3LKUA

Crystal structure of s. cerevisiae get4 in complex with an n-terminal fragment of get5
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
286
structure length
286
Chain Sequence
b'AKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0363 protein YOR164C
publication title Structural characterization of the Get4/Get5 complex and its interaction with Get3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 116
structure length 286
sequence length 286
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2010-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lkuA01
2WPVA 2VYIA 4JA9A 2QFCA 2GW1A 1A17A 5FZQA 3CEQA 3ESKA 4BT8A 4N3BA 4KXKB 3PDNA 2UY1B 3URZA 2XCBA 4HOSA 3R9AB 2Y4TA 1E96B 4UQZA 5LCWC 3KD7A 4GPKA 2V5FA 3CVNA 3TG5A 2HO1A 3CK8A 3Q47B 5D0QD 2WQHA 5EX0A 4JA7A 3CKBA 2AVPA 4G25A 4I2WA 2E2EA 3OXFA 4UQYA 1P5QA 4KYOB 2FF4A 4J8DA 4HOQA 3UPVA 4A1SA 5FJYA 3RIBA 4YNDA 5JJ6A 2PQRA 2XGMA 2KCLA 4WNFA 3AS5A 1TJCA 2JLBA 4N2QA 2LSVA 2UY1A 4UI9J 3PE3A 5KJNA 3TG4A 2VGXB 3ZPJA 1YA0A 3QDNA 2C0LA 5DIZA 4N3AA 2XGSA 4H7YA 4H7XA 4ME2A 3CV0A 1Y8MA 3Q5MA 2KCKA 4GYOA 3AS4A 4I2ZA 2FBNA 3ZGQA 3ASDA 3LY8A 4J8FA 4BTBA 4GZ3A 1NA0A 1XNFA 2FI7A 5FT9A 5G04J 4UQXA 2Q7FA 3MA5A 1KT0A 4GZ6A 5CCLA 4GZ5A 4WNEA 1HZ4A 3N71A 3WXXA 5G05C 3ZHEA 3GW4A 5ARFA 1ELWA 5CCMA 3KS2A 1QZ2A 5BW8C 2VGXA 4U0SA 3MV3B 3QWPA 3Q15A 4GYYA 5C1DA 3OXLA 2XPIA 5BT1A 4AY5A 4J0UA 4BT9A 4B94A 2IF4A 1HXIA 2VSNA 3ASGA 4UI9K 4RG6A 2KC7A 3SZ7A 3UQ3A 3SF4A 1QQEA 4J8EA 1W3BA 2FO7A 2NC9A 1IYGA 3LPZA 4KBQA 4LEUA 3CK9A 4N5CA 4IN3B 2PL2A 3CVPA 4UI9C 3U4TA 3QOUA 5LCWJ 4U0UA 4BTAA 3ASHA 3E4BA 2VQ2A 3ZHEB 5AYWD 2IFUA 4AY6A 3IEGA 4I1AA 5KJMA 3ULQA 4YVOA 3TAXA 2Y4UA 2XGOA 1ZU2A 4I9CA 5EX3A 3AS8A 4APOA 3Q4AB 4HOTA 4JL0A 3BEEA 3LCAA 5KJKA 2ONDA 5A7DB 2J9QA 2PZIA 5DBKA 3LKUA 2L6JA 4EQFA 2LNIA 4N3CA 4CDRA 4CGWA 5M72A 4N39A 4YVQC 3RKVA 2LSUA 1NA3A 5FTPA 5EKQD 2HR2A 3CVQA 4XIFA 4G1TA 2YHCA 3VTXA 2HYZA 3RJVA 3OXGA 3S7JA 4GCOA 3QWWA 5FZSA 4GA0A 4RG9A 4CGVA 3MKRA 5HQ8A 5D0OD 3U3WA 2PQNA 4U07A 4F3VA 4GCNA 1HH8A 4W9RA 5A6CA 1KLXA 3UUXA 3Q49B 1WAO1 4BWRA 5KJLA 2R5SA 4WNDA 1KT1A 3KAEA 3FP3A 2YQ8A 3FWVA 3RU0A 2VGYA 2MHKA 1OUVA 3MEKA 2XEVA 2DBAA 5G05J 4WNGA 5CHEE 5ARGA 3ZFWA 4HORA 4XI9A 3GYZA 4U04A 4AIFA 3ASFA 4O6FA 3QWVA 3GZ1A 3LY7A 3S7FA 3RO2A 3CK7A 2C2LA 5JJTA 4HOUA 4G23A 3FFLA 4G26A 3GZ2A 1PC2A 4XI0A 1IHGA 2I6HA 1NZNA 1ZBPA 4AM9A 3HYMB 1WM5A 2KATA 3ZN3A 4Y6CA 5JJ7A 4GA1A 4I9EA 3JYSA 2XCCA 3LY9A 3NF1A 3S7BA 3PE4A 5G04C 4Y6WA 3RO3A 3QKYA 2BUGA 4N2SA 5FZRA 3O48A 4G24A 5HI7A 4G2VA 2FEZA 2OOEA 4ABNA 4GYWA 4NQ0A 3K9IA 1B89A 3VTYA 4GA2A 3S7DA 4I17A 3LYAA 2VSYA 5BNWA 2UWJG 3MV2B 2KCVA 3CKCA 3CVLA 1ELRA 4JHRA 4WUYA 4NRHB 3TGOA 2C0MA 3EDTB 4U0ZA 2P58C 1FCHA
chains in the Genus database with same CATH superfamily
3UKRG 2QFCA 3Q7AA 4MLPA 4URKA 3ZYKA 5ENRD 2RKKA 4I6JA 2R05A 2OCCE 2XCBA 3CVUA 2P9UG 3R9AB 2Y4TA 1E96B 3HHMA 2NSZA 4UQZA 3U9WA 3CLJA 5LCWC 1LD8A 1MX6A 3FU3A 4GPKA 1SW6A 3CVNA 3LJNA 3SQVA 1DVPA 3P1UA 5D0QD 5KBAA 1U2VG 4BY6A 3UM2A 3VLEA 1OT8A 2AVPA 4I2WA 2E2EA 2BF0X 4AJWA 4KYOB 2P9NG 2WXPA 4MKTA 3FH7A 4BSZB 5BXOA 3UPVA 4KT6B 4A1SA 2WB2A 3RIBA 3VLDA 2B0OE 4I6EA 4YNDA 3ABKE 3B7RL 4PDXA 3DSXA 3EHMA 3JCKC 2KCLA 5EIBE 4WNFA 2J09A 2IQCA 4JEUA 2V5QC 3T5XA 2JLBA 3AG1E 2EIKE 4N2QA 4BFRA 2LSVA 1L5JA 3FUEA 5KJNA 4JW1A 4NACA 1E8YA 3PNTB 5JMND 3TL5A 2P9IG 3D9IA 2J08A 1H19A 3SY2A 5T4YA 2C0LA 3PZ2A 5DIZA 3LVQE 4GU5A 5ENQD 4F7AA 3ZU7B 1Y8MA 3KEAA 2OVFA 4MRUA 3DRAA 3Q5MA 3PRZA 2WQ6A 4GTMA 3I4RB 3ZGQA 4HXIA 2GRMA 4HI9A 4LCTA 3AAAC 1JWGA 4GZ3A 3PH0C 1XNFA 4U8YD 4E6HA 1MYOA 4TUMA 4YDEA 3MA5A 4J6IA 2AWIA 2YHEA 1ELKA 4GZ6A 4DX2A 5JHBA 3J5PA 5G05C 4GB9A 1DNPA 5AJLA 5ARFA 4CT4A 3DSSA 5FINA 1Z6TA 3B95A 4G11A 4U0SA 3Q15A 1YYHA 4GYYA 3ZYLA 5C1DA 2LXMA 4I43A 4J0UA 2IF4A 2FO1E 4GTSA 1HE8A 1OWNA 3G2WA 3FEYA 2DZNA 3SZ7A 1NL4A 2V8SE 3UQ3A 3TXMA 1QYMA 4Q69A 1WG0A 4TXQA 1QQEA 3HVEB 2WXMA 3ULYA 5E75A 4MS6A 4N5CA 2LAHA 1K8KG 1UW4B 4IN3B 3U64A 1TNYA 3EIJA 3CGHA 1SVXA 1V55E 1N9AA 1OCCE 3TXNA 3UM1A 2IO2C 2VQ2A 3UIPC 3Q75A 4X8QA 3L22A 1DCEA 3APDA 2IFUA 3ZXSA 3BU8A 1PAQA 5KJMA 3ULQA 3NZSA 3QAQA 2XGOA 3JUIA 2V0PA 4KZCA 1U3CA 3UT4A 3Q4AB 4HOTA 3P2BA 3BEEA 3PEVB 5BV0A 3O4ZA 5BPPA 2J9QA 4UWGA 4TXPA 3OAWA 4AVXA 3E32A 4GZDA 4HFGA 4EQFA 1ZB1A 4GTVA 4N3CA 4CDRA 4K5CA 3DEOA 3SHFA 5FTPA 4XIFA 4L2LA 2HYZA 1Q2ZA 1OWLA 1LTXA 5FZSA 4RG9A 4CGVA 4D10C 5FWQA 3V30A 4DK5A 3U3WA 2J07A 2GRLA 3X2QE 4GCNA 1HH8A 4W9RA 5A6CA 2XPYA 4HB5A 5D66A 1UN9A 3DSVA 2BKKB 4ACLA 1WAO1 2Y69E 1KT1A 4TRQA 2X6FA 3FP3A 3ZRHA 4TXRA 3EUVA 1O1RA 2M63A 3RU0A 2DBAA 1E7UA 3HXBA 2CG3A 2QYJA 3ZIMA 1X81A 2OV8A 2RG8A 2KXPC 4XI9A 3GYZA 3DXMG 1N4RA 2RD0A 4FC8A 4DLOA 3CK7A 2J4BA 1NI1A 2WM9A 4F53A 5CMWA 3FFLA 5IY5E 3HXEA 1IHGA 2I6HA 3PZ1A 3RRNB 3HYMB 4PS8A 4BESA 1JPLA 5CBNA 4V3IA 2WVIA 2I1KA 3PEUB 4I9EA 1OWPA 4YDWA 4JHJA 4ILIA 4BETA 3S7BA 4ACKA 4FHKA 3PZ4A 3EHRA 4B0ZA 4GMLA 4G24A 3FUMA 4U95D 4L23A 4UWKA 3CVWA 2FEZA 5ITZF 5T8IA 2WXIA 4FLHA 4JVSA 3LYAA 1N4SA 3FDHA 1RZ4A 3OTNA 2JABA 1IQUA 1EYHA 4WUYA 4NRHB 3TGOA 4FU3A 2L0IA 2H6IA 2MOWA 4U0ZA 1FCHA 2WPVA 4JA9A 4KMOA 3FUNA 2GW1A 5FZQA 3ZUVB 1JWFA 3CEQA 4FLBA 3G2SA 3FH5A 3TWSA 4ATZD 4N3BA 3CVYA 5CERB 2WXJA 1D9SA 4ZHBA 3URZA 2NYJA 1H6PA 2A5UA 2YNQA 3PZDA 2R02A 4APFA 3UTMA 4ANUA 3ULEG 2V5FA 1AP7A 3PUKA 1TNBA 3DSWA 5CMYA 1OY3D 1KZOA 3TG5A 2HO1A 3Q47B 5AQ7A 4PH4B 3IBEA 3AU4A 3CQCB 4G25A 3CVVA 4G8LA 3OXFA 4UQYA 4DX1A 3ZW3A 4AV7A 2FF4A 5C2YA 4J8DA 5FQ8A 5CRVA 4K5AB 4J8YA 2R2LA 2BTDA 2AXUA 4GTRA 3AS5A 3ZVVA 2KZTB 3L17A 5D2MC 1TJCA 1JCSA 2GRRB 3R7RA 4C0EA 3PE3A 4JXTA 1BI8B 2VGXB 1OWMA 3ZPJA 2AJAA 4FJZA 2ILRA 4BX9A 4F6RD 5B1AE 4ZFHA 4N3AA 4L2YA 2XGSA 2RFAA 3RAUA 4EECA 4FA6A 2KCKA 4GYOA 3AS4A 5FQ4A 1N0QA 4I2ZA 4NIKA 4UUCA 4I1OB 2XS1A 4LNGA 3QC1A 2VGEA 4BTBA 2CG2A 3PZ3A 1K1BA 4BEPA 4DX7D 3L54A 3AG3E 5G04J 5E76A 4B93B 3SNXA 3I5PA 2F8XK 2XS8A 3QB2A 4UWFA 2QYUA 1HZ4A 4U7EB 4HLEA 4XX5A 1LD7A 3GW4A 1YMPA 5CCMA 1ELWA 4L1BA 1OWOA 1QZ2A 4GMRA 3MV3B 4B8CB 4BSXA 3D9HA 3JQ1A 5HKPA 4AY5A 4BT9A 3AG2E 1S70B 1HXIA 2R03A 5EYPF 4GTPA 1OCOE 3ASGA 1Z3YA 3DSTA 4RG6A 2KC7A 1A5EA 3RSEG 2PM7A 3SGHA 2DZOA 4C0MA 2DCPA 1IYGA 4KBQA 3CR3A 3E33A 3HG0D 3GZSA 2XENA 2ETAA 4PS7A 2PL2A 2P9KG 4BX8A 5AJDA 3QOUA 4WWOA 3FTYA 3ASHA 4O60A 3APCA 3SBSA 5CEAA 1N94A 3FU0A 3IEGA 4YVOA 4DLQA 4RVBA 2Y4UA 4OVUA 3ABLE 4I9CA 2HM8A 1LF8A 2ONDA 4K5BA 3ML9A 2IO3C 2QY7A 1FVHA 2VSXE 5AIJA 3HVEA 2PZIA 1QBQA 2GGFA 3TJPA 2F0YA 2LNIA 5M72A 2WMOA 3RKVA 1NA3A 3FH8A 3CVQA 4Q94A 4OAVB 2IOLA 5H7PA 2ZGGA 3ABME 2H6FA 3QWWA 1HX8A 1SA5A 2YINA 3JXJA 3MKRA 3FEXA 1UJKA 3MGBA 3D3MA 1HF8A 4C9BB 4EHMA 3Q9UC 3UINC 2XRZA 3KEZA 1SA4A 2X6HA 1OCRE 4LG6A 2R5SA 4WNDA 3KAEA 5AN8A 3FWVA 3B7BA 4A3TA 4ANWA 2WXOA 1TN6A 3FTWA 5AARA 5BXUA 4AIFA 5HRYA 3GZ1A 2X6KA 2AXZA 3LY7A 4CYMD 3B7TA 5HS0A 1NP7A 3FUJA 5JJTA 4A1GA 1IHBA 3L82A 4G23A 3DPYA 5ENTD 3GZ2A 4XI0A 3E30A 3AU5A 3L13A 2WXGA 1ZBPA 3CIAA 1K1AA 3ZN3A 1AWCB 4Y6CA 2I9CA 3ML8A 1H0AA 5FIOA 4GA1A 3TWRA 4CEMA 5EIDA 3TWWA 4L7TA 4I1MA 3W9FA 3AG4E 4JPSA 1HS6A 4XKBA 3IKOB 4Y6WA 4PS3A 3TWXA 5KWDA 2BUGA 3CHSA 5FZRA 3JXIA 5BUZA 2XEHA 3LJ3A 3LVRE 3QJZA 2B6CA 4OYSA 1Y6IA 5HI7A 3F6QA 4GYWA 4NQ0A 1B89A 2GRNB 4GA2A 2H6GA 2VSYA 3MKQB 2UWJG 1PY1A 2XQ0A 3MV2B 1BI7B 3UKUG 4M7CA 3CVLA 4ANXA 3D9MA 1FPPA 2ZISA 2F37A 2VYIA 2MYOA 4UWHA 1V54E 3ZYMA 3MZLB 3ESKA 3PVLA 4BT8A 3SI5A 1EF1C 2UY1B 1N95A 3LEWA 3B7UX 2Y1LE 4HOSA 1MZCA 3FUHA 1JCQA 4I6GA 4DI4A 4HLLA 3KD7A 2J8SD 5KNGA 3T9KA 3CK8A 4B8AA 2P2CP 5EX0A 5LOZA 4EPZA 3SFXA 3Q9NC 4O1OA 3CHQA 1HG2A 4JZYA 1P5QA 3D9LA 2Y3AA 1HFAA 4WWPA 3UX4A 3NQPA 2VTBB 2WXLA 5FJYA 3NB2A 4XEIG 1S63A 2PQRA 2EINE 4WAFA 2L0TB 3E37A 3EU9A 2LXLA 3QNKA 3SBTB 3B7SA 4EBAG 1E8XA 2X38A 4CCAA 4NURA 4HRMB 3ENEA 5J90A 4HNAD 2IJGX 3ISMC 2ZXWE 3DEPA 3SFZA 4Z68A 1S0PA 2I2OA 4LERA 2FBNA 1IXVA 1Z5SC 3FU5A 4XE0A 1MX2A 3LY8A 5AQAA 4JB8P 3ASOE 1NA0A 5FT9A 2FI7A 4UQXA 2WXFA 4C48B 3HXCA 2Q7FA 1KT0A 4P29A 3B13A 4GZ5A 4WNEA 3FTVA 3IHYA 3WXXA 2KZTA 2XRYA 2QZAA 4ILHB 1BPOA 3DSUA 5BW8C 2VGXA 4YDYA 2BEDA 3QWPA 4TUUA 3NAWA 2VJ8A 4IULA 4Q96A 2L9BA 2XPIA 4HI8A 2OEWA 2ETCA 2IONA 2R17C 3QARA 1WDYA 2NXPA 5AENA 2A5EA 4JEHA 3HDXA 5ENPD 4AOFA 1DCQA 4FULA 1N0RA 2WXKA 3C3QA 2FULA 3SF4A 3QK0A 2AXVA 1W3BA 4GZCA 4DPRA 3CK9A 1UN8A 3ONKA 3UM0A 3D9KA 3ESLA 2E0IA 1WY6A 2IY0C 4A63B 5LCWJ 4U0UA 4BTAA 2XHEA 3L6AA 3E4BA 1TNUA 2WMNA 3G2VA 4GAAA 4L9PA 5CRUA 5AYWD 2EIJE 1BD8A 3CHOA 4AY6A 1UG3A 2EQXA 4I1AA 2VSOE 3G2UA 3FUIA 3KSQA 4HQDA 4AP2A 2MRIA 1ZU2A 5ANRA 5EX3A 3AS8A 3FTXA 1H6KA 3EJNA 4J8SA 4AEZC 4GMJA 3W9GA 1Z3XA 2ETBA 3DPDA 3T5VA 1KZPA 2R59A 3CSTA 3PS6A 3LKUA 2OEVA 2L6JA 1O1TA 4HS2A 4HRLA 4YVQC 3SFYA 3CQGB 2WXQA 1YCSB 2EIME 4G1TA 3L16A 3VTXA 4U63A 3OXGA 3S7JA 4GCOA 1GW6A 5G55A 4IRUA 4GA0A 5ENNA 5HQ8A 5B1BE 4QFVA 4U07A 4F3VA 1U3DA 4B89A 3FY4A 2KBXA 1N4PA 3TWTA 1TYQG 1OXJA 1TJFA 5KCMA 2YQ8A 4PUCA 3MJWA 2MHKA 2XEVA 2H6HA 5G05J 4HVBA 3ZYQA 5CHEE 3UT7A 4FJYA 3ZFWA 1IKND 1MQSA 2GRPB 2DYSE 1FT1A 3ZEFA 4O6FA 4ANVA 1D8DA 3FTZA 2XEEA 2CHWA 3CHRA 4U8HA 4HOUA 2KM4A 4G26A 1PC2A 1N4QA 1FT2A 1NZNA 4OVVA 4K03A 4AM9A 1WM5A 4EZLA 4ATGA 5JJ7A 4F1PA 3JYSA 2XCCA 4KZ0A 3LY9A 3V2OA 3MX3A 4BERA 5G04C 3S2AA 4RSYA 4CT0A 3Q79A 3RO3A 3NOCD 3D9OA 4N2SA 4CDNA 3O48A 4KVMA 3T8MA 2CHZA 4G2VA 5LFAA 3UT8A 2OOEA 3FTSA 3IV0A 1TN8A 3C5RA 3UMVA 3K9IA 5A23A 2CFUA 4I17A 2X6JA 5BNWA 4EBAA 3APFA 4RQIA 3I4GA 2P9PG 4XKCA 2KCVA 4JHRA 1ELRA 1BLXB 2RFMA 3HXFA 3TWQA 4A3VA 1D8EA 3EDTB 1A17A 1H2UA 3HIZA 3PREA 1H2VC 2DYRE 4KXKB 3PDNA 2A4ZA 3UIOC 3RRUA 4HBDA 2WXNA 3CSFA 4TV3A 3EHQA 3C98A 1HO8A 1O5MA 4JHKA 3MYVA 5T3RA 5EDSA 4E85A 2WQHA 4HRNA 4JA7A 3CKBA 3MKQA 3FUKA 5J08A 1TEZA 4EZJA 4LNUD 5ENOD 4HOQA 4LNBA 5B3SE 5JJ6A 2GRQB 1SQMA 3EU5A 2AW6A 2XGMA 3FULA 3I3NA 3FTUA 5KNHD 1TR4A 2HE0A 3TWUA 4O1PA 3G2TA 4LSZE 1TNOA 2UY1A 4UI9J 4XZ4A 3WG7E 3TG4A 3EIQC 4FP7A 1YA0A 2PNNA 3QDNA 3CHPA 4N5QA 5LX8A 1N52A 4H7YA 4H7XA 4ME2A 3CV0A 2XZDG 1SZAA 4UWLA 1EPUA 5BV1A 2L6BA 2LAIA 4QQIA 2IOSA 5JA4D 3FUDA 3ASDA 3T8KA 1X5BA 3ASNE 4J8FA 1TNZA 1H6OA 3Q7FA 3PUJA 2VTBA 2P9LG 2XPZA 2ZU6B 1G3NB 3LDZA 3FU6A 3DWLG 4U8VD 5CCLA 1MJ0A 1K3ZD 3N71A 4CZ2D 3ZHEA 4M3OA 3IHVA 3UM3A 3VLFA 3BQOA 1O1SA 2EILE 2I1JA 3KS2A 4IYPA 2CHXA 3OXLA 5BT1A 5EN5D 3MCXA 3NZUA 3ZXPA 4B94A 3TWVA 2VSNA 4DJAA 5EYLA 3UI2A 4UI9K 2X3MA 3R7QA 3ZKJA 4G8KA 3LS8A 3L9TA 4J8EA 4DUIA 2FO7A 2NC9A 5EILA 3LPZA 4LEUA 4RLYA 2F8YA 3LXUX 2V4HC 3CVPA 1E8ZA 4UI9C 3U4TA 1XGWA 1E90A 1SZ9A 1N11A 3V2XA 4DX5D 3BG0B 3ZHEB 2DVWA 1INZA 3C3OA 2DWZA 3D9PA 4DI3A 1UOHA 3TAXA 4K0RA 1E7VA 2Y0BG 4F1SA 4LUNU 4WWNA 4APOA 1NFIE 3ONLA 4JL0A 4GTOA 5CECB 1UJJA 5CBOA 3LCAA 4EZKA 5KJKA 3C72A 1HU3A 5A7DB 3U66A 1KPSB 1IQRA 4CDMA 3SD5A 5DBKA 2GROB 2QC9A 3C3RA 2LUHA 4CRWA 3DBSA 4CGWA 3E34A 4N39A 3V79K 4A55A 3R9MA 4GTQA 2LSUA 2WQ7A 2LO6A 5EKQD 2HR2A 2V4LA 3HXDA 1EDUA 5AAOA 2YHCA 3RJVA 4DRXE 3JUEA 3SO8A 4LRZA 3BUAA 1TN7A 3FUFA 3KSLA 1H2TC 2XZTG 5D0OD 2PQNA 1HG5A 2WXHA 2J49A 3L08A 1KLXA 3UUXA 3Q49B 3RRMB 4BWRA 4JD2G 1S64A 5KJLA 2BKGA 5LP0A 3UXGA 5G2NA 4FHJA 2VGYA 5JHAA 1N54A 1OUVA 3MEKA 3JQ0A 2DIWA 4WNGA 2PM6A 5ARGA 3D9JA 4YDOA 3ZNGA 1FVFA 1MHQA 4HORA 4DX6D 2OVBA 4U04A 3ASFA 3QWVA 3DXKG 3S7FA 4R7LA 3RO2A 3FHEA 4MBGA 2C2LA 3HRAA 3AJIA 4KVOA 1E8WA 3EHNA 2WXRA 5CEDB 1OCZE 1RW2A 4GPMA 3NBNB 3CVXA 1DC2A 2KATA 5AQ9A 3Q78A 2ZIRA 2IU1A 3V31A 1JUQA 3Q73A 4OAUC 3NF1A 3BG1B 2X6IA 1BU9A 4AXHA 3PE4A 3D9NA 3RK6A 3QKYA 3PNLB 5FQ7A 2J4DA 3IXEA 2CFZA 5ENSD 5AQBA 4ABNA 4GTTA 1VDYA 3VTYA 4J7WA 1MX4A 3S7DA 5FQ6A 2JEKA 1JCRA 3CHMA 4ILGA 4U96D 4FADA 5ANLA 2ZGDA 3CKCA 2IEJA 4JC8A 3NOGD 1QNFA 3J5QB 2C0MA 2P9SG 2P58C
chains in the Genus database with same CATH topology
2WPVA 2VYIA 4JA9A 4KMOA 2QFCA 3FUNA 2GW1A 1A17A 4UWHA 5FZQA 1JWFA 4MLPA 1H2UA 3HIZA 3ZYMA 3CEQA 3MZLB 4FLBA 3G2SA 3PREA 3ZYKA 4URKA 3ESKA 3FH5A 3PVLA 1H2VC 4BT8A 4N3BA 3CVYA 3SI5A 4KXKB 1EF1C 2WXJA 4I6JA 3PDNA 2UY1B 3LEWA 3URZA 2XCBA 3CVUA 3B7UX 2A4ZA 4HOSA 3FUHA 3RRUA 4I6GA 2WXNA 2Y4TA 1E96B 3CSFA 2NSZA 3HHMA 4UQZA 4TV3A 3R9AB 3U9WA 2A5UA 2YNQA 3PZDA 3CLJA 4DI4A 5LCWC 4APFA 4ANUA 3KD7A 3FU3A 4GPKA 2V5FA 3CVNA 3PUKA 3C98A 1HO8A 5CMYA 1DVPA 4JHKA 3P1UA 3MYVA 5T3RA 3TG5A 2HO1A 5EDSA 3CK8A 3Q47B 5D0QD 4B8AA 4E85A 2WQHA 4BY6A 4PH4B 5EX0A 3IBEA 3AU4A 4JA7A 5LOZA 4EPZA 3CKBA 3CQCB 3VLEA 2AVPA 3CHQA 3MKQA 4G25A 3FUKA 5J08A 4I2WA 2E2EA 1TEZA 1HG2A 3CVVA 4JZYA 3OXFA 2BF0X 4UQYA 4AJWA 1P5QA 3D9LA 2Y3AA 4KYOB 3ZW3A 4EZJA 4AV7A 1HFAA 2FF4A 5C2YA 4WWPA 2WXPA 4MKTA 4J8DA 3UX4A 3FH7A 5FQ8A 4HOQA 3NQPA 3UPVA 4KT6B 2VTBB 4A1SA 2WXLA 5FJYA 3RIBA 2WB2A 3VLDA 4I6EA 4YNDA 5JJ6A 1SQMA 2PQRA 2BTDA 3B7RL 3EHMA 2AW6A 2XGMA 2AXUA 3FULA 2KCLA 3I3NA 3JCKC 4WNFA 3FTUA 2L0TB 2J09A 4WAFA 3AS5A 2IQCA 3QNKA 4JEUA 3SBTB 4PDXA 3ZVVA 2KZTB 3L17A 1TJCA 3T5XA 3B7SA 4EBAG 2JLBA 3G2TA 3R7RA 1E8XA 4C0EA 4N2QA 4BFRA 2LSVA 2UY1A 2X38A 3PE3A 4UI9J 4XZ4A 1L5JA 3FUEA 5KJNA 4JW1A 3TG4A 4CCAA 4NURA 4JXTA 2VGXB 1OWMA 4NACA 3ZPJA 3EIQC 1E8YA 3PNTB 3ENEA 4FP7A 5J90A 1YA0A 3QDNA 4FJZA 3TL5A 3CHPA 3D9IA 2ILRA 1H19A 2J08A 4BX9A 2IJGX 5T4YA 2C0LA 5DIZA 5LX8A 4N3AA 3LVQE 4L2YA 1N52A 2XGSA 4GU5A 4H7YA 3SFZA 4H7XA 4F7AA 4ME2A 3CV0A 1Y8MA 1SZAA 4UWLA 1S0PA 4EECA 2OVFA 4FA6A 4MRUA 1EPUA 3Q5MA 3PRZA 5BV1A 2KCKA 2WQ6A 4GYOA 3AS4A 2I2OA 5FQ4A 4I2ZA 4I1OB 4LERA 3I4RB 2FBNA 2LAIA 3ZGQA 4HXIA 2GRMA 2IOSA 3FUDA 3ASDA 1X5BA 3FU5A 3QC1A 4LCTA 3LY8A 4XE0A 1JWGA 4J8FA 4BTBA 2CG2A 4GZ3A 3L54A 3PH0C 1NA0A 1XNFA 2FI7A 5FT9A 3PUJA 4E6HA 5G04J 5E76A 2VTBA 4UQXA 2XPZA 2WXFA 2ZU6B 2Q7FA 3MA5A 4J6IA 2AWIA 2YHEA 3LDZA 1KT0A 3SNXA 3I5PA 4P29A 1ELKA 4GZ6A 3FU6A 5CCLA 3B13A 4GZ5A 4WNEA 3QB2A 4UWFA 1HZ4A 3N71A 3FTVA 3IHYA 3WXXA 2KZTA 2XRYA 5JHBA 5G05C 3ZHEA 4HLEA 4M3OA 4GB9A 3IHVA 4XX5A 3VLFA 1DNPA 3GW4A 5AJLA 5ARFA 1ELWA 4L1BA 4CT4A 5CCMA 2I1JA 3KS2A 4ILHB 1BPOA 1OWOA 1QZ2A 4IYPA 5BW8C 1Z6TA 2VGXA 4G11A 3MV3B 4U0SA 3QWPA 4B8CB 3Q15A 4TUUA 2CHXA 2VJ8A 4IULA 4BSXA 4GYYA 4Q96A 3OXLA 2L9BA 3ZYLA 5C1DA 2XPIA 4I43A 5BT1A 3JQ1A 4AY5A 3MCXA 3NZUA 4J0UA 4BT9A 4B94A 2IF4A 2IONA 2R17C 1HXIA 3QARA 1HE8A 2NXPA 2VSNA 1OWNA 3G2WA 4DJAA 3ASGA 1Z3YA 5AENA 4JEHA 3HDXA 4UI9K 2X3MA 3R7QA 4RG6A 4AOFA 2KC7A 3FEYA 3SZ7A 2V8SE 4FULA 3UQ3A 2PM7A 3SGHA 3TXMA 2WXKA 4Q69A 2FULA 3LS8A 4C0MA 3SF4A 1QQEA 2DCPA 3QK0A 4J8EA 2AXVA 1W3BA 3HVEB 4GZCA 2FO7A 2WXMA 4DPRA 2NC9A 5E75A 1IYGA 4MS6A 3LPZA 4KBQA 3CR3A 4LEUA 3GZSA 3CK9A 1UN8A 4N5CA 3ONKA 2LAHA 1UW4B 3LXUX 3D9KA 2PL2A 3ESLA 4IN3B 4PS7A 3U64A 3CVPA 1E8ZA 4UI9C 3U4TA 1XGWA 4BX8A 2E0IA 5AJDA 1WY6A 1E90A 3EIJA 3CGHA 3QOUA 1SZ9A 4WWOA 5LCWJ 4F3VA 3TXNA 3BG0B 4U0UA 4BTAA 3FTYA 2XHEA 3ASHA 3E4BA 3L6AA 2VQ2A 3APCA 2WMNA 3G2VA 3ZHEB 1INZA 4GAAA 3L22A 3SBSA 5AYWD 3APDA 2IFUA 3CHOA 3ZXSA 4AY6A 1UG3A 2EQXA 3D9PA 1PAQA 3FU0A 3IEGA 4I1AA 4DI3A 5KJMA 2VSOE 3G2UA 3ULQA 3FUIA 4YVOA 3TAXA 4DLQA 3NZSA 3QAQA 4RVBA 4AP2A 4K0RA 1E7VA 2MRIA 2Y4UA 4OVUA 2XGOA 1ZU2A 3JUIA 4I9CA 5ANRA 5EX3A 2HM8A 2V0PA 4F1SA 4LUNU 4KZCA 1U3CA 3AS8A 4WWNA 3UT4A 4APOA 3ONLA 3Q4AB 4HOTA 3P2BA 4JL0A 3BEEA 1UJJA 1LF8A 3PEVB 3FTXA 5BV0A 3LCAA 4EZKA 5KJKA 1H6KA 2ONDA 3EJNA 1HU3A 4J8SA 3O4ZA 4AEZC 5A7DB 2J9QA 4GMJA 4UWGA 5BPPA 1Z3XA 3ML9A 2QY7A 3U66A 3DPDA 3T5VA 1FVHA 2R59A 2VSXE 3CSTA 1IQRA 5AIJA 4CDMA 3HVEA 2PZIA 3OAWA 3SD5A 3PS6A 5DBKA 3LKUA 2L6JA 4AVXA 2GGFA 4GZDA 4HFGA 3TJPA 4EQFA 4CRWA 3DBSA 4HS2A 2LNIA 4N3CA 4CDRA 4CGWA 5M72A 4N39A 4YVQC 4A55A 2WMOA 3RKVA 2LSUA 1NA3A 2WXQA 3CQGB 3FH8A 2WQ7A 3SHFA 2LO6A 5FTPA 5EKQD 2HR2A 2V4LA 3CVQA 4Q94A 4XIFA 1EDUA 4G1TA 2YHCA 2IOLA 4L2LA 3L16A 3VTXA 2HYZA 4U63A 3RJVA 3OXGA 1OWLA 4LRZA 3S7JA 4GCOA 1GW6A 3QWWA 5G55A 4IRUA 3FUFA 5FZSA 4GA0A 4RG9A 1H2TC 4CGVA 1HX8A 5ENNA 2YINA 3MKRA 5HQ8A 4D10C 5FWQA 4DK5A 5D0OD 3U3WA 2J07A 2PQNA 3FEXA 4QFVA 2GRLA 1UJKA 4U07A 1HG5A 2WXHA 3MGBA 3D3MA 1HH8A 1HF8A 4GCNA 2J49A 1U3DA 3L08A 2XPYA 1KLXA 4W9RA 4B89A 1UN9A 4C9BB 5A6CA 2XRZA 3UUXA 3KEZA 3Q49B 4ACLA 1WAO1 3FY4A 3RRMB 4BWRA 2X6HA 5KJLA 1TJFA 2R5SA 4WNDA 1KT1A 3KAEA 4TRQA 2X6FA 3FP3A 3ZRHA 5KCMA 5LP0A 2YQ8A 5G2NA 4FHJA 3FWVA 2M63A 3RU0A 2VGYA 4PUCA 5JHAA 3MJWA 1N54A 2MHKA 1OUVA 3MEKA 2XEVA 4A3TA 4ANWA 3JQ0A 2WXOA 2DIWA 2DBAA 1E7UA 2CG3A 3FTWA 5G05J 4HVBA 3ZYQA 4WNGA 2PM6A 5CHEE 5ARGA 3ZIMA 3UT7A 3D9JA 4FJYA 3ZFWA 1FVFA 1MQSA 2OV8A 2RG8A 1MHQA 4HORA 2OVBA 3GYZA 4XI9A 4U04A 3ZEFA 4AIFA 3ASFA 4O6FA 3QWVA 4ANVA 3GZ1A 2X6KA 2AXZA 3LY7A 3S7FA 4R7LA 2RD0A 4FC8A 3RO2A 4DLOA 3B7TA 3FHEA 3FTZA 1NP7A 3FUJA 3CK7A 2J4BA 2C2LA 2CHWA 3CHRA 2WM9A 4A1GA 5JJTA 4F53A 4U8HA 4HOUA 4G23A 5CMWA 3FFLA 4KVOA 1E8WA 2KM4A 4G26A 3EHNA 2WXRA 3GZ2A 1PC2A 4XI0A 1IHGA 2I6HA 3CVXA 3AU5A 3L13A 1NZNA 3RRNB 4OVVA 2WXGA 4K03A 1ZBPA 4AM9A 3HYMB 4PS8A 1WM5A 2KATA 3CIAA 1JPLA 4EZLA 3ZN3A 4ATGA 2IU1A 4Y6CA 2I9CA 3ML8A 1H0AA 4V3IA 5JJ7A 2WVIA 4GA1A 2I1KA 3PEUB 4I9EA 1OWPA 3JYSA 4CEMA 1JUQA 4JHJA 4ILIA 2XCCA 4KZ0A 3LY9A 3NF1A 4L7TA 3BG1B 4I1MA 2X6IA 3MX3A 4JPSA 1HS6A 3S7BA 4XKBA 4ACKA 4AXHA 3PE4A 3IKOB 5G04C 3S2AA 3D9NA 4RSYA 4FHKA 4Y6WA 4CT0A 3RO3A 4PS3A 3RK6A 3D9OA 3QKYA 2BUGA 3CHSA 5FZRA 4N2SA 3PNLB 5FQ7A 5BUZA 2J4DA 4CDNA 4B0ZA 3O48A 4KVMA 4GMLA 3T8MA 2CFZA 4G24A 3LJ3A 3LVRE 3FUMA 3QJZA 4OYSA 1Y6IA 5HI7A 2CHZA 4L23A 4UWKA 4G2VA 3CVWA 5LFAA 2FEZA 5T8IA 3UT8A 2OOEA 2WXIA 3FTSA 3IV0A 4ABNA 4GYWA 4FLHA 3UMVA 4NQ0A 3K9IA 1B89A 1VDYA 5A23A 3VTYA 4JVSA 4GA2A 2CFUA 3S7DA 5FQ6A 2JEKA 4I17A 3LYAA 2VSYA 2X6JA 3MKQB 5BNWA 2UWJG 4EBAA 1PY1A 3CHMA 4ILGA 3APFA 3FDHA 2XQ0A 3I4GA 3MV2B 3OTNA 4FADA 5ANLA 4XKCA 1IQUA 2KCVA 3CKCA 3CVLA 1ELRA 1EYHA 4JHRA 4JC8A 4ANXA 1QNFA 4WUYA 4NRHB 3TGOA 4FU3A 2C0MA 2L0IA 4A3VA 3D9MA 3EDTB 2MOWA 4U0ZA 2P58C 1FCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV A;  2VYI A;  4JA9 A;  2QFC A;  2GW1 A;  1A17 A;  5FZQ A;  3CEQ A;  3ESK A;  4BT8 A;  4N3B A;  4KXK B;  3PDN A;  2UY1 B;  3URZ A;  2XCB A;  4HOS A;  3R9A B;  2Y4T A;  1E96 B;  4UQZ A;  5LCW C;  3KD7 A;  4GPK A;  2V5F A;  3CVN A;  3TG5 A;  2HO1 A;  3CK8 A;  3Q47 B;  5D0Q D;  2WQH A;  5EX0 A;  4JA7 A;  3CKB A;  2AVP A;  4G25 A;  4I2W A;  2E2E A;  3OXF A;  4UQY A;  1P5Q A;  4KYO B;  2FF4 A;  4J8D A;  4HOQ A;  3UPV A;  4A1S A;  5FJY A;  3RIB A;  4YND A;  5JJ6 A;  2PQR A;  2XGM A;  2KCL A;  4WNF A;  3AS5 A;  1TJC A;  2JLB A;  4N2Q A;  2LSV A;  2UY1 A;  4UI9 J;  3PE3 A;  5KJN A;  3TG4 A;  2VGX B;  3ZPJ A;  1YA0 A;  3QDN A;  2C0L A;  5DIZ A;  4N3A A;  2XGS A;  4H7Y A;  4H7X A;  4ME2 A;  3CV0 A;  1Y8M A;  3Q5M A;  2KCK A;  4GYO A;  3AS4 A;  4I2Z A;  2FBN A;  3ZGQ A;  3ASD A;  3LY8 A;  4J8F A;  4BTB A;  4GZ3 A;  1NA0 A;  1XNF A;  2FI7 A;  5FT9 A;  5G04 J;  4UQX A;  2Q7F A;  3MA5 A;  1KT0 A;  4GZ6 A;  5CCL A;  4GZ5 A;  4WNE A;  1HZ4 A;  3N71 A;  3WXX A;  5G05 C;  3ZHE A;  3GW4 A;  5ARF A;  1ELW A;  5CCM A;  3KS2 A;  1QZ2 A;  5BW8 C;  2VGX A;  4U0S A;  3MV3 B;  3QWP A;  3Q15 A;  4GYY A;  5C1D A;  3OXL A;  2XPI A;  5BT1 A;  4AY5 A;  4J0U A;  4BT9 A;  4B94 A;  2IF4 A;  1HXI A;  2VSN A;  3ASG A;  4UI9 K;  4RG6 A;  2KC7 A;  3SZ7 A;  3UQ3 A;  3SF4 A;  1QQE A;  4J8E A;  1W3B A;  2FO7 A;  2NC9 A;  1IYG A;  3LPZ A;  4KBQ A;  4LEU A;  3CK9 A;  4N5C A;  4IN3 B;  2PL2 A;  3CVP A;  4UI9 C;  3U4T A;  3QOU A;  5LCW J;  4U0U A;  4BTA A;  3ASH A;  3E4B A;  2VQ2 A;  3ZHE B;  5AYW D;  2IFU A;  4AY6 A;  3IEG A;  4I1A A;  5KJM A;  3ULQ A;  4YVO A;  3TAX A;  2Y4U A;  2XGO A;  1ZU2 A;  4I9C A;  5EX3 A;  3AS8 A;  4APO A;  3Q4A B;  4HOT A;  4JL0 A;  3BEE A;  3LCA A;  5KJK A;  2OND A;  5A7D B;  2J9Q A;  2PZI A;  5DBK A;  3LKU A;  2L6J A;  4EQF A;  2LNI A;  4N3C A;  4CDR A;  4CGW A;  5M72 A;  4N39 A;  4YVQ C;  3RKV A;  2LSU A;  1NA3 A;  5FTP A;  5EKQ D;  2HR2 A;  3CVQ A;  4XIF A;  4G1T A;  2YHC A;  3VTX A;  2HYZ A;  3RJV A;  3OXG A;  3S7J A;  4GCO A;  3QWW A;  5FZS A;  4GA0 A;  4RG9 A;  4CGV A;  3MKR A;  5HQ8 A;  5D0O D;  3U3W A;  2PQN A;  4U07 A;  4F3V A;  4GCN A;  1HH8 A;  4W9R A;  5A6C A;  1KLX A;  3UUX A;  3Q49 B;  1WAO 1;  4BWR A;  5KJL A;  2R5S A;  4WND A;  1KT1 A;  3KAE A;  3FP3 A;  2YQ8 A;  3FWV A;  3RU0 A;  2VGY A;  2MHK A;  1OUV A;  3MEK A;  2XEV A;  2DBA A;  5G05 J;  4WNG A;  5CHE E;  5ARG A;  3ZFW A;  4HOR A;  4XI9 A;  3GYZ A;  4U04 A;  4AIF A;  3ASF A;  4O6F A;  3QWV A;  3GZ1 A;  3LY7 A;  3S7F A;  3RO2 A;  3CK7 A;  2C2L A;  5JJT A;  4HOU A;  4G23 A;  3FFL A;  4G26 A;  3GZ2 A;  1PC2 A;  4XI0 A;  1IHG A;  2I6H A;  1NZN A;  1ZBP A;  4AM9 A;  3HYM B;  1WM5 A;  2KAT A;  3ZN3 A;  4Y6C A;  5JJ7 A;  4GA1 A;  4I9E A;  3JYS A;  2XCC A;  3LY9 A;  3NF1 A;  3S7B A;  3PE4 A;  5G04 C;  4Y6W A;  3RO3 A;  3QKY A;  2BUG A;  4N2S A;  5FZR A;  3O48 A;  4G24 A;  5HI7 A;  4G2V A;  2FEZ A;  2OOE A;  4ABN A;  4GYW A;  4NQ0 A;  3K9I A;  1B89 A;  3VTY A;  4GA2 A;  3S7D A;  4I17 A;  3LYA A;  2VSY A;  5BNW A;  2UWJ G;  3MV2 B;  2KCV A;  3CKC A;  3CVL A;  1ELR A;  4JHR A;  4WUY A;  4NRH B;  3TGO A;  2C0M A;  3EDT B;  4U0Z A;  2P58 C;  1FCH A; 
#chains in the Genus database with same CATH topology
 3UKR G;  2QFC A;  3Q7A A;  4MLP A;  4URK A;  3ZYK A;  5ENR D;  2RKK A;  4I6J A;  2R05 A;  2OCC E;  2XCB A;  3CVU A;  2P9U G;  3R9A B;  2Y4T A;  1E96 B;  3HHM A;  2NSZ A;  4UQZ A;  3U9W A;  3CLJ A;  5LCW C;  1LD8 A;  1MX6 A;  3FU3 A;  4GPK A;  1SW6 A;  3CVN A;  3LJN A;  3SQV A;  1DVP A;  3P1U A;  5D0Q D;  5KBA A;  1U2V G;  4BY6 A;  3UM2 A;  3VLE A;  1OT8 A;  2AVP A;  4I2W A;  2E2E A;  2BF0 X;  4AJW A;  4KYO B;  2P9N G;  2WXP A;  4MKT A;  3FH7 A;  4BSZ B;  5BXO A;  3UPV A;  4KT6 B;  4A1S A;  2WB2 A;  3RIB A;  3VLD A;  2B0O E;  4I6E A;  4YND A;  3ABK E;  3B7R L;  4PDX A;  3DSX A;  3EHM A;  3JCK C;  2KCL A;  5EIB E;  4WNF A;  2J09 A;  2IQC A;  4JEU A;  2V5Q C;  3T5X A;  2JLB A;  3AG1 E;  2EIK E;  4N2Q A;  4BFR A;  2LSV A;  1L5J A;  3FUE A;  5KJN A;  4JW1 A;  4NAC A;  1E8Y A;  3PNT B;  5JMN D;  3TL5 A;  2P9I G;  3D9I A;  2J08 A;  1H19 A;  3SY2 A;  5T4Y A;  2C0L A;  3PZ2 A;  5DIZ A;  3LVQ E;  4GU5 A;  5ENQ D;  4F7A A;  3ZU7 B;  1Y8M A;  3KEA A;  2OVF A;  4MRU A;  3DRA A;  3Q5M A;  3PRZ A;  2WQ6 A;  4GTM A;  3I4R B;  3ZGQ A;  4HXI A;  2GRM A;  4HI9 A;  4LCT A;  3AAA C;  1JWG A;  4GZ3 A;  3PH0 C;  1XNF A;  4U8Y D;  4E6H A;  1MYO A;  4TUM A;  4YDE A;  3MA5 A;  4J6I A;  2AWI A;  2YHE A;  1ELK A;  4GZ6 A;  4DX2 A;  5JHB A;  3J5P A;  5G05 C;  4GB9 A;  1DNP A;  5AJL A;  5ARF A;  4CT4 A;  3DSS A;  5FIN A;  1Z6T A;  3B95 A;  4G11 A;  4U0S A;  3Q15 A;  1YYH A;  4GYY A;  3ZYL A;  5C1D A;  2LXM A;  4I43 A;  4J0U A;  2IF4 A;  2FO1 E;  4GTS A;  1HE8 A;  1OWN A;  3G2W A;  3FEY A;  2DZN A;  3SZ7 A;  1NL4 A;  2V8S E;  3UQ3 A;  3TXM A;  1QYM A;  4Q69 A;  1WG0 A;  4TXQ A;  1QQE A;  3HVE B;  2WXM A;  3ULY A;  5E75 A;  4MS6 A;  4N5C A;  2LAH A;  1K8K G;  1UW4 B;  4IN3 B;  3U64 A;  1TNY A;  3EIJ A;  3CGH A;  1SVX A;  1V55 E;  1N9A A;  1OCC E;  3TXN A;  3UM1 A;  2IO2 C;  2VQ2 A;  3UIP C;  3Q75 A;  4X8Q A;  3L22 A;  1DCE A;  3APD A;  2IFU A;  3ZXS A;  3BU8 A;  1PAQ A;  5KJM A;  3ULQ A;  3NZS A;  3QAQ A;  2XGO A;  3JUI A;  2V0P A;  4KZC A;  1U3C A;  3UT4 A;  3Q4A B;  4HOT A;  3P2B A;  3BEE A;  3PEV B;  5BV0 A;  3O4Z A;  5BPP A;  2J9Q A;  4UWG A;  4TXP A;  3OAW A;  4AVX A;  3E32 A;  4GZD A;  4HFG A;  4EQF A;  1ZB1 A;  4GTV A;  4N3C A;  4CDR A;  4K5C A;  3DEO A;  3SHF A;  5FTP A;  4XIF A;  4L2L A;  2HYZ A;  1Q2Z A;  1OWL A;  1LTX A;  5FZS A;  4RG9 A;  4CGV A;  4D10 C;  5FWQ A;  3V30 A;  4DK5 A;  3U3W A;  2J07 A;  2GRL A;  3X2Q E;  4GCN A;  1HH8 A;  4W9R A;  5A6C A;  2XPY A;  4HB5 A;  5D66 A;  1UN9 A;  3DSV A;  2BKK B;  4ACL A;  1WAO 1;  2Y69 E;  1KT1 A;  4TRQ A;  2X6F A;  3FP3 A;  3ZRH A;  4TXR A;  3EUV A;  1O1R A;  2M63 A;  3RU0 A;  2DBA A;  1E7U A;  3HXB A;  2CG3 A;  2QYJ A;  3ZIM A;  1X81 A;  2OV8 A;  2RG8 A;  2KXP C;  4XI9 A;  3GYZ A;  3DXM G;  1N4R A;  2RD0 A;  4FC8 A;  4DLO A;  3CK7 A;  2J4B A;  1NI1 A;  2WM9 A;  4F53 A;  5CMW A;  3FFL A;  5IY5 E;  3HXE A;  1IHG A;  2I6H A;  3PZ1 A;  3RRN B;  3HYM B;  4PS8 A;  4BES A;  1JPL A;  5CBN A;  4V3I A;  2WVI A;  2I1K A;  3PEU B;  4I9E A;  1OWP A;  4YDW A;  4JHJ A;  4ILI A;  4BET A;  3S7B A;  4ACK A;  4FHK A;  3PZ4 A;  3EHR A;  4B0Z A;  4GML A;  4G24 A;  3FUM A;  4U95 D;  4L23 A;  4UWK A;  3CVW A;  2FEZ A;  5ITZ F;  5T8I A;  2WXI A;  4FLH A;  4JVS A;  3LYA A;  1N4S A;  3FDH A;  1RZ4 A;  3OTN A;  2JAB A;  1IQU A;  1EYH A;  4WUY A;  4NRH B;  3TGO A;  4FU3 A;  2L0I A;  2H6I A;  2MOW A;  4U0Z A;  1FCH A;  2WPV A;  4JA9 A;  4KMO A;  3FUN A;  2GW1 A;  5FZQ A;  3ZUV B;  1JWF A;  3CEQ A;  4FLB A;  3G2S A;  3FH5 A;  3TWS A;  4ATZ D;  4N3B A;  3CVY A;  5CER B;  2WXJ A;  1D9S A;  4ZHB A;  3URZ A;  2NYJ A;  1H6P A;  2A5U A;  2YNQ A;  3PZD A;  2R02 A;  4APF A;  3UTM A;  4ANU A;  3ULE G;  2V5F A;  1AP7 A;  3PUK A;  1TNB A;  3DSW A;  5CMY A;  1OY3 D;  1KZO A;  3TG5 A;  2HO1 A;  3Q47 B;  5AQ7 A;  4PH4 B;  3IBE A;  3AU4 A;  3CQC B;  4G25 A;  3CVV A;  4G8L A;  3OXF A;  4UQY A;  4DX1 A;  3ZW3 A;  4AV7 A;  2FF4 A;  5C2Y A;  4J8D A;  5FQ8 A;  5CRV A;  4K5A B;  4J8Y A;  2R2L A;  2BTD A;  2AXU A;  4GTR A;  3AS5 A;  3ZVV A;  2KZT B;  3L17 A;  5D2M C;  1TJC A;  1JCS A;  2GRR B;  3R7R A;  4C0E A;  3PE3 A;  4JXT A;  1BI8 B;  2VGX B;  1OWM A;  3ZPJ A;  2AJA A;  4FJZ A;  2ILR A;  4BX9 A;  4F6R D;  5B1A E;  4ZFH A;  4N3A A;  4L2Y A;  2XGS A;  2RFA A;  3RAU A;  4EEC A;  4FA6 A;  2KCK A;  4GYO A;  3AS4 A;  5FQ4 A;  1N0Q A;  4I2Z A;  4NIK A;  4UUC A;  4I1O B;  2XS1 A;  4LNG A;  3QC1 A;  2VGE A;  4BTB A;  2CG2 A;  3PZ3 A;  1K1B A;  4BEP A;  4DX7 D;  3L54 A;  3AG3 E;  5G04 J;  5E76 A;  4B93 B;  3SNX A;  3I5P A;  2F8X K;  2XS8 A;  3QB2 A;  4UWF A;  2QYU A;  1HZ4 A;  4U7E B;  4HLE A;  4XX5 A;  1LD7 A;  3GW4 A;  1YMP A;  5CCM A;  1ELW A;  4L1B A;  1OWO A;  1QZ2 A;  4GMR A;  3MV3 B;  4B8C B;  4BSX A;  3D9H A;  3JQ1 A;  5HKP A;  4AY5 A;  4BT9 A;  3AG2 E;  1S70 B;  1HXI A;  2R03 A;  5EYP F;  4GTP A;  1OCO E;  3ASG A;  1Z3Y A;  3DST A;  4RG6 A;  2KC7 A;  1A5E A;  3RSE G;  2PM7 A;  3SGH A;  2DZO A;  4C0M A;  2DCP A;  1IYG A;  4KBQ A;  3CR3 A;  3E33 A;  3HG0 D;  3GZS A;  2XEN A;  2ETA A;  4PS7 A;  2PL2 A;  2P9K G;  4BX8 A;  5AJD A;  3QOU A;  4WWO A;  3FTY A;  3ASH A;  4O60 A;  3APC A;  3SBS A;  5CEA A;  1N94 A;  3FU0 A;  3IEG A;  4YVO A;  4DLQ A;  4RVB A;  2Y4U A;  4OVU A;  3ABL E;  4I9C A;  2HM8 A;  1LF8 A;  2OND A;  4K5B A;  3ML9 A;  2IO3 C;  2QY7 A;  1FVH A;  2VSX E;  5AIJ A;  3HVE A;  2PZI A;  1QBQ A;  2GGF A;  3TJP A;  2F0Y A;  2LNI A;  5M72 A;  2WMO A;  3RKV A;  1NA3 A;  3FH8 A;  3CVQ A;  4Q94 A;  4OAV B;  2IOL A;  5H7P A;  2ZGG A;  3ABM E;  2H6F A;  3QWW A;  1HX8 A;  1SA5 A;  2YIN A;  3JXJ A;  3MKR A;  3FEX A;  1UJK A;  3MGB A;  3D3M A;  1HF8 A;  4C9B B;  4EHM A;  3Q9U C;  3UIN C;  2XRZ A;  3KEZ A;  1SA4 A;  2X6H A;  1OCR E;  4LG6 A;  2R5S A;  4WND A;  3KAE A;  5AN8 A;  3FWV A;  3B7B A;  4A3T A;  4ANW A;  2WXO A;  1TN6 A;  3FTW A;  5AAR A;  5BXU A;  4AIF A;  5HRY A;  3GZ1 A;  2X6K A;  2AXZ A;  3LY7 A;  4CYM D;  3B7T A;  5HS0 A;  1NP7 A;  3FUJ A;  5JJT A;  4A1G A;  1IHB A;  3L82 A;  4G23 A;  3DPY A;  5ENT D;  3GZ2 A;  4XI0 A;  3E30 A;  3AU5 A;  3L13 A;  2WXG A;  1ZBP A;  3CIA A;  1K1A A;  3ZN3 A;  1AWC B;  4Y6C A;  2I9C A;  3ML8 A;  1H0A A;  5FIO A;  4GA1 A;  3TWR A;  4CEM A;  5EID A;  3TWW A;  4L7T A;  4I1M A;  3W9F A;  3AG4 E;  4JPS A;  1HS6 A;  4XKB A;  3IKO B;  4Y6W A;  4PS3 A;  3TWX A;  5KWD A;  2BUG A;  3CHS A;  5FZR A;  3JXI A;  5BUZ A;  2XEH A;  3LJ3 A;  3LVR E;  3QJZ A;  2B6C A;  4OYS A;  1Y6I A;  5HI7 A;  3F6Q A;  4GYW A;  4NQ0 A;  1B89 A;  2GRN B;  4GA2 A;  2H6G A;  2VSY A;  3MKQ B;  2UWJ G;  1PY1 A;  2XQ0 A;  3MV2 B;  1BI7 B;  3UKU G;  4M7C A;  3CVL A;  4ANX A;  3D9M A;  1FPP A;  2ZIS A;  2F37 A;  2VYI A;  2MYO A;  4UWH A;  1V54 E;  3ZYM A;  3MZL B;  3ESK A;  3PVL A;  4BT8 A;  3SI5 A;  1EF1 C;  2UY1 B;  1N95 A;  3LEW A;  3B7U X;  2Y1L E;  4HOS A;  1MZC A;  3FUH A;  1JCQ A;  4I6G A;  4DI4 A;  4HLL A;  3KD7 A;  2J8S D;  5KNG A;  3T9K A;  3CK8 A;  4B8A A;  2P2C P;  5EX0 A;  5LOZ A;  4EPZ A;  3SFX A;  3Q9N C;  4O1O A;  3CHQ A;  1HG2 A;  4JZY A;  1P5Q A;  3D9L A;  2Y3A A;  1HFA A;  4WWP A;  3UX4 A;  3NQP A;  2VTB B;  2WXL A;  5FJY A;  3NB2 A;  4XEI G;  1S63 A;  2PQR A;  2EIN E;  4WAF A;  2L0T B;  3E37 A;  3EU9 A;  2LXL A;  3QNK A;  3SBT B;  3B7S A;  4EBA G;  1E8X A;  2X38 A;  4CCA A;  4NUR A;  4HRM B;  3ENE A;  5J90 A;  4HNA D;  2IJG X;  3ISM C;  2ZXW E;  3DEP A;  3SFZ A;  4Z68 A;  1S0P A;  2I2O A;  4LER A;  2FBN A;  1IXV A;  1Z5S C;  3FU5 A;  4XE0 A;  1MX2 A;  3LY8 A;  5AQA A;  4JB8 P;  3ASO E;  1NA0 A;  5FT9 A;  2FI7 A;  4UQX A;  2WXF A;  4C48 B;  3HXC A;  2Q7F A;  1KT0 A;  4P29 A;  3B13 A;  4GZ5 A;  4WNE A;  3FTV A;  3IHY A;  3WXX A;  2KZT A;  2XRY A;  2QZA A;  4ILH B;  1BPO A;  3DSU A;  5BW8 C;  2VGX A;  4YDY A;  2BED A;  3QWP A;  4TUU A;  3NAW A;  2VJ8 A;  4IUL A;  4Q96 A;  2L9B A;  2XPI A;  4HI8 A;  2OEW A;  2ETC A;  2ION A;  2R17 C;  3QAR A;  1WDY A;  2NXP A;  5AEN A;  2A5E A;  4JEH A;  3HDX A;  5ENP D;  4AOF A;  1DCQ A;  4FUL A;  1N0R A;  2WXK A;  3C3Q A;  2FUL A;  3SF4 A;  3QK0 A;  2AXV A;  1W3B A;  4GZC A;  4DPR A;  3CK9 A;  1UN8 A;  3ONK A;  3UM0 A;  3D9K A;  3ESL A;  2E0I A;  1WY6 A;  2IY0 C;  4A63 B;  5LCW J;  4U0U A;  4BTA A;  2XHE A;  3L6A A;  3E4B A;  1TNU A;  2WMN A;  3G2V A;  4GAA A;  4L9P A;  5CRU A;  5AYW D;  2EIJ E;  1BD8 A;  3CHO A;  4AY6 A;  1UG3 A;  2EQX A;  4I1A A;  2VSO E;  3G2U A;  3FUI A;  3KSQ A;  4HQD A;  4AP2 A;  2MRI A;  1ZU2 A;  5ANR A;  5EX3 A;  3AS8 A;  3FTX A;  1H6K A;  3EJN A;  4J8S A;  4AEZ C;  4GMJ A;  3W9G A;  1Z3X A;  2ETB A;  3DPD A;  3T5V A;  1KZP A;  2R59 A;  3CST A;  3PS6 A;  3LKU A;  2OEV A;  2L6J A;  1O1T A;  4HS2 A;  4HRL A;  4YVQ C;  3SFY A;  3CQG B;  2WXQ A;  1YCS B;  2EIM E;  4G1T A;  3L16 A;  3VTX A;  4U63 A;  3OXG A;  3S7J A;  4GCO A;  1GW6 A;  5G55 A;  4IRU A;  4GA0 A;  5ENN A;  5HQ8 A;  5B1B E;  4QFV A;  4U07 A;  4F3V A;  1U3D A;  4B89 A;  3FY4 A;  2KBX A;  1N4P A;  3TWT A;  1TYQ G;  1OXJ A;  1TJF A;  5KCM A;  2YQ8 A;  4PUC A;  3MJW A;  2MHK A;  2XEV A;  2H6H A;  5G05 J;  4HVB A;  3ZYQ A;  5CHE E;  3UT7 A;  4FJY A;  3ZFW A;  1IKN D;  1MQS A;  2GRP B;  2DYS E;  1FT1 A;  3ZEF A;  4O6F A;  4ANV A;  1D8D A;  3FTZ A;  2XEE A;  2CHW A;  3CHR A;  4U8H A;  4HOU A;  2KM4 A;  4G26 A;  1PC2 A;  1N4Q A;  1FT2 A;  1NZN A;  4OVV A;  4K03 A;  4AM9 A;  1WM5 A;  4EZL A;  4ATG A;  5JJ7 A;  4F1P A;  3JYS A;  2XCC A;  4KZ0 A;  3LY9 A;  3V2O A;  3MX3 A;  4BER A;  5G04 C;  3S2A A;  4RSY A;  4CT0 A;  3Q79 A;  3RO3 A;  3NOC D;  3D9O A;  4N2S A;  4CDN A;  3O48 A;  4KVM A;  3T8M A;  2CHZ A;  4G2V A;  5LFA A;  3UT8 A;  2OOE A;  3FTS A;  3IV0 A;  1TN8 A;  3C5R A;  3UMV A;  3K9I A;  5A23 A;  2CFU A;  4I17 A;  2X6J A;  5BNW A;  4EBA A;  3APF A;  4RQI A;  3I4G A;  2P9P G;  4XKC A;  2KCV A;  4JHR A;  1ELR A;  1BLX B;  2RFM A;  3HXF A;  3TWQ A;  4A3V A;  1D8E A;  3EDT B;  1A17 A;  1H2U A;  3HIZ A;  3PRE A;  1H2V C;  2DYR E;  4KXK B;  3PDN A;  2A4Z A;  3UIO C;  3RRU A;  4HBD A;  2WXN A;  3CSF A;  4TV3 A;  3EHQ A;  3C98 A;  1HO8 A;  1O5M A;  4JHK A;  3MYV A;  5T3R A;  5EDS A;  4E85 A;  2WQH A;  4HRN A;  4JA7 A;  3CKB A;  3MKQ A;  3FUK A;  5J08 A;  1TEZ A;  4EZJ A;  4LNU D;  5ENO D;  4HOQ A;  4LNB A;  5B3S E;  5JJ6 A;  2GRQ B;  1SQM A;  3EU5 A;  2AW6 A;  2XGM A;  3FUL A;  3I3N A;  3FTU A;  5KNH D;  1TR4 A;  2HE0 A;  3TWU A;  4O1P A;  3G2T A;  4LSZ E;  1TNO A;  2UY1 A;  4UI9 J;  4XZ4 A;  3WG7 E;  3TG4 A;  3EIQ C;  4FP7 A;  1YA0 A;  2PNN A;  3QDN A;  3CHP A;  4N5Q A;  5LX8 A;  1N52 A;  4H7Y A;  4H7X A;  4ME2 A;  3CV0 A;  2XZD G;  1SZA A;  4UWL A;  1EPU A;  5BV1 A;  2L6B A;  2LAI A;  4QQI A;  2IOS A;  5JA4 D;  3FUD A;  3ASD A;  3T8K A;  1X5B A;  3ASN E;  4J8F A;  1TNZ A;  1H6O A;  3Q7F A;  3PUJ A;  2VTB A;  2P9L G;  2XPZ A;  2ZU6 B;  1G3N B;  3LDZ A;  3FU6 A;  3DWL G;  4U8V D;  5CCL A;  1MJ0 A;  1K3Z D;  3N71 A;  4CZ2 D;  3ZHE A;  4M3O A;  3IHV A;  3UM3 A;  3VLF A;  3BQO A;  1O1S A;  2EIL E;  2I1J A;  3KS2 A;  4IYP A;  2CHX A;  3OXL A;  5BT1 A;  5EN5 D;  3MCX A;  3NZU A;  3ZXP A;  4B94 A;  3TWV A;  2VSN A;  4DJA A;  5EYL A;  3UI2 A;  4UI9 K;  2X3M A;  3R7Q A;  3ZKJ A;  4G8K A;  3LS8 A;  3L9T A;  4J8E A;  4DUI A;  2FO7 A;  2NC9 A;  5EIL A;  3LPZ A;  4LEU A;  4RLY A;  2F8Y A;  3LXU X;  2V4H C;  3CVP A;  1E8Z A;  4UI9 C;  3U4T A;  1XGW A;  1E90 A;  1SZ9 A;  1N11 A;  3V2X A;  4DX5 D;  3BG0 B;  3ZHE B;  2DVW A;  1INZ A;  3C3O A;  2DWZ A;  3D9P A;  4DI3 A;  1UOH A;  3TAX A;  4K0R A;  1E7V A;  2Y0B G;  4F1S A;  4LUN U;  4WWN A;  4APO A;  1NFI E;  3ONL A;  4JL0 A;  4GTO A;  5CEC B;  1UJJ A;  5CBO A;  3LCA A;  4EZK A;  5KJK A;  3C72 A;  1HU3 A;  5A7D B;  3U66 A;  1KPS B;  1IQR A;  4CDM A;  3SD5 A;  5DBK A;  2GRO B;  2QC9 A;  3C3R A;  2LUH A;  4CRW A;  3DBS A;  4CGW A;  3E34 A;  4N39 A;  3V79 K;  4A55 A;  3R9M A;  4GTQ A;  2LSU A;  2WQ7 A;  2LO6 A;  5EKQ D;  2HR2 A;  2V4L A;  3HXD A;  1EDU A;  5AAO A;  2YHC A;  3RJV A;  4DRX E;  3JUE A;  3SO8 A;  4LRZ A;  3BUA A;  1TN7 A;  3FUF A;  3KSL A;  1H2T C;  2XZT G;  5D0O D;  2PQN A;  1HG5 A;  2WXH A;  2J49 A;  3L08 A;  1KLX A;  3UUX A;  3Q49 B;  3RRM B;  4BWR A;  4JD2 G;  1S64 A;  5KJL A;  2BKG A;  5LP0 A;  3UXG A;  5G2N A;  4FHJ A;  2VGY A;  5JHA A;  1N54 A;  1OUV A;  3MEK A;  3JQ0 A;  2DIW A;  4WNG A;  2PM6 A;  5ARG A;  3D9J A;  4YDO A;  3ZNG A;  1FVF A;  1MHQ A;  4HOR A;  4DX6 D;  2OVB A;  4U04 A;  3ASF A;  3QWV A;  3DXK G;  3S7F A;  4R7L A;  3RO2 A;  3FHE A;  4MBG A;  2C2L A;  3HRA A;  3AJI A;  4KVO A;  1E8W A;  3EHN A;  2WXR A;  5CED B;  1OCZ E;  1RW2 A;  4GPM A;  3NBN B;  3CVX A;  1DC2 A;  2KAT A;  5AQ9 A;  3Q78 A;  2ZIR A;  2IU1 A;  3V31 A;  1JUQ A;  3Q73 A;  4OAU C;  3NF1 A;  3BG1 B;  2X6I A;  1BU9 A;  4AXH A;  3PE4 A;  3D9N A;  3RK6 A;  3QKY A;  3PNL B;  5FQ7 A;  2J4D A;  3IXE A;  2CFZ A;  5ENS D;  5AQB A;  4ABN A;  4GTT A;  1VDY A;  3VTY A;  4J7W A;  1MX4 A;  3S7D A;  5FQ6 A;  2JEK A;  1JCR A;  3CHM A;  4ILG A;  4U96 D;  4FAD A;  5ANL A;  2ZGD A;  3CKC A;  2IEJ A;  4JC8 A;  3NOG D;  1QNF A;  3J5Q B;  2C0M A;  2P9S G;  2P58 C; 
#chains in the Genus database with same CATH homology
 2WPV A;  2VYI A;  4JA9 A;  4KMO A;  2QFC A;  3FUN A;  2GW1 A;  1A17 A;  4UWH A;  5FZQ A;  1JWF A;  4MLP A;  1H2U A;  3HIZ A;  3ZYM A;  3CEQ A;  3MZL B;  4FLB A;  3G2S A;  3PRE A;  3ZYK A;  4URK A;  3ESK A;  3FH5 A;  3PVL A;  1H2V C;  4BT8 A;  4N3B A;  3CVY A;  3SI5 A;  4KXK B;  1EF1 C;  2WXJ A;  4I6J A;  3PDN A;  2UY1 B;  3LEW A;  3URZ A;  2XCB A;  3CVU A;  3B7U X;  2A4Z A;  4HOS A;  3FUH A;  3RRU A;  4I6G A;  2WXN A;  2Y4T A;  1E96 B;  3CSF A;  2NSZ A;  3HHM A;  4UQZ A;  4TV3 A;  3R9A B;  3U9W A;  2A5U A;  2YNQ A;  3PZD A;  3CLJ A;  4DI4 A;  5LCW C;  4APF A;  4ANU A;  3KD7 A;  3FU3 A;  4GPK A;  2V5F A;  3CVN A;  3PUK A;  3C98 A;  1HO8 A;  5CMY A;  1DVP A;  4JHK A;  3P1U A;  3MYV A;  5T3R A;  3TG5 A;  2HO1 A;  5EDS A;  3CK8 A;  3Q47 B;  5D0Q D;  4B8A A;  4E85 A;  2WQH A;  4BY6 A;  4PH4 B;  5EX0 A;  3IBE A;  3AU4 A;  4JA7 A;  5LOZ A;  4EPZ A;  3CKB A;  3CQC B;  3VLE A;  2AVP A;  3CHQ A;  3MKQ A;  4G25 A;  3FUK A;  5J08 A;  4I2W A;  2E2E A;  1TEZ A;  1HG2 A;  3CVV A;  4JZY A;  3OXF A;  2BF0 X;  4UQY A;  4AJW A;  1P5Q A;  3D9L A;  2Y3A A;  4KYO B;  3ZW3 A;  4EZJ A;  4AV7 A;  1HFA A;  2FF4 A;  5C2Y A;  4WWP A;  2WXP A;  4MKT A;  4J8D A;  3UX4 A;  3FH7 A;  5FQ8 A;  4HOQ A;  3NQP A;  3UPV A;  4KT6 B;  2VTB B;  4A1S A;  2WXL A;  5FJY A;  3RIB A;  2WB2 A;  3VLD A;  4I6E A;  4YND A;  5JJ6 A;  1SQM A;  2PQR A;  2BTD A;  3B7R L;  3EHM A;  2AW6 A;  2XGM A;  2AXU A;  3FUL A;  2KCL A;  3I3N A;  3JCK C;  4WNF A;  3FTU A;  2L0T B;  2J09 A;  4WAF A;  3AS5 A;  2IQC A;  3QNK A;  4JEU A;  3SBT B;  4PDX A;  3ZVV A;  2KZT B;  3L17 A;  1TJC A;  3T5X A;  3B7S A;  4EBA G;  2JLB A;  3G2T A;  3R7R A;  1E8X A;  4C0E A;  4N2Q A;  4BFR A;  2LSV A;  2UY1 A;  2X38 A;  3PE3 A;  4UI9 J;  4XZ4 A;  1L5J A;  3FUE A;  5KJN A;  4JW1 A;  3TG4 A;  4CCA A;  4NUR A;  4JXT A;  2VGX B;  1OWM A;  4NAC A;  3ZPJ A;  3EIQ C;  1E8Y A;  3PNT B;  3ENE A;  4FP7 A;  5J90 A;  1YA0 A;  3QDN A;  4FJZ A;  3TL5 A;  3CHP A;  3D9I A;  2ILR A;  1H19 A;  2J08 A;  4BX9 A;  2IJG X;  5T4Y A;  2C0L A;  5DIZ A;  5LX8 A;  4N3A A;  3LVQ E;  4L2Y A;  1N52 A;  2XGS A;  4GU5 A;  4H7Y A;  3SFZ A;  4H7X A;  4F7A A;  4ME2 A;  3CV0 A;  1Y8M A;  1SZA A;  4UWL A;  1S0P A;  4EEC A;  2OVF A;  4FA6 A;  4MRU A;  1EPU A;  3Q5M A;  3PRZ A;  5BV1 A;  2KCK A;  2WQ6 A;  4GYO A;  3AS4 A;  2I2O A;  5FQ4 A;  4I2Z A;  4I1O B;  4LER A;  3I4R B;  2FBN A;  2LAI A;  3ZGQ A;  4HXI A;  2GRM A;  2IOS A;  3FUD A;  3ASD A;  1X5B A;  3FU5 A;  3QC1 A;  4LCT A;  3LY8 A;  4XE0 A;  1JWG A;  4J8F A;  4BTB A;  2CG2 A;  4GZ3 A;  3L54 A;  3PH0 C;  1NA0 A;  1XNF A;  2FI7 A;  5FT9 A;  3PUJ A;  4E6H A;  5G04 J;  5E76 A;  2VTB A;  4UQX A;  2XPZ A;  2WXF A;  2ZU6 B;  2Q7F A;  3MA5 A;  4J6I A;  2AWI A;  2YHE A;  3LDZ A;  1KT0 A;  3SNX A;  3I5P A;  4P29 A;  1ELK A;  4GZ6 A;  3FU6 A;  5CCL A;  3B13 A;  4GZ5 A;  4WNE A;  3QB2 A;  4UWF A;  1HZ4 A;  3N71 A;  3FTV A;  3IHY A;  3WXX A;  2KZT A;  2XRY A;  5JHB A;  5G05 C;  3ZHE A;  4HLE A;  4M3O A;  4GB9 A;  3IHV A;  4XX5 A;  3VLF A;  1DNP A;  3GW4 A;  5AJL A;  5ARF A;  1ELW A;  4L1B A;  4CT4 A;  5CCM A;  2I1J A;  3KS2 A;  4ILH B;  1BPO A;  1OWO A;  1QZ2 A;  4IYP A;  5BW8 C;  1Z6T A;  2VGX A;  4G11 A;  3MV3 B;  4U0S A;  3QWP A;  4B8C B;  3Q15 A;  4TUU A;  2CHX A;  2VJ8 A;  4IUL A;  4BSX A;  4GYY A;  4Q96 A;  3OXL A;  2L9B A;  3ZYL A;  5C1D A;  2XPI A;  4I43 A;  5BT1 A;  3JQ1 A;  4AY5 A;  3MCX A;  3NZU A;  4J0U A;  4BT9 A;  4B94 A;  2IF4 A;  2ION A;  2R17 C;  1HXI A;  3QAR A;  1HE8 A;  2NXP A;  2VSN A;  1OWN A;  3G2W A;  4DJA A;  3ASG A;  1Z3Y A;  5AEN A;  4JEH A;  3HDX A;  4UI9 K;  2X3M A;  3R7Q A;  4RG6 A;  4AOF A;  2KC7 A;  3FEY A;  3SZ7 A;  2V8S E;  4FUL A;  3UQ3 A;  2PM7 A;  3SGH A;  3TXM A;  2WXK A;  4Q69 A;  2FUL A;  3LS8 A;  4C0M A;  3SF4 A;  1QQE A;  2DCP A;  3QK0 A;  4J8E A;  2AXV A;  1W3B A;  3HVE B;  4GZC A;  2FO7 A;  2WXM A;  4DPR A;  2NC9 A;  5E75 A;  1IYG A;  4MS6 A;  3LPZ A;  4KBQ A;  3CR3 A;  4LEU A;  3GZS A;  3CK9 A;  1UN8 A;  4N5C A;  3ONK A;  2LAH A;  1UW4 B;  3LXU X;  3D9K A;  2PL2 A;  3ESL A;  4IN3 B;  4PS7 A;  3U64 A;  3CVP A;  1E8Z A;  4UI9 C;  3U4T A;  1XGW A;  4BX8 A;  2E0I A;  5AJD A;  1WY6 A;  1E90 A;  3EIJ A;  3CGH A;  3QOU A;  1SZ9 A;  4WWO A;  5LCW J;  4F3V A;  3TXN A;  3BG0 B;  4U0U A;  4BTA A;  3FTY A;  2XHE A;  3ASH A;  3E4B A;  3L6A A;  2VQ2 A;  3APC A;  2WMN A;  3G2V A;  3ZHE B;  1INZ A;  4GAA A;  3L22 A;  3SBS A;  5AYW D;  3APD A;  2IFU A;  3CHO A;  3ZXS A;  4AY6 A;  1UG3 A;  2EQX A;  3D9P A;  1PAQ A;  3FU0 A;  3IEG A;  4I1A A;  4DI3 A;  5KJM A;  2VSO E;  3G2U A;  3ULQ A;  3FUI A;  4YVO A;  3TAX A;  4DLQ A;  3NZS A;  3QAQ A;  4RVB A;  4AP2 A;  4K0R A;  1E7V A;  2MRI A;  2Y4U A;  4OVU A;  2XGO A;  1ZU2 A;  3JUI A;  4I9C A;  5ANR A;  5EX3 A;  2HM8 A;  2V0P A;  4F1S A;  4LUN U;  4KZC A;  1U3C A;  3AS8 A;  4WWN A;  3UT4 A;  4APO A;  3ONL A;  3Q4A B;  4HOT A;  3P2B A;  4JL0 A;  3BEE A;  1UJJ A;  1LF8 A;  3PEV B;  3FTX A;  5BV0 A;  3LCA A;  4EZK A;  5KJK A;  1H6K A;  2OND A;  3EJN A;  1HU3 A;  4J8S A;  3O4Z A;  4AEZ C;  5A7D B;  2J9Q A;  4GMJ A;  4UWG A;  5BPP A;  1Z3X A;  3ML9 A;  2QY7 A;  3U66 A;  3DPD A;  3T5V A;  1FVH A;  2R59 A;  2VSX E;  3CST A;  1IQR A;  5AIJ A;  4CDM A;  3HVE A;  2PZI A;  3OAW A;  3SD5 A;  3PS6 A;  5DBK A;  3LKU A;  2L6J A;  4AVX A;  2GGF A;  4GZD A;  4HFG A;  3TJP A;  4EQF A;  4CRW A;  3DBS A;  4HS2 A;  2LNI A;  4N3C A;  4CDR A;  4CGW A;  5M72 A;  4N39 A;  4YVQ C;  4A55 A;  2WMO A;  3RKV A;  2LSU A;  1NA3 A;  2WXQ A;  3CQG B;  3FH8 A;  2WQ7 A;  3SHF A;  2LO6 A;  5FTP A;  5EKQ D;  2HR2 A;  2V4L A;  3CVQ A;  4Q94 A;  4XIF A;  1EDU A;  4G1T A;  2YHC A;  2IOL A;  4L2L A;  3L16 A;  3VTX A;  2HYZ A;  4U63 A;  3RJV A;  3OXG A;  1OWL A;  4LRZ A;  3S7J A;  4GCO A;  1GW6 A;  3QWW A;  5G55 A;  4IRU A;  3FUF A;  5FZS A;  4GA0 A;  4RG9 A;  1H2T C;  4CGV A;  1HX8 A;  5ENN A;  2YIN A;  3MKR A;  5HQ8 A;  4D10 C;  5FWQ A;  4DK5 A;  5D0O D;  3U3W A;  2J07 A;  2PQN A;  3FEX A;  4QFV A;  2GRL A;  1UJK A;  4U07 A;  1HG5 A;  2WXH A;  3MGB A;  3D3M A;  1HH8 A;  1HF8 A;  4GCN A;  2J49 A;  1U3D A;  3L08 A;  2XPY A;  1KLX A;  4W9R A;  4B89 A;  1UN9 A;  4C9B B;  5A6C A;  2XRZ A;  3UUX A;  3KEZ A;  3Q49 B;  4ACL A;  1WAO 1;  3FY4 A;  3RRM B;  4BWR A;  2X6H A;  5KJL A;  1TJF A;  2R5S A;  4WND A;  1KT1 A;  3KAE A;  4TRQ A;  2X6F A;  3FP3 A;  3ZRH A;  5KCM A;  5LP0 A;  2YQ8 A;  5G2N A;  4FHJ A;  3FWV A;  2M63 A;  3RU0 A;  2VGY A;  4PUC A;  5JHA A;  3MJW A;  1N54 A;  2MHK A;  1OUV A;  3MEK A;  2XEV A;  4A3T A;  4ANW A;  3JQ0 A;  2WXO A;  2DIW A;  2DBA A;  1E7U A;  2CG3 A;  3FTW A;  5G05 J;  4HVB A;  3ZYQ A;  4WNG A;  2PM6 A;  5CHE E;  5ARG A;  3ZIM A;  3UT7 A;  3D9J A;  4FJY A;  3ZFW A;  1FVF A;  1MQS A;  2OV8 A;  2RG8 A;  1MHQ A;  4HOR A;  2OVB A;  3GYZ A;  4XI9 A;  4U04 A;  3ZEF A;  4AIF A;  3ASF A;  4O6F A;  3QWV A;  4ANV A;  3GZ1 A;  2X6K A;  2AXZ A;  3LY7 A;  3S7F A;  4R7L A;  2RD0 A;  4FC8 A;  3RO2 A;  4DLO A;  3B7T A;  3FHE A;  3FTZ A;  1NP7 A;  3FUJ A;  3CK7 A;  2J4B A;  2C2L A;  2CHW A;  3CHR A;  2WM9 A;  4A1G A;  5JJT A;  4F53 A;  4U8H A;  4HOU A;  4G23 A;  5CMW A;  3FFL A;  4KVO A;  1E8W A;  2KM4 A;  4G26 A;  3EHN A;  2WXR A;  3GZ2 A;  1PC2 A;  4XI0 A;  1IHG A;  2I6H A;  3CVX A;  3AU5 A;  3L13 A;  1NZN A;  3RRN B;  4OVV A;  2WXG A;  4K03 A;  1ZBP A;  4AM9 A;  3HYM B;  4PS8 A;  1WM5 A;  2KAT A;  3CIA A;  1JPL A;  4EZL A;  3ZN3 A;  4ATG A;  2IU1 A;  4Y6C A;  2I9C A;  3ML8 A;  1H0A A;  4V3I A;  5JJ7 A;  2WVI A;  4GA1 A;  2I1K A;  3PEU B;  4I9E A;  1OWP A;  3JYS A;  4CEM A;  1JUQ A;  4JHJ A;  4ILI A;  2XCC A;  4KZ0 A;  3LY9 A;  3NF1 A;  4L7T A;  3BG1 B;  4I1M A;  2X6I A;  3MX3 A;  4JPS A;  1HS6 A;  3S7B A;  4XKB A;  4ACK A;  4AXH A;  3PE4 A;  3IKO B;  5G04 C;  3S2A A;  3D9N A;  4RSY A;  4FHK A;  4Y6W A;  4CT0 A;  3RO3 A;  4PS3 A;  3RK6 A;  3D9O A;  3QKY A;  2BUG A;  3CHS A;  5FZR A;  4N2S A;  3PNL B;  5FQ7 A;  5BUZ A;  2J4D A;  4CDN A;  4B0Z A;  3O48 A;  4KVM A;  4GML A;  3T8M A;  2CFZ A;  4G24 A;  3LJ3 A;  3LVR E;  3FUM A;  3QJZ A;  4OYS A;  1Y6I A;  5HI7 A;  2CHZ A;  4L23 A;  4UWK A;  4G2V A;  3CVW A;  5LFA A;  2FEZ A;  5T8I A;  3UT8 A;  2OOE A;  2WXI A;  3FTS A;  3IV0 A;  4ABN A;  4GYW A;  4FLH A;  3UMV A;  4NQ0 A;  3K9I A;  1B89 A;  1VDY A;  5A23 A;  3VTY A;  4JVS A;  4GA2 A;  2CFU A;  3S7D A;  5FQ6 A;  2JEK A;  4I17 A;  3LYA A;  2VSY A;  2X6J A;  3MKQ B;  5BNW A;  2UWJ G;  4EBA A;  1PY1 A;  3CHM A;  4ILG A;  3APF A;  3FDH A;  2XQ0 A;  3I4G A;  3MV2 B;  3OTN A;  4FAD A;  5ANL A;  4XKC A;  1IQU A;  2KCV A;  3CKC A;  3CVL A;  1ELR A;  1EYH A;  4JHR A;  4JC8 A;  4ANX A;  1QNF A;  4WUY A;  4NRH B;  3TGO A;  4FU3 A;  2C0M A;  2L0I A;  4A3V A;  3D9M A;  3EDT B;  2MOW A;  4U0Z A;  2P58 C;  1FCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...