA 1WM5A 3WXXA 1QZ2A 5KJNA 5A7DB 5FT9A 3UUXA 3ESKA 4I1AA 2IF4A 1XNFA 4N2QA 3ZHEA 4JA9A 5LCWC 3AS5A 3CK7A 4N3BA 3MA5A 4AY6A 5M72A 2VGXB 4U0SA 3PE4A 5JJ6A 4AY5A 1PC2A 5A6CA 3CEQA 3URZA 3UPVA 1OUVA 2UY1B 1ZBPA 2WQHA 3ZPJA 2P58C 1KT1A 4GZ6A 2JLBA 1QQEA 4GZ3A 4WUYA 1FCHA 3GZ2A 3LKUA 4UQZA 3NF1A 3ZN3A 4G25A 1B89A 3OXFA 4XI0A 3Q49B 4UI9C 3QKYA 3IEGA 1E96B 4GA2A 3Q5MA 3MKRA 3CKCA 4I9CA 3Q4AB 3RKVA 3N71A 4Y6CA 4G2VA 3QWVA 3E4BA 2HR2A 3KS2A 3CKBA 4U0ZA 3ASHA 4N5CA 5HQ8A 3LY7A 2V5FA 4LEUA 1NA0A 3CV0A 3SZ7A 4G1TA 3U3WA 2NC9A 3AS4A 2PQRA 5EX3A 3TG5A 3OXGA 2XCCA 4H7YA 4N2SA 3FWVA 3QWPA 4YVOA 2AVPA 4BTAA 2XCBA 4I2ZA 4RG6A 2HYZA 4J8DA 3ULQA 4UQYA 3S7FA 5KJLA 4U04A 3PE3A 3QOUA 2UWJG 2PL2A 3VTXA 4HOUA 5EX0A 2FBNA 4GA0A 4HOTA 4GCNA 4ME2A 2C0LA 4W9RA 4EQFA 1HH8A 2VSNA 1A17A 2J9QA 4J8FA 2YQ8A 3ASDA 2VSYA 3GZ1A 2XEVA 5AYWD 2GW1A 2PQNA 4U07A 4Y6WA 1Y8MA 3LY8A 3RO2A 1W3BA 3O48A 3ZHEB 5JJTA 3AS8A 3GW4A 5KJMA 2VGYA 2KCKA 5D0OD 3FP3A 2YHCA 3KD7A 4IN3B 1KLXA 4N39A 4WNEA 4YNDA 2FEZA 4BWRA 3JYSA 5ARFA 3CVLA 2DBAA 3QDNA 3Q47B 4I17A 4KYOB 5HI7A 1NZNA 4JHRA 5BW8C 3MV2B 5G05C 5FZQA 4WNGA 4JL0A 1NA3A 2ONDA 2I6HA 1P5QA 5LCWJ 4H7XA 4BT8A 2KATA 2WPVA 3ASGA 4APOA 5FTPA 4BT9A 3CK8A 3S7BA 4GPKA 2FI7A 5FZRA 4B94A 3LCAA 4YVQC 4NQ0A 3S7JA 3K9IA 3S7DA 2KCVA 3Q15A 5BNWA 3FFLA 4GYWA 5D0QD 2QFCA 4HOQA 1IYGA 3PDNA 3SF4A 3CVQA 4AM9A 4XI9A 4U0UA 4UI9J 3ASFA 4ABNA 4WNFA 5DIZA 3QWWA 1YA0A 3ZGQA 2VGXA 5G05J 4CGVA 3TG4A 3CK9A 1KT0A 5JJ7A 2KC7A 1WAO1 2LNIA 2PZIA 2UY1A 1ELWA 3UQ3A 3GYZA 4J8EA 2VYIA 4XIFA 5BT1A 4AIFA 3HYMB 4F3VA 1HXIA 2IFUA 1ELRA 2FO7A 2L6JA 4G26A 3U4TA 2XGOA 4O6FA 5KJKA 4UI9K 4CDRA 4CGWA 2OOEA 2E2EA 4KXKB 3LY9A 3RO3A 3LYAA 2C0MA 3LPZA 2LSUA 5CCLA 4G24A 3TGOA 2Y4TA 2BUGA 3BEEA 4RG9A 5G04C 3MEKA 3CVPA 4GCOA 4BTBA 3RJVA 4G23A 2MHKA 2C2LA 4GZ5A 2XGMA 1HZ4A 1IHGA 2Q7FA
chains in the Genus database with same CATH superfamily
5LP0A 2HO1A 4A3VA 2CHWA 4A1GA 1UOHA 2DYSE 3OXLA 4F6RD 1S64A 3BG1B 2FO1E 2AWIA 3B7RL 4D10C 4ZFHA 4I9EA 1JPLA 3DBSA 3GZSA 2QC9A 1QNFA 3HXFA 3TWRA 3NBNB 4L7TA 3TL5A 4K5AB 4FADA 1SVXA 2QZAA 2WXGA 3LXUX 3ESLA 3RAUA 5ENOD 5C1DA 2AW6A 4N3AA 1K1AA 1TJCA 4EZJA 3KAEA 4ANWA 4N3CA 4F1PA 2XHEA 3CQCB 4XE0A 5ENTD 1TEZA 2NSZA 4KMOA 3RU0A 3DSUA 3UIPC 4A1SA 1WM5A 4OAVB 4OVUA 2R2LA 3UMVA 3OAWA 5FT9A 4I1AA 2IF4A 3MKQB 4N2QA 3ZHEA 4JA9A 3CK7A 4N3BA 3MA5A 3EUVA 1DCEA 4U0SA 3PE4A 2WQ6A 3CEQA 3G2UA 1NI1A 3UM2A 2P58C 1EDUA 2BKGA 4GZ3A 2BEDA 2WB2A 3WG7E 3RRUA 5BUZA 3LKUA 4HXIA 3EHMA 3TJPA 3UM1A 3NF1A 3ZN3A 4EBAG 4DX5D 2WQ7A 4NURA 2ZGDA 3IEGA 1E96B 1N95A 4TRQA 5CMWA 2WXIA 3ZRHA 1GW6A 2V8SE 1UW4B 3I4GA 2HR2A 1SQMA 3FTZA 2H6FA 3CKBA 4I6JA 5EYLA 1N0QA 1MX6A 4LNUD 4PS7A 4N5CA 1SA5A 3PZ4A 3T8KA 3MJWA 5AAOA 3T9KA 2J49A 2X6KA 4G1TA 2E0IA 2NC9A 1OCCE 2PQRA 4FJYA 3TG5A 4PS8A 2A5EA 2XCCA 3LVQE 4RG6A 4WAFA 3TXNA 2I1KA 1INZA 3UT8A 4DK5A 3OTNA 4GTQA 2UWJG 3ABKE 2XEEA 1UN8A 4U8YD 2IOLA 2ZU6B 2XPZA 2EIME 4TXPA 5EX0A 1WG0A 3V2XA 4HOTA 5EN5D 4FA6A 2C0LA 3Q73A 3W9FA 1HE8A 2CG2A 1IQRA 1TN7A 3ZEFA 2J9QA 4MBGA 4HFGA 4DX6D 2ETBA 5EDSA 1PY1A 4BX8A 4GTVA 4U07A 2EILE 4YDWA 4M3OA 3B7UX 3RO2A 4F7AA 3O48A 3QJZA 3P2BA 5JJTA 3B95A 3EHNA 4NACA 3KD7A 2P9SG 4IN3B 1KLXA 2KM4A 3TWVA 5E76A 1PAQA 2WMNA 3HRAA 4AP2A 3MGBA 3CVLA 3SNXA 2XZDG 1O1SA 1LTXA 4JHRA 3SFXA 5FZQA 1H6PA 4DJAA 1N9AA 4UWGA 2RKKA 3FULA 2ONDA 2L0IA 3AU4A 2I6HA 3L54A 3FTYA 3MZLB 1E90A 2L0TB 4LSZE 3HXBA 2FI7A 2PM6A 3ZKJA 4ANUA 5FZRA 4MKTA 1O1RA 2WXHA 2R05A 4DX2A 3AJIA 4FU3A 3K9IA 2KCVA 3V79K 4GYWA 2QFCA 1H19A 3ZXSA 3QNKA 3SF4A 4AM9A 3SFYA 3CQGB 5AJDA 4URKA 2Y0BG 3CVXA 1V55E 4CT0A 1RW2A 3D9MA 2XENA 1YA0A 4KT6B 4MLPA 1HG2A 2VGXA 3LDZA 3HVEA 3NOGD 3CK9A 3SY2A 3UKRG 5JJ7A 3UXGA 2KC7A 3D9LA 2PZIA 2UY1A 5AQ9A 5E75A 1ELWA 4E85A 3TWSA 1EF1C 3HYMB 4U96D 5BXUA 1NL4A 5CBNA 2OEWA 2IFUA 4JPSA 3LS8A 2GROB 1ELRA 2IONA 2FO7A 1N94A 3SO8A 1N0RA 3U4TA 2AXZA 3ZVVA 1E8ZA 4O6FA 2X38A 3CLJA 1OWOA 3RRNB 4CDRA 2F8XK 3ENEA 5LFAA 2E2EA 3LY9A 3LYAA 4LNBA 2C0MA 3L6AA 4U7EB 5AIJA 5ENQD 3IV0A 3TGOA 1TNUA 4RG9A 5G04C 3CGHA 3DSXA 2YNQA 2V4LA 5KWDA 2EQXA 4GCOA 4RSYA 3B13A 3ZYLA 2YINA 4BTBA 3RJVA 4U8VD 4FULA 4FJZA 1MHQA 3PZ1A 3Q9UC 2Q7FA 4KZCA 5DBKA 4IRUA 2DVWA 2XGSA 3NOCD 1ZB1A 4GA1A 2P9IG 1KPSB 5C2YA 2DYRE 4CDMA 3PNLB 3D9OA 4UUCA 4EECA 2NYJA 2B6CA 5HS0A 5BXOA 3EHQA 1O5MA 1HFAA 5AQBA 4BX9A 4B8CB 4GYOA 4WNDA 5LOZA 3S2AA 3UTMA 4B89A 3EU9A 4YDEA 5FINA 5FQ7A 3SHFA 4NRHB 2J8SD 3NQPA 5G04J 1ZU2A 3MV3B 1OWPA 4K5CA 2R59A 2VQ2A 3FUKA 3WXXA 2J4BA 2VTBA 1H6OA 2J08A 4DX1A 5EYPF 1MQSA 5LCWC 1N52A 2DZNA 3DSSA 4ILIA 3HIZA 3SQVA 3VLFA 3APDA 5JHAA 2XZTG 5CRUA 4J7WA 2BTDA 1FVHA 1HS6A 3URZA 3T5VA 4L1BA 3UPVA 1BLXB 1ZBPA 4BFRA 2IO3C 4GTPA 4FHKA 5FQ4A 4ANXA 1MX2A 1KT1A 4B93B 3FU6A 3EJNA 3FTXA 4WUYA 4ZHBA 3GZ2A 4J8SA 4UQZA 3SGHA 2X6FA 4XEIG 4HS2A 1OY3D 3SD5A 4ACKA 1B89A 1YMPA 1D9SA 3OXFA 4UI9C 3Q5MA 3CVYA 5HKPA 3U64A 2AXUA 3CKCA 2BKKB 4GTOA 1WDYA 1DVPA 3EU5A 3Q4AB 4WWPA 3CHRA 3IBEA 4Y6CA 4B0ZA 3PRZA 1Z5SC 1UN9A 5CEAA 3CVUA 3ABLE 3ASHA 2WXNA 1H6KA 4F53A 5ENNA 3LY7A 2P9UG 3FUHA 3ZW3A 3FH5A 4P29A 4JHKA 2GRLA 4B8AA 1TNBA 3DSWA 3ZUVB 1JWGA 3L16A 3U3WA 4JVSA 3FY4A 3CHSA 3LEWA 2F8YA 3UM3A 5EX3A 3FEXA 4Q94A 5T8IA 4I2ZA 1OWNA 4UQYA 4J8DA 2KZTA 3S7FA 4U04A 1NP7A 4TXRA 2OCCE 3PREA 2PL2A 3I4RB 3KEAA 1IXVA 4GA0A 2WMOA 1VDYA 4GCNA 5KCMA 4CRWA 4ME2A 4U63A 2VSNA 1TYQG 1A17A 3FTUA 2XEHA 3D9HA 2XEVA 3JQ0A 2PQNA 4BERA 3FH7A 2RD0A 4FLHA 3FTVA 3LY8A 1S0PA 3MYVA 4EBAA 1SZ9A 3GW4A 5KJMA 1AP7A 2VGYA 5D0OD 5G55A 5IY5E 1SW6A 3ML8A 4N39A 4WNEA 4C9BB 4ILGA 4APFA 4EPZA 3EHRA 4YDYA 2H6GA 1S63A 4XKCA 4EZKA 3L82A 5ARFA 2WM9A 2DIWA 2DBAA 3FUJA 3J5QB 3Q47B 4UWFA 4IULA 4KYOB 4JEHA 1NZNA 3MV2B 2ZISA 3MCXA 3EIJA 4WNGA 2OEVA 1G3NB 3AU5A 2DWZA 1E8WA 2VSXE 3ISMC 1JCSA 3UT4A 1NA3A 2WXQA 1FPPA 3D9JA 4L2YA 4H7XA 3VLDA 4RVBA 4IYPA 4BETA 2WPVA 4WWOA 5T3RA 3IXEA 3PEVB 4LNGA 1MX4A 1LF8A 4AJWA 3S7BA 4GPKA 3ZIMA 2PM7A 4YVQC 4I43A 3FU5A 4L9PA 1IHBA 5BV0A 2IJGX 3SI5A 4BY6A 5J08A 5BNWA 3NB2A 4O1OA 4HOQA 4HI9A 4ATZD 4OAUC 4XI9A 3BU8A 5ENSD 1Z3XA 3VLEA 2XS8A 3U9WA 3MKQA 3I3NA 4ABNA 3FDHA 5DIZA 2WXKA 3ZGQA 3ZYKA 1E8YA 4RLYA 4HNAD 3HDXA 3TG4A 1TNYA 2LNIA 3FUIA 3U66A 5FQ8A 2RG8A 3CHOA 2IO2C 4F3VA 4RQIA 2M63A 4R7LA 5AJLA 4GAAA 4ACLA 2IY0C 4UWKA 4DI4A 2GRMA 4I1MA 2XGOA 4QQIA 3HVEB 1KZOA 3P1UA 4LUNU 3AG3E 4MS6A 4UI9K 3T8MA 4KXKB 2YHEA 4ANVA 4GMRA 2X3MA 5CCLA 2GRQB 3CVVA 4C48B 4G8KA 2BUGA 3BEEA 4TV3A 4UWLA 4NIKA 4JHJA 1K1BA 4JZYA 1U3CA 3PS6A 2MHKA 5CERB 1X81A 3ZNGA 4PDXA 2LSVA 4CT4A 1K8KG 2OVBA 3CVNA 2BF0X 4JD2G 1NFIE 2R5SA 1UJJA 2P9PG 3VTYA 4J0UA 2QY7A 4UQXA 3DXKG 3DPDA 4CZ2D 1FT2A 5FIOA 4ILHB 3E34A 3E30A 4UWHA 5J90A 1Q2ZA 1HF8A 4I2WA 1OXJA 2R03A 3D9KA 3FU3A 4JW1A 4G11A 4JA7A 3AAAC 1LD7A 3R9AB 1N4SA 3FUMA 3TWXA 2I1JA 1OT8A 2P9NG 1N4RA 4GB9A 2Y4UA 4DUIA 2LAHA 1XGWA 2LO6A 3L08A 5BV1A 5CHEE 2NXPA 3E37A 2AJAA 5CCMA 4O1PA 4DRXE 4HOSA 3ZFWA 2X6JA 2WXMA 4Q96A 3FUNA 3NZUA 5A7DB 3UUXA 4G8LA 2RFAA 1SA4A 3KSLA 1IQUA 1XNFA 3LJNA 4FC8A 1MJ0A 1A5EA 4AY6A 5A6CA 3UI2A 1V54E 2GRPB 3D9IA 2EINE 1TNZA 3ZPJA 4EHMA 1O1TA 2LXMA 1KZPA 1RZ4A 4JC8A 3HG0D 2WXJA 3DSTA 2XS1A 5CRVA 1MZCA 5CMYA 4XX5A 4XZ4A 4G25A 3V2OA 1D8EA 3BQOA 2GGFA 5ENPD 3D3MA 2A4ZA 4DI3A 2LXLA 3MKRA 4I9CA 1U2VG 3RKVA 3N71A 4G2VA 2R02A 1DNPA 4KZ0A 1MYOA 3V30A 3KS2A 3Q78A 4U0ZA 3CHQA 2WXOA 5JA4D 5HQ8A 3PNTB 4Z68A 2X6HA 2V5FA 4J8YA 4LEUA 1NA0A 3CV0A 3QK0A 3Q7AA 5FWQA 4GZCA 4BEPA 5B3SE 3G2WA 1JCRA 2WVIA 3Q7FA 3AS4A 3JUIA 3D9NA 4H7YA 4N2SA 3QWPA 2AVPA 1L5JA 4JEUA 2HYZA 5CEDB 4E6HA 4HVBA 5KJLA 5FQ6A 2CHZA 2GRRB 3Q75A 3QOUA 2OV8A 3ULEG 3O4ZA 2DZOA 4CCAA 2FBNA 2L6BA 1FVFA 4W9RA 4EQFA 1TN8A 3L17A 4J8FA 3Q9NC 3FUEA 3RK6A 2KZTB 3AG1E 4WWNA 5AYWD 4AVXA 1TR4A 2GW1A 3RSEG 5D2MC 1Y8MA 1W3BA 3FU0A 2FULA 5A23A 3ZHEB 1BI7B 3UM0A 2XRYA 3AS8A 3ONKA 4AV7A 3FP3A 2KXPC 2YHCA 4BSZB 2HE0A 3TXMA 1N54A 4FP7A 2Y69E 4GTTA 4HRNA 2I2OA 4V3IA 3LJ3A 5ANLA 4I17A 3G2VA 4F1SA 5HI7A 3NZSA 3C5RA 5G05C 2J4DA 2VSOE 1H2TC 2RFMA 3NAWA 4JL0A 3HXEA 5KNGA 3IKOB 4AOFA 5LCWJ 3CSTA 1BI8B 4Q69A 2JABA 2MOWA 1WY6A 4BT8A 2MYOA 3QARA 2J07A 5FTPA 4BT9A 3CK8A 1LD8A 3B7SA 2P2CP 2ZXWE 4B94A 3LCAA 4NQ0A 3Q79A 2H6IA 4TXQA 3E33A 1N4PA 3S7JA 3APFA 2VGEA 4GTSA 3S7DA 3Q15A 1H0AA 3FFLA 4HRMB 4PS3A 4CEMA 3B7TA 4GU5A 1S70B 2R17C 4N5QA 4GPMA 3HXDA 4ATGA 4UI9J 4CYMD 3ASFA 1BPOA 3F6QA 4HI8A 4BSXA 2QYJA 3DEOA 4GMJA 4LCTA 2IEJA 5G05J 4CGVA 1KT0A 2LAIA 3PUJA 1JCQA 3IHVA 3DRAA 5BT1A 4AIFA 4M7CA 2IQCA 2QYUA 5AQAA 2CFUA 3FTSA 4HLLA 4G26A 3UX4A 5BPPA 3B7BA 4FHJA 1E7VA 3DPYA 3DXMG 3JQ1A 2OOEA 5KNHD 2ETCA 3ZXPA 5G2NA 3LPZA 3BUAA 3W9GA 2LSUA 5D66A 3UIOC 4A3TA 2Y4TA 3CHPA 4JB8P 4EZLA 1UJKA 2IU1A 1N4QA 3CVPA 4HB5A 1TNOA 3R7QA 5EILA 3AG2E 4G23A 3IHYA 2C2LA 1SZAA 4C0EA 2XGMA 1HZ4A 5EIDA 3RIBA 5ENRD 5FZSA 4GYYA 2EIJE 3BG0B 3FHEA 4KBQA 1OCZE 3EDTB 4I6EA 2KCLA 5AN8A 3TAXA 2IOSA 2WXRA 2V4HC 3QB2A 2X6IA 5CBOA 5EKQD 4HLEA 4C0MA 4GMLA 4HBDA 3C98A 3AG4E 3PH0C 4K0RA 1UG3A 1U3DA 3C3QA 5HRYA 2F0YA 3CVWA 1HX8A 4HORA 4FLBA 3JCKC 4AEZC 3PZ2A 2FF4A 3CIAA 3T5XA 3UINC 3CR3A 2XPYA 4KVMA 5FJYA 2XPIA 5ARGA 1AWCB 1QZ2A 5KJNA 1QBQA 1D8DA 3ESKA 3ML9A 2CG3A 3AS5A 5M72A 2VGXB 5LX8A 2XQ0A 5JJ6A 2JEKA 4AY5A 1PC2A 1OUVA 2UY1B 2WQHA 5AENA 3CSFA 4TUMA 4LG6A 4GZ6A 3TWUA 4AXHA 2JLBA 1QQEA 2J09A 1ELKA 1FCHA 3L9TA 2WXLA 1E7UA 2EIKE 1EYHA 3JXJA 4JXTA 3PZDA 4XI0A 3C3OA 1K3ZD 1YYHA 3Q49B 3QKYA 2CFZA 4GA2A 2WXPA 2OVFA 2LUHA 4DLOA 1YCSB 4A55A 4YDOA 3V31A 3QWVA 3E4BA 3RRMB 3PEUB 4KVOA 4HQDA 4U95D 3I5PA 3JUEA 3ULYA 3J5PA 3SZ7A 2ILRA 3MX3A 4X8QA 2F37A 3ZYQA 1DC2A 4A63B 3OXGA 4DX7D 4PUCA 1JUQA 3FWVA 4YVOA 4BTAA 2XCBA 3ULQA 1BD8A 3PE3A 1Z3YA 2ZIRA 5H7PA 4DLQA 3VTXA 4HOUA 2HM8A 3FEYA 5JHBA 3R7RA 4OYSA 3TWQA 3QC1A 1BU9A 2ZGGA 1HH8A 3PVLA 1Y6IA 2YQ8A 3ASDA 4LERA 1OWMA 2V0PA 2VSYA 3GZ1A 1H2VC 3HXCA 5ANRA 2Y1LE 3DEPA 4Y6WA 1Z6TA 2MRIA 2VTBB 4L2LA 4J6IA 4BESA 3PUKA 1FT1A 3TWWA 4PH4B 3R9MA 2KCKA 3FUDA 3HHMA 2V5QC 2Y3AA 3ZU7B 2WXFA 4CDNA 3G2SA 5T4YA 4YNDA 4I6GA 2FEZA 4BWRA 3JYSA 3QDNA 4MRUA 4QFVA 1DCQA 5BW8C 2B0OE 5ITZF 3JXIA 2KBXA 3APCA 4HRLA 1X5BA 5B1AE 3QAQA 1EPUA 4U8HA 1JWFA 3CHMA 1P5QA 3ZYMA 2PNNA 5CECB 4GTRA 1OCRE 1TJFA 2KATA 1OWLA 1TN6A 3ASGA 2DCPA 4APOA 4XKBA 3EIQC 2ETAA 4LRZA 2XRZA 3UT7A 3D9PA 2L9BA 3PZ3A 4TUUA 1IKND 5D0QD 1QYMA 3KEZA 3L22A 5AARA 1IYGA 3PDNA 3SBSA 1E8XA 3CVQA 4U0UA 5JMND 3X2QE 3G2TA 4WNFA 4L23A 3QWWA 5AQ7A 2A5UA 4I1OB 4GZDA 1HU3A 3DWLG 3ONLA 1OCOE 4K5BA 1WAO1 2P9KG 3UQ3A 3UKUG 3GYZA 4J8EA 2VYIA 3LVRE 4XIFA 5B1BE 3KSQA 4GTMA 1HXIA 3ASOE 2GRNB 3C3RA 2H6HA 2L6JA 1N11A 5KBAA 5KJKA 4K03A 3DSVA 4CGWA 2AXVA 3SFZA 4DPRA 1H2UA 3RO3A 2P9LG 3SBTB 2I9CA 3ASNE 3L13A 3FH8A 4G24A 3ABME 4OVVA 3FTWA 3MEKA 2CHXA 3TWTA 1HG5A 5EIBE 1HO8A 3C72A 2VJ8A 3E32A 4GZ5A 4O60A 1IHGA 3FUFA
chains in the Genus database with same CATH topology
3RIBA 5LP0A 2HO1A 2LSVA 4KZCA 5DBKA 4CT4A 2OVBA 4A3VA 3CVNA 2CHWA 4IRUA 4A1GA 2BF0X 5FZSA 4GYYA 2XGSA 2R5SA 1UJJA 3OXLA 3VTYA 3BG0B 4J0UA 3FHEA 4KBQA 3EDTB 2QY7A 4I6EA 2KCLA 4GA1A 4W9RA 3BG1B 3TAXA 2AWIA 2IOSA 2WXRA 3B7RL 4UQXA 4D10C 3DPDA 5C2YA 4I9EA 3QB2A 4CDMA 1JPLA 2X6IA 3PNLB 3D9OA 3DBSA 4ILHB 3GZSA 5EKQD 4UWHA 4EECA 4HLEA 5J90A 1QNFA 4L7TA 3TL5A 4C0MA 1HF8A 4I2WA 4GMLA 4FADA 3D9KA 3FU3A 4JW1A 1HFAA 3C98A 4G11A 4JA7A 4BX9A 3R9AB 3FUMA 4B8CB 4GYOA 3PH0C 4K0RA 4WNDA 1UG3A 5LOZA 2I1JA 2WXGA 1U3DA 3ESLA 3LXUX 3CVWA 4GB9A 3S2AA 2Y4UA 4B89A 1HX8A 5C1DA 4HORA 2AW6A 3JCKC 4FLBA 2LAHA 5FQ7A 4N3AA 1XGWA 3SHFA 2LO6A 3L08A 4AEZC 5BV1A 1TJCA 2FF4A 5CHEE 2NXPA 4EZJA 3KAEA 4NRHB 3CIAA 3T5XA 5CCMA 4ANWA 3CR3A 3NQPA 4N3CA 1ZU2A 5G04J 2XHEA 4HOSA 3CQCB 4XE0A 3MV3B 3ZFWA 2X6JA 1TEZA 2XPYA 1OWPA 2NSZA 2WXMA 4KVMA 4KMOA 2R59A 5FJYA 3RU0A 2XPIA 2VQ2A 5ARGA 3FUKA 4A1SA 1WM5A 4Q96A 4OVUA 3WXXA 1QZ2A 3FUNA 3NZUA 3UMVA 3OAWA 5KJNA 5A7DB 2J4BA 5FT9A 3UUXA 2VTBA 1IQUA 3ESKA 2J08A 4I1AA 1XNFA 2IF4A 3MKQB 3ML9A 4N2QA 4FC8A 1MQSA 3ZHEA 4JA9A 5LCWC 2CG3A 3AS5A 3CK7A 1N52A 4N3BA 4ILIA 3MA5A 3HIZA 4AY6A 5M72A 3VLFA 3APDA 5JHAA 2VGXB 5LX8A 2XQ0A 4U0SA 3PE4A 5JJ6A 2JEKA 4AY5A 2BTDA 1FVHA 2WQ6A 1PC2A 1HS6A 5A6CA 3CEQA 3URZA 3T5VA 3G2UA 4L1BA 3UPVA 1OUVA 2UY1B 3D9IA 1ZBPA 4BFRA 2WQHA 3ZPJA 5AENA 4FHKA 3CSFA 2P58C 5FQ4A 4ANXA 1EDUA 1KT1A 4GZ6A 3FU6A 4AXHA 2JLBA 3EJNA 1QQEA 3FTXA 4GZ3A 4WUYA 2J09A 1ELKA 4JC8A 1FCHA 2WB2A 3RRUA 3GZ2A 2WXLA 3LKUA 4HXIA 4J8SA 4UQZA 5BUZA 2WXJA 3EHMA 3TJPA 1E7UA 3SGHA 2X6FA 1EYHA 5CMYA 4HS2A 3NF1A 3SD5A 3ZN3A 4XX5A 4JXTA 4XZ4A 4G25A 1B89A 4ACKA 4EBAG 3OXFA 3PZDA 4XI0A 2GGFA 2WQ7A 4NURA 3Q49B 4UI9C 3QKYA 2CFZA 3IEGA 1E96B 3D3MA 4GA2A 2WXPA 4TRQA 3Q5MA 2A4ZA 5CMWA 4DI3A 3CVYA 2WXIA 2OVFA 3U64A 2AXUA 3MKRA 3ZRHA 3CKCA 4DLOA 4I9CA 1DVPA 3Q4AB 3RKVA 4WWPA 4A55A 3CHRA 1GW6A 3IBEA 3N71A 4Y6CA 4B0ZA 4G2VA 3PRZA 3QWVA 1DNPA 3E4BA 4KZ0A 2V8SE 3RRMB 1UW4B 3I4GA 2HR2A 1UN9A 1SQMA 3FTZA 3PEUB 4KVOA 3KS2A 3CKBA 4I6JA 3CVUA 4U0ZA 3CHQA 2WXOA 3ASHA 2WXNA 1H6KA 4PS7A 4F53A 4N5CA 5HQ8A 3I5PA 5ENNA 3LY7A 3PNTB 3MJWA 2X6HA 2V5FA 3FUHA 3ZW3A 4LEUA 3FH5A 4P29A 1NA0A 4JHKA 3CV0A 3QK0A 2GRLA 4B8AA 5FWQA 4GZCA 3SZ7A 1JWGA 2ILRA 3MX3A 2J49A 2X6KA 4G1TA 2E0IA 3G2WA 3L16A 3U3WA 2NC9A 4JVSA 3FY4A 2WVIA 3ZYQA 3CHSA 3AS4A 3LEWA 2PQRA 4FJYA 3JUIA 5EX3A 3TG5A 3OXGA 4PUCA 4PS8A 3FEXA 3D9NA 4Q94A 2XCCA 4H7YA 4N2SA 1JUQA 3FWVA 3QWPA 5T8IA 4YVOA 2AVPA 4BTAA 1L5JA 2XCBA 3LVQE 1OWNA 2HYZA 4J8DA 2KZTA 4JEUA 4I2ZA 4RG6A 4UQYA 4WAFA 3S7FA 4U04A 3TXNA 3ULQA 5FQ6A 4E6HA 5KJLA 2I1KA 3PE3A 1NP7A 2CHZA 3UT8A 4DK5A 1INZA 3OTNA 3PREA 3QOUA 2UWJG 2PL2A 1Z3YA 2OV8A 4DLQA 1UN8A 2IOLA 2ZU6B 2XPZA 3VTXA 3O4ZA 4HOUA 3I4RB 5EX0A 4CCAA 2FBNA 2HM8A 3FEYA 5JHBA 3R7RA 4GA0A 2WMOA 4OYSA 4HOTA 1VDYA 4GCNA 5KCMA 4CRWA 1FVFA 3QC1A 4FA6A 4ME2A 2C0LA 1HE8A 1IQRA 2CG2A 1HH8A 4U63A 2VSNA 3PVLA 1Y6IA 1A17A 2J9QA 3ZEFA 4EQFA 3L17A 4J8FA 4HFGA 2YQ8A 3FUEA 3ASDA 3RK6A 2KZTB 4LERA 3FTUA 1OWMA 2V0PA 5EDSA 2VSYA 3GZ1A 2XEVA 1H2VC 5ANRA 1PY1A 4WWNA 5AYWD 4AVXA 4BX8A 2GW1A 2PQNA 3JQ0A 3FH7A 4U07A 4Y6WA 2RD0A 4M3OA 1Z6TA 1Y8MA 3B7UX 3FTVA 2MRIA 3LY8A 4FLHA 3RO2A 1W3BA 4F7AA 1S0PA 2VTBB 3FU0A 4L2LA 3O48A 2FULA 3QJZA 3MYVA 4J6IA 5A23A 3ZHEB 4EBAA 1SZ9A 2XRYA 3PUKA 3P2BA 4PH4B 5JJTA 3AS8A 3GW4A 5KJMA 2VGYA 2KCKA 3FUDA 3ONKA 3EHNA 5D0OD 5G55A 4AV7A 3FP3A 3HHMA 2Y3AA 4NACA 2YHCA 3ML8A 3KD7A 4IN3B 3TXMA 1N54A 4FP7A 1KLXA 4N39A 2WXFA 2KM4A 4WNEA 5E76A 4C9BB 4CDNA 4ILGA 4APFA 4EPZA 3G2SA 1PAQA 5T4YA 2WMNA 4XKCA 4EZKA 2I2OA 4YNDA 4I6GA 2FEZA 4BWRA 3JYSA 4V3IA 5ARFA 2WM9A 3MGBA 3CVLA 4AP2A 2DIWA 3LJ3A 3SNXA 2DBAA 3FUJA 3QDNA 4MRUA 3Q47B 4UWFA 5ANLA 4I17A 3G2VA 4F1SA 4IULA 4KYOB 4QFVA 4JEHA 5HI7A 1NZNA 3NZSA 4JHRA 5BW8C 3MV2B 3MCXA 5G05C 5FZQA 3EIJA 2J4DA 4WNGA 3APCA 3AU5A 2VSOE 1E8WA 1X5BA 2VSXE 3QAQA 4DJAA 1H2TC 3UT4A 1EPUA 4U8HA 4UWGA 1JWFA 4JL0A 3FULA 1NA3A 3CHMA 2ONDA 2WXQA 2L0IA 3AU4A 2I6HA 1P5QA 3IKOB 3L54A 3ZYMA 4AOFA 3FTYA 3CSTA 3D9JA 4L2YA 5LCWJ 3MZLB 4Q69A 4H7XA 3VLDA 2MOWA 1TJFA 1WY6A 4RVBA 4BT8A 4IYPA 1E90A 2KATA 2L0TB 2WPVA 4WWOA 5T3RA 1OWLA 3ASGA 3QARA 2DCPA 4APOA 3PEVB 2J07A 5FTPA 4XKBA 4BT9A 3CK8A 1LF8A 4AJWA 3S7BA 3EIQC 3B7SA 2FI7A 2PM6A 4GPKA 4ANUA 4LRZA 5FZRA 4MKTA 3ZIMA 4B94A 2WXHA 3LCAA 2PM7A 4YVQC 2XRZA 4NQ0A 3UT7A 3D9PA 4I43A 3FU5A 3S7JA 2L9BA 5BV0A 2IJGX 3APFA 4FU3A 3K9IA 3S7DA 2KCVA 3Q15A 3SI5A 4BY6A 5J08A 5BNWA 1H0AA 4TUUA 3FFLA 4GYWA 5D0QD 2QFCA 1H19A 3ZXSA 4PS3A 4HOQA 3KEZA 3QNKA 4CEMA 3L22A 1IYGA 3PDNA 3SF4A 3B7TA 4GU5A 1E8XA 3CVQA 3SBSA 4AM9A 2R17C 4XI9A 3CQGB 4HVBA 4U0UA 5AJDA 1Z3XA 3VLEA 4ATGA 4URKA 4UI9J 3U9WA 3CVXA 3G2TA 3ASFA 3MKQA 3I3NA 4ABNA 4CT0A 1BPOA 4WNFA 3D9MA 4L23A 3FDHA 5DIZA 4BSXA 2WXKA 1YA0A 3QWWA 4KT6B 2A5UA 4I1OB 4MLPA 1HG2A 4GZDA 3ZGQA 3ZYKA 1HU3A 1E8YA 2VGXA 4GMJA 4LCTA 5G05J 3ONLA 3LDZA 3HDXA 3HVEA 3CK9A 3TG4A 4CGVA 1KT0A 2LAIA 3PUJA 5JJ7A 2KC7A 3D9LA 1WAO1 2LNIA 2PZIA 2UY1A 3FUIA 5E75A 1ELWA 3UQ3A 3U66A 5FQ8A 4E85A 2RG8A 3GYZA 3IHVA 4J8EA 2VYIA 3LVRE 4XIFA 5BT1A 3CHOA 1EF1C 4AIFA 3HYMB 4F3VA 2IQCA 1HXIA 2IFUA 4JPSA 3LS8A 2M63A 1ELRA 2IONA 4R7LA 2FO7A 5AJLA 4GAAA 4ACLA 2CFUA 2L6JA 4UWKA 3FTSA 4DI4A 4G26A 2GRMA 2AXZA 4I1MA 3U4TA 2XGOA 3UX4A 3ZVVA 5BPPA 3HVEB 1E8ZA 3P1UA 4LUNU 4O6FA 4MS6A 4FHJA 5KJKA 1E7VA 2X38A 4UI9K 3CLJA 4K03A 3T8MA 1OWOA 3RRNB 4CDRA 3JQ1A 4CGWA 2AXVA 2OOEA 3SFZA 3ENEA 5LFAA 4DPRA 2E2EA 4KXKB 1H2UA 3LY9A 3RO3A 3LYAA 2YHEA 3SBTB 5G2NA 4ANVA 2C0MA 2I9CA 3L6AA 3LPZA 2LSUA 2X3MA 5CCLA 3L13A 5AIJA 3CVVA 3FH8A 3IV0A 4G24A 4A3TA 3TGOA 4OVVA 2Y4TA 3CHPA 2BUGA 3BEEA 4EZLA 1UJKA 3FTWA 4RG9A 2IU1A 4TV3A 3MEKA 3CGHA 4UWLA 5G04C 2CHXA 3CVPA 2YNQA 2V4LA 1HG5A 4JHJA 1HO8A 2EQXA 4GCOA 3R7QA 4RSYA 2VJ8A 3B13A 4JZYA 1U3CA 3ZYLA 2YINA 4BTBA 3RJVA 3PS6A 4G23A 2MHKA 2C2LA 3IHYA 4FULA 1SZAA 4C0EA 4GZ5A 2XGMA 4FJZA 1HZ4A 1MHQA 1IHGA 2Q7FA 3FUFA 4PDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  2HO1 A;  2LSV A;  5DBK A;  3CVN A;  5FZS A;  4GYY A;  2XGS A;  2R5S A;  3OXL A;  3VTY A;  4J0U A;  4KBQ A;  3EDT B;  2KCL A;  4GA1 A;  3TAX A;  4UQX A;  4I9E A;  5EKQ D;  4I2W A;  4JA7 A;  3R9A B;  4GYO A;  4WND A;  2Y4U A;  5C1D A;  4HOR A;  4N3A A;  1TJC A;  2FF4 A;  5CHE E;  3KAE A;  4NRH B;  5CCM A;  4N3C A;  1ZU2 A;  5G04 J;  4HOS A;  3MV3 B;  3ZFW A;  5FJY A;  3RU0 A;  2XPI A;  2VQ2 A;  5ARG A;  4A1S A;  1WM5 A;  3WXX A;  1QZ2 A;  5KJN A;  5A7D B;  5FT9 A;  3UUX A;  3ESK A;  4I1A A;  2IF4 A;  1XNF A;  4N2Q A;  3ZHE A;  4JA9 A;  5LCW C;  3AS5 A;  3CK7 A;  4N3B A;  3MA5 A;  4AY6 A;  5M72 A;  2VGX B;  4U0S A;  3PE4 A;  5JJ6 A;  4AY5 A;  1PC2 A;  5A6C A;  3CEQ A;  3URZ A;  3UPV A;  1OUV A;  2UY1 B;  1ZBP A;  2WQH A;  3ZPJ A;  2P58 C;  1KT1 A;  4GZ6 A;  2JLB A;  1QQE A;  4GZ3 A;  4WUY A;  1FCH A;  3GZ2 A;  3LKU A;  4UQZ A;  3NF1 A;  3ZN3 A;  4G25 A;  1B89 A;  3OXF A;  4XI0 A;  3Q49 B;  4UI9 C;  3QKY A;  3IEG A;  1E96 B;  4GA2 A;  3Q5M A;  3MKR A;  3CKC A;  4I9C A;  3Q4A B;  3RKV A;  3N71 A;  4Y6C A;  4G2V A;  3QWV A;  3E4B A;  2HR2 A;  3KS2 A;  3CKB A;  4U0Z A;  3ASH A;  4N5C A;  5HQ8 A;  3LY7 A;  2V5F A;  4LEU A;  1NA0 A;  3CV0 A;  3SZ7 A;  4G1T A;  3U3W A;  2NC9 A;  3AS4 A;  2PQR A;  5EX3 A;  3TG5 A;  3OXG A;  2XCC A;  4H7Y A;  4N2S A;  3FWV A;  3QWP A;  4YVO A;  2AVP A;  4BTA A;  2XCB A;  4I2Z A;  4RG6 A;  2HYZ A;  4J8D A;  3ULQ A;  4UQY A;  3S7F A;  5KJL A;  4U04 A;  3PE3 A;  3QOU A;  2UWJ G;  2PL2 A;  3VTX A;  4HOU A;  5EX0 A;  2FBN A;  4GA0 A;  4HOT A;  4GCN A;  4ME2 A;  2C0L A;  4W9R A;  4EQF A;  1HH8 A;  2VSN A;  1A17 A;  2J9Q A;  4J8F A;  2YQ8 A;  3ASD A;  2VSY A;  3GZ1 A;  2XEV A;  5AYW D;  2GW1 A;  2PQN A;  4U07 A;  4Y6W A;  1Y8M A;  3LY8 A;  3RO2 A;  1W3B A;  3O48 A;  3ZHE B;  5JJT A;  3AS8 A;  3GW4 A;  5KJM A;  2VGY A;  2KCK A;  5D0O D;  3FP3 A;  2YHC A;  3KD7 A;  4IN3 B;  1KLX A;  4N39 A;  4WNE A;  4YND A;  2FEZ A;  4BWR A;  3JYS A;  5ARF A;  3CVL A;  2DBA A;  3QDN A;  3Q47 B;  4I17 A;  4KYO B;  5HI7 A;  1NZN A;  4JHR A;  5BW8 C;  3MV2 B;  5G05 C;  5FZQ A;  4WNG A;  4JL0 A;  1NA3 A;  2OND A;  2I6H A;  1P5Q A;  5LCW J;  4H7X A;  4BT8 A;  2KAT A;  2WPV A;  3ASG A;  4APO A;  5FTP A;  4BT9 A;  3CK8 A;  3S7B A;  4GPK A;  2FI7 A;  5FZR A;  4B94 A;  3LCA A;  4YVQ C;  4NQ0 A;  3S7J A;  3K9I A;  3S7D A;  2KCV A;  3Q15 A;  5BNW A;  3FFL A;  4GYW A;  5D0Q D;  2QFC A;  4HOQ A;  1IYG A;  3PDN A;  3SF4 A;  3CVQ A;  4AM9 A;  4XI9 A;  4U0U A;  4UI9 J;  3ASF A;  4ABN A;  4WNF A;  5DIZ A;  3QWW A;  1YA0 A;  3ZGQ A;  2VGX A;  5G05 J;  4CGV A;  3TG4 A;  3CK9 A;  1KT0 A;  5JJ7 A;  2KC7 A;  1WAO 1;  2LNI A;  2PZI A;  2UY1 A;  1ELW A;  3UQ3 A;  3GYZ A;  4J8E A;  2VYI A;  4XIF A;  5BT1 A;  4AIF A;  3HYM B;  4F3V A;  1HXI A;  2IFU A;  1ELR A;  2FO7 A;  2L6J A;  4G26 A;  3U4T A;  2XGO A;  4O6F A;  5KJK A;  4UI9 K;  4CDR A;  4CGW A;  2OOE A;  2E2E A;  4KXK B;  3LY9 A;  3RO3 A;  3LYA A;  2C0M A;  3LPZ A;  2LSU A;  5CCL A;  4G24 A;  3TGO A;  2Y4T A;  2BUG A;  3BEE A;  4RG9 A;  5G04 C;  3MEK A;  3CVP A;  4GCO A;  4BTB A;  3RJV A;  4G23 A;  2MHK A;  2C2L A;  4GZ5 A;  2XGM A;  1HZ4 A;  1IHG A;  2Q7F A; 
#chains in the Genus database with same CATH topology
 5LP0 A;  2HO1 A;  4A3V A;  2CHW A;  4A1G A;  1UOH A;  2DYS E;  3OXL A;  4F6R D;  1S64 A;  3BG1 B;  2FO1 E;  2AWI A;  3B7R L;  4D10 C;  4ZFH A;  4I9E A;  1JPL A;  3DBS A;  3GZS A;  2QC9 A;  1QNF A;  3HXF A;  3TWR A;  3NBN B;  4L7T A;  3TL5 A;  4K5A B;  4FAD A;  1SVX A;  2QZA A;  2WXG A;  3LXU X;  3ESL A;  3RAU A;  5ENO D;  5C1D A;  2AW6 A;  4N3A A;  1K1A A;  1TJC A;  4EZJ A;  3KAE A;  4ANW A;  4N3C A;  4F1P A;  2XHE A;  3CQC B;  4XE0 A;  5ENT D;  1TEZ A;  2NSZ A;  4KMO A;  3RU0 A;  3DSU A;  3UIP C;  4A1S A;  1WM5 A;  4OAV B;  4OVU A;  2R2L A;  3UMV A;  3OAW A;  5FT9 A;  4I1A A;  2IF4 A;  3MKQ B;  4N2Q A;  3ZHE A;  4JA9 A;  3CK7 A;  4N3B A;  3MA5 A;  3EUV A;  1DCE A;  4U0S A;  3PE4 A;  2WQ6 A;  3CEQ A;  3G2U A;  1NI1 A;  3UM2 A;  2P58 C;  1EDU A;  2BKG A;  4GZ3 A;  2BED A;  2WB2 A;  3WG7 E;  3RRU A;  5BUZ A;  3LKU A;  4HXI A;  3EHM A;  3TJP A;  3UM1 A;  3NF1 A;  3ZN3 A;  4EBA G;  4DX5 D;  2WQ7 A;  4NUR A;  2ZGD A;  3IEG A;  1E96 B;  1N95 A;  4TRQ A;  5CMW A;  2WXI A;  3ZRH A;  1GW6 A;  2V8S E;  1UW4 B;  3I4G A;  2HR2 A;  1SQM A;  3FTZ A;  2H6F A;  3CKB A;  4I6J A;  5EYL A;  1N0Q A;  1MX6 A;  4LNU D;  4PS7 A;  4N5C A;  1SA5 A;  3PZ4 A;  3T8K A;  3MJW A;  5AAO A;  3T9K A;  2J49 A;  2X6K A;  4G1T A;  2E0I A;  2NC9 A;  1OCC E;  2PQR A;  4FJY A;  3TG5 A;  4PS8 A;  2A5E A;  2XCC A;  3LVQ E;  4RG6 A;  4WAF A;  3TXN A;  2I1K A;  1INZ A;  3UT8 A;  4DK5 A;  3OTN A;  4GTQ A;  2UWJ G;  3ABK E;  2XEE A;  1UN8 A;  4U8Y D;  2IOL A;  2ZU6 B;  2XPZ A;  2EIM E;  4TXP A;  5EX0 A;  1WG0 A;  3V2X A;  4HOT A;  5EN5 D;  4FA6 A;  2C0L A;  3Q73 A;  3W9F A;  1HE8 A;  2CG2 A;  1IQR A;  1TN7 A;  3ZEF A;  2J9Q A;  4MBG A;  4HFG A;  4DX6 D;  2ETB A;  5EDS A;  1PY1 A;  4BX8 A;  4GTV A;  4U07 A;  2EIL E;  4YDW A;  4M3O A;  3B7U X;  3RO2 A;  4F7A A;  3O48 A;  3QJZ A;  3P2B A;  5JJT A;  3B95 A;  3EHN A;  4NAC A;  3KD7 A;  2P9S G;  4IN3 B;  1KLX A;  2KM4 A;  3TWV A;  5E76 A;  1PAQ A;  2WMN A;  3HRA A;  4AP2 A;  3MGB A;  3CVL A;  3SNX A;  2XZD G;  1O1S A;  1LTX A;  4JHR A;  3SFX A;  5FZQ A;  1H6P A;  4DJA A;  1N9A A;  4UWG A;  2RKK A;  3FUL A;  2OND A;  2L0I A;  3AU4 A;  2I6H A;  3L54 A;  3FTY A;  3MZL B;  1E90 A;  2L0T B;  4LSZ E;  3HXB A;  2FI7 A;  2PM6 A;  3ZKJ A;  4ANU A;  5FZR A;  4MKT A;  1O1R A;  2WXH A;  2R05 A;  4DX2 A;  3AJI A;  4FU3 A;  3K9I A;  2KCV A;  3V79 K;  4GYW A;  2QFC A;  1H19 A;  3ZXS A;  3QNK A;  3SF4 A;  4AM9 A;  3SFY A;  3CQG B;  5AJD A;  4URK A;  2Y0B G;  3CVX A;  1V55 E;  4CT0 A;  1RW2 A;  3D9M A;  2XEN A;  1YA0 A;  4KT6 B;  4MLP A;  1HG2 A;  2VGX A;  3LDZ A;  3HVE A;  3NOG D;  3CK9 A;  3SY2 A;  3UKR G;  5JJ7 A;  3UXG A;  2KC7 A;  3D9L A;  2PZI A;  2UY1 A;  5AQ9 A;  5E75 A;  1ELW A;  4E85 A;  3TWS A;  1EF1 C;  3HYM B;  4U96 D;  5BXU A;  1NL4 A;  5CBN A;  2OEW A;  2IFU A;  4JPS A;  3LS8 A;  2GRO B;  1ELR A;  2ION A;  2FO7 A;  1N94 A;  3SO8 A;  1N0R A;  3U4T A;  2AXZ A;  3ZVV A;  1E8Z A;  4O6F A;  2X38 A;  3CLJ A;  1OWO A;  3RRN B;  4CDR A;  2F8X K;  3ENE A;  5LFA A;  2E2E A;  3LY9 A;  3LYA A;  4LNB A;  2C0M A;  3L6A A;  4U7E B;  5AIJ A;  5ENQ D;  3IV0 A;  3TGO A;  1TNU A;  4RG9 A;  5G04 C;  3CGH A;  3DSX A;  2YNQ A;  2V4L A;  5KWD A;  2EQX A;  4GCO A;  4RSY A;  3B13 A;  3ZYL A;  2YIN A;  4BTB A;  3RJV A;  4U8V D;  4FUL A;  4FJZ A;  1MHQ A;  3PZ1 A;  3Q9U C;  2Q7F A;  4KZC A;  5DBK A;  4IRU A;  2DVW A;  2XGS A;  3NOC D;  1ZB1 A;  4GA1 A;  2P9I G;  1KPS B;  5C2Y A;  2DYR E;  4CDM A;  3PNL B;  3D9O A;  4UUC A;  4EEC A;  2NYJ A;  2B6C A;  5HS0 A;  5BXO A;  3EHQ A;  1O5M A;  1HFA A;  5AQB A;  4BX9 A;  4B8C B;  4GYO A;  4WND A;  5LOZ A;  3S2A A;  3UTM A;  4B89 A;  3EU9 A;  4YDE A;  5FIN A;  5FQ7 A;  3SHF A;  4NRH B;  2J8S D;  3NQP A;  5G04 J;  1ZU2 A;  3MV3 B;  1OWP A;  4K5C A;  2R59 A;  2VQ2 A;  3FUK A;  3WXX A;  2J4B A;  2VTB A;  1H6O A;  2J08 A;  4DX1 A;  5EYP F;  1MQS A;  5LCW C;  1N52 A;  2DZN A;  3DSS A;  4ILI A;  3HIZ A;  3SQV A;  3VLF A;  3APD A;  5JHA A;  2XZT G;  5CRU A;  4J7W A;  2BTD A;  1FVH A;  1HS6 A;  3URZ A;  3T5V A;  4L1B A;  3UPV A;  1BLX B;  1ZBP A;  4BFR A;  2IO3 C;  4GTP A;  4FHK A;  5FQ4 A;  4ANX A;  1MX2 A;  1KT1 A;  4B93 B;  3FU6 A;  3EJN A;  3FTX A;  4WUY A;  4ZHB A;  3GZ2 A;  4J8S A;  4UQZ A;  3SGH A;  2X6F A;  4XEI G;  4HS2 A;  1OY3 D;  3SD5 A;  4ACK A;  1B89 A;  1YMP A;  1D9S A;  3OXF A;  4UI9 C;  3Q5M A;  3CVY A;  5HKP A;  3U64 A;  2AXU A;  3CKC A;  2BKK B;  4GTO A;  1WDY A;  1DVP A;  3EU5 A;  3Q4A B;  4WWP A;  3CHR A;  3IBE A;  4Y6C A;  4B0Z A;  3PRZ A;  1Z5S C;  1UN9 A;  5CEA A;  3CVU A;  3ABL E;  3ASH A;  2WXN A;  1H6K A;  4F53 A;  5ENN A;  3LY7 A;  2P9U G;  3FUH A;  3ZW3 A;  3FH5 A;  4P29 A;  4JHK A;  2GRL A;  4B8A A;  1TNB A;  3DSW A;  3ZUV B;  1JWG A;  3L16 A;  3U3W A;  4JVS A;  3FY4 A;  3CHS A;  3LEW A;  2F8Y A;  3UM3 A;  5EX3 A;  3FEX A;  4Q94 A;  5T8I A;  4I2Z A;  1OWN A;  4UQY A;  4J8D A;  2KZT A;  3S7F A;  4U04 A;  1NP7 A;  4TXR A;  2OCC E;  3PRE A;  2PL2 A;  3I4R B;  3KEA A;  1IXV A;  4GA0 A;  2WMO A;  1VDY A;  4GCN A;  5KCM A;  4CRW A;  4ME2 A;  4U63 A;  2VSN A;  1TYQ G;  1A17 A;  3FTU A;  2XEH A;  3D9H A;  2XEV A;  3JQ0 A;  2PQN A;  4BER A;  3FH7 A;  2RD0 A;  4FLH A;  3FTV A;  3LY8 A;  1S0P A;  3MYV A;  4EBA A;  1SZ9 A;  3GW4 A;  5KJM A;  1AP7 A;  2VGY A;  5D0O D;  5G55 A;  5IY5 E;  1SW6 A;  3ML8 A;  4N39 A;  4WNE A;  4C9B B;  4ILG A;  4APF A;  4EPZ A;  3EHR A;  4YDY A;  2H6G A;  1S63 A;  4XKC A;  4EZK A;  3L82 A;  5ARF A;  2WM9 A;  2DIW A;  2DBA A;  3FUJ A;  3J5Q B;  3Q47 B;  4UWF A;  4IUL A;  4KYO B;  4JEH A;  1NZN A;  3MV2 B;  2ZIS A;  3MCX A;  3EIJ A;  4WNG A;  2OEV A;  1G3N B;  3AU5 A;  2DWZ A;  1E8W A;  2VSX E;  3ISM C;  1JCS A;  3UT4 A;  1NA3 A;  2WXQ A;  1FPP A;  3D9J A;  4L2Y A;  4H7X A;  3VLD A;  4RVB A;  4IYP A;  4BET A;  2WPV A;  4WWO A;  5T3R A;  3IXE A;  3PEV B;  4LNG A;  1MX4 A;  1LF8 A;  4AJW A;  3S7B A;  4GPK A;  3ZIM A;  2PM7 A;  4YVQ C;  4I43 A;  3FU5 A;  4L9P A;  1IHB A;  5BV0 A;  2IJG X;  3SI5 A;  4BY6 A;  5J08 A;  5BNW A;  3NB2 A;  4O1O A;  4HOQ A;  4HI9 A;  4ATZ D;  4OAU C;  4XI9 A;  3BU8 A;  5ENS D;  1Z3X A;  3VLE A;  2XS8 A;  3U9W A;  3MKQ A;  3I3N A;  4ABN A;  3FDH A;  5DIZ A;  2WXK A;  3ZGQ A;  3ZYK A;  1E8Y A;  4RLY A;  4HNA D;  3HDX A;  3TG4 A;  1TNY A;  2LNI A;  3FUI A;  3U66 A;  5FQ8 A;  2RG8 A;  3CHO A;  2IO2 C;  4F3V A;  4RQI A;  2M63 A;  4R7L A;  5AJL A;  4GAA A;  4ACL A;  2IY0 C;  4UWK A;  4DI4 A;  2GRM A;  4I1M A;  2XGO A;  4QQI A;  3HVE B;  1KZO A;  3P1U A;  4LUN U;  3AG3 E;  4MS6 A;  4UI9 K;  3T8M A;  4KXK B;  2YHE A;  4ANV A;  4GMR A;  2X3M A;  5CCL A;  2GRQ B;  3CVV A;  4C48 B;  4G8K A;  2BUG A;  3BEE A;  4TV3 A;  4UWL A;  4NIK A;  4JHJ A;  1K1B A;  4JZY A;  1U3C A;  3PS6 A;  2MHK A;  5CER B;  1X81 A;  3ZNG A;  4PDX A;  2LSV A;  4CT4 A;  1K8K G;  2OVB A;  3CVN A;  2BF0 X;  4JD2 G;  1NFI E;  2R5S A;  1UJJ A;  2P9P G;  3VTY A;  4J0U A;  2QY7 A;  4UQX A;  3DXK G;  3DPD A;  4CZ2 D;  1FT2 A;  5FIO A;  4ILH B;  3E34 A;  3E30 A;  4UWH A;  5J90 A;  1Q2Z A;  1HF8 A;  4I2W A;  1OXJ A;  2R03 A;  3D9K A;  3FU3 A;  4JW1 A;  4G11 A;  4JA7 A;  3AAA C;  1LD7 A;  3R9A B;  1N4S A;  3FUM A;  3TWX A;  2I1J A;  1OT8 A;  2P9N G;  1N4R A;  4GB9 A;  2Y4U A;  4DUI A;  2LAH A;  1XGW A;  2LO6 A;  3L08 A;  5BV1 A;  5CHE E;  2NXP A;  3E37 A;  2AJA A;  5CCM A;  4O1P A;  4DRX E;  4HOS A;  3ZFW A;  2X6J A;  2WXM A;  4Q96 A;  3FUN A;  3NZU A;  5A7D B;  3UUX A;  4G8L A;  2RFA A;  1SA4 A;  3KSL A;  1IQU A;  1XNF A;  3LJN A;  4FC8 A;  1MJ0 A;  1A5E A;  4AY6 A;  5A6C A;  3UI2 A;  1V54 E;  2GRP B;  3D9I A;  2EIN E;  1TNZ A;  3ZPJ A;  4EHM A;  1O1T A;  2LXM A;  1KZP A;  1RZ4 A;  4JC8 A;  3HG0 D;  2WXJ A;  3DST A;  2XS1 A;  5CRV A;  1MZC A;  5CMY A;  4XX5 A;  4XZ4 A;  4G25 A;  3V2O A;  1D8E A;  3BQO A;  2GGF A;  5ENP D;  3D3M A;  2A4Z A;  4DI3 A;  2LXL A;  3MKR A;  4I9C A;  1U2V G;  3RKV A;  3N71 A;  4G2V A;  2R02 A;  1DNP A;  4KZ0 A;  1MYO A;  3V30 A;  3KS2 A;  3Q78 A;  4U0Z A;  3CHQ A;  2WXO A;  5JA4 D;  5HQ8 A;  3PNT B;  4Z68 A;  2X6H A;  2V5F A;  4J8Y A;  4LEU A;  1NA0 A;  3CV0 A;  3QK0 A;  3Q7A A;  5FWQ A;  4GZC A;  4BEP A;  5B3S E;  3G2W A;  1JCR A;  2WVI A;  3Q7F A;  3AS4 A;  3JUI A;  3D9N A;  4H7Y A;  4N2S A;  3QWP A;  2AVP A;  1L5J A;  4JEU A;  2HYZ A;  5CED B;  4E6H A;  4HVB A;  5KJL A;  5FQ6 A;  2CHZ A;  2GRR B;  3Q75 A;  3QOU A;  2OV8 A;  3ULE G;  3O4Z A;  2DZO A;  4CCA A;  2FBN A;  2L6B A;  1FVF A;  4W9R A;  4EQF A;  1TN8 A;  3L17 A;  4J8F A;  3Q9N C;  3FUE A;  3RK6 A;  2KZT B;  3AG1 E;  4WWN A;  5AYW D;  4AVX A;  1TR4 A;  2GW1 A;  3RSE G;  5D2M C;  1Y8M A;  1W3B A;  3FU0 A;  2FUL A;  5A23 A;  3ZHE B;  1BI7 B;  3UM0 A;  2XRY A;  3AS8 A;  3ONK A;  4AV7 A;  3FP3 A;  2KXP C;  2YHC A;  4BSZ B;  2HE0 A;  3TXM A;  1N54 A;  4FP7 A;  2Y69 E;  4GTT A;  4HRN A;  2I2O A;  4V3I A;  3LJ3 A;  5ANL A;  4I17 A;  3G2V A;  4F1S A;  5HI7 A;  3NZS A;  3C5R A;  5G05 C;  2J4D A;  2VSO E;  1H2T C;  2RFM A;  3NAW A;  4JL0 A;  3HXE A;  5KNG A;  3IKO B;  4AOF A;  5LCW J;  3CST A;  1BI8 B;  4Q69 A;  2JAB A;  2MOW A;  1WY6 A;  4BT8 A;  2MYO A;  3QAR A;  2J07 A;  5FTP A;  4BT9 A;  3CK8 A;  1LD8 A;  3B7S A;  2P2C P;  2ZXW E;  4B94 A;  3LCA A;  4NQ0 A;  3Q79 A;  2H6I A;  4TXQ A;  3E33 A;  1N4P A;  3S7J A;  3APF A;  2VGE A;  4GTS A;  3S7D A;  3Q15 A;  1H0A A;  3FFL A;  4HRM B;  4PS3 A;  4CEM A;  3B7T A;  4GU5 A;  1S70 B;  2R17 C;  4N5Q A;  4GPM A;  3HXD A;  4ATG A;  4UI9 J;  4CYM D;  3ASF A;  1BPO A;  3F6Q A;  4HI8 A;  4BSX A;  2QYJ A;  3DEO A;  4GMJ A;  4LCT A;  2IEJ A;  5G05 J;  4CGV A;  1KT0 A;  2LAI A;  3PUJ A;  1JCQ A;  3IHV A;  3DRA A;  5BT1 A;  4AIF A;  4M7C A;  2IQC A;  2QYU A;  5AQA A;  2CFU A;  3FTS A;  4HLL A;  4G26 A;  3UX4 A;  5BPP A;  3B7B A;  4FHJ A;  1E7V A;  3DPY A;  3DXM G;  3JQ1 A;  2OOE A;  5KNH D;  2ETC A;  3ZXP A;  5G2N A;  3LPZ A;  3BUA A;  3W9G A;  2LSU A;  5D66 A;  3UIO C;  4A3T A;  2Y4T A;  3CHP A;  4JB8 P;  4EZL A;  1UJK A;  2IU1 A;  1N4Q A;  3CVP A;  4HB5 A;  1TNO A;  3R7Q A;  5EIL A;  3AG2 E;  4G23 A;  3IHY A;  2C2L A;  1SZA A;  4C0E A;  2XGM A;  1HZ4 A;  5EID A;  3RIB A;  5ENR D;  5FZS A;  4GYY A;  2EIJ E;  3BG0 B;  3FHE A;  4KBQ A;  1OCZ E;  3EDT B;  4I6E A;  2KCL A;  5AN8 A;  3TAX A;  2IOS A;  2WXR A;  2V4H C;  3QB2 A;  2X6I A;  5CBO A;  5EKQ D;  4HLE A;  4C0M A;  4GML A;  4HBD A;  3C98 A;  3AG4 E;  3PH0 C;  4K0R A;  1UG3 A;  1U3D A;  3C3Q A;  5HRY A;  2F0Y A;  3CVW A;  1HX8 A;  4HOR A;  4FLB A;  3JCK C;  4AEZ C;  3PZ2 A;  2FF4 A;  3CIA A;  3T5X A;  3UIN C;  3CR3 A;  2XPY A;  4KVM A;  5FJY A;  2XPI A;  5ARG A;  1AWC B;  1QZ2 A;  5KJN A;  1QBQ A;  1D8D A;  3ESK A;  3ML9 A;  2CG3 A;  3AS5 A;  5M72 A;  2VGX B;  5LX8 A;  2XQ0 A;  5JJ6 A;  2JEK A;  4AY5 A;  1PC2 A;  1OUV A;  2UY1 B;  2WQH A;  5AEN A;  3CSF A;  4TUM A;  4LG6 A;  4GZ6 A;  3TWU A;  4AXH A;  2JLB A;  1QQE A;  2J09 A;  1ELK A;  1FCH A;  3L9T A;  2WXL A;  1E7U A;  2EIK E;  1EYH A;  3JXJ A;  4JXT A;  3PZD A;  4XI0 A;  3C3O A;  1K3Z D;  1YYH A;  3Q49 B;  3QKY A;  2CFZ A;  4GA2 A;  2WXP A;  2OVF A;  2LUH A;  4DLO A;  1YCS B;  4A55 A;  4YDO A;  3V31 A;  3QWV A;  3E4B A;  3RRM B;  3PEU B;  4KVO A;  4HQD A;  4U95 D;  3I5P A;  3JUE A;  3ULY A;  3J5P A;  3SZ7 A;  2ILR A;  3MX3 A;  4X8Q A;  2F37 A;  3ZYQ A;  1DC2 A;  4A63 B;  3OXG A;  4DX7 D;  4PUC A;  1JUQ A;  3FWV A;  4YVO A;  4BTA A;  2XCB A;  3ULQ A;  1BD8 A;  3PE3 A;  1Z3Y A;  2ZIR A;  5H7P A;  4DLQ A;  3VTX A;  4HOU A;  2HM8 A;  3FEY A;  5JHB A;  3R7R A;  4OYS A;  3TWQ A;  3QC1 A;  1BU9 A;  2ZGG A;  1HH8 A;  3PVL A;  1Y6I A;  2YQ8 A;  3ASD A;  4LER A;  1OWM A;  2V0P A;  2VSY A;  3GZ1 A;  1H2V C;  3HXC A;  5ANR A;  2Y1L E;  3DEP A;  4Y6W A;  1Z6T A;  2MRI A;  2VTB B;  4L2L A;  4J6I A;  4BES A;  3PUK A;  1FT1 A;  3TWW A;  4PH4 B;  3R9M A;  2KCK A;  3FUD A;  3HHM A;  2V5Q C;  2Y3A A;  3ZU7 B;  2WXF A;  4CDN A;  3G2S A;  5T4Y A;  4YND A;  4I6G A;  2FEZ A;  4BWR A;  3JYS A;  3QDN A;  4MRU A;  4QFV A;  1DCQ A;  5BW8 C;  2B0O E;  5ITZ F;  3JXI A;  2KBX A;  3APC A;  4HRL A;  1X5B A;  5B1A E;  3QAQ A;  1EPU A;  4U8H A;  1JWF A;  3CHM A;  1P5Q A;  3ZYM A;  2PNN A;  5CEC B;  4GTR A;  1OCR E;  1TJF A;  2KAT A;  1OWL A;  1TN6 A;  3ASG A;  2DCP A;  4APO A;  4XKB A;  3EIQ C;  2ETA A;  4LRZ A;  2XRZ A;  3UT7 A;  3D9P A;  2L9B A;  3PZ3 A;  4TUU A;  1IKN D;  5D0Q D;  1QYM A;  3KEZ A;  3L22 A;  5AAR A;  1IYG A;  3PDN A;  3SBS A;  1E8X A;  3CVQ A;  4U0U A;  5JMN D;  3X2Q E;  3G2T A;  4WNF A;  4L23 A;  3QWW A;  5AQ7 A;  2A5U A;  4I1O B;  4GZD A;  1HU3 A;  3DWL G;  3ONL A;  1OCO E;  4K5B A;  1WAO 1;  2P9K G;  3UQ3 A;  3UKU G;  3GYZ A;  4J8E A;  2VYI A;  3LVR E;  4XIF A;  5B1B E;  3KSQ A;  4GTM A;  1HXI A;  3ASO E;  2GRN B;  3C3R A;  2H6H A;  2L6J A;  1N11 A;  5KBA A;  5KJK A;  4K03 A;  3DSV A;  4CGW A;  2AXV A;  3SFZ A;  4DPR A;  1H2U A;  3RO3 A;  2P9L G;  3SBT B;  2I9C A;  3ASN E;  3L13 A;  3FH8 A;  4G24 A;  3ABM E;  4OVV A;  3FTW A;  3MEK A;  2CHX A;  3TWT A;  1HG5 A;  5EIB E;  1HO8 A;  3C72 A;  2VJ8 A;  3E32 A;  4GZ5 A;  4O60 A;  1IHG A;  3FUF A; 
#chains in the Genus database with same CATH homology
 3RIB A;  5LP0 A;  2HO1 A;  2LSV A;  4KZC A;  5DBK A;  4CT4 A;  2OVB A;  4A3V A;  3CVN A;  2CHW A;  4IRU A;  4A1G A;  2BF0 X;  5FZS A;  4GYY A;  2XGS A;  2R5S A;  1UJJ A;  3OXL A;  3VTY A;  3BG0 B;  4J0U A;  3FHE A;  4KBQ A;  3EDT B;  2QY7 A;  4I6E A;  2KCL A;  4GA1 A;  4W9R A;  3BG1 B;  3TAX A;  2AWI A;  2IOS A;  2WXR A;  3B7R L;  4UQX A;  4D10 C;  3DPD A;  5C2Y A;  4I9E A;  3QB2 A;  4CDM A;  1JPL A;  2X6I A;  3PNL B;  3D9O A;  3DBS A;  4ILH B;  3GZS A;  5EKQ D;  4UWH A;  4EEC A;  4HLE A;  5J90 A;  1QNF A;  4L7T A;  3TL5 A;  4C0M A;  1HF8 A;  4I2W A;  4GML A;  4FAD A;  3D9K A;  3FU3 A;  4JW1 A;  1HFA A;  3C98 A;  4G11 A;  4JA7 A;  4BX9 A;  3R9A B;  3FUM A;  4B8C B;  4GYO A;  3PH0 C;  4K0R A;  4WND A;  1UG3 A;  5LOZ A;  2I1J A;  2WXG A;  1U3D A;  3ESL A;  3LXU X;  3CVW A;  4GB9 A;  3S2A A;  2Y4U A;  4B89 A;  1HX8 A;  5C1D A;  4HOR A;  2AW6 A;  3JCK C;  4FLB A;  2LAH A;  5FQ7 A;  4N3A A;  1XGW A;  3SHF A;  2LO6 A;  3L08 A;  4AEZ C;  5BV1 A;  1TJC A;  2FF4 A;  5CHE E;  2NXP A;  4EZJ A;  3KAE A;  4NRH B;  3CIA A;  3T5X A;  5CCM A;  4ANW A;  3CR3 A;  3NQP A;  4N3C A;  1ZU2 A;  5G04 J;  2XHE A;  4HOS A;  3CQC B;  4XE0 A;  3MV3 B;  3ZFW A;  2X6J A;  1TEZ A;  2XPY A;  1OWP A;  2NSZ A;  2WXM A;  4KVM A;  4KMO A;  2R59 A;  5FJY A;  3RU0 A;  2XPI A;  2VQ2 A;  5ARG A;  3FUK A;  4A1S A;  1WM5 A;  4Q96 A;  4OVU A;  3WXX A;  1QZ2 A;  3FUN A;  3NZU A;  3UMV A;  3OAW A;  5KJN A;  5A7D B;  2J4B A;  5FT9 A;  3UUX A;  2VTB A;  1IQU A;  3ESK A;  2J08 A;  4I1A A;  1XNF A;  2IF4 A;  3MKQ B;  3ML9 A;  4N2Q A;  4FC8 A;  1MQS A;  3ZHE A;  4JA9 A;  5LCW C;  2CG3 A;  3AS5 A;  3CK7 A;  1N52 A;  4N3B A;  4ILI A;  3MA5 A;  3HIZ A;  4AY6 A;  5M72 A;  3VLF A;  3APD A;  5JHA A;  2VGX B;  5LX8 A;  2XQ0 A;  4U0S A;  3PE4 A;  5JJ6 A;  2JEK A;  4AY5 A;  2BTD A;  1FVH A;  2WQ6 A;  1PC2 A;  1HS6 A;  5A6C A;  3CEQ A;  3URZ A;  3T5V A;  3G2U A;  4L1B A;  3UPV A;  1OUV A;  2UY1 B;  3D9I A;  1ZBP A;  4BFR A;  2WQH A;  3ZPJ A;  5AEN A;  4FHK A;  3CSF A;  2P58 C;  5FQ4 A;  4ANX A;  1EDU A;  1KT1 A;  4GZ6 A;  3FU6 A;  4AXH A;  2JLB A;  3EJN A;  1QQE A;  3FTX A;  4GZ3 A;  4WUY A;  2J09 A;  1ELK A;  4JC8 A;  1FCH A;  2WB2 A;  3RRU A;  3GZ2 A;  2WXL A;  3LKU A;  4HXI A;  4J8S A;  4UQZ A;  5BUZ A;  2WXJ A;  3EHM A;  3TJP A;  1E7U A;  3SGH A;  2X6F A;  1EYH A;  5CMY A;  4HS2 A;  3NF1 A;  3SD5 A;  3ZN3 A;  4XX5 A;  4JXT A;  4XZ4 A;  4G25 A;  1B89 A;  4ACK A;  4EBA G;  3OXF A;  3PZD A;  4XI0 A;  2GGF A;  2WQ7 A;  4NUR A;  3Q49 B;  4UI9 C;  3QKY A;  2CFZ A;  3IEG A;  1E96 B;  3D3M A;  4GA2 A;  2WXP A;  4TRQ A;  3Q5M A;  2A4Z A;  5CMW A;  4DI3 A;  3CVY A;  2WXI A;  2OVF A;  3U64 A;  2AXU A;  3MKR A;  3ZRH A;  3CKC A;  4DLO A;  4I9C A;  1DVP A;  3Q4A B;  3RKV A;  4WWP A;  4A55 A;  3CHR A;  1GW6 A;  3IBE A;  3N71 A;  4Y6C A;  4B0Z A;  4G2V A;  3PRZ A;  3QWV A;  1DNP A;  3E4B A;  4KZ0 A;  2V8S E;  3RRM B;  1UW4 B;  3I4G A;  2HR2 A;  1UN9 A;  1SQM A;  3FTZ A;  3PEU B;  4KVO A;  3KS2 A;  3CKB A;  4I6J A;  3CVU A;  4U0Z A;  3CHQ A;  2WXO A;  3ASH A;  2WXN A;  1H6K A;  4PS7 A;  4F53 A;  4N5C A;  5HQ8 A;  3I5P A;  5ENN A;  3LY7 A;  3PNT B;  3MJW A;  2X6H A;  2V5F A;  3FUH A;  3ZW3 A;  4LEU A;  3FH5 A;  4P29 A;  1NA0 A;  4JHK A;  3CV0 A;  3QK0 A;  2GRL A;  4B8A A;  5FWQ A;  4GZC A;  3SZ7 A;  1JWG A;  2ILR A;  3MX3 A;  2J49 A;  2X6K A;  4G1T A;  2E0I A;  3G2W A;  3L16 A;  3U3W A;  2NC9 A;  4JVS A;  3FY4 A;  2WVI A;  3ZYQ A;  3CHS A;  3AS4 A;  3LEW A;  2PQR A;  4FJY A;  3JUI A;  5EX3 A;  3TG5 A;  3OXG A;  4PUC A;  4PS8 A;  3FEX A;  3D9N A;  4Q94 A;  2XCC A;  4H7Y A;  4N2S A;  1JUQ A;  3FWV A;  3QWP A;  5T8I A;  4YVO A;  2AVP A;  4BTA A;  1L5J A;  2XCB A;  3LVQ E;  1OWN A;  2HYZ A;  4J8D A;  2KZT A;  4JEU A;  4I2Z A;  4RG6 A;  4UQY A;  4WAF A;  3S7F A;  4U04 A;  3TXN A;  3ULQ A;  5FQ6 A;  4E6H A;  5KJL A;  2I1K A;  3PE3 A;  1NP7 A;  2CHZ A;  3UT8 A;  4DK5 A;  1INZ A;  3OTN A;  3PRE A;  3QOU A;  2UWJ G;  2PL2 A;  1Z3Y A;  2OV8 A;  4DLQ A;  1UN8 A;  2IOL A;  2ZU6 B;  2XPZ A;  3VTX A;  3O4Z A;  4HOU A;  3I4R B;  5EX0 A;  4CCA A;  2FBN A;  2HM8 A;  3FEY A;  5JHB A;  3R7R A;  4GA0 A;  2WMO A;  4OYS A;  4HOT A;  1VDY A;  4GCN A;  5KCM A;  4CRW A;  1FVF A;  3QC1 A;  4FA6 A;  4ME2 A;  2C0L A;  1HE8 A;  1IQR A;  2CG2 A;  1HH8 A;  4U63 A;  2VSN A;  3PVL A;  1Y6I A;  1A17 A;  2J9Q A;  3ZEF A;  4EQF A;  3L17 A;  4J8F A;  4HFG A;  2YQ8 A;  3FUE A;  3ASD A;  3RK6 A;  2KZT B;  4LER A;  3FTU A;  1OWM A;  2V0P A;  5EDS A;  2VSY A;  3GZ1 A;  2XEV A;  1H2V C;  5ANR A;  1PY1 A;  4WWN A;  5AYW D;  4AVX A;  4BX8 A;  2GW1 A;  2PQN A;  3JQ0 A;  3FH7 A;  4U07 A;  4Y6W A;  2RD0 A;  4M3O A;  1Z6T A;  1Y8M A;  3B7U X;  3FTV A;  2MRI A;  3LY8 A;  4FLH A;  3RO2 A;  1W3B A;  4F7A A;  1S0P A;  2VTB B;  3FU0 A;  4L2L A;  3O48 A;  2FUL A;  3QJZ A;  3MYV A;  4J6I A;  5A23 A;  3ZHE B;  4EBA A;  1SZ9 A;  2XRY A;  3PUK A;  3P2B A;  4PH4 B;  5JJT A;  3AS8 A;  3GW4 A;  5KJM A;  2VGY A;  2KCK A;  3FUD A;  3ONK A;  3EHN A;  5D0O D;  5G55 A;  4AV7 A;  3FP3 A;  3HHM A;  2Y3A A;  4NAC A;  2YHC A;  3ML8 A;  3KD7 A;  4IN3 B;  3TXM A;  1N54 A;  4FP7 A;  1KLX A;  4N39 A;  2WXF A;  2KM4 A;  4WNE A;  5E76 A;  4C9B B;  4CDN A;  4ILG A;  4APF A;  4EPZ A;  3G2S A;  1PAQ A;  5T4Y A;  2WMN A;  4XKC A;  4EZK A;  2I2O A;  4YND A;  4I6G A;  2FEZ A;  4BWR A;  3JYS A;  4V3I A;  5ARF A;  2WM9 A;  3MGB A;  3CVL A;  4AP2 A;  2DIW A;  3LJ3 A;  3SNX A;  2DBA A;  3FUJ A;  3QDN A;  4MRU A;  3Q47 B;  4UWF A;  5ANL A;  4I17 A;  3G2V A;  4F1S A;  4IUL A;  4KYO B;  4QFV A;  4JEH A;  5HI7 A;  1NZN A;  3NZS A;  4JHR A;  5BW8 C;  3MV2 B;  3MCX A;  5G05 C;  5FZQ A;  3EIJ A;  2J4D A;  4WNG A;  3APC A;  3AU5 A;  2VSO E;  1E8W A;  1X5B A;  2VSX E;  3QAQ A;  4DJA A;  1H2T C;  3UT4 A;  1EPU A;  4U8H A;  4UWG A;  1JWF A;  4JL0 A;  3FUL A;  1NA3 A;  3CHM A;  2OND A;  2WXQ A;  2L0I A;  3AU4 A;  2I6H A;  1P5Q A;  3IKO B;  3L54 A;  3ZYM A;  4AOF A;  3FTY A;  3CST A;  3D9J A;  4L2Y A;  5LCW J;  3MZL B;  4Q69 A;  4H7X A;  3VLD A;  2MOW A;  1TJF A;  1WY6 A;  4RVB A;  4BT8 A;  4IYP A;  1E90 A;  2KAT A;  2L0T B;  2WPV A;  4WWO A;  5T3R A;  1OWL A;  3ASG A;  3QAR A;  2DCP A;  4APO A;  3PEV B;  2J07 A;  5FTP A;  4XKB A;  4BT9 A;  3CK8 A;  1LF8 A;  4AJW A;  3S7B A;  3EIQ C;  3B7S A;  2FI7 A;  2PM6 A;  4GPK A;  4ANU A;  4LRZ A;  5FZR A;  4MKT A;  3ZIM A;  4B94 A;  2WXH A;  3LCA A;  2PM7 A;  4YVQ C;  2XRZ A;  4NQ0 A;  3UT7 A;  3D9P A;  4I43 A;  3FU5 A;  3S7J A;  2L9B A;  5BV0 A;  2IJG X;  3APF A;  4FU3 A;  3K9I A;  3S7D A;  2KCV A;  3Q15 A;  3SI5 A;  4BY6 A;  5J08 A;  5BNW A;  1H0A A;  4TUU A;  3FFL A;  4GYW A;  5D0Q D;  2QFC A;  1H19 A;  3ZXS A;  4PS3 A;  4HOQ A;  3KEZ A;  3QNK A;  4CEM A;  3L22 A;  1IYG A;  3PDN A;  3SF4 A;  3B7T A;  4GU5 A;  1E8X A;  3CVQ A;  3SBS A;  4AM9 A;  2R17 C;  4XI9 A;  3CQG B;  4HVB A;  4U0U A;  5AJD A;  1Z3X A;  3VLE A;  4ATG A;  4URK A;  4UI9 J;  3U9W A;  3CVX A;  3G2T A;  3ASF A;  3MKQ A;  3I3N A;  4ABN A;  4CT0 A;  1BPO A;  4WNF A;  3D9M A;  4L23 A;  3FDH A;  5DIZ A;  4BSX A;  2WXK A;  1YA0 A;  3QWW A;  4KT6 B;  2A5U A;  4I1O B;  4MLP A;  1HG2 A;  4GZD A;  3ZGQ A;  3ZYK A;  1HU3 A;  1E8Y A;  2VGX A;  4GMJ A;  4LCT A;  5G05 J;  3ONL A;  3LDZ A;  3HDX A;  3HVE A;  3CK9 A;  3TG4 A;  4CGV A;  1KT0 A;  2LAI A;  3PUJ A;  5JJ7 A;  2KC7 A;  3D9L A;  1WAO 1;  2LNI A;  2PZI A;  2UY1 A;  3FUI A;  5E75 A;  1ELW A;  3UQ3 A;  3U66 A;  5FQ8 A;  4E85 A;  2RG8 A;  3GYZ A;  3IHV A;  4J8E A;  2VYI A;  3LVR E;  4XIF A;  5BT1 A;  3CHO A;  1EF1 C;  4AIF A;  3HYM B;  4F3V A;  2IQC A;  1HXI A;  2IFU A;  4JPS A;  3LS8 A;  2M63 A;  1ELR A;  2ION A;  4R7L A;  2FO7 A;  5AJL A;  4GAA A;  4ACL A;  2CFU A;  2L6J A;  4UWK A;  3FTS A;  4DI4 A;  4G26 A;  2GRM A;  2AXZ A;  4I1M A;  3U4T A;  2XGO A;  3UX4 A;  3ZVV A;  5BPP A;  3HVE B;  1E8Z A;  3P1U A;  4LUN U;  4O6F A;  4MS6 A;  4FHJ A;  5KJK A;  1E7V A;  2X38 A;  4UI9 K;  3CLJ A;  4K03 A;  3T8M A;  1OWO A;  3RRN B;  4CDR A;  3JQ1 A;  4CGW A;  2AXV A;  2OOE A;  3SFZ A;  3ENE A;  5LFA A;  4DPR A;  2E2E A;  4KXK B;  1H2U A;  3LY9 A;  3RO3 A;  3LYA A;  2YHE A;  3SBT B;  5G2N A;  4ANV A;  2C0M A;  2I9C A;  3L6A A;  3LPZ A;  2LSU A;  2X3M A;  5CCL A;  3L13 A;  5AIJ A;  3CVV A;  3FH8 A;  3IV0 A;  4G24 A;  4A3T A;  3TGO A;  4OVV A;  2Y4T A;  3CHP A;  2BUG A;  3BEE A;  4EZL A;  1UJK A;  3FTW A;  4RG9 A;  2IU1 A;  4TV3 A;  3MEK A;  3CGH A;  4UWL A;  5G04 C;  2CHX A;  3CVP A;  2YNQ A;  2V4L A;  1HG5 A;  4JHJ A;  1HO8 A;  2EQX A;  4GCO A;  3R7Q A;  4RSY A;  2VJ8 A;  3B13 A;  4JZY A;  1U3C A;  3ZYL A;  2YIN A;  4BTB A;  3RJV A;  3PS6 A;  4G23 A;  2MHK A;  2C2L A;  3IHY A;  4FUL A;  1SZA A;  4C0E A;  4GZ5 A;  2XGM A;  4FJZ A;  1HZ4 A;  1MHQ A;  1IHG A;  2Q7F A;  3FUF A;  4PDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...